2FNAA

Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
357
structure length
352
Chain Sequence
b'GMLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIMSGSEMGLLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSKCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein
publication title Crystal structure of a novel archaeal AAA+ ATPase SSO1545 from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Atp-binding protein
total genus 128
structure length 352
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01637 ATPase_2 ATPase domain predominantly from Archaea
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2fnaA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fnaA01
3UMSA 1Z6RA 1JHFA 2H18A 2ZRHA 2HCBA 2HUPA 4OQMA 1E79D 3CRVA 4QHYA 2VT3A 3GJXC 4IVPA 1DO2A 3JAMK 4JL8A 3RLFA 2RNJA 4G8XA 2VSFA 2JPBA 3SC3A 4UVCA 1ZG1A 1M7BA 2XRNA 1G291 2QTFA 4F91B 1G18A 1P92A 1XMSA 1MOZA 3FKSD 5EE5B 2DFIA 4CDGA 4KFUA 1GRQA 1AK2A 3TRFA 4YG2F 4QWQA 4TLEA 3HRSA 4TL9A 1XGNA 2X1VA 4CW7A 2J59A 3GUDA 1XRJA 4IOMA 5EZ6B 4BLTA 4NHJA 4P4SA 2C96A 4U7BA 3SEAA 2HS5A 3OAAA 1OPXA 3RRMA 4B3CA 1S7OA 2D1VA 3EDPA 2KRFA 1KHTA 2ZR9A 3LX8A 3KUCA 1N6IA 1DELA 2PJPA 4B74A 4OOIA 4OMYA 2MSDB 3GLHB 3PUYA 4YMSA 4G7HF 2H16A 2ZYWX 2JLYA 2A5FA 3B60A 4AWXA 3O3KA 4C2TA 1OFTA 5FFXA 3J7AO 3U7HB 4YQFA 5FOVA 3CX8A 1G3WA 1YRBA 1Q22A 1AKYA 1JALA 3EZ7A 3K53A 3QG1A 3UG7A 3R9IA 4HAUA 2YOHA 2IJLA 5KO2A 3A4LA 4HLDA 3VR6A 2A07F 4URYR 3BDDA 3KJEA 4NCKA 2AKYA 3DDCA 1DOAA 2CYYA 1RUOA 1KQ8A 1YHNA 4BXUA 1U9IC 2LKDA 4MRVA 1NN0A 1NNEA 4W5WA 3T61A 3OHMA 5FR1A 1TEXA 2YC2C 2HYGD 2HJVA 3H0KA 5HZHA 5C18A 2O6GE 1EX6A 5FPSA 1YZNA 3ASZA 4OMZA 5BYJA 3BFXA 3MWLA 4LWZA 4BFSA 2ZI4A 1XPRA 1R1VA 2FFBA 5JWHA 4Z8XA 3FHZA 1WCV1 1N6PA 3GP8A 2XZLA 3WTVC 2FU5C 3UMRA 4KVGA 3LSTA 3OV8A 1W5SA 3N97A 2W83A 3O8DA 1U5TC 4B76A 3P9CA 2F3TA 3U2RA 1G4DA 4JT2A 1YQAA 2ODWA 2JSCA 3VODA 1AQYA 1P5ZB 3KFXA 5H70A 3U3RA 1HV8A 4NPHA 1ODFA 3RKYA 3I4PA 3CLVA 2A6EF 1F4KA 2HCJB 1TQPA 3HR7A 1FC3A 3GF2A 1NSTA 1R2QA 2XKOA 3QRFF 1OT3A 2ZYVX 4C7OA 1TBXA 1XPUA 3NDBB 1U90A 2JEOA 1BIAA 5F9HA 3RYPA 2O8XA 2E87A 3RS2A 5L3SA 3R61A 4HQEA 4Q4ZF 4AG6A 2P6UA 1SXJA 2FEOA 3CIOA 2P6SA 4I1SA 4M21A 3MZHA 4LG0B 2REXB 1XCBA 2OA4A 4OIPF 1S8FA 4Q47A 2DWPA 3S1AA 4EJSA 5DYIA 1UBCA 5AJWA 4ESVA 1YS7A 4JLBA 2QT1A 4ENNA 4TT3A 3EPKA 2WM9B 3FWYA 1JR3A 3Q9VA 5JI2E 1XJ0A 4RB3C 4HX4A 5E95A 2K7LA 3L82B 4RD6A 5D6FA 5H1YA 4C0AC 3KQKA 2W2TA 4ON0A 4M1YA 1BS1A 2GBLA 2QE7D 3K9NA 4LBYA 3VFDA 2ZE8A 2CHVA 1NG1A 3MWMA 3NBXX 4PC7A 1FNNA 2D3WA 4RKFA 4MDFA 4L8GA 4QLCU 1FMLA 1VHTA 2BBOA 1VG1A 3AKYA 5LRRA 2EFDB 4I2OA 4M1MA 3JAMZ 4TSFA 3T1QA 3ECOA 2O8FB 5DEQA 4MGIR 4G94A 4OQLA 3W6OA 1XMJA 4QHTA 2JLSA 4PHHA 4Q66C 2CHGA 4Q9HA 1Z07A 1J7KA 3L8YA 3CO7C 1Q3HA 1XEFA 4GBMA 4N1AA 4ON9A 3X1DA 1W4MA 1VYTA 2BEJA 2QSZA 4US0R 4BLQA 1P2TA 2RHDA 2QZ4A 1G7TA 1TX4B 4LLLA 4KU4A 1OR7A 4JLMA 4WXRA 3WMGA 2HWVA 2ZMEA 2ANBA 1FBSA 2ZI5A 4L9JA 1YKSA 4I0AA 5J4KA 3B78A 5FBWB 2QL6A 4DZZA 4LZZA 4NCIA 2V7QA 1F60A 2ORVA 4Q9LA 1OB2A 4PZZA 4JL6A 1QZMA 1SD5A 3SQNA 1HE8B 3WRYC 1B9NA 1G19A 3KKNA 4M22A 2EK5A 3L2CA 3WHLA 2WC2A 1EK0A 1YR6A 3CWQA 3W90A 4CF7A 4BPBA 2ZSFA 2Y0MA 4GO1A 3R8CA 4P9UA 4CEJB 4YIFA 1BBYA 5P21A 3KCCA 1MO5A 1ZM4A 3EPLA 2HT1A 1XN7A 2VP6A 1YJ5A 1KK0A 3I53A 1HKSA 4UV9A 3EPHA 3KJIA 5FBLB 1W36B 2GA8A 4A6DA 2EV5A 5FTKA 1E99A 4X8OA 4WWCA 3KXIA 1R10A 3W6KB 3OIUA 3F21A 4UXIA 4LJ7A 4PDKA 2OXCA 4KODA 2Z5UA 3OEHA 4PHFA 5EE0A 2WKQA 4NZYA 5L3RA 2BCGY 2WJHA 2DU9A 1JJVA 3B73A 1LDDA 5D8KB 3BBPA 4PQYA 4DDWA 1GFIA 3E2IA 4ZI3A 1UHWA 4PCQA 2J0UB 3KXKA 2A61A 1UHMA 4WZAE 2YR2A 2GCOA 5E17F 5KNDA 2BBTA 3U4QA 2ZI6A 2Z5FA 3QKSA 5D4SA 2CMKA 1UB9A 2GJAA 2HF8A 4JKYA 4X8MA 5JWRA 2OM2A 3ECCA 5DN6A 1TTTA 4EJVA 1UKZA 2DFTA 4MNUA 2CK3D 2WJJA 4KCGA 1AS0A 1E6CA 4URVR 5JS8A 4E70A 4DCVA 4C2UA 4EQQA 2XAJA 3ZIAD 1Q1QA 3IKJA 3R60A 2PZEA 1JAHA 5E20A 1U94A 2L4MA 3OIWA 1KNQA 2Z6VA 4EUNA 4OKSA 3CNLA 2OLJA 3BGWA 2OU2A 1N25A 3MFKA 2HEOA 1Z5ZA 2ZS8A 2EFGA 2QGNA 2CCJA 2CGPA 4RB2C 4PAOA 3P4XA 2C99A 1J75A 4GI7A 2W84A 4ZYDA 3WTSC 4PSKA 2PX0A 2HXYA 3GJ4A 4UNNA 2O8CA 3WTTC 2LDUA 5ILUA 1FFHA 2VBCA 2ZJBA 2ZQ5A 1XCGB 2NO7A 4KFSA 4RZUA 4RY2A 4S05A 4BFVA 1GXQA 3H2YA 1HW5A 2R6GA 2Y75A 2FBKA 2VLIA 1JXMA 2GAUA 1EFRA 3F8BA 2RVCA 3ROUA 1H8EA 1RYHA 3F72A 