2FNAA

Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
357
structure length
352
Chain Sequence
GMLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIMSGSEMGLLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSKCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel archaeal AAA+ ATPase SSO1545 from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Atp-binding protein
molecule keywords Conserved hypothetical protein
total genus 128
structure length 352
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01637 ATPase_2 ATPase domain predominantly from Archaea
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2fnaA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fnaA01
4KMUX 2J46A 2ZTSA 4GP6A 1ZG1A 2GZHA 1RPZA 4ZV4A 1LF0A 2J0QA 4CF7A 2JLRA 1NVMA 1FWZA 1W7PD 1J8MF 3A36A 4M1KA 4TMKA 1R8SA 5LHIA 1J75A 1BC8C 4Q00A 4ZYEA 2P3SA 2ZVPX 3KFWX 4Q9LA 4XWOA 2O8DA 5H6RA 1P2TA 2YYZA 3RS2A 3O8BA 1STZA 4GNKA 4B09A 1KAGA 3QPVA 3I5YA 4GFDA 3U4QA 3NC1C 3ML6A 1PDNC 3UMFA 4KXFB 4RB1A 3W6KB 2JRTA 1K7AA 521PA 2MA3A 2D3WA 2IWHA 3L0IB 4TLAA 3BJAA 4HLCA 4L9WA 3I62A 2HYFA 3RJPA 2W00A 4TQ9A 4N0BA 1WB9A 3LXRA 3GFTA 3G0HA 3AF4A 4WXPA 5AUNB 2IUUA 2V1DA 2HGCA 1Z0AA 4ACBA 1HTWA 1KA8A 3E3VA 1OE0A 2WJJA 4EPYA 2QRNA 2KRFA 3BFKA 5BN5A 5JFGA 2ZMEB 4EQQA 5BWMA 1RRGA 4YC7A 4EM2A 1XPUA 1TQ4A 3Q5DA 4QM6A 4H9GA 1LEAA 3PEUA 3EZ6A 4XTRA 3BRWD 4XH9B 2FH5B 3B9PA 4OIRF 3LBIA 3TQFA 1JALA 1RRCA 2KIUA 3OF5A 3RYPA 2L4MA 2IYSA 3WYFA 2DWOA 5DGXA 4M73A 3FPAA 4AKEA 1MABA 4MGRA 1ZG5A 3GLXA 1QDEA 3QXHA 2QPTA 2V8OA 2C6YA 1TQPA 2VH5R 3Q7QA 4DCNA 1JXMA 1UADA 2EV5A 1WF3A 1LEBA 2QLZA 1ULYA 2BBYA 4JLNA 2M45A 3TQCA 1PVOA 2O8EB 1DUXC 4LJ6A 4WXCA 5SZHB 2JDID 3E97A 3K1PA 1RYFA 3CWZA 4IDNA 4PZLA 5ILVA 1OFUX 2R6GA 1SXJA 4WXDA 4KHZA 1YZTA 3W8RA 3ICEA 4XSZF 4X8HA 2ODWA 4M9ZA 4LJAA 3LQRA 1H9TA 1HYQA 1HEIA 4GXOA 2FV8A 1EX6A 3PIRA 3PUXA 4MRVA 2GRJA 1S9HA 2D74A 2ZSDA 4P3YA 3WMFA 4DLYA 4KSCA 3U3MA 2QM3A 1E0KA 5AJXA 2ZI3A 4L9JA 5HS8A 3AVUA 3NBXX 3GLIA 1GRQA 5L3DA 1GXQA 4QG7A 3FOZA 3LRPA 4G9YA 3V7SA 3PVSA 4DRZA 1KQ8A 1VTKA 2VP2A 3PQCA 1VCIA 3KDSE 5DI3B 1R0XA 4URZR 3L2OB 4URXR 2KI5A 4OINF 3ROUA 4HYEA 2CBZA 1WBDA 5FGMA 1MO6A 2DVWB 2L54A 4CZZA 4Z1MA 1EGAA 1OXXK 1ZU4A 5HOOA 2HFHA 3HTUA 1EH6A 2JJ1D 3CLVA 2QZ8A 4ZCMA 2O52A 3KZZA 4LB6B 3U4QB 4CT5A 4JLDA 1GDDA 2H09A 4DLSA 2QAJA 3BROA 4DC9A 4D25A 5FPHA 2MD5A 4HX7A 4Q4JB 2HKXA 1KI7A 1KKMA 1YRAA 2EVWX 4TV7A 1HXDA 3QKTA 1TADA 2LDUA 1CEEA 4MKFA 2O6GE 1UB9A 3TDUC 5JZVA 1YKSA 4GZMA 1G5RA 2QP3A 1BYUA 2ZREA 3R8FA 4GOKA 1W0JD 1WA5A 2WV9A 3SBDA 3T12A 3W6OA 3NQOA 4X8MA 2MLKA 1MT0A 3RS3A 5CITA 3I53A 3D0SA 1FSHA 2JLSA 5C18A 3L0SA 3QG5A 4BRUA 1GKYA 2CSOA 1LB2A 1TW3A 3GF2A 1YVDA 1ZD1A 2ANCA 2LKDA 4HDCA 2ZUCA 2LKPA 2FGJA 5E1WA 2ZYWX 3DKWA 1KK2A 4EMSA 3AKEA 5KDLA 4QGFA 1Q1HA 2SHKA 3E70C 4ZDWA 4OQFA 1T98A 1W47A 2VSOA 1IHUA 5JECA 4YMTA 3GLFE 3U9GA 2Y8EA 3VKGA 1SXJB 2E87A 1U9IC 3RI4A 3U7EB 2ZO4A 2PCLA 4ETSA 2PL3A 1RJ9A 3OEEA 4TLBA 2DTRA 2XSZD 3KP4A 3JSOA 2FEOA 1RIOH 1XEWY 1RZ3A 2M30A 5KU1A 2F2EA 1XFAA 1TNSA 3DMDA 2VHQA 4A2WA 2AN9A 1E2NA 1RRPA 4I02A 2NOAA 4Q7KA 1W2GA 1R22A 2ZRNA 4P55A 1S7AA 1EFHA 1G7RA 4KVGA 2BMFA 4R98A 3K1MA 3CH4B 4OJQA 3K0LA 3RKXA 1EK0A 3W6NA 1OHHD 1XSXA 5HPYB 1ZGAA 3KJGA 4ZO4A 2ZCWA 2CHQA 5ICGA 1VHLA 2Q21A 3D31A 2FSIA 4HUTA 4U0YA 2E1RA 2BEKA 1T8TA 2F3TA 3Q3JB 4DLTA 1B23P 3EETA 2RB4A 5H70A 3NC0C 4JBYA 1Y63A 3TSOA 1EWRA 3KQLA 2KJBA 3I4LA 1OPCA 2VL7A 4JKIA 3F3YA 1UDWA 1WWXA 4HAYA 2CVFA 1K8RA 1UCRA 3HOTA 4MYHA 4NYJQ 5C1BA 5K5QA 4PTLA 3THOA 1E2DA 5A2QZ 4FHTA 2O3FA 4IVNA 1MRSA 2C98A 2OAQ1 2ZJ8A 3I92A 1Q12A 2OCAA 2BCJQ 3CX8A 4GOXA 4US0R 2LF7A 1CXZA 2IF2A 3FFBA 2QPOA 4Q7MB 2ZBKA 3L00A 2ZM5A 2ESHA 3UG7A 3SQXA 1HT1E 2OHFA 1ZMXA 2IYXA 3CKLA 2YINC 4KCGA 1DBSA 3ISPA 2XUBA 4EJSA 3G73A 5LEJA 4JVLA 4MQVA 1X1RA 1W46A 1KI8A 2UZ3A 2AX4A 2GEUA 4EIWA 2VBZA 3OEHD 4Q21A 1AS0A 4HLUA 1UKEA 1NVVQ 2QP4A 5HDGA 3PCRB 5JWOA 1XTQA 4PXAA 3SJBA 1RYHA 3TR5A 2KB0A 1WXQA 4DCVA 5JLJA 4F91B 5JS8A 4LG0A 4I2OA 1P3JA 4JT2A 5FB2A 5HLGA 4DDUA 4TMTA 1NBME 1FPQA 3K0FB 3W34A 3CUQB 2B6HA 1AK2A 4ZYHA 3NBZC 1R6BX 2DZNB 3VR1A 3TGPA 4D80A 5JI6A 3MJRA 5C4MA 5L3BA 3QNUA 1GILA 3A8TA 4DLWA 1TTYA 2RGCA 1B6AA 2AXNA 4F4IA 2V9VA 1NI3A 1JPNA 1E1QD 2QUZA 1O57A 1SAXA 1IZ1A 3IIKA 3O8DA 4MGYR 4Z2YA 1GRNA 3EZ7A 4ON9A 5DHFA 5TRDA 1VCNA 3KL4A 3MG9A 3VQTA 4B3DA 4BLSA 1HT2E 4NB5A 2UKDA 3QU3A 4TQUS 4U02A 2JATA 1DAFA 1SVWA 3WP1B 1OB2A 2YV5A 5J4HA 4E03A 4I0AA 3J7AO 4IHQA 2E9SA 1ZU5A 3TVTA 4E22A 4LBWA 4YQFA 1E2KA 3DPUA 3O8RA 1Z0KA 3CIOA 5EUMA 5J4VA 2O8FB 3ZN0A 8OHMA 1SMYF 1Z7UA 2YJTD 5FOUA 2DT5A 3SFVA 3EASA 3TSZA 1H0MA 2QM7A 2K7LA 4KBGA 1NY6A 3DEUA 2OG2A 4ON0A 1R0YA 3ZZUA 2NNNA 3NBYC 1L2TA 2PX0A 3GLHA 2XRNA 3J81Z 2ATXA 4BRWA 4NCNA 4K81B 5JI3E 2IYYA 2NRAC 1CJMA 3HYRA 2ASEA 2OUKA 5GJCA 1KJYA 4EFMA 3P26A 4G0NA 1SD6A 2MSCB 4JL5A 4AIIA 4IRIA 5KTYA 1UF9A 4O6JA 4A0RA 1GHCA 5D5VB 2N46A 1YG2A 1WBBA 1S3SA 3U61B 2FOKA 1JR3A 3BP8A 1KDTA 3EC1A 3HRTA 2E1CA 3VX4A 3PENA 3ERED 2CFXA 5GVSA 3BB3A 3QVVA 2GZAA 3FKQA 4UNSA 4GP7A 5DYGA 4KT5C 4R79A 5C2JB 