2FNAA

Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
357
structure length
352
Chain Sequence
GMLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIMSGSEMGLLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSKCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel archaeal AAA+ ATPase SSO1545 from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Atp-binding protein
molecule keywords Conserved hypothetical protein
total genus 128
structure length 352
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01637 ATPase_2 ATPase domain predominantly from Archaea
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2fnaA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fnaA01
4US2R 1T6NA 1T8TA 1LDKB 4Q4ZF 1HBXG 2QNRA 4IOLA 1GL6A 1XCBA 3QXHA 4BLQA 1ZNYA 2QVOA 3K0FB 4EJOA 3QSYA 4LY6A 1NVUQ 5B64A 1Z6AA 4KICA 1ZU4A 2P6TA 3RRZA 2ZSEA 5J4HA 2IA1A 3GWZA 2P6RA 1HTWA 2PT5A 2EFGA 2BHRA 2I4IA 3DPUA 4KYIB 1ZIPA 3T1VA 4JLDA 4XRFA 3K8YA 4E22A 1KI7A 3FMFA 3TO7A 5FR1A 2IP2A 2QTVB 2GAUA 4B47A 5JEEA 1FP1D 1R00A 3ZMDA 3CRQA 3EPLA 1TF7A 1ZJ6A 1X8JA 3AF1A 1IAQA 2FG5A 2OQRA 2ZYUX 4EQ6B 4U88A 2DK8A 1TNSA 3P7NA 3BPVA 4XLNF 1BC8C 2QQEA 3NKVA 1L8QA 2OE2A 4BPBA 3I72A 4IF4A 2O8BB 4KO8A 2WWYA 1RRGA 4QBHA 2E7XA 3GEZA 2VHQA 5DUKA 2A5FA 2ZJ5A 2AK2A 2C95A 1GUAA 3H3UA 3LAWA 4HLDA 1S7AA 4RB1A 4Q1DA 1E69A 1W49A 2OUKA 2ESHA 1T0HB 4UQOA 3I5YA 4P9UA 1ODDA 1DP7P 1GZSA 2C98A 3GD7A 4EQ6A 5F2EA 4F92B 4TZ0A 4CEHB 4YIFA 2CVHA 4ASUD 5AJVB 1BM9A 3ND8A 2QAGA 4YFXF 1TAGA 4GZMA 1UDWA 1VCOA 4L9WA 4F4IA 1DO2A 4P31A 2GA2A 4A6DA 2XOKD 4IEEA 1ZVQA 2D62A 2BBYA 1IRFA 4MA4A 1E9RA 3W5JA 2BCJQ 4KXFB 4PAOA 1P9RA 3OIYA 4Q66C 1UFQA 3WNBA 5F3WB 1SAXA 5DD4A 4LPKA 2VHUA 4GITA 1L3LA 1KU3A 1J9IA 1NSTA 2A7QA 2PCLA 4JKIA 2HZTA 3WYAA 2GXQA 3I62A 1IY0A 4POAA 3F23A 1KYIA 4IDOA 2M87A 4KMUX 3ZMVA 4OK6A 2G1JA 3M1EA 5FI1B 4N0EA 1G7RA 1U8ZA 3CONA 2XAFA 1TMKA 1RZ4A 4ZZLA 3CLVA 5CLQA 5G3YA 3EIQA 2RC4A 4HV6A 2A9KA 4RD0A 1OXSC 5ANRB 5CB8A 2ZETA 4A0RA 3K1PA 4ZDIA 5J4YA 1KAOA 5L3VA 4F4CA 2ODBA 2IXGA 3G73A 4ESJA 5L3CA 5TRDA 2GJ8A 2OFWA 3CX7A 4HZUA 5TY0A 3UATA 4B2PA 2JAQA 1P5ZB 5A4JA 4KN4X 4DIDA 4D25A 1MJBA 5FLXK 5K5QA 3EA5A 4KLZA 3HHHA 3W3AA 1Z6TA 1TPZA 3JSOA 4OKSA 1RRCA 4RD1A 2XJ4A 3CF2A 2D2EA 2XHKA 3B60A 4KN7X 1QHSA 4YG2F 1EG7A 4JLVA 1KZGB 4NZYA 2O8FA 4HAVA 3U5ZB 3ZS8A 5H6QA 3MEXA 1K79A 1F60A 3SQNA 3T5XA 1TF5A 3IUYA 4TL6A 3KKPA 2GVZC 3QY0A 1YLFA 4M6YA 3U7GA 1YZKA 2KIMA 3CWZA 2MH2A 4A15A 5BQ5A 3ZJYA 3TDZC 1YU9A 2QGZA 1QNTA 2VPPA 4KIBA 4HDQB 1YRAA 5BN3A 3LA3A 4G8XA 1UHMA 1KK3A 1NF3A 3TO6A 4R79A 1WE2A 4C3ZA 3RJPA 1NVWQ 4DUGD 3UWKA 1JXSA 1J2XA 3TQFA 1UBFA 4W5JA 1YW7A 1OFTA 2GWRA 1T4GA 2QPTA 2JIZD 3GFJA 2PI0A 2KI5A 2PZGA 4LHXA 4NYMR 5AJZA 4OIRF 1LFDB 4MYHA 5M04A 3L2CA 1XFAA 4L9NA 4LYJA 2KRKA 4Y0VA 4UXJA 1OB2A 1XSDA 2C03A 2CCKA 4AG6A 4WWCA 1FX7A 4A0HA 2LDUA 3LW8A 5HLHA 4OIOF 3RKWA 4RB0A 1IAWA 3AVWA 2R6DA 2WMOB 5G53C 3E70C 3O2PE 1P9WA 3FDIA 3B78A 4ACAA 4KIGA 5JSZB 5LHIA 2EV5A 3KCCA 2J87A 3PG5A 4LRWA 3F6VA 4ZYGA 3L0IB 2VP5A 2HDNB 4KVAA 4JYBA 4PQRA 4ESVA 4C2UA 3G0HA 4LJ5A 4Q1AA 1HSJA 1P72A 1W5SA 4QXAA 3QKSA 1XCPA 1LS1A 2EFEB 4LSGA 4TYQA 4LK2A 4Q9LA 4C30A 3RSLA 1V3FA 3GVAA 2RHDA 2KWIA 2WWXA 3VMFA 4B32A 4EFMA 2YKGA 2HKOA 1CXZA 3GLIE 5EP2A 2DWQA 3LVQE 4G5GA 1WB9A 5FTJA 2ZS7A 1R1TA 2QPAA 3CWQA 5H1YA 1XPRA 4BFWA 4LHVA 2QLZA 4DQ2A 1AKYA 5DIFA 3RRYA 4HF1A 2JLXA 2NIPA 2WSMA 1GAJA 2PEXA 3R0JA 4M9SA 3QOFA 1XN7A 4HQMA 3CRW1 4DZZA 2L54A 4F7ZA 5CDFA 2PEYA 4IRHA 2YJTD 3SYLA 1ZD9A 2ZI5A 1KMQA 5D5UB 3GMTA 4G94A 5HCNA 4QBIA 4LBWA 3X1YA 3NEYA 2QYOA 2OU2A 1KZ7B 1Z0KA 2HR3A 2HFHA 1F4KA 1E1RD 4FX4A 4A0YA 1KK2A 3MSXA 1ZUIA 1XZPA 2ZRCA 3QJYA 4PZZA 3TDUC 1DAKA 4PAQA 1W46A 1ZUHA 3FE2A 5CVRA 3LSTA 4LHWA 5E1ZB 2JLUA 1HQCA 3L7WA 2KSQA 2H94A 2P3SA 3HR8A 1XXHA 3QENA 5KOYA 3MAAC 3AP3A 4D0GA 2R6GA 3EWAA 1G7TA 5JCPA 4CGZA 1AGPA 3ZIAD 1DARA 1D2MA 1KKLA 5TJJA 5BMZA 2CYYA 1KU7A 1F5TA 1X8LA 3K0CC 1D5VA 1SVWA 1QZMA 2IWHA 1XJCA 3WTSC 3R8CA 3PCRB 3QOPA 3X1DA 2L01A 2PN6A 2AFHE 2FFQA 5EXPA 1DBSA 2HF9A 1KI3A 3A1TA 3MLEA 2Z33A 4A5NA 1MKYA 2B7CA 4TZ6A 3GLHB 2ZRMA 1OIWA 4AD9A 1NN3A 1SHZA 3AP2A 1H9TA 3K9TA 1NY6A 2HT6A 2J7PD 3SN6A 3U2QA 2OCAA 3DFGA 4I1SA 2NO7A 2ZSBA 4JVSB 2WV0A 3FMSA 4BFZA 5E7IA 2FA5A 4AC9A 2QQ9A 3D7MA 5F9HA 2ZRGA 3PENA 4A6EA 2XGXA 2JDID 2CE2X 2ZREA 3SE0A 3L00A 1VCMA 4ENMA 5DYMA 2W57A 1BI3A 2K7LA 1W0JA 2GJ9A 1V43A 4PAMA 2BEJA 2OV2A 3WTVC 2CK3A 1U8YA 3MCAA 521PA 2HYDA 2MLKA 1IN8A 3HJNA 3ROUA 4HA8A 2WBLC 5L3QA 5BXQC 2W0SA 2GQQA 5ILUA 4PZYA 2FNAA 2MD5A 1TQ2A 3IGFA 2KKOA 5FLXZ 3MHVC 1Z1DA 3C4JA 1R1VA 2BJVA 2B0LA 2TDXA 2QA5A 5A2QZ 4D4KA 4Q9JA 1CR1A 1I2MA 2VLIA 5E7JA 2J0UA 1P2FA 4IHQA 4JL6A 4ACBA 4BUJA 5KNBA 3FX3A 1JGSA 2WC2A 4G5OA 2I1VB 4YQFA 2FSGA 3K70D 3VNVA 3IL2A 3X1WA 5JI2E 2EK5A 3P9IA 5HE9A 5CB6A 2FRHA 5HS7A 2MSCB 3NBXX 1G41A 3GZ5A 1ZRFA 2RGEA 2R65A 1P6RA 1GIAA 5E3HA 4YXWD 1XPUA 4PC1A 3KQLA 4XJXA 2EWWA 1J99A 3BB1A 2F43B 5BPIA 1XDSA 1FX0A 1Z2AA 4PFSA 4DWJA 1TTYA 3KKOA 4CZ2A 3T1BA 3I59B 5KSOA 1MRNA 2VHCA 5ICGA 1UPTA 1H8HA 2CWEA 3N2IA 1T3HA 4FI3C 4JKYA 