1F48A 2HT6A 2JJ8A 5E1XA 1G8HA 4HLCA 4HX7A 2C6YA 5FOXA 5EQTA 3IKVA 1JI0A 1F3OA 2NPIA 2PBRA 4YMUA 3V4FA 3SZRA 2OFXA 2PEXA 4GPTA 3CPEA 2WBLC 1A04A 1REPC 1W47A 3U7GA 2AXPA 2HXSA 1N6LA 3QQ5A 1XTKA 2FEZA 2OCYC 1IN6A 1US8A 1K8RA 4ZCMA 1YQTA 2F6RA 2BIFA 1A2BA 2C2HA 3DPUA 1CJUC 4K81B 4WBSA 2WWFA 1R5OA 2XTZA 5FBVB 3WNDA 2FMLA 2KIFA 1OW3B 3DV8A 1MZBA 1C1KA 1TQ4A 3AQ4A 4TQAA 4A0ZA 4HDCA 2J7PA 3QF4B 4GRAA 4YLGA 4TYPA 2WSSD 1T0JB 1D2NA 1C1YA 4P33A 4MTDA 3Q5EA 1QVAA 3WE3A 1G6OA 2BYVE 3DKWA 4L15A 3E70C 1Z28A 2QRNA 1KU3A 4KLZA 2ONJA 2R6AA 4TV7A 1OIVA 1ZM7A 5G3ZA 2ESNA 1SXJC 2AX4A 4LPSA 5D5WB 3UANA 5K8IA 1HKQA 2O8DB 2ZIAA 4EJSC 2FNAA 3I0TA 3PXGA 4AIKA 4WZBE 3HYIA 1ZC3A 1II0A 1TF5A 2PZGA 2WWXA 5DNYB 4Y17A 3U60B 4KIGA 1W7PA 3IWFA 2QGZA 5IDVA 2O03A 3GX4X 3QVVA 2GRJA 4EQ6A 3KP4A 2BM1A 2K4BA 2BWJA 2WIAA 4MA4A 4P0TA 4PANA 721PA 6PAXA 3FMIA 4NMMA 1EV7A 1T4GA 2GBLC 2P3SA 1NL3A 3T06B 2IK8A 3FHTA 5JECA 1OYIA 3WU1B 2NGRA 3V4RA 3K70B 2EQBA 1S6LA 4Q48A 3FMRA 3LA6A 3AH8A 4XJXA 1FX0A 4Q18A 1LTQA 4PPNA 1BI1A 5CVJA 1G21E 2EU8A 4OINF 4M9QA 1RYFA 5A4JA 4HZUB 4QNRA 2J5XA 2V6IA 3DMDA 5EP2A 5CYVA 1FP1D 3EAQA 4H1VA 4P4TA 4MEYF 4IHTA 1N6KA 1RZ4A 3IRRA 2Y48A 1L7VC 3MMPA 4HF0A 2JGNA 2FU4A 3ZVLA 4ZI2A 1ZNYA 4Z51A 3I61A 4YDHB 3GLFA 3HYTA 1RC8A 3LVRE 4PSVA 1Z6YA 1CRQA 1Q1EA 4A9AA 2NZ8A 2O52A 4M8NE 5EUMA 3L8ZA 4NYIR 4ZKDA 2GCPA 2M1BA 5LB2A 5L3BA 1KSJA 2OAZA 1E9CA 3UATA 4U02A 1E9EA 3H3ZA 2DWQA 4CO8A 3FE2A 1JXOA 2WWIA 2JDID 3OFND 2FSIA 4JBAA 1BC7C 1OXUA 1XMVA 3BY6A 3LO5A 3TQNA 1W4BA 3H92A 3MAAC 4XSGA 3RC8A 2HEIA 3IEUA 3KFWX 4TTPA 1ZUHA 3RC3A 2XITA 4B2IA 3V7SA 2FZ4A 4B33A 1ZG3A 4B2LA 1KI6B 2XAQA 3NQOA 5ERIA 2ISZA 2GVDC 1CR2A 3K0EA 3IIKA 4P96A 2GWRA 3EIQA 4WIAA 3KKMA 4DT1A 5BQ5A 2CXXA 2COMA 5F1RA 2RGGA 2AKAB 2YWHA 4JSYA 2XAHA 4ZH4F 5FUXA 3SFVA 4LLGF 1KU2A 1ZIOA 2IW5A 2XOKA 3AF4A 1Q12A 4PO9A 4TL7A 3AP1A 5G3YA 4QM7A 5E8GA 3PG5A 5JSZB 5J6XA 2V1XA 1KTVA 3NEJA 3E5QA 1P3JA 2IXFA 1TUEA 4J0QA 5H6QA 4YIIA 1SVKA 1W0KD 4PZLA 3VKWA 4XWKA 1TQIA 1CULC 3GLFE 5IHPA 1XU4A 2BGCA 3HWSA 2QORA 2QQAA 5DE3A 3W3ZB 4QL3A 1S29A 2GXAA 2F43A 3HU2A 2V9PA 4KIBA 2GXQA 1CR1A 2ZJ8A 2VEDA 2KBFA 2WWYA 5LEJA 1SKYB 1V5WA 2A5GA 2DBYA 2VSOA 4NYMQ 5H68A 3PEWA 3BOSA 2Q6TA 5EP1A 1IN8A 1FQKA 3DO6A 4TZ6A 2VBXA 3GEIA 3E6DA 4IEIA 3B1YA 1WI9A 4WXDA 4L9WA 5F6FA 2IWRA 5AIPA 1MJBA 1XCPA 2NO0A 1KO8A 4QRHA 4ZCLA 1M34E 1CF7B 1E9BA 1LVGA 3QPHA 1FTSA 1F5NA 3R4KA 1QQIA 2R7DA 1IQPA 2O8EA 1DBSA 1U0HC 5AUPB 3Q72A 4BFXA 2FWRA 5LB4A 2ZXJA 4DNCA 5JFRA 2ZUCA 4LV6A 1IRFA 3HRTA 1XD2A 4XSHA 1NMXA 4HZIA 3QKRB 1J8MF 2OZ6A 5K1YA 1BMFA 1YRAA 3P26A 5EE9A 4NE2A 2ACJA 1IBRA 3I1FA 2BDTA 2NAZA 4ZYEA 2RQPA 1BH2A 5LRSA 1JAIA 1GP2A 2IYLD 3I8XA 5LD2C 3DHWC 3WBKA 2MD5A 4YXWA 3FB4A 4E09A 3T5GA 2MC3A 5DYMA 4HF1A 2VC1A 3HP1A 1PJRA 1RFLA 2D2WA 1GRRA 3SZPA 1HQCA 4IF4A 2J7KA 1IRGA 5SZKB 4L5JA 5E1ZB 1Y0UA 1YU9A 4AYWA 1U8AA 1Z47A 1X1RA 4U0YA 1MABA 3F6OA 4MH0R 3K9HA 2OFOA 4Y13A 3B1ZA 5TARA 3PEVA 5ILSA 4M1KA 1SD7A 1G3RA 3QXSA 5HR5A 1TQ2A 5TJJA 1Z3IX 2FFQA 4BLRA 4D80A 4D2IA 1T5IA 4EAQA 4EPXA 4NQWA 3GLXA 2IL1A 3WHKA 4DSTA 4ZDKA 4ASUD 4WOPA 3MWYW 1M7HA 3VNUA 3RKWA 1UDXA 1NVVQ 4TT3D 3SE0A 4PPQA 2STTA 2JATA 1QPMA 4HA8A 2FMXA 3AKEA 2EWVA 2QAGA 1PLJA 4A0XA 2O61A 1G4UR 1KI1A 1NSFA 3FFAA 4L18B 2IYXA 4NYIQ 5FL3A 4XVUA 3E5UA 3AKCA 2JJ1D 1P4WA 1N6NA 1PLKA 4Z2YA 1UADA 2ZRLA 1JPJA 3EC1A 5FPTA 5HCIA 5J40A 1FW6A 3A4MA 1KMHA 1N3BA 2EFCB 4MYTA 4PQFA 2F5FA 1U99A 2D2EA 3JZAA 4JKIA 4A6XA 2JPCA 2V1UA 2P7VB 1G5TA 3WODF 4Z8YA 3J81K 1XEXB 2W6JA 2VE9A 1G20E 1NF3A 3BJIC 4PQRA 3CR7A 4UXJA 4LPKA 3SHWA 5CIWA 3K1MA 4MQ9F 2HKXA 1ON2A 5IT9Z 2BCJQ 3I73A 1CIPA 4UNPA 4XOIA 4BEBA 5L3CA 4TSFD 1XDBA 2XNDA 4AVPA 3WTYC 1KI7A 3LFKA 2H27A 1XSVA 4GOJA 1Z08A 4QG7A 4CRWB 3RIRA 1IUYA 4A36A 4AYTA 2A3RA 3VX3A 2XGJA 1CTQA 4PC2A 3U3MA 1C4OA 4C0HA 2FE4A 3SZTA 4ENJA 1HEIA 3ZMDA 2K27A 3MGCA 5CLSA 4HSEA 2ZXUA 1W46A 2GWHA 1R5GA 2BJVA 4CT5A 1GUAA 4KMFA 5AUQA 4EM1A 5D8LB 1PUJA 1ONVA 4B6EA 2EJRA 1PLLA 1ULYA 3Q7PA 3KL4A 3E5XA 2V7QD 1VCNA 3SBEA 1L3LA 1XJCA 2N1BA 3SNHA 4CZZA 2EA4A 3ASYA 2NNNA 5A0FA 3FM3A 1R6BX 2ZAOA 2DK5A 3I71A 4EV0A 3AP3A 4US1R 2VP9A 1T3LA 5J4YA 3ECHA 4KA4A 1CXZA 1K6MA 2DI3A 2XHKA 1ZVQA 4MKHA 4KXFB 4BWYA 4DVGA 5FUYA 1P6XA 3I59B 5HS9A 1BI2A 5JCZA 2MSCB 4FW9A 1OF1A 3FMPB 3RDIA 3JW4A 4G5QA 4M6YA 1U5TB 4ZYGA 1MH1A 