3SYKA 1O7FA 1DADA 2Z43A 3RNLA 2STWA 1UFQA 3E2IA 3FHCB 1U5TB 3QEJA 3HU1A 4RD4A 2ZI4A 5EXXA 4LHVA 4Q9HA 4ENMA 2Z33A 3GP8A 2D2EA 1N5KA 1BYIA 2O0HA 5C4GB 5BXQC 3PUVA 4H0EA 2IA5A 4C9BA 2QAGC 1ZYUA 3Q85A 5FD5A 2J87A 2NO9A 2P6NA 3WGGA 4D4LA 5JSZA 5IF9A 4Q7JB 1TUIA 2BHRA 1G291 2ZUDA 5E1ZB 1DAHA 2GZDA 5L3VA 2PJZA 4CXFA 2YX7A 3ZIAA 3WE3A 1CJVC 4R71A 2V3CC 1XMJA 4PSVA 2A7QA 2NO6A 2IS4A 3LA2A 2AR7A 2CO5A 4Q4AA 3GFIA 5IK2D 4URUR 2CLSA 4JLAA 2Z4RA 5GJBA 1SULA 1O7LA 4LRSA 1COWA 2B8WA 2WZQA 5AJVB 4I01A 1ANKA 4CICA 5J6XA 4IFBA 3CR8A 4Q1AA 4R7ZA 2GBLA 2EA4A 3OV8A 1G1MA 1W4BA 2FPMA 4QM7A 4ZI2A 2EWWA 3GLHB 2D62A 3C4JA 3TGNA 5E8GA 1IRFA 1TEXA 2HF8A 3GJ0A 4L9TA 3OHMA 1II8B 1N6RA 5CIQA 3TNFA 4ZDKA 2Y75A 3QP6A 4M6YA 3G5UA 1ZAKA 5TXGA 2BIFA 4HUQB 4LBZA 3VR4A 4A6PA 1VIAA 3LFKA 2XIGA 4BQAA 3ZVNA 1Z22A 4B3BA 1QPMA 1ZH5A 3ZQ6A 3C16C 4N0EA 3N97A 4Y17A 3QI2A 4HYYA 3THYA 1BS1A 1FYLA 2O61A 4TL9A 4XLPF 3IIMA 3B85A 3S1AB 2CW0F 1M1YE 3R8CA 4EAQA 1XD7A 1B59A 3FM3A 1KTVA 1FBSA 3N5CA 1PLJA 3B9QA 1E9CA 1KQ9A 1GXPA 4I98B 2XX3A 1DG1G 1YRBA 4L18B 4PC2A 3MD0A 4URWR 4F93B 2BYVE 4I0BA 4BZXA 3LAJA 3CTAA 2PT5A 2Z0MA 1KI2A 2VE8A 1G3QA 1BI1A 5LLQA 2EQBA 1G3SA 2GJAA 2MH2A 4BHCA 1U8ZA 4ESBA 1Z06A 4AIKA 4LV5B 3I71A 1U8AA 2KKOA 3RHFA 1EG7A 2GTPA 1ZYRF 3E6CC 1NN5A 3ZIAD 1H8EA 3AH8A 1Q21A 2ZETA 3E5HA 2DK5A 1OXSC 1GIAA 1W1WA 1AQUA 1E1RA 3LO5A 5FFMA 3EYIA 2B92A 3BY6A 2Q3HA 2AWOA 4TL8A 2OO7A 2RGEA 2G3YA 4M9XA 1B0UA 3F6VA 1ZRFA 2F43B 1Z8FA 1L7VC 2KBFA 3QPWA 4LYJA 3MUFA 4UHTA 2L3DA 1OXUA 4FN5A 5TARA 5LPNA 4ZKDA 4LDJA 2O03A 4WA7A 4NYMR 1ZGJA 1KO4A 5HLIA 1XJCA 2W83A 2XTMA 3H1TA 2G9WA 2VHUA 1SKYE 4PPFA 1HUQA 1KK3A 4KFRA 3TBKA 1E99A 4Q9IA 2RN7A 2PEXA 4KAXA 2D45A 2ZJYA 3LDAA 5ED4A 3KFVA 4JT4A 4OQMA 4TSFA 3GD7A 4HQMA 1VCMA 4DCSA 4QJ4A 3AVXA 3GUDA 2FFBA 1HKQA 3FFAA 1NLZA 1W4AA 2NO0A 5CM9C 1KYZA 3WNBA 3MWMA 4DCTA 4F4CA 1QHYA 3K09C 5D4SA 1S29A 3TO7A 1XJ0A 5EXPA 4D26A 4QOSA 1CP2A 1QBKC 2ZKZA 4JJKA 2PJRA 2FRHA 3P4XA 1G6OA 1Z2AA 3Q9SA 4PZJA 3QUSA 4GMDA 1T0HB 5FPSA 5KNBA 2IT0A 3ZD7A 4PSKA 2QQ9A 3GVAA 4MGKR 3QSYA 2ISZA 4RKFA 4KN7X 3T61A 1U5TC 3C5HA 5D8KB 3HSEA 2H94A 5L3CA 1E98A 1T9HA 1KYIA 2DWQA 3IHUA 3RKYA 4MKGA 2REOA 4DLZA 3K9TA 1XXHE 2RMKA 3ABTA 4I1OA 2MLGA 1IUYA 2C99A 3HOSA 2CMKA 4GGGA 4D0GA 4P5OA 5KUTA 5GJWC 4LYAA 1O3QA 2XV4S 2F9LA 5ICFA 5LDDC 4KBFA 1IXRC 1BIFA 2ZRCA 1FQJA 3WRYC 1W7AA 1FFHA 1R5GA 4OI0A 1XD2B 3PJRA 2C78A 5DISB 5KO2A 5KK1A 4Q66C 1IW7F 3WYGA 1IN7A 2W2XA 2DZOB 2GIVA 3KKOA 1OIVA 1X8JA 4JVMA 1IXSB 5CLLA 3KUCA 4IOKA 4V0MA 3FB4A 4KITB 3ZS9A 4TL6A 3GXOA 5CVUA 4FCTA 1Q44A 2XJ4A 4DWJA 4EFNA 5KPJA 2EV6A 1FLIA 1TAGA 2XJ9A 1CF7A 2XNDD 3L8YA 4MH0R 1TU3A 1SGWA 2DAOA 1XCVA 1GL7A 1E9FA 2GA2A 2GHIA 3IRQA 1YZKA 4HDQB 4CW7A 1TF5A 4HDUA 1ZVQA 3IBYA 3LAWA 2BM1A 3NG1A 4MUAA 5BOXA 3MMPA 2A61A 3WU1B 4YFNF 4KVAA 2RKOA 1CULC 4IW3B 4ZCLA 4EGZA 3K9NA 4FMCF 1T0JB 1HW5A 1KGDA 1LQ1A 4DEYA 2TDXA 3KTAA 5DDGA 4MHGA 5FTNA 2ZRLA 3FGNA 2MC3A 2ODNA 5KHOC 2F7SA 1DDNA 2RGDA 3JW4A 4P96A 4LFUA 1US8A 3BDDA 2CCJA 2ATVA 3QY0A 4E09A 4JK1X 4IHSA 1P4AA 1TNDA 2CK3D 2ZI7A 3BH0A 4I1SA 3GO5A 2PG4A 4LC1A 3UG6A 2ZANA 2FMLA 3AP1A 3AGPA 2NGRA 3W8NA 5F9HA 1UBGA 2JZYA 1Z6RA 2FU5C 3EZ9A 1EESA 1MDMB 4NCKA 3HYTA 3Q72A 4Z51A 3DDCA 4KFUA 2OXRA 4A2PA 1XGMA 2ELHA 3WXMA 2G0TA 4M21A 3AUYA 2W6JA 3RC3A 3HYIA 1MJBA 2AS5F 3IRRA 3A1TA 1OHHA 3A1UA 5HDNA 3WGIA 3RLFA 1FX0B 1F9NA 3CPEA 3AGQA 2DFNA 4BFSA 3ZMTA 1DS6A 5KNCA 3N2IA 3UPUA 3V4FA 3TDZC 4EGYA 4RD3A 1GSIA 3GFJA 1GVJA 3BJOA 2RH5A 4E70A 1S3JA 2GQQA 5B30A 5BW8A 3R9XA 4AWXB 4OIOF 2QBYA 5IT9K 3R0JA 2DYKA 3B7GA 4NYMQ 3AF2A 4PPQA 1S7OA 4CVNA 5C46F 1FSEA 3VR5A 5HCNA 1D2EA 1PZNA 4HLYA 5E3HA 2A5DA 3B78A 3OEED 1LTQA 2AD5A 3PG5A 4UXHA 3DOFA 2QNRA 5AK0A 4E5UA 5CB6A 2P5KA 3DOEA 5BN3A 2QG6A 4GL2A 5IDVA 2P67A 3WHLA 1JXSA 2HQRA 1VG0B 2EFCB 2RGGA 1R10A 2VOOA 4F4JA 2HYGD 3R61A 1KI1A 3FHZA 2CGPA 1G41A 3GFLA 1CJKC 2Q6TA 2XAUA 4JIMA 2GCOA 1YW7A 3BC1A 4FMDF 4MUBA 2HTSA 4PCQA 1U2WA 1OYYA 1G9XA 1RE0A 4XSHA 4H1VA 4AY2A 3FM5A 4GT1A 3RS4A 2GAAA 3DO6A 4EUNA 4FX4A 5JWHA 2VHCA 3QKSB 1XX6A 1RC8A 2A5JA 1UAAA 2FF4A 3B73A 3RAPR 4DSOA 1E0AA 4S05A 1GNRA 2DFIA 3D8BA 2IK8A 4A0ZA 3BFXA 1ONBA 1RI7A 2ZYTX 4A8JB 1SKYB 1NJFA 3C18A 4NU0A 3T1TA 1C1YA 1MOZA 2ZI5A 1A7JA 2ZJAA 5E4FA 3KUDA 4DT1B 1Z29A 1SVKA 4J0QA 1ESNA 2OBLA 3GQBA 1XRJA 2PQ8A 3PUYA 1ZJ6A 5HS7A 1UDXA 4RSGA 4W9MC 2PCJA 4OIPF 3N70A 1DEKA 3JTHA 1IXCA 4KIGA 4LV8B 1NF3A 4MA4A 5TB5A 4WWCA 5FUWA 3RRYA 5KSOA 2V7QA 2NZ8A 4JN6A 1E69A 3GZ6A 4G1UC 4JYCA 3LA6A 5F2EA 4IVPA 1CF7B 3DM9B 4Z1MD 2PT7A 3IPXA 2PLRA 4M1SA 4LJ8A 2DHRA 5FPTA 3A6PC 1LNWA 2BE5F 1C0WA 1B9NA 2DBBA 2ZIAA 3QF4B 4NHOA 1G4DA 4WBSA 1MH1A 1T5LA 3BFVA 4WXRA 2WVJA 4Z8YA 1IF1A 3MAAC 3DF8A 3RWOA 1W4RA 1Z0DA 4FWIB 4Q03A 2HJGA 2CWEA 4RGRA 4XD7D 4HQEA 2GCNA 1FMLA 2JCSA 3BH7A 3IO5A 3MCZA 2W0SA 1NNEA 1FOEB 2FEMA 2AXLA 1L4UA 1P2VA 3HRUA 1SXJD 1E0JA 2N42A 4QGAA 4DLRA 3J81k 1NSFA 3E6MA 4P9UA 3EDPA 1KU2A 1USSA 4P32A 2O0YA 1Z0FA 4IDQA 4PR0A 5D3QA 1HKSA 3T1VA 2IXGA 2IJLA 1RKBA 1H8ED 1EH7A 4KJZA 2AFHE 1E94E 2C5LA 2PEZA 221PA 2Q8KA 2PBRA 3RSOA 3U7GA 1W44A 3AB3A 