2FFHA 4S04A 4X8OA 4D0NA 5KNDA 2C9YA 1U90A 5F1RA 4X8MA 1Z63A 4M4SA 2W24A 2NNYA 3P26A 2I3BA 3EZFA 1FTSA 2X0LA 5LPNA 2P6UA 2OXRA 2WMNB 1OIVA 4US1R 3FXQA 3KJEA 1WA5A 5CVJA 4ASNA 3LH5A 3LV8A 3VKGA 1X6VA 4XVRA 1XWIA 1ZM9A 4EPVA 1PUEE 4MGIR 4X8HA 1GVJA 3WXMA 2ZRHA 1T5IA 1HW2A 4GP6A 3AKYA 5FPTA 4C4PA 4F7WA 4TL9A 3ZZUA 2XAGA 1COWD 3AKDA 1BIAA 2P67A 1CJUC 2ZJ8A 8OHMA 3K70C 3S1AB 1OH5A 5D4SA 4BFTA 3EETA 3NDPA 1TNDA 3ECHA 1S96A 4MKFA 2WPDD 4PSKA 4R8HA 4ZPXA 4S05A 4IXNA 4UHTA 1WQ1R 4OK3A 3OIVA 1F9NA 2XAHA 5FGMA 2FFAA 4QJ5A 3H84A 3P9KA 2HYGD 3DPTA 1M2OB 4WW0A 1NLFA 1OHHA 2ERYA 2DT5A 2DPUA 2OCBA 4DEXA 2OAZA 4OOIA 1R5BA 4NMMA 4URUR 1VG1A 4F91B 4Q4HB 4Q01A 1QG4A 1LVGA 1LF0A 1YKSA 3H92A 4A0ZA 2G0NA 3QPHA 1II0A 5HVQC 3JVUA 4RCYA 1U2WA 4E5UA 2ASEA 2E1NA 5J4LA 2NO0A 1OPCA 3QP6A 4BECA 3VNUA 1NIJA 1VDZA 3JAMZ 2ZRPA 3U3MA 3SOPA 4PZJA 2EYQA 1I2DA 3HOSA 3RS5A 4A2QA 4KYWA 4LX0A 4FW9A 2V6ZM 5FL7A 3DP7A 5EEGA 5EEHA 4C0KA 3C7KA 1BI2A 4OQNA 1U6GA 5KYKA 3T1TA 3V00A 4KIFA 1P62B 3THXA 2JSCA 4WXHA 5D3MA 5LLQA 2EFDB 3WMGA 5JCZA 4HW0A 1E79A 1B1BA 3THYB 1FBQA 5H8WA 1D2NA 2XIGA 2ZYVX 4Q7LA 3IHUA 2ELHA 4KDPA 1AM4D 2WHXA 2Z4SA 4HB2A 1TBXA 5ICFA 2J41A 5DNYB 2ZRLA 3EZ2A 1EH6A 3CR7A 3SZTA 2VBXA 3KW6A 1UADA 2WPDA 3QF7A 3BJIC 3GEEA 3GJ3A 5FPYA 1L4UA 1I27A 1N6KA 2IEZA 4JJKA 1MGTA 3VR2A 4EM1A 4XWKA 3EPKA 2O52A 4LYAA 2ESNA 5AONA 3CUEF 4QGAA 2MH9A 3HRMA 5ICEA 1AKEA 2OLJA 2ZU6A 4GCVA 1E3MA 4M1KA 1CP2A 1T3LA 2A78A 4UNSA 2J59A 4CYMA 1RYHA 4ZZDA 2VA8A 4RZUA 1KGDA 1GFIA 4NPHA 3E2IA 4D2IA 2H5EA 2WWIA 2VP4A 4K81B 2Y8EA 5JVTA 1GITA 1OXUA 3R9IA 4ESHA 4TSFA 2Q6TA 4PHHA 3B82A 4TT3D 1SVOA 4HATA 3RS0A 5LGNA 4RGSA 2QM8A 4A2WA 2A6EF 2LF8A 3AH8A 4TMWA 1MD0A 4FX0A 4ERNA 4QGFA 4PC2A 3RABA 4Q4AB 1K8RA 4L9VA 2GWHA 1H8HD 2DHRA 2ZI7A 1FY7A 4IVNA 4EJUA 2JEOA 3IHLA 1G7CA 3AF2A 4BWYA 2V3CC 1MV5A 4NTZA 1HQYE 3MGCA 2RH5A 3OEEA 2CG4A 1RVDA 1Z0IA 2PBRA 5FI0B 4AYXA 1FUKA 2J9RA 1RPZA 1N6RA 2XZLA 1HURA 3B1WA 3KFWX 2V55B 2KIUA 3ZS9A 1XEFA 4RD3A 3K2ZA 3OAAD 1RW4A 1M8PA 1FSHA 3WTZA 3QIAA 5AK0A 3BJ6A 1A1VA 1XB4A 1VMAA 1I4DD 4N9HA 2IUUA 2F5EA 3KKQA 3T1OA 5GVRA 3K69A 4KCGA 1DTSA 1FP6A 3M4YA 4ZDJA 1DAFA 4BLOA 2H6CA 1MR3F 5LD2C 4ZYEA 2FMXA 1ODFA 5D5WB 3QPUA 2CEAA 2WSSA 3NH9A 3WMEA 2W6IA 2AHOA 3LX5A 2JJ1A 3KB2A 4OHWA 4I09A 4KFSA 5JJKA 4KFCA 1XRJA 3K9LA 1IXRC 4P4SA 2W84A 1FX0B 4TQ9A 3UIEA 1QHIA 4L5IA 3Q7PA 1BC7C 1ZC4A 2MSEB 2A61A 1GP2A 1KI9A 2DWPA 5L8VA 2PMKA 3LQRA 1XEWY 3W6OA 4B74A 1KQ9A 2A6HF 4M1MA 4BZXA 3WGHA 1A04A 3K0LA 2AL7A 2XAUA 4IJMA 5KSYA 2JJ1D 1K78B 1SFXA 1Y63A 3KJGA 4JT4A 2GCOB 2P6NA 4PXAA 2G9NA 3GFLA 4P0TA 2QN6A 4TMXA 3LAPA 2Q0HA 1SKYB 1RJ9A 1XTSA 5HOOA 3K9HA 3KXLA 3NBZC 5FBVB 1SVIA 5KO2A 1JAIA 3EPHA 2HLDA 5DCMA 1E9FA 1KQ8A 2BKUA 1BIFA 2AN9A 1P4AA 1BOFA 2VSOA 3LVRE 3OAAA 3SJCA 1EFHA 3DZDA 2JPCA 1ZLJA 3DM9B 5K1YA 3DKWA 3IO5A 2IC5A 3HIFA 2X8AA 2RB4A 4P5OA 1W5TA 5DGXA 4Z2YA 1G3RA 4JVMA 2P5LC 4KFTA 4Q4AA 3SJZA 2SHKA 4DDWA 4M22A 2H17A 2C96A 3N70A 5B30A 1YO5C 2RGVA 1F3OA 2K5UA 4KSCA 1W48A 2WIAA 4ZCIA 2VT2A 1UKVY 3FKSA 1Z05A 1E99A 3SYKA 1OFHA 2OZEA 1W36D 4TT3A 3PEYA 5FFZA 3CRMA 2E1RA 3CNLA 1FNNA 2YWHA 4EPYA 4ON0A 4FN5A 1E2MA 4JBYA 3EARA 4PPFA 2GBLA 1ZM4A 1CF4A 2ZCWA 1T3SA 2WJYA 4UNOA 4RGUA 2ODNA 5BPDA 2X77A 4BLPA 5CIQA 3C3WA 4GL2A 1IUYA 5AJYA 1RFLA 1PVOA 1U99A 3FFBA 4RB3C 3EXAA 4PQYA 1TW3A 2BYVE 1HY3A 2F1RA 2CCJA 5JEDA 4OJKA 3U4QA 4LBYA 4E07A 1E2JA 3W6KB 2DZNB 2IYXA 1W0KD 3PUVA 4NH0A 3EIHA 3E97A 2XAJA 3HSRA 4CHUA 1S3JA 2HEOA 2E9SA 4AY2A 3X1XA 1GRRA 4GXOA 1R5HA 3QXSA 2HCBA 4DHEA 4I01A 3A58B 2A07F 4G5SA 5EE5B 1ZHFA 2CQKA 1SULA 1E79D 1M7BA 1KU2A 4NHOA 2ZRFA 1XJQA 4RZXA 4UVCA 3COAC 2ISZA 1KI6B 1X86B 2CDNA 2CLCX 1HUQA 5FL7D 1JR3D 1QZYA 3IHWA 4EUNA 5FBWB 4A12A 3GJ6A 1W4MA 3U7FB 3EAQA 4PO8A 1IOZA 2R2AA 2VTKA 4Q00A 1UM8A 1L7VC 4G5RA 1HKTA 2R6CA 4U0YA 4XTRA 4B35A 4CT5A 5G3ZA 2QAGB 4OYHA 1UFMA 2UXXA 1JECA 2ZR9A 4MKHA 3RDIA 5G41A 4Q02A 1WF3A 1KYWA 1TW2A 4Q47A 1E0KA 1LW7A 2VXZA 4A0GA 2AS5F 1G7SA 5DCFA 2IHBA 4AI6A 4O2RA 1QHXA 2XNSA 3ECOA 4BLSA 3Q85A 3TR0A 1S29A 4PPGA 5EXXA 4UNPA 3VOEA 4GDFA 1WMSA 1KO5A 1XGOA 1UDXA 1YZGA 1NL3A 1OLOA 4LDJA 3JW4A 2VC0A 1IRGA 4PZLA 3GO5A 2ZRJA 2EFWA 1SD7A 1R10A 4Z8XA 3AVQA 5D3MB 2P5TB 2BMEA 3THYA 2VYFA 3ZQ6A 1D8KA 5IT5A 2XZOA 1NP6A 4OI4A 4CRWB 3I0TA 1Q1BA 1T9HA 4ZDWA 4II7A 3OEHA 1UBGA 4HAZA 2RVCA 3OIUA 5B58C 3WMFA 1JQLB 2C77A 3E6CC 3SQXA 3RYPA 4B6FA 5LD2B 1SHKA 1CU1A 2UZIR 3ZZTA 2WOOA 3PV0A 2Q3HA 3K1MA 1G4UR 1Z2CA 2F7SA 3G82C 5JJIA 3RPUA 1OE0A 5CYOA 1OMIA 2HYIC 1VCNA 3KFXA 4MGRA 2GVDC 3AF3A 3QAHA 2G7UA 5JZVA 3F0TA 5FFXA 1GWNA 1S9HA 4LJ6A 2NOAA 3K0AB 1K6MA 1Q44A 5LB2A 2ZRAA 2Q8KA 4IDPA 721PA 3H2YA 4U02A 3BIFA 4JLJA 2ZNZA 2ZE8A 5C4MA 5AUQA 3AVXA 1E2NA 4HAUA 3VX3A 3ZQJA 3R61A 1G3QA 1ZP6A 221PA 3ELKA 3R8FA 5EE0A 3D5LA 4YFNF 2QQ0A 1HA3A 2HXSA 4LYHA 1PZNA 2YOHA 1CJVC 2VE8A 4GBMA 2QMEA 1DG3A 2WZQA 1GNRA 3N97A 1Z6XA 3DV8A 1GKYA 1VHTA 3RAPR 1XGMA 3W9YA 4G7OF 2LSOA 1BO6A 3UMSA 5DSZA 1T6SA 1XX6A 2X2FA 1W0JD 2O5VA 3B2EA 1OKKD 2ECKA 2EFCB 3VLFB 1T98A 2A68F 2GKSA 2ZS8A 3W34A 3P20A 4G0NA 2BM0A 5C18A 5HKKA 1ZCBA 3MFYA 5EP3A 