1E2KA 3THXB 4TMTA 4DDTA 4LMYA 3BD9A 4DXAA 1IXZA 3FZVA 1R00A 5FTLA 2EYUA 1SFEA 4LK2A 3MAJA 1R58A 2XNSA 2CDNA 1GVJA 1II9A 4HDUA 3D5LA 4Q7MB 1AS3A 4WXPA 4HOBA 4G0NA 1Z6AA 1TQ6A 3THWA 3G0HA 1K7AA 2FEMA 4D4JA 1AOYA 1A2KC 1NJGA 1KAGA 3ZN1A 4EGZA 3ETLA 3TVDA 1BJAA 4Q02A 3QXJA 3C7KA 4EFMA 4DLUA 1MGTA 1IONA 3JTHA 4UVAA 4PO1A 5LGNA 3CM0A 5DN6D 5HE9A 4S2EA 1EFCA 4LRTA 2F1HA 1CR0A 4BZPA 4C0SA 1I5ZA 4EFNA 2IXGA 2HYIC 1Z0IA 3ZH9B 1N0UA 3THYB 1D8JA 1K5GA 4E5UA 3FOZA 1Z0FA 4BH9A 3LLMA 1T6NA 2F3RA 1E1RA 1BKDR 2JLQA 4DSNA 2GZAA 1X37A 4OI0A 2OT3B 2P6NA 4JJZA 1ZAKA 3IC7A 3BS4A 1DAEA 1FP2A 3IWZA 4A5NA 1GSIA 1CS4C 2PEZA 3QPWA 4W5HA 3TUIC 3VQTA 3A8TA 1BI0A 4FHTA 1RRFA 2OAQ1 4YMWA 4EKDA 3HHGA 1VTKA 2ZE5A 1G41A 1JGSA 4Q1AA 3ZD6A 1PP7U 1DARA 3UXMA 2FQ3A 1CKEA 4Q9JA 1JPNA 3A1SA 4BLPA 3ZMTA 4L4UA 1V4RA 1CBUA 1LS1A 5F2EA 1MDMB 3FHOA 1O57A 4O5VA 1H8ED 4JS0A 5E7IA 2CLDX 3P7NA 2WMOB 2FSFA 1XZQA 2VO1A 4LHWA 1E2MA 4IXNA 1FOEB 5D3QA 3BORA 4MGYR 4PPGA 2HGCA 3CBQA 4OI2A 1W5TA 4CHUA 1QBKC 3IHUA 1PUEE 3DQVC 3K0CA 3QVUA 3G3ZA 4QBHA 1M2OB 4Q7JB 3J81Z 3GYHX 1Z0AA 4R98A 4Q00A 3SXYA 1SVLA 2G1KA 2MMGA 4IRIA 2GXBA 4JVNA 2F5CA 4PC1A 5JFGA 2BJWA 1F2UB 2PFBA 5JEDA 5HPYB 1JEEA 3BZ6A 1A5TA 2ATXA 3CKLA 5KDLA 3E97A 5CLQA 5C1BA 2ZJ2A 2YWEA 3AF0A 2M5WA 1GKYA 1DG3A 2IYUA 2QUZA 4BRWA 3M9AA 3G82C 1MR3F 4URZR 2P0EA 2QRZA 4L16A 2RGAA 3L0OA 3SN6A 1KYIA 5CYOA 3NC0C 1GM5A 2VA8A 2DWOA 3HRMA 1W4CA 4PR0A 4V0KA 1D8KA 3NHBA 3FXQA 4FMDF 2QWWA 4R79A 2FOLA 3CNNA 3HPQA 3PUWA 1WQ1R 1SD4A 1XGOA 2CO5A 3R8FA 4BFTA 1P73A 4D6PA 3N4MA 5ANRB 1Y3AA 3QUSA 2YOFA 4M1TA 3KP5A 3WYGA 3GLGA 1ZHFA 1ZIPA 1K78A 1NY5A 3K0FA 3NDPA 5TMPA 1S3SA 4LUCA 2IW3A 1S2MA 1W7PD 1XTIA 1G6NA 1EH8A 3WNBA 5K5RA 5DO9A 1QHIA 1QHHA 1UKEA 1SFXA 2HV8A 1G64A 4B35A 2G0TA 4P4SB 3Q9SA 1H8HA 4Q21A 5J47A 3AF1A 3CNOA 4D4LA 3AGQA 1II8A 1KIMA 2ZI9A 1B9MA 3I5UA 4O2LA 2UXNA 1LJ9A 2R65A 4P55A 2L01A 2PN6A 2OEPA 3G73A 2YVUA 1YZTA 3KQUA 2AS5F 2C77A 3CTAA 1YTYA 3DOFA 3CF6R 1I1GA 4KDPA 1GRNA 1KO5A 1OHHA 3ADKA 4AWXB 1R8SA 3CRW1 3NVAA 5HS7A 2JAQA 2ZRJA 4ERNA 4WCGA 2ZJYA 5G53C 1XTSA 1XGMA 3VEPA 3LAWA 2Z0MA 4MRPA 1X8KA 3ZS8A 2PQ8A 2F7SA 4NKRA 2CNWA 4Q4AA 4PSAA 3ZPLA 3OZXA 4IKEA 4OU0A 1E2JA 1E4YA 4B73A 2NYXA 3R9WA 2HKOA 3C3WA 2PJZA 3VOEA 2AXLA 4RD0A 1EXMA 2V6JA 2IT1A 2WPDA 3I32A 3OEED 4B44A 3HOSA 2AWOA 1Z63A 1TMKA 4KFRA 1VHLA 3A1TA 2EB7A 3E6MA 5E8IA 1Q3TA 1DO0A 1XDUA 1S3GA 1T0FA 1W44A 1Q0UA 1ZM9A 2XAFA 2UZ3A 2WSMA 3AVOA 3FMOB 1G3TA 2DQRA 4GITA 2X0LA 1E2LA 2RGBA 3TIFA 3MHVC 4Q4HA 1KO1A 1WKMA 1IJFA 2IXEA 3WTXC 4DLZA 4M9SA 4N0EA 1SVSA 1U98A 1CJMA 2CFXA 1E94E 4F4IA 2A5YB 5H20A 2QMHA 1E2PA 2YYZA 1JECA 1O3SA 4RFSB 3T1OA 3E5HA 3KZYA 2XOKD 2HZTA 3HTUA 3VR5A 4FWHA 5D5XB 3K9LA 3MEXA 1KDRA 4C7OB 1RKBA 2GK7A 1VIYA 1P4XA 1R8QA 1FYKA 3B9PA 4OIRF 2C03A 2FF7A 3BRWD 3O47A 3QENA 3VAAA 4EFLA 1IY0A 5L3SB 4AKHA 3K70D 2RKOA 4O0MA 1JQJC 1QG2A 1QHYA 3NKVA 1KKLA 2GXGA 3L43A 3RS0A 1BIFA 4EJSB 4MHGA 3S1AB 2P5KA 3X1XA 1SVMA 3AVYA 1P60A 5L3EA 1QZZA 1GTVA 1XTRA 2AN9A 2ZE6A 3DEFA 5JBQA 3RI4A 221PA 3ZVNA 3OIVA 4ETSA 3GJ6A 1VG0B 1QZYA 5D5UB 2P65A 4TYQA 3CZPA 2CHQA 1J70A 5DI3A 5CVIA 2XTMA 4LBVA 1JBKA 1AJEA 2VP2A 3B6EA 5CM9C 2Z3YA 1T39A 3MCZA 4KN7X 1E2DA 3LY5A 4HI0E 3HOTA 5DI9A 2FDCA 2GEUA 5HDNA 2PEYA 3T8TA 3GD7A 4ARZB 3ISPA 2OSBA 2PCLA 1E0SA 3DKVA 2JLRA 2PCJA 2RV8A 4JSTA 2FNPA 2GA2A 3EZ2A 4IVRA 1NN3A 1ZP6A 1UFMA 4IDNA 5L3DA 1U8ZA 2STWA 3QIAA 2I1VB 3IIJA 1M8PA 4C0LA 1FY7A 1R7JA 1P2FA 1VTNC 2GZDA 4OJQA 3KE2A 1N0WA 1A82A 2WTUA 5AUNB 1OYWA 2VT2A 4A8JB 1KO7A 2XJ9A 1AA9A 4YMVA 5A2QZ 1BMFD 1XEWX 2QTHA 2VH5R 2WJVA 1XZPA 3R0JA 2O5VA 2FF4A 5JI6A 4HUQA 1JXSA 4X8LA 1BN5A 2IS2A 2ZMEB 3CLOA 4HLQB 3KQNA 1SAXA 4JYCA 3TH5A 4YXWD 2KIUA 5TXGA 3QEJA 2JLZA 2ORIA 1H65A 5CK4A 4RD2A 2REOA 2HTSA 1RNLA 2X19A 1R7RA 2J0SA 3LA7A 4FCVA 1KOFA 2BMDA 1I4TD 2F9LA 2IF0A 2CWEA 5DUIA 2WWGA 3MD0A 1AIPA 4PC3A 1XCMA 5FPKA 5JWOA 1S7AA 4JZKA 4XBFA 2EFNA 3NC1C 4MYCA 4DHEA 4F4JA 1S9DA 3U44A 2W57A 2IYWA 3F3YA 3PUZA 2YX4A 3NRVA 1IXCA 1HSTA 2OBLA 3QXHA 3GFTA 4WAUA 4W7SA 1UBEA 4ZDJA 1QNTA 3JTGA 3H3UA 4PPFA 4P32A 2D2FA 3LBIA 2QMUA 3B7GA 1W7AA 4UV8A 1QDEA 3PUXA 2R8RA 3P20A 2KJCA 2VHQA 1OMIA 1I1SA 4DB4A 4CYMA 5FD6A 4BLSA 5DDGA 3CPHA 5HZKA 3TOAA 4XD7A 2AD5A 5LHGA 1Q20A 4D25A 2ODEA 4LJZF 5EE3A 1EWQA 3LBNA 3IILA 4DUGA 2GCOB 1DPUA 1GILA 2L02A 4JLOA 