3H2YA 1EH8A 2QENA 4K2EA 1U78A 3TUJC 2GWRA 1TPZA 3X1YA 4LJ4A 3CO6C 4B3XA 5J4KA 5DO9A 1AS3A 1XCPA 4RZUA 2H6CA 2L02A 2DPDA 4LG0B 1X3SA 5EE5B 5L3RA 2VP6A 1XB4A 5LHHA 1E2GA 1EXMA 3NHAA 4TWZA 2KWIA 1Z07A 2OLJA 4TMZA 2OM2A 1T3HA 1E3MA 4BLRA 3CB4A 2OBMA 4NBSA 4JYBA 3T8RA 4KODA 1X1SA 2BKUA 4WZAE 2IBMA 2WJVA 3BIFA 4QNRA 1Z05A 3ZMVA 3NHBA 1TQMA 4MGIR 2DW4A 3QVUA 2D1VA 3CX6A 2QBYB 2HDNB 3V00A 3DFGA 1G20E 4A5MA 3CPHA 1KO5A 2L01A 2BMJA 4QBHA 2PMDA 3VOEA 5E18F 2CHGA 1I4LD 3SS8A 3FDIA 4DVGA 1XXHB 1CRQA 3GEHA 3FMOB 1T0FA 4RB3C 1BC7C 1Z0IA 2A6HF 3MWLA 3EQLF 1FT9A 1ZRDA 3PUWA 5EP1A 2WSMA 4BE7B 5L3QA 2WV0A 1Z3IX 3V7CA 1HH4A 5ELXA 5K5RA 3QF7A 3X1WA 2HTJA 2MH9A 2D06A 1NY5A 4URYR 1M2OB 4GITA 4PANA 3AV0B 3OESA 3WMEA 4EQ6B 1NMZA 4XSXF 4L0ZB 1E9RA 4PO8A 3HTSB 5A0FA 1R4AA 2WAYA 3PITA 4US2R 2FX3A 4V0KA 4QHYA 4EPXA 2XXAA 3BK7A 2C96A 1MKYA 4IDOA 2QQBA 2ZRDA 1N6OA 3EPHA 3AAFA 3KJHA 1P2UA 1CR4A 3SEAA 2Z83A 1A2BA 1DTSA 4HZUB 1E32A 2WMNB 2RGNC 4BLQA 2GXSA 2QPAA 2KE5A 5DNYB 1XMAA 1XMIA 2YKGA 4UXIA 5CM8B 2HS5A 2R6FA 4LJYA 5AUQA 4Q1FA 2ZR0A 4XIGS 1NN3A 2OLKA 4PQFA 4PX9A 5E7JA 5J47A 4CO8A 5JHGB 1TF2A 5FBWB 2A5GA 2WWFA 2ORIA 3EC2A 3K9LA 1YJ5A 4QL3A 4RY2A 3W6JB 1EFRA 3B8HA 4BFVA 2W6IA 4CEHA 3JAMZ 1JXOA 4U88A 4HZFA 2FFAA 2ORWA 4MRRA 3P9IA 3SHFA 3VODA 4Q02A 2EFOA 3KP6A 3VKHA 4MYTA 2EFNA 1ESMA 1L8QA 2WWXA 2JLZA 2GXAA 3LW7A 1B4AA 1BMFA 1KNQA 1P9RA 3K9HA 2FF7A 1E9SA 4PC3A 3KP7A 3QXSA 2EA2A 3KLOA 1XNJA 4LOAA 1E9DA 2GA1A 5F1RA 2QRZA 2OZUA 2IS1A 1X37A 2H16A 3AKCA 3MZHA 3IPYA 1XTJA 2G77B 5SZKB 2G0NA 4MDEA 1BIBA 1KU3A 2V1XA 2VONA 1CLUA 2A30A 2GXUA 2JLXA 2LKCA 3I59A 1W49A 2J9RA 2PMUA 5CVRA 2HCBA 2H5EA 5JWRA 3W90A 1QHHA 3P7NA 1FZPB 1V43A 5HLHA 4D82A 4HAMA 1MKMA 2RDPA 1P4SA 2GDJA 2MSDB 3CF6R 3S1AA 3LFUA 4R9UC 5FPYA 5AR1A 3IGFA 1R23A 3B82A 2FNAA 4IF4A 2QMOA 4UV8A 1YW8A 5FOTA 3BORA 2J5OA 2XOKA 4Q5SF 4IJAA 4P0TA 3A37A 1K5DA 1XD8A 1G8YA 3K0EA 2OILA 4BHPA 5DEQA 2V6CA 1JPJA 4TTQA 1U0LA 2A78A 1DAIA 1N6HA 3I32A 3RRMA 4QJ5A 1L3LA 4Q01A 3FKSD 3TH5A 3RPUA 2CJWA 3MHVC 2AXPA 2QTHA 2ZRHA 3EAQA 4A0XA 4LJ5A 2P2LA 3HPRA 4YDSA 1R58A 3ZGXA 4AYXA 4HV5A 4DZZA 2COMA 4WZ6A 2ZRJA 1FP7A 2GCOB 4D4JA 3J80Z 4QBGB 2B7BA 4FWGA 4BECA 4OHXA 3B1ZA 3KJEA 2F5EA 1E2EA 2PMKA 2VO1A 2FMYA 4GI7A 1GOTA 3CWQA 4B2IA 4HDVA 3WG9A 1G16A 4QHTA 3P9CA 2JTVA 4K8OA 4LJZF 2GAUA 2QQEA 2ZR9A 5LGUA 3CRW1 3D3QA 3FYHA 4DCUA 3K0CA 5AJZA 4ASNA 1BI2A 1W0KA 1QHSA 4US1R 1ZUIA 2H1LA 2D4HA 3TIFA 2WWGA 3X1DA 4Z54A 3Q9VA 4RGSA 3WTUC 2WIBA 4AIJA 1U90A 1IN6A 4QBFA 1R1VA 3QU6A 2I4IA 3SDZA 2ZRMA 5DSZA 2WSSD 3DKVA 3GFOA 3E1SA 4U7BA 2M5WA 2X77A 4WW0A 3KKQA 1N25A 4S04A 4R2HA 3MSXA 1HY3A 4BGDA 3GEZA 1IN4A 5D4RA 1YFHA 2OAP1 2R9VA 5DHAA 1W36B 4BLOA 3A4MA 1UBCA 3GYHX 3VR2A 4UXNA 2J45A 621PA 2FU4A 4M22A 1BOAA 1QHGA 1AZSC 4MQBA 1UPTA 1VDZA 1Z6GA 2VPPA 4Y15A 3B02A 2CLDX 4BXUA 4QKQA 2JT1A 2QGNA 2O5VA 2Q3MA 3K2ZA 3AF0A 2CNWD 2ZU0C 4ABYA 4C0LA 2YOFA 5KDDA 4Q1EA 1E2XA 4MNUA 5E95A 3COAC 3L0OA 2MBFA 2XAHA 4CIDA 1X8LA 2VE9A 1ZM9A 3MAJA 2D2WA 4M71A 5LRRA 1P9NA 3AP2A 1M8PA 5CJPA 3EUHA 2CLCX 5HKKA 1XN7A 4G6DA 3HR7A 4M74A 2WICA 5FI1B 1ZC3A 1TBXA 2WWIA 4N1AA 2XTZA 2O8DB 5FL3A 4I4LA 1YLFA 3B1WA 3WTSC 4G5SA 1XDSA 3L82B 2ANBA 3L09A 4IDHA 2PJPA 2ZEJA 3EW9A 5E7IA 4RGXA 4D0NA 3ZS8A 2IA0A 3OAAA 1AS2A 1T6SA 1WKMA 3K1NA 3GLFB 2QTVB 2HYIC 4LCBA 3DEFA 4AVPA 2ESNA 4IXAA 1NKSA 4NP6A 4PO1A 1X86B 1UBEA 1U3EM 1ZP6A 4M72A 4WF2A 2CJWB 3RPQA 2PBIA 1ZM2A 4TL7A 4QFMA 3HSFA 5G41A 4Z8XA 2STTA 1H65A 5DYIA 4M4SA 3VHXA 5CB8A 1Z28A 3DHWC 3WBKA 2EJRA 3FXUA 2V6IA 3ETLA 4P4UA 4E07A 4C0AC 1M74A 4LHXA 3FMSA 2ZJZA 1NBMD 1JAHA 3ASZA 3LW8A 1DE0A 5FTKA 4II7A 5JJLA 3BOSA 1AZTA 2C9OA 1BI0A 1MJ9A 1GTVA 5IT9Z 1XD2A 4M1TA 3M8EA 5P21A 1BM9A 1OFTA 4KN4X 4EFLA 4QJ3A 3MQ0A 1E79A 2XAFA 2NTYC 2J0UB 2G7UA 4ARZB 3U60B 1FYMA 1P73A 3OAAD 1OH6A 5E17F 4IKEA 1GUAA 1QHNA 5CDFE 3T5GA 4UXJA 5M04A 3NEYA 3I3SR 4JZKA 5SZJA 4B43A 1LFDB 1W0JA 4EV0A 1KSJA 3EG5A 3OFNA 4AG5A 2F1JA 4NH0A 1FBUA 2YVUA 4RGUA 2R62A 3U1DA 2FSFA 1XGNA 3THXB 1IXZA 1BKDR 3ND8A 4EJTA 3Q9LA 5FI0B 5K8TA 3VFDA 4EJSB 4FCVA 4LPSA 1W7PB 2HOEA 1JEEA 2HT6A 3DKPA 2ZROA 4HZIA 2IEZA 1FQKA 2X2FA 4JMPA 4LHYA 4MKHA 4HLDA 1KK0A 4MRNA 4C4PA 5BMZA 4YMVA 3VU9B 3T8TA 2EWVA 3F5FA 4RD0A 4RFSB 3NTUA 3WNCA 4A8JC 1G8HA 2YWFA 1CKEA 2WJGA 4NPHA 1KMHA 4F38A 2HCJB 5AUPB 2O8EA 4OHZA 1R0WA 2QA5A 1R5HA 3GJ4A 1PUIA 2CQKA 5GADl 1QVRA 1F48A 2JJ1A 3H3ZA 5SZIA 4LB5A 1J70A 1F4KA 1N6IA 1P4WA 1J8YF 2GK6A 2EWNA 2E1NA 2EB7A 5FOVA 3KTAB 1MD0A 5KYKA 2NIPA 4JSYA 1S96A 2O0JA 1HE1C 2G1JA 2ZSAA 4G3XA 3NDBB 4IFEA 4C2TA 2G6BA 4P4SA 1SFEA 5CDFA 2BVNA 3OIYA 5EQTA 4N0DA 4DEXA 4IEIA 2ZXJA 3CUQA 2WSSA 1S8NA 4GZLA 4PAOA 3WE2A 3I64A 3NDPA 1YZNA 1AQYA 1I2DA 4W5WA 5BYKA 2KBEA 3TAHA 4ZDJA 2XZOA 1XEFA 1R2QA 2HT1A 1JB1A 1Z6YA 3LWNA 5H1YA 1IN5A 2GEVA 1DARA 4QXAA 2P6SA 5FUYA 2JJ2D 1ZC4A 4M1YA 4LUCA 5HCIA 3SZPA 1KI4A 5D3MA 4OHYA 3OIUA 1R1UA 2P65A 5F6FA 2UXXA 1FYKA 2Q9CA 3M8FA 3T35A 3VR6A 1ZNZA 5CYVA 3F3XA 5TV2A 2LWIA 2VSXA 3RC8A 4IRGA 1G3MA 3UKDA 4AWXA 2ZS8A 4M9SA 2I3BA 2YHSA 1E2IA 4FINA 3KX2A 2ERYA 3BS4A 5J40A 5LB4A 2ZJ5A 5DI9A 3AP3A 