2JGNA 2UKDA 3LX8A 5K8TA 1CTQA 4RCZA 2O8DA 2OBLA 3K09A 2E7WA 3THWB 1NIPA 4CEHA 4ENKA 2J7PA 4UXNA 3TMKA 3UXMA 2REBA 3IRQA 4ARZA 4P4SB 2YINC 1LNZA 4XSHA 2BV6A 4IFEA 3TOBA 2J0VA 5CM8B 4WF2A 2OBNA 5CVUA 2C6YA 3ONWA 1NG9A 1TTTA 4IEIA 3TIFA 2OHFA 5L3EA 2UZKA 4PC7A 1RE0A 4I02A 2GA8A 4UJ3A 4C0AC 3R4KA 1AS3A 1A2KC 2RGBA 3DZ8A 3EC1A 3T1QA 2F1JA 1UCRA 3T5DA 2ZNYA 1XXHB 3I53A 1J0RA 2OZ6A 5GJBA 3FXUA 4HB3A 1N6LA 2W2TA 2FSFA 3IQXA 4NYJQ 1J8MF 1Z0FA 4DRZA 2YPRA 3HP1A 2DWZB 4M2LA 4TMTA 2ZKZA 3SS8A 5DLQC 3AVVA 3HPQA 4LRSA 2IK8A 1BIBA 4Q5SF 2WAYA 1IJEA 1HW5A 4N0DA 4MYUA 4EPXA 1FW6A 4PHFA 3DPLC 1DDNA 1KK1A 1AGRA 2XKPA 2CJWB 2WICA 4KBGA 5DISB 3JSPA 3A1SA 5DHFA 3SBDA 2QY9A 1F1ZA 1XF9A 3RWOA 3C41J 3WU1B 4C2TA 4M21A 2BDTA 4V0LA 2RHMA 2M1BA 1NVMA 1F6BA 2QU8A 1ZREA 2IYUA 1Y3AA 2Y0MA 4G7ZF 4OU0A 5K5RA 1BMFA 5K8IA 5BYKA 3GLGE 1P6XA 2YOFA 4LC0A 2IS1A 4I99A 1W36C 3CZPA 4HI0E 4H1VA 3IO3A 1M74A 1Z9CA 3NBYC 1T39A 1YHNA 1YZUA 3D3QA 3GPLA 1S9DA 3TGPA 3NHAA 3QBVA 1U0LA 5FBLB 2R44A 4L18B 2IYSA 1P3JA 1G5TA 2YC4C 2YHSA 3FMOB 4EPWA 4DB2A 1HEIA 2KJCA 3PUYA 3CJNA 5HZKA 4D81A 4LJ8A 1FT9A 1G6NA 2L4AA 4LFUA 1VCIA 2BEKA 2FSIA 1XEWX 5IDVA 2DQLA 5JSZA 5AJXA 5GVSA 4PTLA 1U9IA 2GEDA 4N0BA 1Q1ZA 4DDTA 4O3MA 1TU4A 4P32A 3NBFA 2GK7A 3NRVA 3PJRA 1EH8A 4KU4A 5EE9A 3U6BA 4QNMA 1KOFA 3U3JA 3T0YA 1G18A 1P73A 2AKYA 2PLRA 2W6ID 5JHUA 2VF7A 1C1KA 2F5DA 1AZSC 1N2CE 1SKYE 3DM5A 5E18F 1KDTA 1SGWA 3O47A 5CLLA 4KITB 4JK1X 1FPMA 1WI9A 4Q4JA 3RC3A 3IEUA 2YC2C 3Q72A 3T8RA 5A5GA 4Q9IA 1W1WA 2I1QA 2XB4A 1U5TA 4DLYA 4NCIA 3BJOA 2F5FA 2V9PA 2DFIA 3EWSA 3DL0A 3UMRA 2A3RA 4LWZA 2PH1A 4TQUS 1DVRA 5FOTA 1NMYA 4BRUA 4HLUC 4U7BA 1KSGA 1Z22A 3DDCA 3K0AA 121PA 3QKUA 3FWEA 2LCFA 1N0UA 4FWIB 1ZN2A 5DE3A 4XBFA 1EFTA 1PLJA 4LV6A 2QT1A 4IW3B 2Z9OA 2QMUA 4TYPA 2IF0A 4ZI2A 4MRVA 1FUUA 2IF2A 1F2UA 4M74A 3MZHA 1YW8A 5KSZA 1E2DA 1SXJB 2WJHA 3VR5A 3GYHX 2PJZA 4KBFA 1QRAA 1OYIA 4XD7D 1VPLA 1SFUA 1P60A 2ZJOA 3CLOA 1D8JA 2ZYTX 4CIDA 4IOKA 3PEUA 4M1WA 4TSFD 3WRXC 3TJZA 4BFXA 1J75A 4RKFA 1B9NA 4U00A 4HZUB 3C15C 3L8ZA 3OEHD 1C4OA 4TWZA 4FT8A 4HLXA 2GJAA 5JMTA 3P4XA 2J5PA 4GMXA 2GZDA 2XEXA 3HPRA 4JT2A 5P21A 3U3KA 2RKOA 2D2WA 1W44A 2RGCA 4PO9A 1WWXA 5FH9A 4DCVA 3WP1B 4B3XA 4UNRA 2YZ2A 4IDHA 3RYTC 4YMUA 3K1NA 1J90A 4M71A 2DFNA 1I6XA 2ZM5A 4LK0F 5IRCD 3RDPA 1I1GA 2VH5R 4Y13A 5D6EA 1ZM3A 2CLSA 2F3RA 2Q2EA 3TSOA 3U7HB 3D8BA 3WTWC 1LY1A 2GNOA 4I0AA 3KLNA 4L0ZB 3A1VA 3LWNA 1XP8A 1ZC3A 3CNNA 1E9DA 1X8KA 1KYZA 2JZYA 1CJTC 1UF9A 2RQPA 3I4PA 3BOSA 3VFZA 2DBYA 2H8KA 2O8CA 3TUJC 4C0JA 2ZJZA 4DLWA 2XROA 3KP2A 3VKHA 1R1UA 4B48A 3SFZA 2CJWA 4XLPF 2OESA 4XWOA 2DVWB 1WKMA 5HLIA 2VP9A 3ZP5A 2QPOA 4B71A 5FTLA 1KK0A 2EV0A 1KI6A 4HDCA 5C4GB 2FMYA 3UG6A 1T5LA 1OH6A 1XMSA 3I5UA 1LV7A 2STTA 3CRRA 3R9WA 2XV4S 3RC8A 3GJXC 4MTDA 1MO6A 3HTSB 1P2TA 2DI3A 2V9VA 4WCGA 3WTTC 1M6NA 2ZJBA 4DIEA 2NYXA 3EPJA 2HTJA 3FHZA 1O57A 5CIWA 2O8BA 2G88A 3KTAA 1ZG5A 1GRQA 2WOJA 4Q5IA 3VU9A 4EQQA 5ILVA 3GLIA 5FOSA 5CVVA 5EJEA 2C5LA 1BJAA 3THXB 3J80Z 4A6XA 2V6CA 5L3QB 2QTHA 4NCJA 4M8NE 3UPUA 3A4NA 3K9GA 2R6FA 3CF6R 4ITRC 3EDPA 5DI3B 3P4YA 3NXSA 1YE8A 1R5NA 3H0KA 2HQNA 1ZGAA 1FP7A 4ARZB 1BI1A 2EFOA 4H9GA 4V0KA 2AR7A 2IUTA 2GIVA 5FO5A 2VONA 4LBZA 3THOA 3TVTA 3K09C 4LC1A 4BLRA 2QORA 3OHMA 2FX3A 1TQPA 1OXTA 2FV8A 4Z51A 1KJWA 4IVRA 3REFA 3TW4A 1VYVA 4I1OA 3U2RA 4ZIRB 4EMSA 1HH4A 2A5DA 4B33A 1QHNA 4BZQA 4DLXA 2NG1A 4NCKA 2ZU0C 1DPFA 3NH6A 1LS6A 4PPQA 3GLFB 3HWSA 3L82B 4FWTA 1LTQA 1M7GA 1N3BA 3D31A 3NC1C 4KJZA 3MWYW 1S4QA 3F8MA 5JFGA 4NYJR 1O3RA 3FB4A 4HAWA 2AKAB 4R2IA 2H6BA 1G3UA 1Z91A 2RDPA 1G4DA 1F2TB 5LDDC 2P4WA 4AKIA 1ULYA 3BORA 1T38A 2VP2A 4EFLA 2G6BA 1ZMXA 4IRGA 1JAHA 1XD2A 3MMPA 1S1MA 4HSEA 2JASA 2JJ2D 2RV8A 4L8GA 4LPSA 4C0BA 1LVAA 2GF0A 2PZEA 1XDUA 2C78A 5DCMB 4EJSB 1XMVA 1ZNWA 1GHCA 3RVBA 2KJQA 4E09A 4E03A 1D9ZA 3GCGA 1BYUA 2OA4A 3JTHA 4ILEA 1XDBA 1IM2A 3NG1A 5CK4A 2NZ8A 3ZVLA 4AKEA 1A7JA 4L9JA 1YS7A 2VF8A 3CIOA 3FWYA 4KV9A 2ZSAA 5SZJA 3BPXA 5EUQB 2OBMA 3A1UA 2NAZA 4LJZF 1K78A 1F48A 4MRSA 2JLRA 4URZR 2BCGY 4FCTA 3F8NA 2AXPA 3QUSA 5FTNA 1F2UB 1T8UA 3ZVRA 4FXPA 2YWEA 1X37A 1G16A 2QT0A 2NTYC 4RGRA 5HS8A 1XXHE 2CL0X 1K7AA 2YVUA 3EG5A 4L5BA 5KSPA 4BEJA 3TR5A 4DCSA 3B6EA 2YNMA 2DR3A 1KY3A 3NWJA 3QKSB 1FZQA 4A8JA 4QJ3A 3HOTA 3BDDA 3G3ZA 2ZR0A 3IIMA 1RNLA 4FMCF 1FL9A 1U8AA 2P5SA 2H1LA 1P9NA 2TMKA 4RVCA 1Q0UA 2A5JA 2OSBA 4M1SA 2IA5A 2FU4A 2B8TA 3FOZA 2LKDA 2IYYA 4Q7KA 3TUIC 3U3OA 4EJWA 3F3XA 3W6JB 3C1DA 4HYYA 1NKTA 3U44B 4L15A 3LWFA 4MYCA 3CNOA 3GF2A 4P3YA 1Z28A 1YG2A 2HCJB 3LLUA 1JPJA 3CUQC 2ZE5A 1UEIA 3AVOA 4H1UA 1M1YE 2V79A 2DLLA 5DDGA 4G7HF 1E9AA 2V7QD 4ETSA 2ZQ5A 3B8HA 3CDHA 4RGXA 2RGNA 1R6BX 2ZFWA 2QROA 4DLRA 3IWFA 4YDSA 1S8NA 2WJJA 1DEKA 3FKQA 4M1YA 5DHAA 1R5GA 5HE8A 3DMDA 4FD2A 3FYHA 1G3TA 3RHFA 1J5YA 4IVQA 3GX4X 1FLIA 1CS4C 4NYIQ 4A92A 2O8CB 2BGCA 2Q0OA 2OCYC 3SU8A 4JLPA 2IL1A 2VT3A 2ETHA 3CUQA 5IT9Z 1YJ5A 1IQPA 2GZHA 4HAMA 1E1RA 4B75A 1JR3A 5E7MA 5B57C 2WTEA 2IXFA 1FWZA 2DBBA 2QBYB 2BJWA 4QGHA 1YR8A 3V7RA 4U5XA 3SHWA 1LEBA 2GAAA 2ZE7A 1KHTA 4P9FA 2UWMA 3VHXA 4A8JC 3AUXA 1JR6A 1W7PB 