5G40A 1N5JA 4QM6A 2I3BA 5KHOC 3U4QB 4DQ2A 2W6JD 3GFIA 2ZBKA 3W9YA 2A2ZA 1E9SA 3B1VA 4HLUC 2IX3A 4LJ8A 4MITA 5KPDA 5HLHA 4FWIB 3S2WA 3JSOA 1J2XA 3GFLA 4WF2A 5JHUA 3U5ZB 1Z8FA 2L0XA 5CJ9A 3GVAA 2W00A 1E1QA 2ZS9A 3CR8A 4U5XA 1UCRA 4EPYA 1TPZA 2XNDD 4DLVA 3CO5A 2IUSA 5EE1A 5TY0A 3EWAA 2ZREA 4DCNA 2XEXA 1XNJA 2VF7A 2NIPA 4LV5B 3AVVA 1ZARA 1SXJE 2G0NA 2GETA 1LNZA 2X2FA 4HAYA 3T35A 1GZSA 5D3MA 2XZOA 3GFMA 3BJAA 1TUIA 4LRSA 1HSJA 3VLFB 1YO5C 3IBYA 5BWMA 3BFKA 5FH9A 1NIPA 2J41A 2O8CB 2QQEA 1M74A 4Q1BA 4HDVA 3TW8B 4B3XA 1JR3E 4HAXA 5EP4A 5FOSA 3FMFA 4IOJA 3C8UA 5UKDA 4JIMA 3DVLA 2VSXA 2ZJ5A 4GGGA 1ZRCA 3EASA 2DPXA 3NIBA 2D06A 3THOA 4DCUA 3BH6A 3Q9LA 2V79A 3L00A 1Z2CA 3OOPA 3SYKA 2ZRNA 4AK9A 621PA 2BKEA 4EM0B 2QM7A 4A0GA 1XGSA 5D6EA 3AAFA 1LDJA 2P2LA 4L5BA 4WX9A 2QZ8A 1ZRHA 4IJMA 1YW9A 3QAHA 2CLSA 2KE5A 5LD2B 5J4VA 1P72A 4KO8A 1Z06A 2RGEA 3W3AA 1S4QA 2IHBA 4BYYA 2A3SA 3PVSA 3TGPA 1N0VC 2A68F 1US8B 1SMYF 1ZUNB 5DD4A 1UEIA 2CCGA 2XZPA 4HB3A 2IUUA 4DDUA 4GZLA 2DFNA 5JHGB 4MEXF 4R8HA 2HJGA 1NKTA 5F9FA 3E3VA 2IYYA 4EJTA 4BHPA 2GEVA 4G6QA 4LJAA 2DZOB 1U0LA 1USTA 4M1WA 1NBMA 1G7SA 2DFLA 4JK1X 4L9TA 2QEQA 5BYKA 2LNBA 1IAQA 2R6DA 2ONKA 3HR8A 4H0EA 2EWWA 5ED4A 3BK7A 5DLQC 4PZYA 5DH9A 4DCSA 5J4LA 4UNSA 2QVOA 4A12A 1KJYA 1C9KA 2BV6A 5JHHB 3JSPA 2XTNA 4EGYA 1D6JA 1LY1A 4YONB 5L3VA 1ZLJA 2P5LC 2RDPA 2RC4A 1TNTA 4G9YA 5KVRA 1LB2A 5CLLA 2GQQA 1KI8A 4P31A 2YKGA 3F5FA 3CX7A 4OIQF 3Q85A 4LB6B 2Z9OA 1LFDB 3H86A 1JNYA 4OQXA 3RWOA 2P5SA 4M73A 1HY3A 2O3FA 1W7PB 3ZP5A 1P6RA 4XSXF 1NLYA 1Z6XA 4GYIA 4A5MA 2HDNB 4B48A 4EQ6B 2A9KA 3DMNA 2HTJA 1EX7A 1WBDA 4HEJA 3U3JA 1BYUA 1LEAA 2OAP1 1UEJA 4ACBA 3C14C 3RYTC 421PA 3K9TA 1E2IA 1P9NA 2H92A 2JJ2A 2ZU6A 1RUNA 3BH0A 3RS3A 4I1UA 3LAPA 3LW8A 1OJLA 1FX0B 1X86B 1NBME 4AURA 5FL7A 4JN6A 2VOOA 1KQ9A 4I02A 2EFOA 3TUJC 3JVVA 1DE0A 2OHFA 3AUYA 1DVRA 1TADA 3L09A 3BP8A 3MCAA 1NLZA 3K1NA 4D4KA 1E3MA 2B8TA 5GADl 4L9VA 3GLFB 1KJWA 1KNXA 4NYMR 4DRZA 4QKQA 1ZUIA 3R9XA 1Q1BA 4YMTA 1KY2A 2VL7A 4HB0A 3SQWA 3ZN0A 3P9IA 3RKXA 1HW2A 3TO7A 2PT5A 5GJWC 5BXQC 2OBPA 4R2IA 1HKTA 2QLZA 3NBYC 4O25A 1N5KA 2JTVA 4D0PA 4A4DA 4LHVA 4TTRA 1JR6A 2Q9AA 5DIFA 4NBSA 2GJKA 5FTMA 3RANA 2DO7A 3KKOA 1ETUA 1S0UA 4QJ4A 1STZA 1HA3A 4LK0F 3ZDQA 4OHYA 5K8UA 3I72A 2V3CC 4ZPXA 1JHHA 3PEYA 2W0SA 1R1UA 2IEZA 4B09A 2OFWA 5FO5A 4PX9A 5DGXA 3T0YA 2FFAA 4EJUA 4DT1B 3U9GA 5FTJA 1YFHA 1UDWA 4MRRA 4V03A 4C4PA 3GFPA 2J9RA 1YR7A 3GJ8A 5KK1A 2UZKA 2VF8A 4I1VA 4LYJA 2IA2A 2BM0A 3WU0A 4FIDA 4XH9B 1G3UA 5F3WB 3HSEA 2RGNA 3T8RA 4ZDWA 3SHFA 4A2UA 4DDVA 1KI3A 3JZMA 1H8HD 4KSCA 4PHTA 1W4AA 4C0JA 5KSYA 3CH4B 2CCKA 5DHFA 5KPJA 4QGFA 1G8YA 1QHNA 1Z1DA 1W49A 4BFUA 4D0NA 3CZQA 1G3IA 5IK2A 2F43B 1DAMA 2YC4C 1ZG5A 2AXNA 5FR2A 4QBIA 2VBZA 4GP7A 4G1UC 4W9MC 4MKIA 3F3XA 4XWOA 2N42A 1KMQA 2F5EA 2R44A 2VHJA 2B92A 2ZS7A 2F2EA 3VU9A 2L4AA 3GXOA 1NVVR 4GXOA 1DAGA 2ODNA 3NHAA 4IW3B 4F4CA 2XXAA 2BMJA 2G3YA 1IN4A 3TVTA 3MJHA 1J8YF 1G6HA 1MV5A 1OFUX 4D26A 1W1WA 4I99A 4U0WA 1YE8A 2VBWA 2UVQA 2Q8KA 3EG5A 3MZYA 2O8EB 4CYDA 2C95A 3AVUA 2FG5A 4LD5A 1TQDA 4QC2A 2HR3A 4UHTA 2W0MA 4UXHA 1G4AE 3LA2A 4Q5SF 1BO6A 1F2TA 1XJQA 3QNUA 2ZM5A 4Z1MA 4XVRA 1IOZA 1XD2B 2WKPA 2REBA 2D45A 3EA5A 3GFOA 3I5YA 4RGSA 1IW7F 3HUGA 1KAOA 2FZLA 2QUFA 3LAJA 1NG9A 1MD0A 1NMZA 4C30A 1KI2A 5HE8A 3A1VA 2A5DA 2M87A 1VCMA 3TJZA 1JE8A 3TQCA 4E22A 3E6CC 3DM5A 4TMWA 3WG9A 2Q0HA 2CL6X 3O8BA 1PVOA 3WTUC 3QF7A 4XLPF 1PDNC 4WA7A 2JLWA 3WYAA 3IEVA 1XCVA 2B6HA 4PTLA 1S96A 3A6PC 1OKRA 1DTSA 2GNOA 1MABB 1N5LA 3QU3A 2VQSA 1ZN2A 1ZM2A 3IO5A 4DB2A 3OAAD 4FMDB 2AK2A 1E79A 2UWMA 2QPOA 3I4LA 1AZSC 3SBDA 2ESHA 1USSA 5CJ2A 3F23A 4JBXA 3QOFA 2F1RA 2V4ZA 2PBIA 3W5JA 5CITA 3W6NA 1WWXA 2IUTA 3KTAA 5SZHB 4A1FA 3FKSA 1XFAA 1RJ9A 2KB0A 4MGZR 2ZEJA 3LRPA 1ON1A 2XKPA 4DLRA 4M1OA 1B4AA 4TYNA 3K0CC 1KZGB 2ZRPA 3H84A 5B64A 2CSOA 2QAGB 4EPRA 1P2UA 2IF2A 1S1MA 1VYVA 3FYHA 1XEWY 1ZNWA 4JLKA 3L0SA 3VHXA 3Q7QA 2PMDA 2AWNA 5AJXA 2GAOA 4IEEA 1KMHB 2ZU0C 2IA5A 4MGKR 3EIEA 2D7CA 2KKOA 2MH9A 4JT4A 2OCAA 3D0SA 3DKPA 2R6CA 2YHSA 3EYIA 1FZQA 3IO3A 1SFUA 1NIJA 3TKYA 4HQMA 4TYYA 5LLQA 3KB1A 4NH0A 3M8EA 5AWFC 4A6PA 1XWIA 5B2ZA 4TTQA 1S3JA 1FMJA 1KSFX 1WBBA 4HBLA 2I1QA 3T34A 1UBGA 3KP3A 3RS4A 4FX0A 2BBWA 1QBJA 1SZPA 4B2PA 3W34A 5CDFA 3KQHA 4AKGA 1K6OA 1FLIA 1IAWA 3K0SA 5JJLA 4M71A 1B59A 