1JR3E 3P1JA 1N6NA 3WU0A 421PA 4M1WA 1Q20A 2GKSA 3THWB 1J90A 1YS7A 3TOBA 2V79A 1AKEA 4KIBA 1II9A 4PC6A 4Q7LA 1XCBA 1G19A 3MWYW 1KO8A 1II0A 2I1QA 3KKMA 3WTZA 3NBFA 3MCAA 4RD1A 1G8PA 2DPUA 3V9PA 1FOKA 1BO6A 1EFUA 3ONWA 3REFA 1GWNA 2CE7A 4NL4H 4DSTA 1KI6A 1HE8B 2ZRPA 2BCGY 4AG6A 2QWWA 1GVNB 2VN2A 2YWHA 3IEVA 3IHLA 3KP3A 3T0YA 4CHUA 1ON1A 4RZ3A 3ICQB 2QE7A 3I1FA 1KU7A 2REXB 2QROA 3TLXA 5KNDA 2IA2A 1P72A 4IRUB 4JKYA 1DP7P 1OF1A 1XZQA 1TQ2A 2WTUA 4OIQF 1I1SA 1NG1A 1NKTA 3QBTA 2O8FA 3RWMB 1E2QA 4Q9JA 4RFVA 4ARZA 1HSTA 2ZRIA 2P5TB 3P32A 2P7VB 1I2MA 4DSNA 5E8IA 5EJEA 4LLLA 1NRJB 1BMFD 5EEGA 1B9MA 2EYUA 3W5IA 1S1MA 3VKWA 2UVQA 3KKPA 4BEBA 4KO8A 4Q48A 3U3OA 3GLGA 1LDDA 1O3RA 1US8B 2AFIE 3SU8A 4C3ZA 2JGNA 2D1HA 1XU4A 2FZ4A 2GJKA 2R2AA 2R6CA 4MYCA 2JJ8A 1IY1A 4WK8F 1NMYA 3LV8A 4RB0A 1GITA 2J59A 2QEQA 3DPTA 2ZSEA 3FMRA 3SNHA 3X1ZA 4CDGA 1BH2A 1XGSA 2FSHA 1VKJA 3F8TA 3EARA 2J0VA 4MKIA 5TDHA 2DWZB 3CUQC 3EIQA 3BPXA 5CJ9A 4CGZA 4Q4LA 1D5VA 3MJHA 4UNQA 1ZAOA 2D7DA 4I1UA 3ZQJA 3HR8A 4I7HA 2G88A 2F5DA 5AUOB 4O5VA 4U0WA 2IYQA 3VEPA 2EFEB 3KP5A 2X19A 3K53A 1CJUC 5LD2B 2JIZA 3KFXA 3ZMDA 1UKZA 1ZD8A 2ZE6A 3IKTA 3L43A 3AVVA 4Q47A 1DAKA 3T15A 3U6KA 4TMXA 2FSGA 3BBPA 3I4PA 1YO5C 1XP8A 1YZUA 3A1VA 1KGSA 3T1QA 4G01B 5BPDA 1GZSA 1N6KA 2ZJBA 3THWA 1UFMA 4LHWA 3BH6A 4RZXA 4G8XA 4LC0A 4U0VA 1OT3A 3TOAA 2C9YA 2GVZC 2IUSA 2P5SA 5A5GA 3WBJA 2WM9B 3GJ8A 2BJVA 1PUJA 3JSPA 2EFGA 2F1HA 2XZLA 2Q2EA 3H3UA 1CJTC 2AWNA 4M0LA 2OFOA 3B1VA 4LMYA 5HVQC 2DPXA 2GJ8A 5JR3A 1ZM7A 5TJJA 2H17A 2YWGA 5TVKA 2OD5A 3BGWA 3WYAA 3GPLA 5D5UB 1DG3A 2F6RA 1SFXA 3F8BA 3PUZA 2JLYA 5LBQA 5CK4A 4A9AA 3A1SA 4DIEA 1G17A 2XTNA 5FOWA 5BPIA 3GJ5A 4R8HA 3X2SA 1G3TA 2WC2A 5E1XA 3EYYA 4GOJA 1B1BA 4I09A 2H6BA 1G7CA 5JEEA 2Z3YA 2P5LC 2JPBA 2GILA 2V54A 3VTKA 3IQWA 1SVIA 3IIJA 1ODFA 2O8BA 4LK2A 3FXRA 1DPUA 3NVAA 2P0EA 1IM2A 4HB0A 5G3YA 4DSUA 4DUGD 3TMKA 3ULQB 1LW7A 4CEIB 3PEVA 1HSJA 5DD8A 1NHAA 2JPCA 3KZ1E 1E2FA 1VMAA 1G8FA 1KSFX 3I8XA 3R7WB 3CDHA 4A15A 1TTTA 2F9MA 5EP2A 1MABB 1SD4A 3TE6A 5L3EA 3UMSA 4V0NA 5JRZA 2F43A 4MITA 5B58C 1OIXA 1OH5A 2IYTA 4JSTA 3TR0A 4HA8A 1R8QA 4B3CA 4B48A 3K1JA 2KRKA 3IWZA 1I4DD 1P75A 1HW2A 4YMWA 4FW9A 3BJIC 1SXJE 2Q3FA 2OQRA 1VG1A 1Z08A 1LJ9A 1A5TA 1HBXG 3FWEA 2O8XA 3O2PE 3QF4A 4OQNA 4Q4HB 5FBRB 4UUVA 5AIQA 2VXZA 1LNZA 1S8FA 2QGZA 3K9GA 3NKVA 4V0LA 3FXQA 2NNYA 1KOFA 1OLOA 5HR5A 2GAOA 1YZQA 3K70C 4LGWA 1ZG3A 2AK3A 1JJ7A 1JAIA 4Q5IA 5LBIA 2DBYA 5HZHA 2QORA 3HJNA 4EJOA 2H7VA 3LXXA 2XEXA 3EZ2A 1T8UA 4HB3A 4NKRA 2QY9A 3CRRA 3FMPB 4P4SB 5GVRA 3SYLA 5AJYA 3U2QA 2L4AA 1QHXA 2Z99A 2BDTA 4XTCS 3VMFA 3ADDA 5FD6A 4MTEA 5LGNA 1Z2CA 2A5FA 4BFXA 1UEJA 4ZIRA 2OCBA 2M1BA 2Z4SA 3L0PA 4TZ6A 2R6DA 4DLUA 3ZVRA 4CYDA 2IPQX 1TLHB 3DXJF 1IAWA 4B33A 1FBQA 3ZYCA 2X8AA 4YIIA 2VEDA 3GLIB 2FPLA 2DLLA 4PPGA 5G3ZA 4IXNA 3E6BA 1Z91A 4B75A 3EWAA 5DE3A 4AI6A 1NVUQ 3SJCA 1U0JA 2F5CA 4P9FA 2O8BB 3KB2A 5FBVB 4L9SA 4IHTA 3OFND 1DELA 4C0HA 3ZMSA 1CIPA 3V8KA 3QBVA 4OHWA 1JBKA 4EPWA 3QKRB 3KETA 1F2TA 4TLCA 4ESVA 2GJSA 1U5TA 4ENJA 2XAJA 1F60A 4Q1CA 4UVCA 4W7SA 4Q4AB 4QWQA 3O8CA 1VIYA 2QP9X 1II8A 4BYYA 4HSEA 4Y0AA 3F8MA 3M7GA 3REGA 4B3FX 1E79D 2WOOA 4LRTA 4MEXF 3U3JA 3OE7A 4L15A 4DLVA 3QXXA 5LD2C 2IYRA 3R7WA 1CRPA 4A0HA 5EZ5A 4BFUA 1O3YA 4G5RA 4W5JA 1EV7A 3L8ZA 5F3WB 1NBMA 1J2JA 1VPLA 3TVDA 1SHKA 4AIHA 4FI3C 4DDVA 4MRSA 4QBIA 1K79A 2HF9A 4MEYF 1RJ9B 5DV5A 3EPLA 3CONA 2B8TA 1KDOA 3P4YA 1KO1A 2AD1A 1R5NA 3CRVA 3D5LA 1F6BA 2F3RA 1N0UA 1GL9B 2FXAA 1KAOA 1KHTA 1ELOA 2J7KA 3LLUA 1U8RA 1M7GA 2A69F 5JJKA 2NPIA 4G7HF 2OCYC 2WKQA 1N0VC 2OESA 1RUOA 1IJFA 1XCGB 2J7PA 1TF7A 5FTMA 5D5WB 4POAA 4TYWA 3WHKA 2QU8A 1VCOA 1G3WA 3LH5A 3MFYA 1I5ZA 2DR3A 1YS6A 2P4WA 2W6JD 2WJYA 5DUKA 3ZPLA 3EA5A 4H1UA 4LPKA 3T06B 2J0SA 3BE4A 1Y3AA 4HF0A 4DB4A 3L9FA 3R6SA 3HIFA 1G5TA 4L4UA 4ESJA 3QG1A 2LSOA 3ZVMA 1ZARA 2QL6A 1V4RA 4YG2F 3C15C 4WZBE 5DH9A 3JVVA 3BWGA 1J0RA 2XB2A 2TMKA 3UMRA 2PEYA 2NQ2C 4C0JA 3IKVA 5CIWA 1KI3A 1U98A 4JBXA 1KJWA 2CK3A 4KIFA 2GEDA 5LB2A 4EJSC 2B7CA 3PR1A 2BBSA 1F1ZA 2ONKA 1CTQA 1BIAA 1F2TB 2WOJA 3RVBA 4A92A 1VHTA 2ZNZA 1ZUNB 3A1WA 5FOXA 4M2LA 4O0MA 2PX3A 3AVYA 1E9EA 1WRBA 5ICCA 1E4YA 4ESHA 1A82A 1TQIA 3IC7A 4NZYA 1NG9A 2R3SA 4BLPA 3A58B 2HLDA 1AM4D 1JR6A 4AYTA 4BEJA 2IW3A 3I54A 5HDKA 3OZXA 1AOYA 2Z9OA 3G3ZA 3F6OA 4HOBA 1CU1A 1D8TA 2BBWA 1CS4C 2IXFA 3UATA 3HSRA 2ZITA 1J5YA 2AK2A 2XNDA 3QKRA 4P33A 4HLUC 5HZKA 4RS8A 4DNCA 4B32A 1ZIOA 1G6NA 2REBA 2PMHA 3KXIA 2BEOA 4JLOA 4JVSB 1W36C 1GNQA 4KFTA 5EE0A 1MR3F 4Y13A 4DBLC 3LA3A 1PLKA 1XZPA 3TUIC 1IBRA 3M9AA 5D8LB 3W9YA 4KLNA 4DT1A 2O8CB 3E5UA 1N3BA 4AK9A 3U7HB 1VTNC 1IY0A 1E2JA 1IN8A 4D0PA 2ACJA 1OB5A 4B35A 2XKOA 2QN6A 1R0ZA 1AIPA 2EFDB 2J0UA 3UXMA 1DO2A 1OFIA 1UJ2A 4ASUD 4G7ZF 4YXWA 2OBNA 3IEUA 3FKSA 4A2UA 1T6NA 3F0TA 5BQTA 4FIDA 2QMEA 3W3AA 2NS0A 1J2XA 3VNUA 1A4RA 1IJEA 2ZI9A 4WOPA 5JRJA 2K4JA 3DQVC 3U3KA 3CZQA 1ZNWA 3DP7A 1RRFA 2OXCA 1JHHA 2PN6A 1HURA 3RDPA 1A2KC 2RGAA 3UWOA 3SC3A 3F21A 3GLHE 4IOJA 3SN6A 5EE9A 4B6FA 3F8CA 1V5WA 3KEQA 3FMFA 2R7FA 1XTRA 2HR3A 2K4BA 3JTGA 2YR2A 1P62B 4HX4A 2GWHA 4V0ME 