5EUMA 2W85A 3IWZA 1NVVQ 3CPHA 3ASYA 5FFMA 2AK3A 2H7VA 2ORVA 2J0SA 3GQBA 4PHTA 2XXAA 1P2VA 4IDNA 2DPXA 4LG0B 4P4UA 4YC7A 1TEVA 3GFIA 1G64A 1VTKA 2QMOA 2ZYWX 3LD9A 4NU0A 4Q7MB 3KP3A 3GLHE 4A6PA 3AVUA 2MC3A 3O3KA 3ZMSA 4XTCS 5ILSA 4NP6A 2OBPA 3E1SA 4GZLA 1CF7B 3AGQA 1PLLA 4IRUB 4XVUA 2CL7X 1E2FA 3IQWA 2V8OA 3M7GA 2Z0MA 2C9CA 3W6NA 1GTVA 1CLUA 2M8EA 3Q9VA 1DO0A 2G9WA 1P7CA 3HSEA 1Z0JA 4RB2C 2VRWA 3N5CA 2GBLC 4S2EA 3IIJA 2BEOA 1Z3IX 3UK6A 2R3SA 4TQAA 3LBIA 1AS0A 2G7HA 2FGJA 3RYRA 3V4RA 1G8GA 3ZMTA 5DEQA 1JXOA 1HE8B 4YMVA 4MRPA 4JS0A 1G20E 5J40A 3RWMB 5KDOA 3THWA 5KHOC 4ZCLA 3WGIA 1KI4A 1Q1EA 3QF4A 4GT1A 3P27A 2F6RA 4PSAA 1W47A 3HU1A 4KLNA 2CCGA 4I0BA 4XSZF 3KB1A 3QP5A 5FL3A 5LB4A 4RY2A 2G1KA 4QNRA 2GXBA 3IEVA 1E9SA 4Q1FA 4KT5C 3QXXA 3KZ1E 4PC6A 4URVR 4EJSA 3R20A 4DT1B 2FPLA 1RC8A 2QUFA 4AURA 4LD5A 3P9CA 4M9XA 1X1SA 2W00A 4HB4A 1XBTA 1XD8A 4LJ9A 1ZAOA 2OFXA 2PMDA 2QRZA 3BRWD 1S3GA 2ZSDA 3DEFA 2VOOA 4HAYA 3ZN0A 2CW0F 2FXAA 2B21A 5ELXA 4B3FX 2NO9A 1PUJA 5HKKD 3X2SA 4ESBA 1P4WA 3WYGA 3RTRA 3ADCA 1P2UA 1XU4A 1RYFA 4PX9A 4URXR 1BBYA 2XKOA 1C1YA 3AEZA 3I3SR 2VBYA 1JR3E 1YTYA 2OLKA 1LEAA 4XSXF 2XITA 5CJPA 2HQRA 4K8OA 3SYNA 5DYIA 2A69F 3OE7A 2O61A 2VSXA 5EE1A 3KLOA 1D5CA 2ZI3A 1TQMA 4BE7B 1KA8A 1I5ZA 2QM3A 1KO7A 1GKUB 1R5OA 2BBTA 2BOVA 4TL7A 4TMKA 4WZAE 4A4DA 5J4VA 4CZZA 5DI3A 3U61B 3J7AO 3TKLA 3IBGA 5EZ5A 1NLYA 1HT2E 4YXWA 1II9A 3QXJA 4BFYA 3QI2A 3FZVA 2F9LA 3WP0A 1USSA 2O8XA 3OEED 1GSIA 5E17F 1QHYA 2IHYA 3M6AA 2L0XA 4M9ZA 1E4YA 2XNDA 3D6TB 1L2TA 3ZN1A 4JL5A 4QBFA 4OI0A 3MAJA 1CRQA 3S2WA 1VG9B 2F1HA 1DPUA 2XTMA 5KTYA 2Q3FA 1Z0DA 1SKQA 1ZINA 5D4RA 1JBKA 3OE7D 1DOAA 4BRWA 3OF5A 2VHTA 2DO7A 2ZMEA 2FNPA 2H92A 4YDHB 2WIBA 4OI1A 4BQSA 1K5DA 1VYUA 3ZVNA 3CO5A 1XEXB 2IEYA 1NNEA 4LB6B 1W4AA 4EM0B 4QRHA 3VB2A 4JBWA 4Q7JB 1VKJA 5FOWA 3B13B 2IPQX 4BEBA 1EWQA 1HXDA 2EV6A 4JLOA 5C1BA 1N5LA 1DAIA 4V0NA 2FOLA 3RNLA 3I8XA 5JRZA 1XGSA 1UBEA 2IW5A 1VYTA 1XJ0A 1X3UA 2QG6A 2MA3A 4EGZA 3TVDA 1HKSA 1OYWA 2P8TA 3RKYA 5D5VB 1E0SA 1J8YF 5FTKA 1II8B 1Q20A 3WNCA 3HUGA 3B5JA 1G8PA 4C9BA 1G17A 4BHBA 3KP5A 4DSUA 3I8SA 1ZARA 2ZMEB 1JE8A 4X8LA 5JWHA 4Q4LA 4IRIA 4QBGB 1IY1A 2BWJA 3GLGA 3KP4A 3GLIB 3WTYC 3LA2A 4HQEA 2GXAA 4LLLA 1Q12A 4ZYHA 1RUOA 2WJIA 4ZCMA 4L9TA 4C7OA 3AVPA 4QLCU 3WYFA 1JHFA 2ODWA 4LHZA 1YFHA 4MRNA 1AIPA 3PUXA 4JLKA 3B1ZA 4AYWA 2PX3A 3CO7C 5LHHA 2ZUDA 4TLAA 3WG9A 1U2RA 4MQBA 4B43A 1OXVA 4CF7A 3Q5EA 5D5XB 3GLFE 3RIRA 3AM1A 3GEHA 2HS5A 3FMQA 4I2OA 4JBAA 1XCGB 5DH9A 2UZ3A 4QGGA 3BFXA 3BGWA 3B7GA 1MO5A 2ZI9A 4A2UA 4DVGA 3ADKA 4EAQA 4I98B 3KX2A 3IILA 3EUHA 1G19A 2VO1A 2YV5A 1B23P 2VE9A 4Q4HA 1KKMA 5L3BA 4BASA 2NNNA 4EFNA 4HDVA 4O2LA 2VIIA 1YR9A 1MOZA 5HPYB 1TQ4A 1SFEA 2ZRKA 1GL7A 1H8ED 4MHGA 1FQJA 2H18A 1W0KA 1SXJC 2QAGC 2FN4A 4JSYA 4JSTA 1Z83A 4MITA 3ND9A 4OL0A 1XMJA 5FUVA 2FBHA 1QHGA 1BN5A 1S0UA 4MEXF 1U5TB 2DYKA 1R23A 2GTPA 3C16C 3HR7A 3RS3A 3C18A 3GXOA 4ENJA 4CXFA 1NBME 2M45A 3H4MA 4IPAA 3V9PA 1E0AA 3IPXA 4Q4JB 2K4JA 3T8TA 5BQTA 1G1MA 3FTQA 4F4JA 3MJHA 3PEVA 4S35A 4R7ZA 3RSOA 2Z83A 1SD6A 4P4TA 2XZPA 1QBJA 4KYUA 3TAHA 2O6GE 4Q1CA 4DT1A 3HRTA 5FUYA 4B3GA 3H3ZA 1E1QD 1EFRD 1R8QA 2LKCA 1E2EA 1ZYUA 2PBIA 1O7LA 2F5CA 3ABUA 1HKQA 1UJ2A 3VODA 1KSHA 2B8WA 3I5XA 2QRNA 3ZVMA 4EJTA 3ZZ0A 5AUPB 3F8FA 2OQGA 2Q9CA 2DY1A 2XTNA 2YWGA 3OIWA 4B8XA 3I64A 4BQAA 5FOVA 3QU3A 3CRVA 1KDRA 1R0YA 3MQ0A 2G77B 4K2EA 2C04A 2L4MA 4M0LA 2HJVA 2V7QA 5DN6A 3UANA 5G40A 1NSFA 4CDGA 5HZHA 3KJIA 5HDKA 2HLDD 2FQ3A 1JXMA 1AK2A 3A4LA 3FM5A 1KY2A 2OCPA 1ONVA 1TQIA 3SJAA 1WQ2A 2YSRA 2QENA 4KFUA 4AWXB 5JFRA 1O3SA 1E0JA 1GILA 2MMCA 1L0OC 2VP0A 3VR6A 5L3SA 2H27A 2AXLA 3I54A 4ON9A 4AIIA 1N0VC 1Z6RA 5IHPA 2MBFA 1KQ0A 4KNYA 2D3WA 4FWGA 2KBFA 3B73A 3KEQA 1EXMA 5LEJA 2CK3D 1MO3A 2O0KA 5D8LB 4MUBA 1RZ3A 1R8SA 3Q9LA 1E96A 4B2LA 3QEOA 5FOUA 2FEMA 1OH8A 5KU1A 4DLZA 4C7OB 4LG0A 2ZRBA 2BBSA 2JLYA 5E1XA 3AV0B 2Z43A 1KU9A 2XXAB 2GAOA 4AIKA 1BH2A 1RRFA 3MRSA 1E4VA 1U94A 1D9XA 3RRMA 3VFDA 1AN0A 3WTXC 2Q21A 2FJUA 3BS4A 3C5CA 4HDOB 3KZYA 1TQ6A 3WBKA 4LB5A 2QSYA 2K86A 1Z8FA 2EFPA 2VHJA 3L43A 1CR4A 2XRNA 1RKBA 1TF2A 4MH0R 2QBYA 4O5VA 2P7CB 3RPQA 1AQYA 1FP2A 4LJYA 4W9MC 1EFUA 1A2BA 1OH7A 2QL6A 1SZPA 4TTPA 3ICEA 4LI0A 3CB4A 1S3SA 1XTRA 2IYZA 3QBTA 4V02A 1Z07A 1NG1A 4RFVA 3O6BB 1R7JA 1D2EA 2EW1A 5JR3A 2RN7A 5DUIA 1KMHA 2J45A 2IJLA 4KSBA 4MQ9F 1TEXA 4OQMA 3KP6A 4OINF 5JECA 1XEXA 4U0WA 2W2XA 3NVAA 4TLBA 1W7AA 5AR1A 3ZH9B 2P7VB 3ABTA 1C0WA 1LB1B 1N25A 1KNXA 3RI4A 1YVDA 3QKTA 4HZIA 5KDLA 1R58A 3I4LA 4KHZA 1FPQA 4D82A 3FMPB 5D8KB 4WVFA 4UNNA 3N4MA 2FF7A 1TL7C 1O87A 1Q3HA 1QVAA 1YYVA 3QRFF 2R7DA 3PIRA 2CHVA 1ELOA 4NE2A 4OQXA 4KFRA 4W5HA 3VKWA 3U1DA 5DI9A 2D7DA 4G6QA 1OFUX 3L0OA 1DAHA 1G6HA 3OFND 3K9NA 4BHCA 3QPTA 2BBOA 1RRPA 4I4LA 2FBKA 4HV5A 4D6PA 5F98A 5J5CA 3X1ZA 3TQNA 4B3DA 2IX3A 4BHPA 3VHLB 1XZQA 1N5JA 2CNWA 4C0LA 3F8CA 4TLCA 4BZPA 2ZRIA 1CRPA 2ZVQX 1XTQA 4Q1EA 5D6FA 3GP8A 2F55A 2EA2A 3WE3A 2GK6A 4TL8A 4CT4B 4ZO4A 3K0FA 2ZAMA 4IXAA 1Q3TA 3MWLA 2UVQA 3U3RA 4JLNA 1DE0A 3U44A 1E32A 4HF0A 2JLQA 2DB3A 1UHWA 3AF0A 6PAXA 1WCV1 1KNQA 3GFPA 2OT3B 