4AKIA 4RB1A 4P3YA 2G77B 1TW3A 4BQAA 3RRYA 2LWIA 1FPQA 1J90A 3AKDA 4LY6A 3RSLA 1A4RA 4QBGB 4EJOA 4JQFA 1R23A 1Y63A 4CVNA 2RB4A 4B3BA 4G5RA 1IXSB 3KB2A 3UMFA 5IT5A 4FT8A 5KUTA 1J0RA 4IXAA 4O2RA 3BB3A 2IYZA 1W0JA 4BHCA 2Z99A 1E98A 1HTWA 2JIZA 4BASA 3F22A 1SXJD 3TO6A 1UKVY 1NRJB 2ZRAA 3K0AB 4TQ9A 3TAUA 5C4MA 4H1UA 4AC9A 1H0MA 1Z6GA 1FYMA 2R3SA 5BQTA 1FZPB 2WV9A 4C0BA 3ZD7A 2C9OA 1DUXC 3SQXA 2L54A 2BHRA 2G6BA 2P6RA 1MRNA 4O3MA 1XB2A 1JR3D 4KICA 2C04A 3BC1A 1ZCAA 4B3FX 1XBTA 3DEUA 3EZ9A 2ZVPX 1BYIA 2ZSAA 1DADA 2QT0A 2D74A 4Q7LA 1UBFA 3T15A 1G5PA 3AM1A 1RRGA 4KFCA 1N6OA 4X8HA 2NOAA 1AKEA 4XD7D 3WXMA 2P4WA 3THWB 4S35A 3V7CA 2EFQA 2Z4RA 2J0VA 2NPFA 1FTNA 2DW4A 1N6HA 5CDFE 5FFZA 4NONA 4ZIRA 4A0FA 3Q3JB 4LOAA 3GW2A 2V1DA 4EM2A 1T6SA 3LWFA 4ZZDA 5LHHA 1RVDA 2E9SA 5AJVB 3VMFA 3BJ6A 2P8TA 1UJ2A 3IBGA 4OJKA 1VCOA 1J5YA 2PLYA 2D4HA 1OE0A 1YR8A 4ZV4A 2RGNC 4CEHA 4IFEA 2BVNA 4NDZA 1Z22A 2ZJZA 4BZQA 1TLHB 4TYWA 4K8OA 3O2PE 1E1QD 3ZQ6A 1KGSA 5C46F 1P2VA 5L3QA 5FOTA 3MWJA 2X4HA 3AJIB 2QE7A 4EMSA 1ZINA 2DYKA 1FQJA 3MUFA 4JLPA 2G9WA 2GVZC 1AZTA 2FBHA 2QN6A 3HRUA 3D31A 2VC0A 5JR3A 3M1IA 2QBYA 4GOKA 4Y0VA 2IEYA 2IT0A 1TNSA 2PG4A 2JCSA 2PI0A 2LCFA 4GFDA 4XVQA 1QO0D 3C7JA 5FFMA 4D0GA 4QHSA 5EXPA 2QA5A 2OILA 3KDSE 3Q5DA 3GO5A 4TLBA 4ZZLA 2ANCA 5E7MA 2DPUA 2NRAC 3OE7A 1YYVA 1QGPA 1V43A 5AJYA 4AY2A 1IY1A 3L0PA 5FBRB 2H09A 3VFZA 3PV0A 1ODDA 2G88A 1DAFA 4TQUS 2EWNA 3M8FA 2LKCA 3UK6A 2WOJA 1Z6TA 3TK1A 2O0HA 4UJ5A 2PL3A 3IHWA 3I5XA 1OH6A 3FFBA 4V0LA 2Q21A 3TDUC 3FF5A 3LA3A 1YG2A 3TDZC 2G7UA 3TE6A 4TL6A 3OEHD 3SR0A 2O0YA 3HU3A 1R36A 2V6CA 2XUBA 4IHSA 2ZTSA 5BN3A 4LHZA 4Q1FA 3EQLF 3KXLA 1ZW6A 3T5DA 2JLUA 2GXUA 2PH1A 4TLDA 4TZ0A 3SYLA 1NBMD 2IPQX 2Z4SA 3K0LA 1CJKC 4Q7KA 4IRUB 3VB2A 4U00A 2XAUA 4RJLA 4RZXA 1KY3A 4RCYA 4BFZA 5GJBA 5K5OA 3HYRA 4K2EA 2TMKA 3BIFA 3QEOA 1JB1A 3RJPA 4EDHA 4A0RA 1VG8A 5JEEA 4BAYA 2ZJOA 2OBMA 2K86A 4YDSA 2ORWA 1B1BA 2B21A 3CRMA 3IHLA 4TMXA 4I01A 2ZO4A 1CJVC 1R1TA 2VODA 3IRQA 2CE2X 3NXSA 4D4MA 4XSZF 4DEXA 2BBYA 4ESHA 1RRCA 3GLGB 2GCNA 1K78B 3K0FB 3QXXA 1LF0A 3KFVA 5EXXA 3BWGA 2IHYA 1P9WA 2QENA 2YWFA 1SHZA 3FXRA 1P61B 3BAFA 3FTQA 1FBUA 4IPAA 3ZMUA 3BROA 4LB5A 1W4RA 2A78A 3TLXA 3ZIAA 4CEIA 5FTNA 2XIGA 1ZD8A 4DLSA 1QHHB 4LLNA 3GLIA 4DCTA 1EFRD 3KEOA 1BOFA 2WWHA 4LSGA 5TB5A 2QPTA 1Z7UA 1II8B 1G3QA 2J45A 2NTYC 4OK5A 1G3MA 2JJ2D 2ZRKA 2J3EA 1O7LA 5J8FA 1Z2AA 2FA9A 3NEYA 1XB4A 4FWDA 3A4NA 3N2IA 4MRNA 2FV8A 2D7DA 2NZJA 2VE8A 5L3FA 3GEZA 2X8AA 1WRJA 5J8CA 2RGXA 3AF2A 1SMTA 2W24A 3GWZA 4MTEA 2HLDA 1XMKA 5EP3A 2FBIA 3LBHA 2ZR0A 3WNCA 2QYOA 6Q21A 3R0AA 2NO1A 5JJKA 3VX4A 3CONA 4OIOF 2JLXA 1OH5A 4DLTA 3FXUA 1T5LA 5IT3A 1FSHA 2RHMA 3D3QA 4GDFA 4QGAA 2XV4S 4Q4AB 2WKRA 8OHMA 3W6JB 5DUKA 1FSEA 2EV0A 2K4JA 3ML6A 2J7PD 2VYFA 3MG9A 4POAA 4Q03A 3SU8A 3R7WA 4FCTA 2ZRCA 4ASNA 2F5DA 2P5TB 2ODBA 1XSXA 2WICA 1Q21A 5FOUA 4Q4JA 1EH7A 4KAXA 3UIEA 3QXCA 4RGXA 1TU4A 1YZKA 4Y0AA 2FSWA 3HJNA 2C9CA 1QHXA 1VG9B 1IY2A 4B32A 3FWEA 4RD3A 2GJ8A 2QM8A 5AJZA 5EXSA 4PAQA 3DOEA 4Q4HB 3KEQA 1E2GA 1DEKA 2QG6A 3B8HA 3LXXA 2OESA 2YWGA 4Y15A 2BC9A 2B7CA 1D9XA 3MJRA 3ZZ0A 5E3HA 5JRZA 4FD2A 1HH4A 1NN5A 3D7MA 4HLUA 4DLYA 1E2EA 4DWJA 1R22A 4W5JA 4IDQA 2E1NA 5JRJA 2FJUA 3VTKA 4DLWA 3AVTA 2IVMA 2WAYA 1J99A 3KZZA 1ZJ6A 5AONA 5FUWA 1E2NA 5GVSA 3REGA 3REFA 5EUQB 4QGHA 4RFSA 1EGAA 3RAPR 1ZAOA 3DPLC 3U7FB 1HT2E 4LJ5A 5B58C 4Q1CA 1WDTA 1ZNZA 4TL8A 2FOKA 1DAHA 2YSRA 3UG6A 5JLJA 4PO8A 1XXHA 2CJWA 4AYXA 2VHCA 4N0DA 3I64A 2AFHE 4F92B 5IK2D 1NHAA 1E69A 4HYEA 2ZSEA 2DWZB 4IDOA 5CB6A 4KSBA 4JL5A 1M7GA 3SFZA 2XROA 2NQ2C 2WJIA 1NMYA 3GJ5A 3AF3A 4JBWA 5M04A 3WBJA 5JCPA 5DI3B 3RSOA 3UWOA 3WYFA 5BN4A 4BQSA 1K5DA 4HV6A 1MKYA 3FGNA 4AKEA 1S1CA 3HSRA 3AEZA 1O3QA 4GNKA 5KSOA 1AQUA 5DSZA 3ZMZA 2VONA 2A7QA 3EWSA 4TMZA 3KX2A 3X1WA 5J4HA 3WP0A 1GKUB 2GXSA 2NG1A 3HSFA 1OB5A 3GLGE 2OQGA 2ATVA 5HKKA 1GAJA 3KUDA 2QM3A 2H94A 2HQNA 2H1LA 3RDPA 4BNCA 5DHAA 3QP5A 2C9YA 1TW2A 1SVOA 2R7FA 1KSHA 1QHSA 3PFIA 3A58B 2FGJA 3CUEF 5CJPA 2CLCX 4Z1MD 3PQJA 2O8BA 1YLFA 2VRWA 4DKXA 2IS4A 1EFHA 5EXTA 5L8VA 2ZETA 4BFWA 1RIFA 4WXHA 1KI9A 4HUQB 5C4GB 2CL0X 2JASA 4A2QA 5DCMA 1DS6A 2KSQA 5C2JB 2WWWA 1XXHE 1YZLA 2IS1A 1NP6A 1G9XA 2UXXA 2JDIA 3ZJYA 1GDDA 3RNLA 2ZNZA 4KT5C 1E9DA 1GITA 2OZEA 2RMKA 1EESA 3CUQA 5ICGA 2V6ZM 4L0YB 3KKQA 2ZR7A 2F55A 3F6VA 