4FWHA 2JLVA 4IOMA 1ZLJA 2X1VA 3QKSA 4QC2A 5KSZA 4KLZA 3Q5FA 1Z6XA 4X8OA 4OI2A 721PA 1R7JA 1I27A 3THYB 3VX3A 3PQJA 2A2ZA 5JHUA 1T3SA 2C2HA 2VA8A 2QTFA 3AVOA 4LX0A 2BGCA 2ERXA 4U7DA 3AQ4A 1I1GA 1FPMA 4KUMA 3QIAA 4BQSA 2N1BA 2P6RA 4WCGA 3CRQA 3Q5EA 4NONA 1G3RA 3I58A 3TO6A 3BPVA 1TQ6A 4A12A 1ZM4A 5DLQC 4RFSA 5JSZB 2W6ID 3BXZA 4TT3A 2J41A 2Q9AA 3CNNA 5FTJA 3N4MA 3CRMA 5L3SB 1VYUA 2MSEB 4JL6A 5J4YA 5IRCD 3WTTC 2FMXA 4B8XA 2MMGA 2YNMA 1VG8A 3JVUA 3T1OA 4C0BA 4G7OF 5DN6D 4C2UA 4LJ9A 1QBJA 3B1XA 4F92B 1R36A 4NE2A 2HQNA 1RNLA 1IAQA 3E5QA 3DL0A 5B64A 4XOIA 2WAXA 4TQAA 2ZRKA 3K70D 4HEJA 1YQAA 4BFYA 5CLSA 3H86A 1W5TA 3D7MA 1JQJC 3CH5A 3VB2A 3SE0A 4ZZLA 2GBLC 1SVLA 4EPRA 4ZI3A 3CNOA 3ECCA 1YR8A 3M6AA 1P92A 2QT1A 4URVR 5KPDA 4UNRA 2P8TA 1HQYE 1DAMA 1OXVA 5G40A 1Y0UA 4L16A 1KYWA 1ETUA 3HPQA 4BLTA 2P5VA 3HU3A 3I5UA 4B2LA 5JCPA 4KFCA 3SQNA 1LVAA 3KZYA 3WTVC 2EFQA 1Q57A 1NVWQ 5J5CA 1KZGB 1DAGA 4AKHA 3ABUA 2E7XA 3AUXA 3V8JA 4CEJB 1XWIA 3GX4X 3NRVA 1G6HA 2BEJA 2RHMA 4P31A 2QT0A 2H8KA 2QMUA 3HU2A 5K5OA 4BFTA 5CLQA 2AL7A 5D5XB 1DVRA 2A9KA 4QGHA 4B73A 2OAZA 1NLFA 3WRXC 2ODBA 5EP3A 4GBMA 3LA7A 1LVGA 2VBXA 1KNXA 2CCKA 5AONA 1JECA 4OI4A 3P20A 1COWD 1F2UA 121PA 2HEOA 1SVOA 3BZ6A 4C7OA 4CT4B 1Z83A 4XVRA 1O3SA 2W2TA 4HLQB 5H20A 5H68A 1YR9A 3ZZTA 5CYPA 2DFTA 4C0KA 1X6VA 4KICA 4D4MA 1G5PA 4WAUA 1QVAA 2RHDA 2DB3A 3AJIB 1RUNA 3TAUA 4O2RA 4JLPA 1ZNXA 1D8JA 4KYWA 5FBQB 5UKDA 3QPHA 4LLGF 1U2RA 1ZD9A 3GJXC 1N6LA 1CR1A 1RVDA 1R5BA 3F72A 2HUPA 2DQLA 2ZSBA 3KE2A 4RZ2A 4V0OA 5DN6A 3RYTC 5IT5A 1E2LA 4IDPA 1HQCA 3ZMZA 1KY3A 4RKEA 2PZGA 4FCWA 1E2HA 1N5IA 2JA1A 1NIJA 4PZZA 4TMWA 4PGGA 2WKPA 4UJ3A 3BAFA 1FY7A 4XD7A 5FH9A 5G53C 2YX4A 1GP2A 2KSQA 4O3MA 2H57A 3FF5A 1D9ZA 1LF5A 2ZAOA 4NYIQ 2FWRA 3RS0A 3S2WA 1Q0UA 3RRZA 5J8FA 4A4DA 1ZREA 1SVSA 1YYVA 4LLNA 2OFWA 1T2KA 2AHOA 4G5GA 1Z6AA 3BWDD 3U5ZB 4GSYA 4RD2A 1QG2A 3K0SA 3M4YA 3DPLC 4IOLA 2VRWA 2IHYA 1VYVA 4GYIA 4CEHB 1P61B 4HB4A 4L5BA 3V7RA 1OXTA 1JR3D 2YU3A 5EEHA 4NDZA 1KU9A 2QVOA 1UBFA 4LYHA 1W48A 3GEEA 4DDTA 2G83A 2QI9C 4Y0VA 5ERIA 3RDIA 5FR1A 1EWQA 1KIMA 2CHVA 3HHHA 1FX0A 2OEPA 2RGXA 2RQPA 4RVCA 2OBPA 5D3MB 1YHNA 2V7QD 2ZJOA 5FPKA 1NN1A 3C7KA 1S3GA 3ECOA 4JQFA 5JVTA 1KMHB 2ZRFA 4JBWA 1VYTA 5A4JA 4LYFA 3H0KA 3QKUA 1F3OA 4LY6A 4A5NA 4HF1A 3T5DA 1OYIA 4I99A 2IA1A 2RKHA 1E96A 3SBEA 2C8VA 2DU9A 5E20A 2YZ2A 3W6PA 1SD5A 1SHZA 1SKQA 1XMVA 3EXAA 2M8EA 1ZRHA 1T91A 1TX4B 2XGXA 2IYUA 4HATA 4AURA 1S9DA 3V4GA 4M8NE 3R9WA 4OL0A 3J80K 3CNLA 3V4RA 2OT3B 5CK5A 5FL7A 2VT3A 1UM8A 4OK3A 5KOYA 1FZQA 1QZXA 2QUFA 3O3KA 4B34A 3AVTA 4HI0E 4YXWD 5KDOA 1LS1A 4ASUA 2CG4A 1VG9B 2BWJA 2CVHA 4D4KA 1T39A 1ZBDA 3KB1A 3N2EA 4IRHA 1XDBA 3WODF 4MTDA 4DLXA 1SFUA 2XHKA 2ZQ5A 1P6RA 4UKDA 4L0YB 4A0YA 2E7WA 1WE2A 3ND9A 5JHHB 4DQ2A 4QNMA 3AVPA 2DK8A 4P4TA 5L8VA 3PV0A 1NJGA 3REOA 2XROA 1E1QA 1Z0JA 2I1VB 1SZPA 4TYQA 4XSGA 2VC1A 1ON2A 1YR7A 4HBLA 5CVJA 2UZKA 5E7MA 4GO1A 2XAGA 2VQSA 3CX7A 4IJMA 4L5IA 2IL1A 2A5YB 3LD9A 2ECKA 5JMTA 2MMCA 4AKGA 2WIAA 1DOAA 2V4ZA 1P4XA 1AGPA 2YOGA 4ESFA 1KMQA 3B5JA 4GPTA 3KQKA 1YIOA 3H4MA 4R2IA 3ELKA 2QSZA 2F1IA 3C14C 3CW2A 1H9GA 1WQ2A 5EE1A 4M6XA 1N0WA 2V1UA 1MGTA 2VF7A 4TTPA 5GJVC 5B2ZA 2O8CA 1ZN2A 4F7ZA 2VBWA 2QAGA 2KJCA 1G4AE 1M7HA 1E6CA 2HLDD 2WMOB 2JLUA 5FFZA 1XTIA 5HTKA 2ZYVX 5JEDA 1OV4A 3BB1A 5IHPA 1KQ0A 2IC5A 4A6EA 1KK1A 6PAXA 1U8YA 4PC7A 3SR0A 3GLGE 5A2QK 3KW6A 2ODEA 4LWZA 2ZXUA 4TYYA 3ZMUA 3RKWA 3FWYA 4WXHA 3U2RA 4EJVA 2FEZA 1P2SA 2IYVA 1Z5ZA 2HJVA 3TUZC 4DJTA 4LK0F 4ILEA 3H84A 5L3GA 2G1KA 2Q0OA 3CLOA 1Z47A 2H92A 2RGBA 4EKDA 1JHFA 3T1BA 2GF0A 3FTQA 3NIBA 3K69A 2BMEA 5AJWA 2NMVA 4FWDA 5BQ5A 2ZYUX 1WDTA 2C04A 1QZYA 2X4HA 1J9IA 1MO5A 2FN4A 3FMIA 4IVRA 2ZAMA 3GJ7A 3AF3A 5EZ6B 1EFTA 2QYOA 2WKRA 5TY0A 1IQPA 1XF9A 3GWZA 2QZ4A 3QRFF 1GFIA 5JBQA 5HE8A 4BH9A 1HV8A 2EU8A 2BBOA 2D2FA 5JI2E 1T5IA 4KSBA 5FR2A 3WY9A 4EDHA 2A3RA 2XGJA 1LS6A 4HAUA 1KSHA 5L3QB 1ZCBA 2J7PD 4RAZA 4PO9A 3LNCA 4C30A 4Q1DA 4WX9A 2IEYA 3AM1A 1F5TA 2W25A 2F1RA 2J5PA 1DO0A 2WHXA 3I8SA 4XWAA 1FP2A 2OU2A 3QPTA 3AF1A 3UIEA 1G64A 3RS5A 4G5QA 2PI0A 1TMKA 3RIRA 4PSAA 2VP0A 1P6XA 4NYIR 1SD7A 2LF8A 2A07F 3UK6A 3C8UA 3EX7C 1XDUA 2ZMEA 1ZM3A 2PZEA 2FBHA 1NVVR 3TQNA 3C7JA 1S0UA 1XB2A 3TW8B 4EM0B 1YE8A 1XBTA 4A3VB 4KA4A 1SVMA 2JAQA 3K8YA 4IEEA 2FOLA 1ZLKA 2GA8A 4HDOB 4AC9A 4BUJA 2ZRBA 1FW6A 1E9AA 2C03A 1XXHA 1QF9A 2CXXA 1PP8F 1NP6A 3HWSA 3TO9A 3NEUA 5DCMA 4BNCA 821PA 5ILUA 1MO4A 5FTLA 2OQGA 1ZIPA 3C5CA 2GCPA 1ZNYA 2DY1A 3IKJA 1N5LA 1Z63A 3PEWA 3X1XA 2M87A 4ZCIA 2NZJA 3F8NA 1GRRA 1F2UB 1JGSA 4JJZA 4XBFA 5F9FA 1JEDA 2ZR7A 3IILA 2OV2A 3UANA 3KQNA 3GLGB 1USTA 3DMNA 4NQWA 3CZPA 3CPJB 2RNJA 2GXGA 1EX7A 3MGCA 4OJKA 5J4LA 3SJAA 1IY2A 4UV9A 4EM1A 4JLMA 3ADBA 5F98A 4TLEA 1KKLA 2VP5A 1TW2A 4N9HA 2P6UA 4XLNF 1W2HA 3IQXA 4YIFA 4NCHA 4M1OA 1L0OC 2OCPA 1GL6A 4NCIA 4YFXF 4EJUA 1D9XA 5HKKD 3CUEF 4LZZA 3H92A 2OSBA 3K09A 1W4CA 4KV9A 3RRNA 1J59A 2FFHA 4FT8A 1JE8A 4TSFD 3LBNA 3CO7C 4AD8A 2C9CA 1FP1D 2VC0A 4XRFA 3MZYA 1BBYA 1LDKB 2CYYA 4R1HA 5CVIA 3SZTA 1ZINA 4B44A 2ADUA 2IWRA 1ZRCA 1NL3A 3QP5A 1C1KA 1G7TA 1D8KA 2QQAA 