3BD9A 3DO6A 1EK0A 3IDQA 3EZ6A 1R0XA 2IT1A 3E5QA 3WTUC 2RGAA 5FBQB 3K70B 3QEJA 5JRJA 2RGXA 4M53A 2QE7D 4OIQF 5JWRA 1FMJA 4TMZA 4HDUA 4FCVA 1ZD8A 4G01B 3IKTA 4UVBA 5E8GA 1FBUA 1ETUA 2HJGA 5L3GA 1YS6A 3GFMA 2CHQA 3I71A 1CR2A 4R2HA 3EC2A 3Q5FA 5J8CA 3FHTA 1G8YA 6Q21A 1N6OA 4IOJA 4MDFA 5JS7A 1E2XA 1R36A 1TU3A 2D2FA 3JZAA 1G3YA 4IDQA 5FPHA 3WY9A 2BM1A 3SI7A 3FVQA 2OG2A 4EIWA 4XWAA 1WP9A 4XH9B 2HGCA 4DNCA 4U7DA 4Q18A 1LJ9A 5DD8A 1A5TA 1MRSA 1ZM7A 2V4ZA 4HUQB 5KUTA 4OJQA 4RS8A 1I4TD 3BY6A 2DCUA 1FQKA 2W2VA 1IY2A 3DKVA 4Z8YA 1HV8A 4FMDF 1NHAA 2FE4A 2O0YA 4IKEA 2AWNA 4R9UC 1D8TA 5FTMA 4TTQA 1JJ7A 4GRAA 5HS9A 1COWA 1ZUNB 5CYPA 4A0XA 3B9QA 2J1LA 1NN0A 3AF4A 2F43A 4M6XA 2QP3A 5J8FA 2GEVA 4M1TA 2JLZA 2C9OA 4WXCA 1PV4A 2C99A 3J81Z 3WNDA 1XD7A 3SZRA 3LA7A 1Z47A 1R0ZA 1W4BA 2EFNA 3HRUA 3AAFA 1VHLA 2R8RA 5F9FA 2YX4A 4US0R 3K0CA 3MJRA 3R9XA 1MJ9A 2OILA 3KDSE 3BWGA 2MSDB 3PQJA 1FFHA 4EVIA 1YZQA 2QP4A 4G5QA 2JTVA 4OBEA 1KI2A 2A2ZA 3CPEA 4DLTA 2JPBA 5LHGA 3BOQA 1KI1A 4M72A 1KSFX 3Q8XB 2RGGA 4GSYA 1SVSA 3CX8A 2B6HA 3TOAA 4M73A 3MUFA 1G6OA 3B9PA 3ZPLA 2FGKA 3IPYA 4GOJA 5KNCA 1E2LA 3GZ6A 1G8HA 4L4UA 2QEQA 3UMFA 5A0FA 4LYFA 1UAAA 1QQIA 1YQAA 4D26A 2M5WA 1NVXQ 3QKRB 2P5VA 2X1VA 2XOKA 3FFAA 3IIKA 1JI0A 1Z6GA 4Y0AA 2PEZA 2BBWA 3O8BA 4LBVA 4MRRA 2A3SA 1KMHB 5KK1A 2WVJA 4RD4A 2KRFA 1OXXK 4ASUA 1E17A 4TTRA 3CZQA 1XSXA 3FGNA 3MWMA 4OMZA 4PGHA 4EV0A 3NIBA 1OV4A 4MTEA 2PLYA 2NRAC 2HXYA 3GLHA 5LGTA 4IHTA 2PCJA 3CUOA 2QE7A 1IXCA 3QNUA 4A82A 3AVYA 1BYIA 4QHTA 3TKYA 1DPRA 4HAXA 4C0QC 3LXXA 4DKXA 2IT0A 1JHHA 2Z99A 4DC9A 3BAFA 3BFKA 1Z08A 4Z1MA 3F6OA 5BN5A 4HOBA 3DHWC 1IJFA 4UXIA 3TNFA 3VEPA 4CEIB 5AUOB 2NPFA 1GXPA 1W4CA 2J46A 3KXIA 4KVGA 2WWGA 4PHGA 5IF9A 1N0WA 2BMJA 4B3BA 3PUWA 2HV8A 1DAMA 2RGNC 2VODA 2PT7A 4O0MA 1IN7A 1HYQA 1G9XA 2O8EB 2Z5FA 1C9KA 1QDEA 3CM0A 2W25A 2O0JA 1SVKA 3V8LA 1EX7A 5F6FA 2CNWD 1XTKA 1H0MA 1LDJA 5EP1A 5J6XA 2PG4A 2CVFA 2ZJYA 2N42A 1ZH5A 1JEEA 1GVNB 4MDEA 4LJ7A 2DFKB 3P1JA 2O03A 1T0FA 3HSFA 1KIMA 1U81A 2A30A 2DQRA 3RS7A 2DAOA 3KFVA 5L3SB 2HUPA 4KUMA 4JN6A 4IJAA 5LBQA 1VIYA 4DEYA 4QM6A 2V6IA 2WV9A 3AP1A 3KQKA 2PQ8A 2KBEA 4HEJA 1SXJA 1Q1HA 1PUIA 3WHLA 1DELA 3LBNA 1D3YA 2YR2A 3T61A 3I59A 4HX7A 2GDJA 2V1XA 2VBZA 2EWVA 2FSHA 3LO5A 4Q9KA 4EKDA 1MKMA 1P4XA 1CJMA 4YONB 4HUTA 3FKSD 2GXGA 5K5OA 3ZD6A 4G3XA 4JVLA 3WE2A 3NEJA 1Q21A 1NI3A 3PFIA 4W7SA 5LEKA 3KL4A 1FTNA 3A37A 4PPNA 1FYKA 2NS0A 4EM2A 3LW7A 4NDZA 4UJ5A 4B3CA 3TGNA 2RAPA 4J0QA 1E9CA 3CH4B 2X2EA 4GYGA 1DADA 3AKEA 5ED4A 1P75A 1DAEA 3KUCA 3SHFA 5E95A 5E8IA 3EYYA 3TK1A 2ZUCA 1OIXA 1US8B 3PQCA 4FCWA 2QI9C 1Z06A 3O8RA 3AKCA 2HF8A 3GJ7A 3P32A 3VR1A 2VBWA 2ZRNA 2HOEA 2A5YB 2E1CA 3BXZA 2IA0A 4IHSA 1PJRA 1ZU5A 5TB5A 5BN4A 2QTFA 4RSGA 1ZNXA 3ADBA 1GG2A 1U5TC 5L3FA 2FZLA 4GFDA 2FDCA 1DS6A 1UEJA 2O8EA 3A36A 2G3YA 1FZPB 5H6RA 1QBKC 5ICCA 2ZROA 3M8EA 4V0OA 1FYMA 1ZGJA 4H0EA 4FMCB 5IK2D 5JHHB 2IS6A 4A2PA 1JPNA 1OKKA 3FXRA 2CMKA 2WAXA 4JYCA 3GLFA 4PANA 2Q9AA 2XUBA 1XTJA 2D45A 3LY5A 2IYWA 5HDNA 4NCNA 2CFXA 1QVRA 2PJPA 2GJSA 4Z1MD 2X4HA 2N46A 4Q21A 5JI3E 1K5GA 1K6OA 2VL7A 1OB5A 2WSSD 2K27A 3C5HA 4CICA 4RJLA 5EP4A 4MQVA 3T15A 1EGAA 4AK9A 1IN4A 1TLHB 3BE4A 5LGUA 4LMYA 2IWRA 2ZE6A 1CEEA 4OMYA 1N6PA 5HLGA 3K0SA 2QAJA 4AIJA 4XOIA 3EASA 2JIZA 4RFSA 5KVRA 1O7FA 2PMHA 1BOAA 1U78A 2ZPTX 1J2JA 3KETA 1IHUA 4BXUA 1OFIA 4BH9A 1CF7A 5DN6D 2VOPA 4DUGA 4UV9A 1ZG1A 4LJAA 2B92A 2ATXA 3V8KA 4CYDA 1B0UA 3GFTA 4LUCA 3T34A 1ZW6A 1QZZA 5BOXA 1UBCA 3WRYC 3CPJB 4YMTA 4CEJA 1KO8A 1E2IA 3F8TA 1R2QA 1S8FA 2W0MA 1TADA 1AWCA 4Q48A 2AX4A 2GETA 1KDPA 3ZMZA 3HYRA 4TMVA 1NJFA 3REOA 4D80A 1XSVA 4BLTA 2KJBA 4PCQA 3BH0A 2FPKA 3Q5DA 4AWXA 1CGPA 4HF2A 5E4FA 5CYVA 4PQFA 3T35A 3W6PA 1G291 1IONA 1IW7F 2ZI4A 2BVNA 1JALA 1JJVA 3JVVA 1ZIOA 2YYZA 3F8BA 4MGZR 1ZAKA 4OQFA 2L3DA 3GLXA 2P6SA 5TVKA 1MO4A 3V7SA 4GGGA 2ONJA 5AIQA 3SEAA 3E6BA 4IFBA 4IXMA 1XCVA 4QWQA 2H57A 1G3WA 4A5MA 1ESMA 2ZS9A 4DB4A 1V5WA 3DMNA 4RD2A 4WXPA 4JJZA 2O8DB 3BZ6A 4MEYF 4CO8A 4RZ3A 4DSNA 1AJEA 2J0QA 4B73A 2ZJ2A 4BFVA 2ZXUA 1ZRDA 2COMA 3QXCA 5LRSA 4KODA 3V8JA 1TUIA 2RMKA 5CVIA 4QC2A 3NQOA 3HU2A 4YIIA 1WDTA 2RKHA 4BYYA 1T2KA 1J7KA 4LK1F 4TLDA 3EA0A 5BW8A 1ON2A 2D1VA 4ZH4F 3C8UA 2IVMA 1J59A 2IRFG 3F5FA 4W5WA 3OZXA 2J7KA 5BWMA 2AXNA 3CF0A 1USTA 3EQLF 2F9MA 3L0PA 4XSGA 4ZKEA 4EJSC 3AJIB 1DUXC 3R7WA 4WXRA 2KIFA 3B85A 3TAUA 4BGDA 2VEDA 1SD4A 1M7HA 4HX8A 2IUSA 4OI2A 1YR6A 4HBLA 4QHYA 4NL4H 4HLQB 5FB2A 2CXXA 4AKHA 2FEZA 2PMUA 3OOPA 2XAQA 5CDFE 4D4MA 2WKPA 3RANA 1YIOA 2BMFA 4GOXA 3RLFA 2CGPA 2ORIA 1REPC 4LHYA 4M1OA 2DTRA 3K0EA 4JMPA 1QO0D 3TUZC 1JEDA 4AIHA 2KE5A 5CM9C 4QL3A 3KQUA 4DSTA 1G3IA 2DW4A 1QPMA 1NRJB 3GJ8A 3ML6A 4NONA 4FWDA 2VBCA 1MJAA 3G5UA 5H68A 2IYVA 1G4AE 4HLUA 2ZO4A 2J5XA 3DOEA 3BERA 2V1UA 2IYRA 4QG7A 1XMAA 1WXQA 4HYEA 3QG5A 2ZJAA 1ZG3A 4R98A 3W3ZB 3ERED 4L9SA 4ZI3A 4LLGF 5LBIA 4Y17A 3WBJA 5TMPA 2H16A 1DG1G 3KP7A 4JLAA 2XVCA 4IOMA 3MD0A 1F2TA 2JCSA 1Q57A 3R7WB 3TW8B 4TYWA 1Z0AA 1SVMA 1E2GA 5LRRA 1AS2A 4TYNA 1AOYA 1US8A 2FA9A 3EZ9A 4WA7A 3I58A 2Z5UA 1W4RA 1GXQA 1QZXA 2YU3A 4YFKF 4FHTA 5KPDA 2FPMA 