5AR1A 4LHXA 5DD8A 2IYTA 2QI9C 2DVWB 3PENA 1SXJB 1FPMA 2OE2A 1X3SA 2YINC 1ZU4A 1KQ0A 4IHQA 4R2HA 3U44B 3J81k 3SS8A 3ADCA 4HUTA 1O3RA 1G8PA 3Q8XB 2DB3A 3EC2A 2CEAA 4DIDA 2EFPA 3LH5A 2QMEA 3DF8A 4HAVA 2M30A 4PAMA 1D9ZA 2KJQA 2JRTA 3U6BA 1GIAA 1BC8C 4O6JA 4LJ6A 1IZ1A 1CR4A 1COWA 2VXZA 2G7HA 1KSGA 3VR4A 3W6PA 3M6AA 1NVUQ 4LRWA 5TDHA 1KO4A 1I27A 2NO6A 3PEUA 1BM9A 1GWNA 3QPVA 4JVMA 1W0KA 2YJTD 5FLXK 4UJ3A 4LFUA 4QOSA 2B8WA 3SYNA 2EFEB 1P9RA 3T1BA 5BOXA 1ONBA 4IXMA 3ICEA 2Q3FA 1A1VA 3BJOA 1U78A 2FX3A 2W2XA 3EYYA 2ECKA 2WJYA 4LC1A 5BS6A 3I92A 2HF9A 1ZC4A 2ZNYA 1SD6A 2VN2A 1RE0A 1OFHA 5DV5A 1SGWA 2PMHA 3CUOA 1E9RA 2AL7A 2H7VA 2BEOA 5D4RA 3ADBA 2R6FA 3KETA 1UPTA 1CRPA 1T3SA 5ICFA 3AVWA 3BE4A 4HAWA 1YZQA 2ZPTX 2PZFA 3K8YA 1AS2A 1U2WA 2ASEA 2EFHB 4EPTA 5FGMA 1EWRA 2OUKA 3CDHA 4GCVA 4I09A 5D3MB 3T1VA 3EA0A 2OLKA 3BWDD 4RD1A 3LLUA 4IJAA 5HLGA 4URWR 3PJRA 3CJNA 4KUMA 1QHGA 2J87A 4IFBA 3V00A 1U8YA 821PA 1XTJA 4UKDA 4CZ2A 4QNMA 1MKMA 2QTVB 1CEEA 2F1JA 2GDJA 3OIYA 4CGZA 4JLDA 2EFWA 2IYVA 2PT7A 3WP1B 1UM8A 1XSDA 1KK2A 4WXCA 2IC5A 4Q4LA 1ZYRF 4HAMA 2X77A 3LD9A 3M1EA 4HW0A 1W0JD 2JIZD 3TR5A 4A2WA 3AP2A 3EUHA 2MSEB 3DXJF 1E2FA 2FN4A 4KVAA 3EETA 4IDHA 1OYYA 2GHIA 3BOQA 2VHUA 2WOOA 3C5HA 2WMNB 4G5OA 1A7JA 5EJEA 3QKUA 4XLNF 5SZJA 1ANKA 2OO7A 1P7CA 1LDKB 3GJ0A 2ZRFA 5SZIA 1BI3A 4M9ZA 1KJZA 1L4YA 4OQFA 3X2SA 5KSPA 2WHXA 4V0MA 2W6IA 4M6XA 4EJWA 4IOKA 2EYQA 2P5VA 2ZAMA 3F8CA 1HBXG 4MUBA 4F7ZA 2J5OA 5EEHA 2HYFA 3DZ8A 1I2DA 1OXXK 1LEBA 2ZROA 3GLHA 3QKSB 3CF0A 1D3YA 4MQVA 3KKPA 4WW0A 3W5IA 4ASUA 1DAKA 2ZUBA 5LGUA 1OKKA 1ZNXA 2ZYUX 2ELHA 1HQYE 4A92A 1VKJA 5FPHA 3RABA 5CVUA 4L5IA 1R0YA 3OF5A 1Z29A 3AV0B 4TWZA 1WXQA 3T1TA 2FRHA 2NS0A 1YW7A 2BMFA 1NLFA 2JJ1A 2QNRA 2V8OA 1GNRA 1P4SA 2FFHA 4M9XA 2QAJA 2DQLA 3T5XA 2FXAA 4YFXF 1ZREA 4LBWA 4QBFA 4RAYA 1RW4A 3R20A 1CJTC 1KDPA 1EH6A 2OCPA 3DM9B 3HU1A 2B7BA 3EZFA 3NBZC 2EW1A 4ACAA 4ZDIA 4E03A 3O6BB 4KITB 4BE7B 5GJVC 1W48A 3GMTA 1E2QA 2AR7A 4GMXA 4JVLA 1XF9A 2DR3A 1RRPA 2AFIE 4TN1A 3HHHA 5FBQB 5J5CA 3ZVRA 3QBTA 2IRFG 1ZMXA 4BUJA 4ENMA 1K79A 3IPXA 4GYGA 2HDCA 2ZRBA 1MO3A 5FOWA 3OE7D 4MRSA 4F38A 3KW6A 4AIIA 1OIXA 3TMKA 4A8JA 4GOXA 2MMCA 3B1WA 4V0ME 1R5HA 5FD5A 1XPOA 4A6EA 4MQBA 3SDZA 1KDTA 4M72A 1QRAA 1R0WA 3NEUA 2KJBA 2XAGA 1ZD1A 2OG2A 3I8SA 1NVMA 1OXTA 1S9HA 4ZYHA 5KSZA 1T2KA 3WE2A 4B8XA 5FLXZ 2B0LA 1D2MA 3GLHE 3U7EB 4ARZA 2OQRA 4G5GA 1VMAA 2ZANA 3C41J 4FN5A 4JLNA 2OBNA 3P27A 5TRDA 1OFIA 3N70A 4HATA 3TSOA 2H8KA 1E0KA 2XSZA 2Q2EA 3V4GA 3TW4A 4D82A 5JI3E 2IA0A 3X1YA 3ZQJA 1PV4A 1PUIA 4E07A 1FL9A 4LG0A 1R5NA 3SJAA 1ZBDA 4JJKA 4KLNA 2WJGA 1JEDA 3COAC 2ZVQX 2R62A 2ZFWA 1SVWA 5FB2A 1I6XA 3KP6A 1KK3A 2XASA 4BLOA 4DJTA 5E7JA 4ESJA 4WZ6A 3IL2A 3TSWA 4OBEA 4G6DA 3CUQC 3QP6A 5EEGA 3F8MA 2FH5B 2Q9CA 3FKQA 5E18F 2K02A 3V8KA 2Z33A 3F8FA 1HYQA 1E1RD 1MT0A 4PGHA 4RGUA 1H9GA 4GT1A 5CYPA 5KTYA 4I0BA 3EPJA 1MRSA 3RWMB 4BECA 1U8RA 1J59A 2C78A 2GILA 1FX7A 1G1MA 1QF9A 2GAAA 2N46A 3GJ7A 1TQMA 2VP5A 4TMKA 2O8FA 2CL7X 521PA 1UKYA 1XP8A 1BOAA 4XRFA 3QG5A 4R71A 4HB4A 2QP9X 3U61B 2EA2A 1WE2A 2Q3HA 5JMTA 3LWNA 4TMVA 5BMZA 3J80K 3SJCA 1AWCA 2HOEA 2J0QA 2O0KA 2CE7A 3KLOA 2OZUA 4MGRA 4NL4H 4Q1EA 5HDKA 3C5CA 1E4VA 1UF9A 1WA5A 1VIAA 3A1WA 2J1LA 3E1SA 4IDPA 1M1YE 4M2LA 5CVRA 5HTKA 1T98A 1KYWA 5AIQA 4RKEA 4IVNA 2ZSDA 3CH5A 3P32A 4V0OA 2GJSA 3KLNA 3BXZA 1L4UA 3MFYA 4OI4A 2QQ0A 2HLDD 3L9FA 1UAAA 3WGGA 5ICEA 2KWIA 3VU9B 1U0JA 2RGDA 3AUXA 2IA1A 5BPIA 1MJAA 5AUOB 4HZFA 4FMCB 4OHWA 1O3TA 2AD1A 4OHVA 4C9BA 4CEJA 2XXAB 5LDDC 1HT1E 1NJFA 2CG4A 4M0LA 1DDNA 3O8RA 5K5QA 1ZCBA 3AVPA 1G8GA 2W25A 1V3FA 3ELKA 3LQRA 3RRNA 3TO9A 4A0HA 4F7WA 3F8TA 4LJ4A 2YZ2A 3TSZA 4KIFA 3NBFA 3VNVA 3ZVMA 5L3GA 4V0NA 3K2ZA 1GXPA 1WQ2A 2M45A 1R5BA 3HIFA 4WK8F 1F2TB 1T3HA 1FUUA 3LVQE 4U7DA 4HDOB 1P62B 1G5RA 1ZYUA 2J0UA 1F1ZA 3L0IB 4C3ZA 2FA5A 2XVCA 5A5GA 2QP3A 1ZGJA 1GHCA 4JLJA 1OH7A 2G9NA 2LF7A 1VCIA 3SOPA 2ZSBA 1LF5A 3H4MA 3FMQA 2Q0OA 1GL7A 1YR9A 3EARA 2ERYA 2A30A 3LXRA 4HB2A 3KZ1E 1I4DD 4G01B 1H9TA 4XTRA 4P9FA 2VOPA 4NP6A 4Q1DA 3IDQA 1KGDA 3GZ5A 3K09A 2O0JA 2YNMA 1FBQA 2GF9A 4YFNF 1T38A 5E1WA 1L2TA 3U1DA 1X8LA 2BOVA 4NHOA 3BH7A 4LHYA 1G7CA 1ZGAA 3V8LA 3WGIA 1Q1ZA 2X2EA 3WMEA 3IUYA 1KU9A 1BIBA 3LX5A 4II7A 3CF2A 3TAHA 1YS6A 3F0TA 3KTAB 3FVQA 1GVNB 1XTQA 3GJ3A 1NVWQ 1RJ9B 3M4YA 2Z83A 4F93B 4U0VA 