2W85A 2BMDA 4PAMA 2XVCA 1YW9A 3J81K 1QZMA 3TKLA 1GKIA 3C3WA 1FUKA 1UKYA 4QRHA 4ZYGA 1FNMA 1QO0D 2Q0HA 3R20A 3BD9A 1U99A 5DIFA 2JASA 1UHWA 4KMFA 3SFZA 2A3SA 5K8IA 3I5XA 2XASA 1RW4A 5CYOA 4PFSA 1YZLA 1OH7A 2JDIA 3JZMA 2ZFWA 2O0KA 4PC1A 1E1RD 3I72A 4MGZR 4FMDB 3TJZA 4EPTA 5K8UA 2CE2X 4OOIA 2VBCA 4QHSA 1OMIA 4PPNA 3HRMA 2P7CB 1PJRA 1ZCAA 2W2VA 3KLNA 4B47A 2A6EF 3RANA 1FMJA 3ZDQA 4YFKF 4BHBA 4Q19A 2IW5A 4ENKA 2Q9BA 4JLBA 3PFIA 2L0XA 4JVNA 5FUVA 3CJNA 4B6EA 1OFHA 3LSTA 1Q3TA 3ADKA 3CBQA 1GAJA 4UNOA 4DUGA 1KZ7B 4IVQA 1Q22A 4RB2C 4DKXA 3K0CC 4DXAA 4G5OA 1AWCA 1QGPA 4HUQA 4KFSA 1P9WA 3Q7PA 3KXLA 1E2PA 1G18A 4IPAA 3R9IA 4LGMA 2A68F 2G9NA 4N9IA 5J8CA 4A6XA 1T38A 1N5JA 1D5CA 3LBHA 2VBYA 1MV5A 4KI0A 4U5XA 4X8LA 2ORVA 1D6JA 3HUGA 3WTXC 1PP7U 3L7WA 3GLFA 3LWFA 1CBUA 2BJWA 1K5GA 3D6TB 4UNPA 4A0FA 3KCCA 4RJLA 3EA0A 1Z1DA 4XVUA 4UVBA 3ZZ0A 1WRJA 3QAHA 2P6TA 1LB1B 3MEXA 3E6DA 2GXQA 2ZE5A 4DB2A 2YC2C 2RGNA 3I61A 1W5SA 1K6MA 1Q1QA 4HV6A 2OFXA 3NEJA 4O2LA 4LI0A 4MDFA 2OZEA 2PFBA 2IYZA 5ICEA 1HKTA 1QNTA 2FNPA 1IRGA 1T3LA 2YOHA 4NTZA 4DIDA 4MQ9F 2BV6A 3CF0A 4BAYA 3U3RA 2FBKA 2C77A 3RSLA 3VLFB 3AEZA 3A4LA 4U00A 5IK2A 4AYWA 2EFPA 4BFZA 2IS2A 1OYWA 3WTYC 5L3SA 4FXPA 2AKAB 1MJAA 1W7PA 3LVQE 4B76A 3K70B 2QMHA 2FFQA 3R60A 4M9QA 1U94A 2KIFA 2R7DA 2RVCA 2EFWA 2NG1A 2IVMA 1QG4A 3CO5A 3LX8A 4C0QC 3U44A 4D2IA 3DM5A 3QENA 4ZDIA 2F55A 1Q1ZA 2HXYA 3FHTA 2YC4C 1AJEA 2V9PA 1V3FA 3WTWC 3LY5A 2DI3A 2VODA 1N2CE 1GG2A 1N6PA 3TW4A 2DCUA 1BI3A 3T5XA 5JS7A 4UVAA 1E4VA 1G21E 1JQLB 4NMMA 4QGGA 4A1FA 3KEOA 1CR2A 2K5UA 1LY1A 4ITRC 1RIFA 3EWSA 3AVWA 5AIPA 4B71A 1NSTA 1TL7C 3KP2A 3MRSA 4NCJA 2DFKB 4TT3D 3TRFA 1AKYA 4OMYA 3I0TA 1JNYA 2R65A 1TUEA 5H8WA 2B21A 4GDFA 2H18A 4F7WA 2Z5FA 1H8HD 4EVIA 1NVXQ 3EPKA 3SQWA 4TZ0A 2VP4A 3R0AA 2DFLA 2ZE7A 5DI3A 1LV7A 4HLXA 3THXA 1TNTA 3L2CA 1G7SA 2W57A 3MWJA 1FTSA 3KQUA 4GRAA 2BKEA 1XEXA 1XTSA 1UEIA 5D6FA 5DUIA 2V6ZM 2HXSA 1KY2A 3JZAA 4HAXA 1IONA 4JLJA 2X2EA 3RABA 1G3UA 1WQ1R 3TSWA 1VECA 3O47A 3VU9A 5IT3A 4OMZA 1RFLA 2D7CA 2IYLD 3SI7A 1AGRA 1BOFA 2FGKA 2QE7D 4JS0A 4B2PA 3QOFA 4TTRA 4ERNA 4GYGA 5EUQB 3ZJYA 4OKSA 3LQQA 4XVQA 3RS7A 4A6DA 4PDKA 3GFMA 3GEIA 3QOPA 2FQ3A 2K86A 1XMKA 3FMQA 1R5OA 2BV3A 3QQ5A 3ASYA 2ISYA 1TU4A 4CEJA 2XB4A 5FBLB 4I1VA 4RD6A 3ZP5A 3RYRA 1GKUB 1SQ5A 4YONB 3WMGA 3ZVLA 4D6PA 1PUEE 2WWWA 5EXSA 1U6GA 1D3YA 4LBVA 5FL7D 1QRAA 3P9KA 1XPOA 1OIWA 1PV4A 2FZLA 3HP1A 3NH6A 1KI9A 1QHHB 5FLXK 3CUOA 3JAMK 1FTNA 1XD9A 2IHBA 3QEOA 4I81A 3QXCA 5CJ2A 2IS6A 1G3YA 3SHWA 1ZHFA 2K27A 1C4OA 2CEAA 2WTEA 1NMXA 2IYWA 4DHEA 4EPVA 4LSGA 3PEYA 4AKIA 2VSFA 3CR7A 5CVVA 4EJWA 5ANRB 3T34A 4MRPA 2RV8A 4A0GA 3AKDA 1GM5A 4QLCU 4HAZA 3WP0A 2B0LA 1XJQA 3GFPA 2NPFA 5H6QA 4N3NA 4HX8A 2HWVA 3F23A 1DAEA 3LLMA 2ONJA 3B1YA 2W58A 3B60A 2JJ2A 3FE2A 3IDQA 2GJ9A 3R4KA 2IF0A 1EFCA 4ZYDA 5FOSA 4C0SA 3CF2A 1HW1A 2QM8A 5KVRA 3GJ6A 1LDJA 5DCMB 5L3FA 1G4UR 3GLIE 2BOVA 2CL7X 2R8RA 2WJHA 4ZPXA 1M7BA 3OOPA 2XXAB 1KJZA 3A4NA 3Q8XB 4D81A 1P2FA 4PQRA 2J3EA 3CM0A 2V55B 1U9IA 3HDTA 3OEHA 3M1EA 4JBAA 1OSNA 2VF8A 3E5XA 3NWJA 3B13B 3FZVA 2UZIR 2XITA 3BB4A 3SOPA 4LV6A 2ZNYA 2FG5A 2RAPA 3WNDA 1Z9CA 3EIEA 1GNPA 1KI6B 1NIPA 4TN1A 2WPDD 5BYJA 2Y48A 4AD9A 1MDMA 2XAQA 2GVDC 3IBGA 3VFZA 2IX3A 2HYDA 3ZH9B 1CR0A 1QHIA 4PHFA 3W3ZB 4PZYA 1OR7A 2LNBA 4RAYA 1YZGA 1FX7A 2V6JA 4L9NA 2ZS9A 3AKYA 3OIVA 3EZFA 5FLXZ 3F22A 2VHJA 2LCFA 3P27A 4ZKEA 4B74A 3UWKA 1M34E 1G8GA 4UQOA 3BOQA 2K02A 3RTRA 1RZ4A 1T4GA 1XCMA 1AN0A 4LRWA 1WCV1 4TLDA 4Q1BA 4TMVA 1O3TA 5HE9A 2J1LA 1XTKA 3AVQA 1WI9A 4HW0A 5FFXA 4CYMA 3VNVA 1YTYA 1S6LA 1ZUHA 4CRWB 2ZRGA 4OK6A 2W0MA 3F8FA 1UHMA 3QE0A 4FX0A 2BC9A 3U7FB 4XJXA 2YWEA 3W5JA 1SXJC 1I6XA 2OA4A 2ZU6A 2GXBA 1OKKA 3BJ6A 4YMSA 1NN0A 2ETHA 4PAQA 1XEWX 3IWFA 2VHTA 2WBLC 3M0EA 1JJVA 3DVLA 2H27A 4OI1A 4BZPA 3BERA 5LHGA 1XMSA 2XSZA 2Z5UA 2Z6VA 2HEIA 2HZTA 1R1TA 4Q18A 2BM0A 2IRFG 4EQ6A 3KQHA 2ZJ2A 4MYUA 3VHLB 3QJYA 5LGTA 4TYPA 1AA9A 4Q4ZF 3OE7D 2NYXA 2QQ0A 3M1IA 4GMXA 1W36D 2CL6X 3DZ8A 4ACAA 2Y0MA 4PGHA 1OKKD 1S1CA 3B2EA 1E0SA 4C7OB 2NO7A 2IUTA 3IUYA 4RCZA 1U0HC 2GESA 3SZRA 2ZI6A 1HA3A 3ZLJA 5EXTA 1WP9A 4OQXA 4S35A 1R7RA 2EK5A 4KYIB 1OH8A 2FSWA 2DWPA 3U44B 2HDCA 2UWMA 1J99A 3MWKA 4ENNA 4A2QA 1E2MA 5K8LA 4K46A 4ZZDA 1P7CA 3ZN1A 4ZH4F 1KDRA 1D2NA 2J5XA 2KIMA 3C1DA 1S4QA 2ZPTX 3LX5A 4G6QA 4A82A 3GW2A 1K78A 1W4MA 2CDNA 3GZ5A 4A36A 1XSVA 3ADCA 1S2MA 1ZW6A 1DPRA 5FO5A 4O25A 2OZ6A 2CNWA 3K0AB 4OU0A 4Q4HA 3NH9A 2X0LA 1L4YA 2VT2A 2WPDA 4KU4A 4Q4JA 3GCGA 2OE2A 5EP4A 4LK1F 1Q1BA 4GCVA 2JLQA 3IHWA 3KXKA 4HB2A 2VLIA 1TQDA 2ZE8A 4PHHA 4PHGA 4A8JA 4TYNA 2FDCA 2JSCA 3DZDA 3GJ3A 4CEIA 1BN5A 3LVRE 3ECHA 6Q21A 3HHGA 4JLVA 1XSDA 1KSGA 3VR3A 3V8LA 1DPFA 4JLKA 4OBEA 4UNNA 3ZQ7A 2JLWA 5LEKA 2RCNA 4FMBB 4IXMA 2UXNA 3FX3A 4KNYA 1X3UA 1G3IA 3I59B 4JL8A 2EW1A 1CGPA 2FBIA 4HAVA 1QQIA 4WIAA 5AWFC 3QXJA 1CF4A 4D0LB 3TKYA 2YPRA 1O87A 1XPRA 4FD2A 4PQYA 3IL2A 1MRNA 4RCYA 4YDHB 4G94A 5FUXA 3TK1A 4OHVA 1W0KD 1E17A 1YQTA 2WJIA 2ZS7A 4HAWA 2DQRA 3B6EA 4B3GA 5D6EA 1R00A 2W84A 1MZBA 1SMTA 1M6NA 2FA9A 3EIHA 1FC3A 4FMCB 1WSUA 3KJIA 4PHTA 4FWTA 2ZVQX 