2RCNA 1SVLA 2WWFA 1IN6A 1E2HA 2Q3MA 2OAP1 3QF4B 5UKDA 4Q19A 3MCZA 2ONKA 3RS2A 3C7JA 2XNDD 4F38A 5GADl 1E98A 3V4GA 2B7BA 3DVLA 4B2IA 3LNCA 3EX7C 2ZR7A 2NMVA 1OPXA 2CHGA 3IBYA 4MGYR 4URWR 3O8CA 3ECCA 3VX4A 1MH1A 2M30A 1FNMA 4LCBA 2FE3A 3ZQ7A 3AQ4A 3ASZA 3I1FA 3QVVA 4KAXA 1PP8F 3WGGA 4AVPA 1U0JA 4A0FA 1XMIA 3SJBA 3V4FA 3I92A 2STWA 2ANCA 4A1FA 3QU6A 5C2JB 3HRSA 2W83A 3SNHA 1PLKA 1R0WA 3ICQB 1E2KA 3F3YA 1STZA 1W2HA 5CK5A 1E2QA 1P92A 4KMFA 1Q1QA 4D0PA 3HHGA 1XD9A 1OJLA 2NO6A 3KTAB 4WBSA 3J81k 1FOEB 3F72A 3W8RA 3DEUA 4HLCA 2Q9BA 4RAYA 2GESA 4GMDA 4I1UA 2QMHA 1JB1A 5HCIA 1XCMA 2JA1A 1B9MA 2WTUA 1W36B 4EGYA 1MABA 4EJVA 4ZYDA 3R60A 3IC7A 1GNPA 4WAUA 1EWRA 2AD1A 1XPOA 3TQCA 3EIEA 2QM7A 3FF5A 1G3SA 2CLDX 1ON1A 2LNBA 4DCUA 3SC3A 3U9GA 1G5PA 4QKQA 3BROA 3FHOA 1A4RA 2OXCA 3TO9A 4CEIA 3DOFA 3RKXA 1LNWA 3D0SA 3M1IA 4B6EA 2FSWA 5FUWA 2IS4A 3N2EA 2ZIAA 3U60B 1I4LD 1Z5ZA 1T0JB 4XVQA 2ORWA 3CUQB 2FZ4A 4V0ME 4AYTA 5TARA 3QVUA 2NGRA 5TXGA 4KA4A 3BFVA 2EB7A 4G6DA 2QWWA 3W90A 5JHGB 2O0HA 1W7PD 2L02A 5J4KA 4N3NA 5K8LA 2GILA 4NQWA 3QQ5A 1N5KA 2P0EA 4RKEA 2ZAOA 821PA 1KJYA 4EPTA 3U6KA 5IT9K 3REGA 1IBRA 3BP8A 3K53A 4E70A 2XASA 3CTAA 3QKRA 1R4AA 5FR2A 1CJKC 1NBMD 5GJCA 1FMLA 1WBBA 2YOGA 3ZD7A 3JTGA 4UUVA 1EESA 3L2OB 2FWRA 4YMWA 3VQTA 3Q7QA 3FPAA 3LBHA 5AUNB 2IS2A 1SXJE 1S7OA 1KI8A 2X19A 3TSWA 4C0SA 3QPWA 3A6PC 1G8FA 3DXJF 5F64A 621PA 4DBLC 4TV7A 4FMDB 3B1YA 1SXJD 1KTVA 4JBXA 3B1VA 4WK8F 2GEUA 3BB3A 5D3QA 3GJ0A 1KSJA 3HYIA 2DPDA 1U98A 3SFVA 2VQSA 1BS1A 2Z4RA 3PUZA 1NY5A 4LJ4A 5JWOA 2C2HA 1HW1A 1GDDA 1LB2A 1P61B 4YLGA 4BAYA 3GFOA 5FPKA 4B76A 2XB2A 1PDNC 1WBDA 2ZI6A 1H9GA 4UXHA 2GZAA 3TSZA 4A8JB 5KPJA 5FD5A 4PR0A 4HLYA 2DFTA 3FMRA 2GA1A 1CBUA 3J80K 1GL9B 3CR8A 2EFHB 4FIDA 4OIPF 2JRTA 3AGPA 3HU3A 3KZZA 1VG8A 2EVWX 4DCTA 2FOKA 1H8EA 2QQAA 1UKZA 5FUXA 1VIAA 3A4MA 1FSEA 4NYIR 3WODF 1YR7A 3KE2A 4HX4A 2JATA 2OM2A 3LRPA 1NLZA 2ZEJA 2D74A 4A9AA 4WIAA 4D4LA 3NDBB 4JLMA 4LRTA 5TDHA 3UG7A 2EJRA 1GM5A 1LQ1A 1NJGA 1CR0A 1FOKA 4DDUA 4N1AA 2DU9A 421PA 2ZXJA 3GJ5A 1IZ1A 1N6NA 5B2ZA 3IKVA 2HDCA 3EZ7A 2HT1A 1IXZA 1OKRA 4OHVA 2GHIA 4DLUA 4P33A 5FOXA 1EV7A 1U9IC 3CO6C 2IBMA 2BIFA 1YW9A 3GLGB 2UXNA 1ZNZA 1UKYA 2EYUA 5E1WA 4M9QA 1WSUA 5EXTA 1W7PA 1XNJA 3PR1A 2ODEA 2XX3A 2W6JD 2ZBKA 4ZDKA 3KKMA 3LXRA 2EU8A 3E5XA 2XJ9A 1A82A 3CW2A 3W5IA 4JQFA 1OHHD 5H70A 4LOAA 2GRJA 3EYIA 1II8A 5AJWA 3BH6A 3SDZA 3ZMUA 3MG9A 2PJRA 1KDOA 5CLSA 4WX9A 2OAQ1 1J70A 2FF4A 2ACJA 1OT3A 4JIMA 4ZIRA 1NN1A 1QHHA 2BKEA 5BYJA 4R71A 3DF8A 4XIGS 2C8VA 1BI0A 2WWWA 3IRRA 1AQUA 2F3TA 4PO1A 2KB0A 4A3VB 3HYTA 4Q1BA 2K4BA 5DO9A 1N6IA 1NKSA 4G1UC 4OHZA 1B4AA 1ZBDA 2PZFA 2D06A 1I1SA 2Y75A 3R0AA 1YRBA 5L3RA 1TQDA 4DLSA 3E3VA 3NHBA 1CIPA 1S1CA 1CULC 2ZSFA 1RIOH 5C46F 1Z7UA 1MABB 3J81K 2PX0A 5A2QK 4OK5A 4WOPA 4UVAA 5JI6A 1S6LA 2LKPA 4TN1A 4OHYA 1G21E 2WKQA 4MKIA 2V1DA 1JQJC 3E5HA 3C14C 4TLEA 4ESFA 4K46A 1ZLKA 1ESNA 2HKXA 4MNUA 2ZTSA 3TLXA 3VR3A 4QHSA 3PQKA 1JNYA 5ERIA 3WHKA 2VP6A 4KI0A 2ERXA 4MYTA 3LFKA 2QQBA 3ZGXA 4GOKA 3B1XA 2JLWA 3U4QB 3GW2A 2Y48A 2WM9B 5J47A 1HE1C 2LWIA 2Z6VA 4RD6A 2IW3A 3I32A 3B02A 1F5NA 2DK5A 1B59A 5AIPA 3LQQA 1E2PA 3NC0C 1YZTA 3UKDA 4LZZA 1B6AA 1CKEA 3O8DA 1UB9A 1FYLA 1KO1A 1T91A 2IYLD 1TX4B 2QGNA 1YQTA 2J3EA 4D4JA 2IXEA 2NZJA 2CE7A 1G5RA 3H1TA 1U3EM 4DJTA 1HSTA 3ETLA 4QFMA 4CW7A 1ZD1A 2V54A 3PITA 3I61A 1N5IA 1O3YA 4AD8A 1GKIA 2REXB 1EH7A 2R6AA 4DCNA 4FINA 3ADDA 3BH7A 2G0TA 3CH5A 1M34E 4GPTA 4HUQA 4DDVA 1WRJA 5JS8A 1EFCA 2GXUA 2BMDA 2IYQA 4PC3A 2F1IA 3TBKA 5FBRB 1X3SA 4B34A 2OFOA 1SD5A 5EXSA 3V7CA 1L4YA 1XTIA 3GJ4A 3LLMA 3E6MA 1Z29A 4B44A 4P55A 1ZRCA 2EQBA 4MKGA 5GJVC 5JJLA 1MDMB 1FC3A 2MLGA 1VTNC 2REOA 3S1AA 4WXDA 1Y0UA 2EFQA 2JDIA 2FBIA 4L16A 1E9BA 1W2GA 4GNKA 1IF1A 2D1HA 3QG1A 1E9EA 3TH5A 1R7RA 1LDDA 1IN5A 1RI7A 2V6JA 4NCHA 4F93B 2MMGA 3M0EA 1H65A 4GP7A 4URYR 1VG0B 1GOTA 4HB0A 3OFNA 3CBQA 4IVPA 5SZHB 3Q9SA 2HWVA 3SQWA 2HYFA 3LA6A 4EDHA 2ZUBA 3M8FA 2NPIA 4I7HA 3L9FA 3DQVC 3LAJA 1OYYA 2J5OA 3T06B 2O3FA 1RIFA 3QE0A 5K8UA 2R7FA 2DFLA 2W6JA 5GJWC 5TV2A 3ZIAA 2EWNA 4ZV4A 1OR7A 2OO7A 4JVNA 2GZWA 2D4HA 3F22A 2JJ8A 2ZVPX 1HT1E 1PP7U 4GI7A 1XB2A 1NMZA 2PL3A 2RGDA 4O25A 5FPSA 2PFBA 1XMKA 3VR4A 4BFSA 2F2EA 3ISPA 5JLJA 3PXGA 4V03A 3LDAA 1IXSB 3QPVA 2NO1A 5SZKB 4CEJB 2GCPA 3BC1A 1ZYRF 2FH5B 5AWFC 2GCNA 4GYIA 3JAMK 1ZRHA 3KEOA 2G83A 4Q03A 1ZM2A 2QSZA 1ANKA 4LLNA 4OQLA 3KQHA 3BB4A 2PLFA 3Q3JB 4LGMA 2J0UB 3SZPA 3RS4A 5L3DA 3T12A 3VU9B 5HR5A 2XSZA 2LF7A 2FMLA 5EQTA 4V0MA 2R62A 3AB3A 4UV8A 2AWOA 2AFIE 5JBQA 3E6DA 3FMIA 3SR0A 2P65A 4UKDA 3MWJA 1N6HA 3AUYA 4JLBA 3DKPA 4NBSA 2DWOA 5EZ6B 4DXAA 5CJ9A 1E6CA 2D7CA 4I81A 4QJ4A 3FHCB 5HTKA 4TYYA 4FWHA 4OHXA 3ULQB 1QF9A 5E20A 3OESA 3H86A 1V4RA 2ZANA 2ISYA 4PSVA 1XGNA 3SBEA 3BWDD 1E94E 4LV8B 1QHHB 4ZKDA 1SQ5A 3LFUA 1GNQA 2BV3A 2ZRDA 3TE6A 1Z6YA 4R1HA 2QP9X 2BC9A 1AZTA 2RNJA 4YMSA 2O8FB 1RUNA 4XD7A 2QUZA 2OD5A 3BBPA 2HTSA 2ADUA 5FD6A 1LF5A 1NBMA 1NVVR 1ONBA 5H20A 3TRFA 2IYTA 2WJGA 3W8NA 4MGKR 3EW9A 4A36A 1Q22A 3BJAA 4NB5A 4O6JA 3KXKA 3ZLJA 1DAGA 2QZ4A 4AG5A 1QG2A 3T5GA 2CO5A 2EA4A 1UKEA 3NEUA 