1VPLA 3ZZUA 1OHHD 5CB8A 3AVXA 4AG5A 2C98A 1ZM3A 4K46A 2BV3A 3BB4A 1O87A 3QPUA 1YZUA 4RB0A 3FX3A 1KU7A 4D81A 2QP4A 4FMBB 4OHZA 3P4YA 1WRBA 2KRKA 4UXNA 1SQ5A 1LB1B 2GZWA 2QY9A 4B6FA 2CNWD 4AIJA 3QE0A 1U81A 4OYHA 3O8CA 3V7RA 2E1CA 1VECA 1CGPA 4M4SA 4DIEA 2RGCA 3U2QA 1S8NA 1XDSA 1YIOA 3FMSA 1ZH5A 2VP4A 3KJHA 3F8NA 3U3KA 3PR1A 4LGMA 1IF1A 3KP7A 4QFMA 1RZ3A 4OK6A 3NH6A 2WPDD 3ZGXA 5HKKD 1AGRA 2CQKA 1MO4A 1ZLKA 2W85A 4KBGA 1RIOH 5B57C 4A8JC 3VR3A 1GNQA 4MUAA 4KNYA 3A1UA 1E0AA 1OSNA 4LK1F 2H6CA 2ZRGA 2ADUA 4PGGA 4UNRA 1LQ1A 1OLOA 3QF4A 4L9NA 5G41A 1FT9A 3B02A 1PZNA 3D8BA 3J80Z 4BZXA 4FWTA 1F9NA 2YU3A 3L2OB 1E17A 3OEEA 4KV9A 2XB2A 2NNYA 1P75A 5BW8A 4RVCA 5KNBA 1WMSA 2VP0A 2XB4A 4XIGS 4Q01A 4PC6A 4N0BA 2Q3MA 2DLLA 1HURA 5JZVA 5ICCA 4UQOA 3I62A 2O8DA 1OH8A 2QSYA 2IYQA 5AK0A 4FCWA 2EV6A 4P5OA 2ZI7A 2IWHA 3WMFA 5IT9K 2YOGA 5HCNA 3X1ZA 4RAZA 1R0ZA 4A15A 3CRQA 1N2CE 1SULA 4ESBA 4EPWA 1MJ9A 3DP7A 3B2EA 5BPDA 3VKGA 3I3SR 1Z83A 2G83A 3ND8A 4UNQA 2GA1A 2IYSA 3A36A 3ZMSA 1Q1HA 1ZRDA 1COWD 3FDIA 3IPYA 4NB5A 5HLIA 3QSYA 1O7FA 1XMIA 3RS7A 1TNDA 2ERXA 2Q9BA 1Z0DA 3N2EA 4KBFA 4MYHA 1GL6A 4OK3A 2ZE7A 4HAZA 4JMPA 3RS5A 5IF9A 4AIHA 1F6BA 1J9IA 4LX0A 3EW9A 4HX8A 4ZIRB 3KP2A 1IM2A 1HW1A 2BMEA 2GESA 2UKDA 2ZCWA 4IOLA 4N3NA 5KOYA 3G5UA 4EVIA 4HZUA 2A69F 1ZU5A 1LNWA 4TLAA 2LSOA 5ELXA 4OI1A 2QROA 4B3GA 4HV5A 4A0YA 4CEHB 4URXR 4H9GA 5FPYA 2VBYA 2A5JA 2IYRA 2JA1A 3QOPA 2WVJA 4KYIB 5K8LA 4QXAA 5L3QB 5JVTA 4OQNA 4KHZA 3CPJB 1P4AA 3BERA 3TNFA 5TVKA 1T0HB 3BB1A 4PHGA 5BN5A 3ZLJA 2QBYB 1TTYA 4ZCIA 1EG7A 2A6HF 2K5UA 2GTPA 4DEYA 3PIRA 1WF3A 4ZO4A 1B0UA 1R0XA 3DL0A 1FOKA 3MRSA 1L0OC 5EZ5A 2EVWX 2ZKZA 4KYUA 5DISB 1U6GA 3N5CA 5D5VB 3FM5A 3UWKA 5ILVA 3D6TB 1ESNA 3M7GA 1KI6A 1X1SA 4AD8A 3PQKA 2QMOA 2OV2A 4Q9IA 4JBYA 3T12A 1TEVA 1E9AA 1YW8A 4HLYA 4YFKF 3CO6C 2KI5A 4A82A 1W36C 2R2AA 2SHKA 4I81A 1E2HA 3RRZA 3IKTA 5KDOA 1G3SA 1DPRA 3MQ0A 1TAGA 3PCRB 5CIQA 2ZI3A 1JQLB 1MO6A 2GJ9A 3AVQA 4JVSB 4EPVA 3SJBA 1VDZA 2YPRA 3GCGA 5LBIA 2E1RA 5JSZA 1B6AA 3WGHA 3NWJA 4EIWA 4QJ3A 3RVBA 4B34A 3RHFA 1Q44A 2W6ID 4Q19A 1SVIA 1EFTA 1WB9A 1LVAA 4UVBA 1UFQA 2KBEA 3EZ6A 3SI7A 4DUGD 4ZKEA 4FXPA 4A3VB 2XGXA 1Z0JA 2CBZA 2CVFA 2PMUA 3WTWC 3ZS9A 1SHKA 4ESFA 1U2RA 2W2VA 3K09C 3ZZTA 1OKKD 4RFVA 4RZ2A 2DHRA 1KKMA 4BHBA 3WY9A 3QI2A 3A37A 2E7WA 3MWKA 2VTKA 4AI6A 4ENKA 2GEDA 2OCBA 1CU1A 1CF7A 2Z43A 3FPAA 4JLVA 5HVQC 4LC0A 1E32A 2MBFA 3RTRA 1DPFA 2Y8EA 1HUQA 3ICQB 1IHUA 1IJEA 1IN7A 5KDDA 4US2R 3QPTA 5IRCD 3U6KA 1KYZA 3VHLB 4PZJA 3WTZA 5GJCA 2YX7A 1Z91A 3BPXA 2H17A 3ABTA 3ZMVA 4NYJR 4NCJA 2FPKA 4IRHA 4GL2A 4BFYA 2UZIR 3V8JA 4CEIB 1L8QA 1G7RA 1QZXA 3ZQ7A 2LF8A 4LYAA 4FMCF 2GK6A 3GLIB 3E6BA 1G17A 1KZ7B 3QKRA 4RZ3A 2P6TA 3TKLA 5F64A 4I7HA 4G5SA 1KK1A 1OV4A 4NU0A 1TF2A 2VPPA 2AHOA 4P4UA 2GKSA 1T8UA 3TUZC 1TF7A 1TU3A 4NCNA 4RD4A 4RGRA 5LEKA 1N6RA 1Q57A 3GQBA 4TLCA 4DC9A 2HQRA 4G7ZF 1ZD9A 2VHTA 4LJYA 1N5IA 2PX3A 1F5TA 2ZRDA 3AGPA 4UNOA 4ILEA 5FUVA 3TOBA 4AD9A 2JZYA 1SKYE 2XX3A 4GMDA 4DBLC 4D0LB 3C18A 1M6NA 2RGVA 4NTZA 4Q5IA 3HDTA 3OESA 4LCBA 5JJIA 2DZNB 5DCFA 3VR2A 2XSZD 2V54A 3HPRA 3QKTA 3RYRA 1SKQA 3B1XA 1GG2A 5LHIA 1D8TA 3AB3A 2LKPA 2OD5A 3B5JA 3K0AA 1U3EM 3LV8A 4I1OA 4R7ZA 2PLFA 4B75A 5CM8B 4IRGA 1ESMA 2FSHA 3W8NA 3DZDA 3EXAA 3R7WB 4ABYA 3I58A 2GF0A 4MDEA 3SJZA 2J5PA 2HFHA 2RCNA 2PMKA 4Q4JB 4KJZA 3K1JA 3CB4A 4HDQB 4V02A 2ZUDA 2RH5A 2DAOA 3M0EA 2QU8A 3QY0A 5CVVA 2IS6A 4UUVA 1NN1A 2V9VA 3CRRA 4LYFA 2C8VA 5TV2A 4RS8A 1I4LD 3LDAA 4LBZA 5LPNA 2BE5F 4C0QC 1OXVA 5F98A 1XEXA 2R9VA 2DT5A 4B3DA 1O3YA 4I98B 1W2GA 2L3DA 3REOA 1D5VA 1AM4D 4HLXA 1GNPA 1XD9A 2CK3A 2ZRMA 3VR1A 2FPLA 5HOOA 1W2HA 1HE1C 1IN5A 4MKFA 1D5CA 5HS8A 1T9HA 3B85A 4PXAA 4URUR 4C0KA 2H6BA 2RN7A 3P9KA 1R4AA 4OL0A 3K70C 3UKDA 2CVHA 4HYYA 5LGTA 1D2EA 3EIHA 2M8EA 3Q5FA 4LYHA 3BPVA 2V55B 2AK3A 1ELOA 1WSUA 4CT4B 2H57A 2PJRA 1HXDA 2F1IA 4GP6A 5DYGA 1XXHB 2CJWB 4I4LA 2P67A 2WIBA 4DSOA 5FL7D 5FI1B 1YVDA 1U9IA 2PLRA 4WVFA 3TR0A 2GZHA 2NMVA 2D62A 3KQLA 1E2XA 2MLKA 4GZMA 2ZRIA 2MH2A 1WP9A 1FNMA 4IVQA 3K9GA 4MYUA 2H5EA 4BGDA 4R1HA 3TGNA 5H8WA 2RKHA 2ISYA 3C4JA 3K69A 3GEEA 1GOTA 1E96A 3I59A 3RPQA 3B13B 1Z9CA 3U3OA 1IXRC 5KNCA 3H1TA 1U5TA 2CW0F 1FUKA 2QQBA 3THXA 4GSYA 1QG4A 2HYDA 1RPZA 3FHCB 3LNCA 4HF2A 4QGGA 2FE3A 5KYKA 3CWZA 1X8JA 1XX6A 3JVUA 3GFJA 1W36D 1T91A 3ONWA 2MLGA 