1A04A 2ZRAA 4M1MA 2NAZA 5KSYA 2BBTA 3U6BA 2FJUA 1YU9A 2HKOA 1FL9A 4LHZA 3ZD6A 4CZ2A 2IP2A 1OPXA 1Z6TA 2PZFA 2EYQA 3PXGA 4BASA 3LAPA 1PLLA 2R44A 3VAAA 4BFWA 3PQKA 2GZWA 3C41J 3GMTA 4NYJR 2G7HA 2FE4A 5DD4A 2FA5A 1TEVA 2WWHA 2WWYA 2FPKA 4DDWA 4S2EA 4HF2A 4YMUA 1FUUA 2GK7A 2NO1A 5DYMA 2XNSA 4ZIRB 1J7KA 2VTKA 3FHOA 4LJ7A 3KKNA 4XWKA 4BPBA 1D2MA 2C95A 4V02A 2XKPA 3O6BB 1KDPA 1E9BA 1YR6A 3OIWA 4WVFA 3MLEA 2AKYA 1F5NA 4W5HA 3SJZA 5JCZA 2XOKD 5TMPA 2VP9A 4LD5A 1Q1EA 2RC4A 1IOZA 1P5ZB 2PLFA 2EV0A 5B57C 1FNNA 5LRSA 3FVQA 1MO3A 1FP6A 2CCGA 1C9KA 2W24A 4L9VA 2PLYA 5EE3A 2VOPA 2EFHB 3SXYA 2IXEA 3QPUA 5KSPA 3WGHA 3G82C 5K1YA 2R6AA 2FE3A 3DV8A 1P60A 2VYFA 4OK5A 2GETA 1OW3B 4OYHA 4L5JA 1OJLA 1OKRA 2DO7A 2GNOA 2VIIA 3MFKA 4BWYA 5JFRA 2HV8A 4KYUA 4KDPA 2QSYA 2CL0X 4L8GA 5BN4A 3EPJA 1QZZA 1XGOA 1WMSA 1X8KA 5DCFA 4LBYA 1NLYA 2QAGB 3NXSA 5ILSA 1H8HA 1I4TD 1BJAA 1K6OA 2JIZD 3K0FA 2GF9A 4M53A 3SYNA 2YSRA 5JJIA 5F64A 4V03A 2ZUBA 2IT1A 2PH1A 1EFRD 4BZQA 3K0AA 4UJ5A 5HS9A 1XEXB 1ONVA 2ZSFA 2F5FA 1U81A 4YLGA 1KO7A 1UKVY 1JI0A 3IO3A 4OQLA 2RGVA 3I73A 1ODDA 4HZUA 1K78B 1Q3HA 4Q9KA 5BS6A 1A1VA 2JEOA 4NHJA 1REPC 2KJQA 2XZPA 3HRSA
chains in the Genus database with same CATH superfamily
1CUEA 1RXIA 2ME0A 4UM9B 3JCUC 3VKVA 1PUXA 3ZQ4A 5LDGA 2HJHA 2JFBA 3F2VA 3HFJA 3ABIA 4XPIA 2X0NA 3KPUA 3HWRA 3C1AA 1EP2B 4V1CI 5HBGA 5E0KB 1V3QE 1PTJC 3JR4A 3A31A 2ZBFA 1W88B 4QO8A 4XM3A 4KEAA 4CLOA 3V46A 4JOSA 2YMMA 2DCMA 2LBCA 1M0SA 1H3NA 3UC9A 4M7PA 4AMGA 2CWWA 1ZG5A 2DC1A 3QXHA 2WA0A 1YBMA 5F1PA 1CVLA 1HDGO 5ILVA 5TSDA 4C4SA 4KSCA 1K88A 2WFMA 2QM3A 2P9GA 2Y1FA 5HGJA 2AX3A 1GXQA 2XKKA 2EBHX 4URXR 3UNGC 1MO6A 2Y9ZA 3U5ZA 3E3OA 4ZCMA 4LB6B 3U4QB 5FPHA 4OREX 1Q1GA 2HKXA 4S24A 2ZM6M 1LX7A 1HQDA 3AX6A 3R8FA 2QTVA 1W0JD 3FI0A 1WA5A 4NBVA 2XDYA 1MT0A 4FASD 1L8XA 1GUDA 4KZPA 2FGJA 4DM4A 4C4TA 3AKEA 3O4IA 4EW1A 1T98A 1YC5A 3ZOKA 1THZA 2BCEA 1RIOH 3UT5B 1JTEA 4J0HA 4WLEA 3WKEA 1YACA 1YQXA 3BDVA 4KQIA 3CH4B 2ZUVA 4D3XA 3PRKE 1EXWA 2JHCA 1QYXA 4M0MA 3TPFA 5ES3A 3M5PA 3F71A 2KJBA 4GH9A 4MYDA 4BFWA 3KYDB 4F1JA 3DCIA 2A0UA 3OPYA 2KPOA 4EHAA 5IJ9B 4JVLA 3LSKA 1SG9A 3PXCX 5HDGA 1QQBA 5JYEA 2IUYA 1M66A 3SIXA 3LKVA 2QVCA 4ZYHA 3NBZC 2DZNB 5L3BA 2EG9A 3LMMA 2FP4B 5GONF 4YJ2B 3AM4A 1UXHA 1W25A 2IITA 5JANA 2Y0TA 1KFVA 3HJCA 2E9SA 2W2MA 3OYHA 3LG2A 4WZBB 1SOWA 2QZPA 2GHQA 2K7LA 3C43A 3KLBA 4L1KA 1E66A 3PDIA 1NXSA 2JZOA 3WIOA 3A1DA 3UAOA 5KTYA 3P26A 2ZWAA 1UF9A 4A0RA 2ADMA 5BV7A 2FOKA 3P9RA 3NZEA 3BB3A 2GZAA 1LPAB 4C6HA 4M0KA 3O4JA 3GRCA 4QJBA 3PPYA 5TRTA 3B52X 1E2UA 2YCBA 1DV0A 4LG3A 1NRWA 4E5DA 1JT0A 3B1JA 3HGQA 4CF6A 1TWCJ 2EJVA 3WAKA 2HNBA 1GPNA 5IYDJ 1KPHA 5B7NA 1GAWA 3IAFA 5CBPB 4YRJA 3S1RJ 2PTHA 4BY9E 1TEXA 1GEGA 4UUOA 4C4ZA 1VIAA 3P9PA 2ZWOA 1Z22A 4RM2A 4ZRMA 3THYA 2QUHA 3ZHOA 5CXQA 1GTG1 4XLPF 3IIMA 3B85A 1XD7A 4Z9YA 3SJMA 3CLSC 4I0BA 3MC1A 3CVYA 1UZAA 2MH2A 3ZD8A 1U8AA 1WXIA 3W5DA 1EG7A 1OGYA 3HA2A 3WGLA 1X38A 2YXBA 2NYVA 3E5NA 3VAAA 3QPWA 5F0FA 1N9ZA 4CFSA 3UKGA 4RXUA 2GLOA 1ZGJA 4YQYA 3SX0A 1WKBA 3NYIA 3EDOA 3LPAA 4D26A 2FRHA 1GTL1 1Z2AA 4GMDA 1PJCA 2QQ9A 2YJ5A 1U5TC 3DLLF 1C7YA 1V34A 1V7PC 1EJ2A 2ASVA 3ABTA 1DJNA 3NWEA 1XVUA 3EVFA 5DX0A 5CLGA 4MQLA 2QS9A 3I34X 4M8SA 1RZVA 5AXAA 3PZBA 1XUOA 4I7EA 1FLIA 2BGTA 1IZ9A 2XWPA 4MUAA 3TP0A 3MB8A 1T0JB 1K82A 3DCJA 1US8A 2EH3A 1YIJI 2XT0A 1VRCA 3GO5A 1ZHHA 3ORRA 1W5EA 1FCJA 1NOIA 1JG7A 2E6UX 4Z51A 1Q92A 4MV6A 1O0BA 3DZGA 4KQ1A 3WK9A 1MF7A 1OHHA 5HDNA 1TC1A 3WGIA 2DUJA 5G1OA 1YMQA 3H9GA 4L28A 4F3RA 3F49S 2A88A 3D7NA 5BWOA 1CUKA 4OIOF 5BSRA 2PZ8A 4GMHA 1Z36A 5AK0A 4JHLA 4UU7A 1Y3HA 3CW8X 2PT6A 4AUNA 1RJGA 1U9ZA 4IJ5A 4BO6A 1GZ6A 1VDMA 1G9XA 1U2WA 4H1VA 3DO6A 2C61A 4B0OA 1MJNA 3D8BA 1RI7A 2J4CA 1T08B 4BYMA 3DB2A 5LMNB 4W9MC 2B4QA 3H8VA 3OU2A 3E53A 5HKAA 3RIHA 3V3KA 1QQTA 2HLHA 1T5LA 2NVUA 2HD4A 1M6VA 2CWEA 2KZVA 3CF4A 4KWEA 4B3MM 4DABA 3DOOA 1R66A 1SU8A 1EH8A 1NXTA 4TUYA 1Z5AA 2EARA 2YS7A 3BIFA 3BSSA 3PWZA 5K7SA 4L0DA 4RB3C 3L25A 3T7IA 4B46A 3EFOB 4E5MA 2GKGA 3INRA 2XVMA 4RXTA 2FX3A 3BWVA 3U81A 3BK7A 1I24A 1T1RA 1CR4A 2QPAA 2Q3DA 3OP1A 1SO8A 2A5GA 3K9LA 4QL3A 3D6UA 3V97A 1B4AA 4PC3A 4BQIA 3OA2A 5F1RA 1MNAA 3WVNA 5C4XJ 3KKLA 3W90A 2G71A 4LDZA 2Q1WA 1P4SA 4R9UC 1YIAA 1ZJ4A 3E1GA 4DYHA 3A37A 3HBMA 3I32A 4R2LA 5K3OA 4LF4B 3HPRA 4XPZA 4HV5A 1ORRA 3E15A 3HZRA 3P71T 2CFRA 1ZLYA 4BECA 4XQ0A 2I6SA 4PRZA 3U5TA 2VO1A 2ZYAA 5DNUA 2C5EA 3CLTC 4C0WA 3P9NA 2GD0A 5IBRA 3HHZA 4F8JA 5TQJA 1VKOA 3R5JA 4H4DA 2ZTMA 4GM1A 3E1SA 1LBEA 2BZ1A 5CFQA 5DHAA 4M0PA 3JD1A 1Z6GA 4L51A 1BDBA 2I0FA 3BTSA 5KDDA 2I78A 2X6RA 3KQPA 2V7EA 1AH2A 2WSEF 4II2A 2D2WA 3WMRA 1PE0A 2WICA 4N3BA 7GPBA 4EX6A 2ESNA 3P94A 1X86B 5SV2A 4YELA 2H08A 1UJCA 3UGKA 4QFMA 3HVJA 2STTA 2O06A 1Z28A 3NHZA 5KO3A 3FXUA 1M74A 3D4OA 4ALIA 3OOEA 1PGYA 3DOAA 4EFLA 4KN4X 3WR5A 1ADBA 1MHPA 2OZLA 1HNXM 2ZSHA 3GJTA 5E3OA 3FTNA 4YRNA 1IPEA 2JEYA 3W67A 5DGDA 1W0JA 2WNIA 4AG5A 1FJGB 4EZIA 4G2NA 1W6UA 1JEEA 4J4BA 2ZROA 4C9YA 4E7ZA 2PQ6A 1LRJA 1F48A 4GR4A 1J70A 4E2WA 4X64M 4G0QA 4AZTA 3F7MA 3C3CA 2CRUA 1IG0A 1WD5A 4JQZA 4M89A 1NI4A 4H4EA 1IEWA 