2ANBA 1D6JA 1OW3B 2FFBA 2ZITA 3CX6A 3RRNA 2WWHA 2WJVA 4DSOA 2N1BA 2E87A 3L09A 1X1RA 2GXSA 2FEOA 3PVSA 3MZYA 2HEIA 3CKLA 3ZYCA 2CL6X 1OSNA 1TUEA 2H09A 1QGPA 1O3QA 3HDTA 4RFSB 4WZBE 2P2LA 4MUAA 4QM7A 4QOSA 2A5GA 2R9VA 1TNTA 1KJZA 1MT0A 2NQ2C 4WZ6A 5DV5A 1U0HC 1EFRA 3FM3A 1E1QA 4BFUA 3K1JA 4D0LB 4PGGA 2YWFA 3GEIA 3M9AA 4FMBB 2JLSA 4CVNA 1NMXA 3UWOA 1R22A 1P4SA 3KKNA 4NKRA 2VN2A 1KO4A 2WKRA 1YZLA 3GUDA 5IK2A 4B09A 5BS6A 3HTUA 2GJKA 3A8TA 3A1WA 3I73A 4JZKA 4Z54A 4LGWA 3R6SA 1MZBA 3OV8A 1ZCAA 1S2MA 4JL8A 3L8YA 3SXYA 4ENNA 5DYGA 3JZMA 2GF9A 5HDGA 3U7EB 2XGJA 2XTZA 1SMYF 4N9IA 5CJ2A 1AA9A 3AVTA 3E5UA 4NHJA 3F21A 2BE5F 4L5JA 1BKDR 2AD5A 3NTUA 3PEWA 4HZFA 4DLVA 1BMFD 3IKJA 3ZDQA 2YX7A 3MFKA 2VSFA 4I1VA 4Y15A 2VC1A 2IA2A 3L0SA 2DZOB 2XSZD 4NYMQ 4L0YB 1XD2B 2ATVA 1WRBA 1YZNA 4EPRA 1KAGA 1RJ9B 4RAZA 5EE3A 1OF1A 2JJ2A 4Q9HA 2CSOA 2OEPA 2FU5C 4PDKA 4P96A 4BNCA 4U0VA 2CBZA 2JT1A 2GCOA 3BK7A 1MDMA 4ABYA 5KDDA 2W58A 1O3TA 5SZIA 1P2SA 5IT3A 2Z3YA 3KQNA 1GRNA 2QZ8A 3MWKA 3VTKA 1FBSA 1VECA 4GO1A 4G9YA 1G3MA 2OZUA 3KUDA 4UNQA 1U8RA 4LV5B 1SMTA 3KJHA 2K02A 3WU0A 1NN5A 4C0HA 1KGSA 2JLVA 4RZ2A 5CITA 4AKGA 2P5KA 3VAAA 1EX6A
chains in the Genus database with same CATH superfamily
4JR1A 3A0UA 1T6NA 1RKTA 3AUKA 2FSSA 4LY6A 5B64A 4NMHA 1KY5A 2XB8A 4I4TF 2ILVA 4J1SA 2I03A 1WJ7A 4XRFA 1S8AA 5BQ3A 1NHGC 3B6KA 4KYTA 3D5TA 5EGOA 1TNSA 2VS1A 3R6TA 2A5FA 4XR4A 1GUAA 1R0CA 4GW3A 3UYKA 3GQVA 5BUSA 1GZSA 4GOOD 3RK4A 4TZ0A 1P7VA 4CEHB 3H11A 2WYUA 1CT9A 4MI1A 3KZXA 3HACA 4L9WA 3Q4GA 4ETNA 4WBXC 2BBYA 5FJ8J 2ZATA 2PFKA 2FYTA 1IOLA 2GAJA 4EVRA 1KU3A 2X5KO 1IY0A 1MD9A 4OK6A 1G7RA 4JQCA 2L9SA 1GPYA 2VWPA 2ZIVB 3UATA 2B4QA 2OFWA 3UMCA 1P5RA 3ILHA 4KLZA 3W5BA 1MGOA 3J81S 1QHSA 4JLVA 2MYSA 3UPTA 1QO7A 4AX8A 1ADGA 3BSSA 2Z2SB 5CUQA 2VPPA 4HDQB 1A3CA 1NVWQ 5F2KA 3TQFA 1UBFA 2HHLA 3FIUA 4TUYB 3T3DA 1ZGWA 1FF9A 4H3VA 5BN1A 2GN1A 4MEBA 3ZU2A 1XFAA 2NV2B 1IV8A 4B82A 2CCKA 3LW8A 4C4SA 1VMKA 3AVWA 4CCLA 5G53C 4KIGA 2KQUA 5LZ4A 4ZI7B 2Y27A 4ESVA 4XORA 1OGJA 1FX1A 4B48A 1UFZA 4HFNA 3PRKE 4MVWA 4BVFA 3SQLA 4M0CA 1W34A 3F8WA 1JFFB 2EKKA 2NVTJ 3FM9A 2QYOA 5CXQA 3KWFA 3WBBA 4DNXA 4HGNA 4F7DA 3GPCA 1RMQA 4YRPA 4IQJA 3Q9UA 3G2PA 3RAGA 4AN0A 1ZK3A 3TNDA 4EA6A 4CMHA 5EXPA 2VC2B 4TZ6A 3VUEA 1WSDA 4CR7A 1J0BA 1EGMB 3FMSA 3L6RA 1OI7A 5F9HA 4U2KA 3WLQA 2CXTA 4JNCA 4ZOLB 2Z6UA 2WBLC 2NQ8A 5LN1A 3L4KA 3DEWA 4Q9JA 2J0UA 4JL6A 1DJQA 1I0LA 3P9IA 3BG7A 1P6RA 2MTBA 2Y1GA 1FX0A 5IYCJ 1N57A 4D46A 1G8SA 5BMVA 4D0NA 5B4VA 4X8MA 1ZN7A 1SZCA 2P6UA 3UOAB 2NADA 3KJEA 2X8JB 1VIMA 2NS8A 1PUEE 1D04A 2XSJC 3AKYA 4P1WA 3ANTA 1D7OA 5AH0A 2XAGA 4TV9B 3EETA 2INGX 1ACLA 2G7MC 4Z6KA 2WPDD 4OK3A 4FYIA 2FR1A 2X6RA 2DT5A 5HNHA 2OAZA 4QUKA 4Q01A 4HQLA 2IEIA 1B14A 2G0NA 1OAOC 3PEFA 1RWBA 1U2WA 4ARIA 2VIXA 4UZSA 3JAMZ 2E5FA 2EYQA 4FW9A 2FXVA 1JTVA 4Q7LA 2WHXA 3PJDA 1NBIA 5LFAA 1HDZA 5LU8A 2ZRLA 2FN8A 1GRCA 4HDAA 3BLYA 2MH9A 5ICEA 4GCVA 4RCVA 5DT9A 1F4LA 2C61A 4EGSA 1H9CA 1SIOA 1FJGB 3RS0A 1KYYA 5BW4A 4BL5A 1S2IA 3HRHA 3BMCA 5BSWA 4NNJA 3BWMA 4BRSA 4XQEA 2VDLB 3O91A 1BCSB 4Y6GB 2R7KA 3R7DA 1QFXA 1FSHA 4N0QA 5KMGB 4IJWA 4FFMA 3K9LA 3WQRA 2MSEB 4OATA 4X9XA 2BTQA 3OJOA 3ZV4A 2QX9A 2QN6A 3LAPA 3SMVA 3CPSA 4RYLA 1ZLJA 2D1YA 1U3UA 3UFBA 5FI3A 3JQFC 3ZWAA 3K6SA 2CKDA 1TCBA 2J08A 5C4IA 3CRMA 1CUIA 2AS0A 5SY4A 4HD8A 2SNIE 4LS3A 1SANA 1SEUA 4KOEC 5FKJA 4EG1A 3GLSA 4M9CA 2YVLA 3KT8A 3EXAA 1DV2A 4Q82A 3O8QB 3KOZA 3U4QA 3UJ3X 1PR3A 1GRRA 4L75A 3V48A 5F77A 1E79D 3VYTB 4UVCA 1NZFA 5HJ7A 4CL8A 4FQ8A 4BNKA 2CDNA 1KU6A 4P84A 3W2WA 4LRYA 5G3ZA 2WHQA 1JECA 1RYNA 2O3SA 2HK6A 4AS3A 4WNIA 5K3EA 2AS5F 1G7SA 5EZYB 5IFLA 1AMOA 5L7WA 1ZEJA 4CE6A 2BFDA 5J58A 1V71A 4CTOA 3KR9A 3JW4A 4YCLA 3GO5A 3JWIA 2I0FA 2BMEA 2YR0A 2QS9A 1ZA2A 2IQ5A 3KS4A 1NNSA 1EM6A 1ZGGA 2G67A 1GADO 5C8YA 2GPJA 2RVCA 5JY1A 4M7WA 2C77A 1SHKA 4CN8A 3DTVB 2XBUA 3M9WA 2M34A 4GMGA 4WFIA 3LHSA 4FFOA 3F0TA 3GEPA 2XVAA 3K0AB 1K6MA 1TZCA 1LQTA 3CCYA 4K2AA 2WNIA 1QU3A 2PTGA 1XQ9A 1YIAA 4JUDX 2FEKA 3RUAA 2OO9A 4MS3B 2YHUA 4LYHA 4OFZA 5IZCA 3FYSA 1EJ0A 1VHTA 3EGCA 3W9YA 5DTJA 2WT8A 4UQLA 3C1TA 4F86A 2RE8A 3LC0A 3PX2A 1FP4A 1YBAA 2ZJRF 2NZYA 3TOBA 1P4HA 4UDOA 1X58A 2WAFA 2TS1A 1N2OA 4B0PA 1URPA 2ZR8A 3GCXA 4N0DA 3WYEA 3OBBA 1KARA 3TFOA 2DOFA 1UK7A 4Y9UA 1ZREA 4E13A 5K5RA 1U3WA 3PGJA 4ALMA 2VJCA 3FCAA 1GQFA 1S9DA 1P3JA 3ABQB 1NOKA 1XEWX 1U9IA 1RZRD 4DDTA 3HSSA 4P7FA 4J94A 4PJJA 5EE9A 1BWRA 1P73A 3ROPA 1N2CE 1TVEA 4UMDA 3FE3A 2EKBA 2JFNA 1E1MA 2XB4A 4HVCA 1IBMB 1KQ3A 3MT8A 2X3UA 1KSGA 4QXRA 4CV1A 1KEPA 4ZARA 2QMUA 1FUUA 2IF2A 4ND4A 3Q9NA 1YNOA 2K6BA 4N5NA 5CDUA 1OYIA 4GKBA 1DZIA 3I34X 1RZRA 3RVQA 1SJ9A 3VH3A 3FYDA 1VJRA 3BTOA 1L5KA 5M2QA 2OSVA 2AJDA 2VASA 3ZDYB 2W4QA 1HDCA 3TSOA 1LY1A 3RG2A 2QUJA 3KOYA 5JH7A 2GPTA 4OM8A 4B7XA 5LYJF 4ENUA 4ZJPA 4LDQA 3VKHA 4KQ1A 1WWKA 4JJIA 5HLIA 5FTLA 4KREA 2EBUA 2X5JO 4WCGA 2ZJBA 2WOJA 4IDBA 2MOKA 4JYPA 3TWMA 4UB8C 4ITRC 3QUQA 1PYDA 3DV9A 3MOGA 4V0KA 1XB2B 2IUTA 5ULLA 2PJRB 4UU8A 2NG1A 4NCKA 1EJ2A 3BTLA 3NYWA 2FY8A 2QKYA 3NC1C 2OZPA 4HAWA 3AERA 1G9TA 1T38A 1ZMXA 3K5IA 3K4MA 1QCYA 1RRMA 3BTCA 3EVBA 5DS9A 5JMWA 1D9ZA 1U7OA 5KKAA 4ILEA 3NG1A 2D1QA 1O58A 1QCCA 5EUQB 2OBMA 1K78A 1SZDA 3JU3A 3F8NA 3LSGA 4R4JA 2QQFA 3UJ9A 4U3JA 2A33A 5HS8A 4MS4A 3EG5A 1PR5A 3TZHA 2IXBA 3S44A 1FL9A 1U8AA 4EG6A 3OO0A 2L4EA 3FOZA 4L15A 2E3JA 1HM5A 1Z28A 4H1UA 3K0HA 3TGLA 2FW7A 4C4TA 2RGNA 5EZYA 1EUDA 4P35A 2ECFA 3K8ZA 1JSLA 3CUQA 5KYYB 1FWZA 1OPRA 1JAZA 1K5PA 1X7WB 1LEBA 4P9FA 1UZNA 1TAHA 1KFKB 2ORVA 4PHTA 4WRRA 4X64B 1EAMA 5LU9A 2QMOA 2ZYWX 1E61A 3WHBA 1J8QA 1C29B 2FOXA 4DW6A 2C9CA 4Y2JA 1QH9A 1JXOA 3H5TA 2AGVA 2I4LA 2EINH 2I29A 3K9OA 2YJ6A 4IHYA 2E7ZA 2XH8A 4OJMX 3LF1A 4B79A 1EUDB 3ZUGA 1OCTC 3OU6A 1XZBA 1YSCA 3IDFA 2V1CA 1GGFA 3WK6A 1MOSA 2O4CA 1ZAOA 2OFXA 1ADBA 2VOOA 2XF3A 3RJMA 4RF4A 4B3FX 4QATA 4CYCB 3O82A 3ROQA 4WLFA 3IR5A 1LK0A 3ADCA 1NQUA 3LQKA 4Y2PA 1YTYA 2PSEA 3P5JA 5DCUA 5A3JA 2WSBA 4XUCA 1F4PA 3UXHA 4RDHA 3ID6C 1II9A 4FI3F 5CB4A 2C2BA 2J5YA 1E4YA 5CLIA 4IGIA 3EB9A 1ZINA 1JBKA 3G9UA 3T3NA 4ZGGA 4M8IA 3ZLUA 4GPZA 4LK3A 2JKYA 2IOFK 4E88A 3I8XA 2RB5A 2QG6A 5JROA 3MJFA 1A9SA 3B5JA 4A03A 5A4KA 3FKJA 3PWKA 5E9WA 1NF9A 3CEJA 1IY1A 1JFVA 3GHYA 4AJLA 3ZC7B 4II3A 1ECLA 3PDUA 3B1ZA 1WHTB 3CGGA 5LHHA 2EBWA 3F6SA 3KAPA 1NKVA 2BGUA 4EJ6A 4X1IB 2X49A 3PNQA 2HBQA 3UM9A 3BQNB 2VIIA 1SC7A 3N1UA 1MENA 2Y4OA 4MB6A 2XMBA 4MPPA 1E59A 1NTCA 4M9RA 2J3IA 5JSUA 3GP1A 4J16A 1X94A 2ISCA 2F5QA 1EGVB 3ETHA 2E2HJ 4BKQA 2G4VA 1N5DA 3I5XA 3ZVMA 1LV8A 2PGAA 3ZXIA 4CFYA 1JSRA 2DY1A 1OCEA 5FA6A 1NHGA 1YDMA 4OXRA 1QA6A 2BY0A 4KE6A 1BW6A 3G0DA 4AWXB 1FK8A 1LK5A 1O4WA 3RPEA 1F6WA 1X7YB 2Z58A 3NHKA 2ZIWB 1FEXA 1BH2A 2JEZA 4U7TB 1ADJA 1HEYA 4N8EA 1BRTA 1AQYA 3ZHSA 4ZCQA 3FKEA 1FY2A 5CX1A 1ZISA 4H27A 1E92A 2UUCB 5DUIA 3VSEA 2V7EA 3T4UA 4R0VA 3RI4A 2OBXA 2PD3A 5LQRA 3ZCOA 1M0SA 3QUCA 4NE2A 4NFHA 4EVSA 3F7TA 1TWGJ 4R0MA 2AHRA 1JYEA 5CFZA 3HP4A 2EIJH 3RVKA 3MBKA 2EA2A 4IXAA 3L84A 3D1VA 2UZ1A 3AF0A 3BD9A 4EW6A 3QUTA 2GBFA 3K70B 3OETA 3FG9A 4IIVA 4M53A 2DXIA 2QE7D 4TMZA 1J06A 1RKWA 5REQB 1JU3A 2H11A 3JZAA 2FPXA 4MULA 3HEAA 4HWTA 2FVXA 3QVMA 1WNFA 3SICE 4ZVSA 4NSOB 1EHCA 3DVQX 2R86A 2VNSA 1W9MA 1XU7A 3RFFA 1XD7A 1W5BA 5A4FS 4JWKA 4D9MA 3U4IA 1TZMA 2JTVA 4DLTA 2JPBA 4D0RA 3SR3A 3TOAA 3B9PA 2W1OA 4QIHA 4BGUA 3E5NA 2Y0BA 3H8SA 3UJNA 4QTRA 5LP6F 5CYFA 4MCHA 2JVJA 1GFZA 1IXCA 4MAFA 4NDNE 1ULSA 1IUPA 3F6OA 1IDZA 1IJFA 2NPFA 1GXPA 2WWGA 3HL4A 1L1ZA 2HMAA 2RGNC 2JP7A 2PT7A 2AO9A 2EIHA 5F6FA 3H8VA 2PUBA 3U4DA 1JEEA 1GVNB 2DFKB 2GM5A 3KTDA 1A9XB 4XKWA 3DR5A 5EIFA 2HUPA 2V6IA 3KQKA 2OY0A 1SXJA 1PUIA 5I4IA 4UC0A 3ZW9A 5K5OA 4RA9A 2IYAA 3WE2A 4I6JA 1MNAA 3KL4A 1G98A 1YA4A 4YJDA 3IT3A 3OJ0A 1Y7LA 2WA1A 5DGTA 1NM5C 4GS5A 5CFOA 1BJZA 3IVAA 3PQCA 3AKCA 5TB5A 3UCXA 4GQAA 4GFDA 1UEJA 3HEMA 4W5TA 4A2PA 5AHRA 3EULA 2CDBA 2Q7XA 2Q1XA 3AIMA 2HQ1A 4Q21A 1K5GA 3BREA 1Q0HA 2WSSD 3V80A 4KQIA 3ROEA 3AY7A 5G1NA 3A03A 4QICA 1O7FA 2PMHA 4E3WA 1BXRB 4ZGWA 1OFIA 4ZVRA 2NM0A 3LOUA 4C4OA 4DM3A 4Q48A 1H6BA 3ZMZA 3HYRA 4DV4M 3T5MA 1P6QA 2B1JA 5K3FB 4X6LA 4MGZR 4Z4IA 1K66A 2O8DB 3PT9A 2J0QA 5TJHA 3QXCA 3AR6A 5JCJA 1OLTA 2VKHA 3H9EO 1O89A 1FLVA 3UVEA 5CA0A 2AT1A 2LWXA 2A1TS 1NNUA 4QTTB 3Q7SA 3DZJA 5JJ5A 2AEJA 3WC4A 3NM6B 2LPMA 2NXNA 2DTRA 3IHPA 3HJQA 1WY7A 5JCJD 4RDUA 4P3PA 4XR6A 2Z2ZA 3HKDB 3OA2A 4DFDA 3MXOA 1W96A 2WY2D 3WWYA 2WWFA 2H4XA 3UJ6A 4BV8A 1IQRA 4NF2A 3EX7C 3H97A 2NMVA 3O8CA 2PV7A 4N39A 4E30A 4F3NA 1DO8A 4FFBA 3CG4A 3LQYA 4BQOA 5HJ5A 1A9QA 3AR7A 2PGXA 3TL2A 4ZEXA 1HSZA 5L8RF 1X7YA 1W36B 1JDZA 4N6NA 3QWFA 3WQSB 1XHEA 2JCBA 3PZRA 1W85A 2JFPA 1J1ZA 2HSEA 3IPRA 2AIRA 2O7RA 1I4LD 1XRQA 4G0VA 4BX3A 2QWWA 1V11A 2FPGA 5JHGB 3MTEA 3CF4G 3HFSA 3CVXA 1OC4A 2POCA 1CJKC 1NBMD 3CZ6A 4NJEA 3WL8A 3B1VA 5D3QA 3BB3A 1BS1A 4TUYA 1C8VB 2C2HA 5LL6P 5JDCC 4I9FA 2IV2X 3PWSA 2GA1A 1QK4A 1S7GA 2FZVA 4HX4A 4IY1A 3R0IA 3F46A 5FBKA 3VZRA 3HOZJ 3NM5A 3L0ZA 1H3NA 3BEDA 3A3PA 2UUCM 2EYUA 3L1VA 1WSUA 4O4JF 3PR1A 2WF9A 2XJ9A 3W5IA 2V6GA 3EYIA 1RQXA 3CWCA 2OZVA 2KB0A 5FNVB 4XM3A 4IICA 3V34A 2WB4A 1TQDA 1XRSB 2HSJA 2Q5IA 1Z7UA 1E8NA 3I2KA 1A9OA 2R7QA 4QASA 3U13A 2FZ5A 2GD2A 3BFJA 1ESNA 5FWNA 2JCYA 1M33A 2IW3A 2QWXA 3LQQA 4N8DA 3QWHA 4DJTA 5CB4F 4DCNA 3GELA 1KXZA 3BH7A 5KYNA 3BIWA 3GT3A 2R1ZA 2IYEA 2AN4A 2PR2A 1GUZA 2GX6A 1Y33E 4URYR 3W2TA 1VKRA 4QELA 3T06B 2O3FA 1IUOA 4ZV4A 5E9QA 2W98A 2JJ8A 4O25A 1PP7U 3EJWA 1HX7A 5EXDA 2NO1A 3TXAA 5SZKB 4QOZC 4YMLA 1FRVA 2Q5JA 3IV7A 3BB4A 3B1KA 4IIBA 3ZD9A 1JDBB 5AOVA 1ZCZA 3NU1A 4IIEA 3LNTA 4C5BA 4BQFA 1RLUA 2ECOA 2RJOA 3STXA 4L76A 1IUKA 2WWTA 3SZUA 5AOBA 4C3OB 4PSVA 3SBEA 4PUSA 4FYMA 2ZRDA 5G0TA 3O2NA 3ORSA 4LW8A 1JG3A 2RCYA 4A36A 4HX5A 4O6JA 1DT3A 2BGNA 1DAGA 3IAS1 5C5IA 3RRNA 1L4MA 2FEOA 1B6SA 3CKLA 3UWDA 4BWFB 3Q3VA 1AUOA 5K01A 3EEOA 1QYXA 1XTPA 1UXOA 1BJRE 3E3NA 3R5TA 5I6DA 1VZ0A 1XK7A 1L7RA 3ESYA 2Y66A 3D8RA 1C3OA 4CCOA 3AVTA 4AJHA 1N1DA 1WHUA 1MAAA 5IVDA 5EWLA 3K4JA 4FEEA 5EE3A 4UAVA 4P96A 2CBZA 3DDOA 5IT3A 1DOHA 4DMLA 5MFZA 4FGSA 1TKCA 3KJHA 4KTTE 5IUJC 1RWXA 3M83A 5A7FA 4O4LA 1UJNA 1N3YA 2EPFA 3ZWXA 4FKMA 2JZ1A 3UJHA 1IPFA 3R24A 1HT3A 3PE3A 4E22A 3FMFA 1KS2A 3R41A 3LT5A 4H60A 4JUIA 1HDOA 4HHEA 3