1GD1O 3FWHA 1NRXA 4D3ZA 1E6LA 3ENNA 4COOA 4QOEA 1P3DA 2VT7A 4LZWA 3WB1A 3RR2A 3MBKA 1UJBA 1SWWA 1FYKA 1ZNZA 1IEXA 3DEZA 4KXXA 2JBAA 3KX2A 1M9NA 2DZLA 2AYZA 3AP3A 3JAMA 2LVBA 1U0GA 3TOBA 4HNAA 1BJRE 1VBMA 1G19A 2OZLB 3E5MA 1X1CA 1L7PA 2ECFA 4EY5A 2JRCA 3L84A 3D1JA 1YSYA 5JVDB 2ADOA 2V4UA 4K9RA 2HSZA 4P36A 3SR4A 4Z86A 2LRHA 5EJEA 3JD0A 2DF8A 3R8XA 2R8PA 1VMKA 1US8B 1TM5E 4L7VA 4BTLA 1A76A 4WK8F 1NMYA 3LV8A 1QKIA 5LXTA 4EKNB 2BF4A 2G9UA 4LGCA 2WTBA 2D7DA 3ZQJA 3ABKH 5B53A 4TMXA 3IEIA 2GK4A 4JUFA 4OU5A 2JVKA 1L4LA 1G0OA 5K3SA 1IUFA 4ARUA 3L49A 2F1HA 2YHUA 2DPXA 5HVQC 1XG1A 3JZDA 3NT5A 2JLYA 2BE9A 4NC9A 3F73A 3LY8A 2JS7A 3IQWA 3KPYA 3SXPA 1AKHB 1YJNI 3ONQA 3VISA 3QRWA 3FXKA 4ZEOA 2D59A 2BSXA 3BMXA 5DBHX 2AMYA 3UMSA 4B31A 5B7GA 1V33A 2PFSA 4TTTS 3SX4A 4AKTA 3LDGA 3GTJJ 1DBIA 3MJSA 5K20A 1VL2A 2Q50A 1FFXA 3TSYA 4V0LA 1H1DA 3AG1H 1ZG3A 5C31A 4Y8VA 4LNUA 2YMLA 4MTEA 4BFXA 3ZUPA 2R6DA 3TJMA 5F7OA 1FBQA 3JD4A 2FPLA 1NVUQ 2BONA 3KB2A 3RTBA 5CAEA 1XQ1A 3WL3A 1F2TA 4GVLA 2VQEB 4MS3B 1II8A 2VRCA 4B3FX 3LK6A 5EZ5A 1O3YA 1QHEA 2FFRA 1UPUA 4UEQA 1O9BA 4BB5A 3HKPA 3IAUA 2OCYC 4G7HF 2R79A 3CEPB 4C4YA 2H1SA 2XGNA 4NICA 2L7HA 3FROA 2VZ0A 5DUKA 1YOVB 3MQFA 5HS4A 5C53B 2PEYA 1KI3A 2WYVA 2X14A 1PNOA 4TXLA 1UM9B 3OLYA 2QD4A 3I30X 3JATB 3R3SA 5IJAA 4K9DA 3A58B 4FQ8A 3DEJA 3OZXA 2Z9OA 2IY7A 1CS4C 4DNCA 3FZEA 3RVKA 2VYCA 2REBA 2BEOA 5ITQA 1RHQA 3SHGB 1KQGA 3GDWA 3LT4A 5E6JA 2ZBDA 2R8BA 3UXMA 2I5UA 5BQTA 2AJCA 1J2XA 1AKNA 2ZI9A 3W06A 4S1NA 3AHGA 3U3KA 2DHDA 1JHHA 1TTHA 3GLHE 2YHIB 3P97A 3ASVA 2K4BA 4HX4A 1Q0QA 1ODSA 4WBXC 1I27A 1B72A 2WHQA 4BQSA 5KVVA 3IVXA 4YRRA 2VZEA 5A3RA 3ZV7A 3D7KA 2ZTHA 3M6XA 4B8XA 2VJPA 4C0BA 4I1RA 2BYTA 3H86A 4YRPA 3NBAA 4MVJE 1PNVA 1U28C 5FUQA 4W1QA 4NEQA 3UJ3X 1EQAA 3LBAA 1ETUA 4BLTA 4N7MA 4TKVA 1FTGA 3QU4A 2CUJA 5ER9A 3HVHA 3TQRA 2VZ9A 1PHPA 3QYJA 5H4HA 5D87A 4BFTA 2FSVA 3UW1A 4GLOA 5IXYA 2WVHA 2G63A 1O95C 3BD8A 4WVLA 4JNCA 3T41A 3OOSA 1AQJA 2HUPA 4WNAB 2ZSBA 3ODGA 2YJNA 2PZGA 4OUKX 2IELA 5KC8A 2CXSA 1PWEA 2YICA 4HGRA 3CZAA 5E8RA 5HQJA 4RVSA 2CY0A 1PL6A 3V7RA 2RFLA 2ATIA 1GPH1 2RQPA 5CNJA 1PW7A 4RKYA 2NP6A 1VYTA 4BUZA 2DU9A 4BE9A 1SKQA 1SC3A 3IBSA 2M8EA 1ZRHA 4LYYA 4HATA 1FXSA 4M8NE 3VSBA 3K71B 2OT3B 3IDZA 5FL7A 1YOBA 1J0AA 1UM8A 4OK3A 5DHUA 2ZXEA 2G72A 3MRTA 4DLXA 5C7IO 2XH9A 1WX1A 3JRAA 3KYIB 2FSPA 2K3FA 3NWSA 2I1VB 2HQBA 3LOCA 5CVJA 3OMXA 2XAGA 2O50A 1RWOA 2GCEA 1ORHA 4NC8A 2VTEA 3ODPA 4EI7A 2O8CA 3H9UA 3Q3IA 2JLUA 3QEMA 1KQ0A 2FZEA 4PC7A 2VYNA 2YU9J 3I0ZA 4ILEA 3W4JA 1Z47A 3PC7A 4EKEA 1RAIA 5CTJA 3H05A 3DEEA 1RYZA 3WGQA 3P7MA 4UHFA 3GWZA 4EDHA 5FR2A 2XGJA 3FTDA 2AMLA 4MW4A 2ZIXA 9ATCA 5F51A 3C6YA 3OCCA 4AX4A 4L3WA 5DGHA 2QD2A 3HH8A 5AM5A 2JAHA 1NVVR 4AU7A 2I8DA 4HDOB 2GA8A 3P2MA 3VZSA 1XXHA 1GPKA 1UZCA 3GHYA 4LZPA 3HWSA 4D4IA 1DCFA 3R6TA 1EJBA 1ZVVA 4KRGA 5TT0A 1JEDA 5K0JA 4CFZA 5F98A 3M34A 2WM8A 3IQXA 4NCIA 4CM9D 3H92A 1TZJA 3W8EA 1I7PA 1SCKA 2JFXA 4TWRA 2I7DA 2QQAA 2YQ4A 2OKCA 1FLDA 4LSMA 1P2BA 1Q0RA 5CYOA 1WW8A 2JDIA 2QIOA 4RIGA 1EF4A 4OX9Y 4RV9A 5C34B 2VJLA 3LCUA 3PFIA 3NWLA 3WHBA 3ADKA 1USWA 4GOND 1GAJA 4UNOA 4G5OA 1QGPA 3E9SA 3Q7PA 4BOYA 3L7WA 3N0XA 1NDUA 3ZZ0A 3FCUB 1C14A 5KQMA 1E5VA 2PH7A 5C8YF 1QVWA 2X48A 1W0TA 4QDXA 4E7PA 1RTKA 3D0KA 1TT5A 3PXAA 3H5RA 3NM4A 4L2IB 2QMHA 4NU5A 3JQAA 2XDVA 1T0FC 1X4PA 1V3FA 1RMQA 1BI3A 4ROTA 2BW3A 1E4VA 4EKDA 2P1DA 2I22A 3AVWA 3ZQFA 3RC7A 5D2CA 1DX4A 2M6KA 2WNHA 3EIUA 2DFLA 2ACEA 5BWLA 4RE5A 3L2CA 1ZRNA 4CXMA 3RVOA 4D79A 3JZAA 3TSWA 4AFNA 1ETVA 1TGYA 3RSGA 1H5NA 3WNQA 3ZK7A 1I7NA 4YJFB 1ISGA 2ISYA 1MMSA 5AKIA 5KAFC 1HX7A 1CHNA 3ORQA 1XPOA 3C2GA 3HP1A 4RTKA 4JI5B 2AC2A 1XD9A 1I3QJ 2IYWA 3AI3A 2Q0SA 1A7KA 1ZA1A 1I2CA 4MRPA 3LU1A 4U7PB 1CNMA 2DERA 3U9LA 3TLYA 3JQRA 3UT6A 4CODB 3GLIE 2XYGA 2FR8C 1PSDA 3O2NA 4D81A 3W68A 1Q2XA 3NAQA 2H9AA 1XMQB 2WPDD 3VC7A 1QHIA 1YZGA 3EZFA 3P27A 3A32A 2A33A 4MVJI 1VQ7I 2I2DA 1HT3A 1KC3A 3FOFC 4F9FA 4TMVA 1C2YA 2IPNA 2H2DA 3IP9A 1PIWA 2G7MC 4JK3A 2PKCA 4LOIA 1Y6JA 4MJ7A 2OXTA 1D6NA 2HEIA 4A3MJ 3MINA 1YDMA 3KQHA 1C9NA 1YIDA 3EQ8A 4FOOA 3WZ2A 3GBVA 1SQ0A 5D84A 2Y0MA 2QD5A 2OTJI 1JYFA 3AUSA 3IUYA 4OQXA 4KYIB 2Y68A 4YHBA 3TEJA 6CHYA 4K46A 2OQ4A 1OBFO 3ZNQA 1DHRA 3ZHRA 2P9HA 4JI1B 5ADVA 3AERB 4QYIA 1UANA 3ADCA 1C9MA 1ZW6A 5FO5A 4AKSA 2O7OA 3N0WA 3MGGA 3W2EA 2X0LA 3OE1A 1IOLA 3WRYA 5EP4A 4LK1F 2JLQA 2JFYA 4Y67A 4ND6A 1OREA 2H9IA 1YB6A 3EF0A 1BXRB 3ZK8A 6ABPA 1XSDA 4JLKA 1ABFA 2EOAA 4WADA 2X0DA 3FG9A 3CG4A 3ABLH 2R6R1 4YDHB 2GH1A 4H4CA 4OHVA 3IE1A 3CCQI 3V7YA 1RWQA 4BP9A 3B6EA 2ZWIA 2FA9A 4PHTA 4Y6SA 5KSYA 1VQOI 1Z6PA 1H3EA 3K6SA 4YJHB 4UPEA 4Z0NA 3GMTA 4B8ZA 3G17A 3WJAA 4XDZA 3KKNA 2UZAA 2YXDA 4XWKA 2PKQO 3BR2A 1A50B 2YYSA 3CSDA 2XOKD 2RC4A 5LBUA 1NE2A 2ZYDA 1JJAA 2W24A 5K4HA 3B51X 5HUJA 4ML3A 1GTZA 1G20B 1YTLA 4UVEA 1CFJA 4Y7DA 4RVDA 4L5JA 1DL5A 1RT9A 1LSSA 4FEAA 1L1EA 3V6MA 1UH5A 1ZCJA 3UH1A 2OFPA 5CNKA 2AVNA 5U1PA 3BR5A 2VDKB 4BKRA 2IPXA 3NCHA 1QGAA 1XXLA 4Q9KA 4C21A 1FQWA 4PICA 1J0EA 1SCJA 2HMYB 4IDAA 3E7DA 2EP5A 1WPRA 1LW6E 4UZSA 5ABPA 4UZEA 4UNIA 3RWBA 2R87A 4GFDA 3NYWA 2