4RSGA 3WRXC 3LQQA 1XD7A 3DPTA 1AGPA 2DY1A 2G1JA 3ABUA 3NG1A 2W58A 3TBKA 4B47A 2JT1A 4FWGA 3IQWA 2YV5A 1CF4A 5K8TA 4CIDA 2DCUA 3GLIE 3LFUA 2WAXA 1KA8A 4Z54A 3PQCA 2O8BB 1LS6A 4NYJQ 4ITRC 1LW7A 3CW2A 2F9MA 4G7OF 4RCZA 4KN4X 3MSXA 2WSSA 1NVXQ 1G8FA 4QJ5A 5B30A 1NY6A 4LGWA 4MKGA 5DCMB 3DFGA 1I2MA 2ZITA 3RPUA 1OXSC 3PITA 4R9UC 1P2SA 2JLVA 4N9HA 1KI4A 4OHXA 2D1HA 1AN0A 2IP2A 1OPCA 2QQ9A 2DPDA 2BBSA 2I4IA 3GZ6A 2OXRA 3THYA 3CUQB 2FSGA 2P7CB 1FP6A 2BKUA 2ZJAA 3ERED 5LBQA 4B71A 1Z05A 3UPUA 5H6RA 3R6SA 3QBVA 1CP2A 1X6VA 2ZYTX 2ETHA 3L7WA 3IQXA 2NO9A 3KJGA 3ULQB 4CICA 2IBMA 4M53A 4YC7A 3GPLA 1Z0KA 2E7XA 2C5LA 1C0WA 2VIIA 3BFVA 1OIWA 4DSUA 1E0JA 3V9PA 4A2PA 2QAGC 5A2QK 3ZYCA 3VKHA 4KMUX 1ZRFA 2XJ4A 3EX7C 1G16A 4LDJA 1DP7P 1E9FA 5JS7A 1MDMA 3ADDA 2FGKA 3TQFA 4FI3C 4LV8B 1X3UA 2DTRA 4XTCS 3B9QA 3P1JA 3NTUA 4Q9KA 4N9IA 4JLAA 1JJ7A 1GL9B 4LJ9A 4XWAA 5FI0B 4DLXA 4BEJA 3LW7A 4KFTA 1KDOA 1NI3A 1QVRA 5CK5A 2GIVA 1YZGA 1J2JA 1G3YA 1EFUA 4KI0A 3B82A 1PP8F 3QJYA 1RI7A 4U88A 4FINA 4B43A 2WZQA 3QU6A 3CX6A 3C1DA 4L9SA 3GEHA 1LV7A 2MA3A 1DAIA 4CXFA 4S04A 2DK8A 1B23P 2RAPA 2QPAA 1CLUA 5E4FA 3ND9A 3IIMA 4NCHA 1XMAA 1VYUA 3C15C 4M74A 1FWZA 4FX4A 3C16C 2FMYA 1F2UA 2WTEA 1DG1G 1NKSA 2TDXA 4L0ZB 4LI0A 1GKIA 2BEKA 1FYLA 4KYWA 2J46A 4M1SA 4JYBA 3PUVA 3IGFA 4BRUA 3I54A 2DBBA 1T8TA 2FPMA 4G3XA 3W8RA 3MLEA 3OFNA 2WV0A 5KU1A 3HTSB 3NH9A 3K1PA 5GVRA 1XD8A 1FP7A 4PFSA 1TL7C 121PA 5HDGA 2KIMA 2DFKB
chains in the Genus database with same CATH superfamily
1ZOPA 1Z6RA 3OLXA 4WKBA 1FJGM 4C6HA 5HS4A 2M1XA 2OL4A 4BP9A 2VN8A 5EPUA 3ZG6A 4QU8A 4TLEA 2HSEA 4GHAA 1YZFA 3U39A 4F46A 2HNBA 4YMSA 3PUYA 1IU9A 1K7YA 3S14J 4QPJC 1AGYA 2OOAA 4F5YA 5FFXA 2UVPA 2VYNA 1RXVA 3A4LA 3VR6A 2V6FA 3Q6MA 4W5WA 1R0KA 5FR1A 3LSYA 3A2KA 1EAYA 4GI1A 2WFAA 2XUIA 4XGQA 3IP3A 2CYAA 1X1AA 5TR9A 1TF0B 3IH3A 2V0CA 4A3IJ 2FZKA 4XJSA 3UMJA 1HV8A 3R3WA 2HA6A 3BZBA 4U2KA 3LWDA 3GY0A 1NSTA 1M1NB 1NQUA 1L6IA 2E87A 3RS2A 4RKQA 1WXFA 5FBQB 1Y42X 4I1SA 1YMUA 3PPIA 4ENNA 3BCHA 1XJ0A 1LE8A 5E95A 1SHLA 3E7XA 4M8IA 5D6FA 1MP0A 2IH4A 3OYEA 2O2ZA 5LMNM 1BE0A 3WZMA 4M9CA 4HT3B 4TKUA 4CIYA 4AJKA 1MIOA 4H4DA 2ACKA 4RYDA 5F4ZA 4DLLA 3KAJA 1TJPB 3I9LA 4I4NA 3ASOH 3KB6A 3NHZA 1G8AA 3ZE2B 1K75A 2KP6A 1IL0A 3SHQA 1OR7A 1F5SA 4V1CA 2HSJA 2CLMB 1F60A 4JL6A 2ZB9A 2XUKA 1U4OA 4XE5A 4I5SA 2FR1A 3LLCA 4M22A 5E79C 1J23A 5IJ0B 3KCCA 2R8BA 1WGLA 2X0KA 3KJIA 5FTKA 1AOXA 4WWCA 4LJ7A 1SBNE 1WBDA 2JZCA 4ZI3A 4PCQA 4RIFA 1CUEA 2HF2A 1YHYA 4JKYA 4C2UA 1T9AA 4REZA 3VDNB 4IIYA 1JSRA 2OZLB 4JP3A 4LVOA 2RC6A 1Q7TA 1P6UA 2WE8A 3HP4A 3NFYA 1A96A 2E5NA 2RVCA 3OJ0A 3KSUA 4XN3A 4FR5A 2ZUUA 1F3OA 3ORSA 3KPJA 3SZRA 4QG3A 2PEXA 4MW6A 1IPHA 1ZX1A 4PG6A 1D2GA 2CMHA 1NVTA 1US8A 2GHQA 1MN3A 3S93A 3OQVA 3GWGA 4BO8A 4TQAA 1M10A 3IVXA 1X4OA 2XWJI 4L15A 1AIPC 4OUDA 2C92A 2EKPA 1Q83A 3U60B 4S2UA 4ND6A 3BXWA 2HU8A 5TF0A 3T06B 3SDSA 3O38A 2A9QA 3UV3A 3MUNA 4HZUB 2J5XA 4BNHA 2NXNB 5EP2A 3EPJA 1VJTA 4CMCA 2IXDA 4ZKDA 1OLUA 3TQNA 2ZBVA 3KFWX 1M34A 2RHHA 4NC7A 1YSYA 4LZNA 1WU8A 1ISPA 1PO7A 3S2GA 5E8GA 1R0RE 1F20A 2PO7A 3NEJA 1W0KD 1FBNA 2QORA 4DUZB 4ZT4A 3EG9B 4P54A 1PNOA 5EP1A 2I2BA 4IEIA 3LLSA 3A4TA 2O2HA 4FIZA 5KYTA 1OLXA 4M8KA 1C81A 5KYGA 1U0HC 3EGVA 2FWRA 3KLPX 4KOEC 4D5CA 1MNQA 1NMXA 1TEHA 1Y81A 1CUUA 5A4IS 3SKXA 5LYYA 1VQ5I 1IRGA 4L5JA 5B3AA 2YZNA 4DCGA 3DV0A 4G4JA 4AS3A 1TAUA 4YUZA 1JTEA 3QVJA 2HOAA 3LVFO 3Q1LA 1NVVQ 5I7EA 2RGRA 4NHEA 3WNVA 4ZK2A 3TQTA 1FW6A 4DM7A 4QDXA 2YS7A 3JZAA 1U99A 4JKIA 2QZZA 3BJIC 1VQ4I 2DMQA 4QIWN 2OGTA 1JFSA 3LL4A 2C82A 4QG7A 1TTHA 3AK4A 1GUAA 2EJRA 2QTLA 1VCNA 4KZPA 2Q5EA 3EEIA 3V6MA 2AQFA 4ZYGA 4KAJA 4HDNA 4TMTA 3X2FA 5HNFA 4GUAA 4NBKA 1UL1X 2I8DA 2HPMA 3MAJA 1R58A 4IXDA 1II9A 1O4VA 2FR8C 4JA2A 1E7QA 3G0HA 3SQOA 3KKKA 4LF7B 3KJFA 2W5UA 3W7AA 1MGTA 1I5ZA 3WQQA 5KB3A 3FOZA 2RK4A 2F3RA 4DLPA 2P6NA 3BC8A 3HOUJ 1FP2A 4A5NA 1GSIA 1KAQA 1H2FA 2OC9A 5EWLB 3ZMTA 5M29A 1BJTA 4MGYR 3MTBA 1W5TA 2DWCA 3VNBA 3CVWA 1IULA 3LYAA 5F77A 3J81Z 1LD3A 2P6OA 2AS0A 3B3QA 3BM5A 4YQZA 1F2UB 4KUGA 5HPYB 1OI4A 3WSTA 2EJWA 1M75A 3M9AA 4URZR 5CB0A 2DWOA 1W4CA 4V0KA 3AHCA 3PUWA 1SD4A 4YT8A 4Z7QB 1BNCA 4O0LA 1APBA 4BNFA 4PZEA 4K9PA 4Z6KA 2I80A 4NDAA 3GTGJ 4J3FA 1ZR4A 1QHIA 4KMSA 4YRTA 4OJYA 2HV8A 1G64A 4E7HA 3DBHA 2D2IA 3HVUA 3CRW1 2NT3A 5J59A 1T26A 4K8RB 4MRPA 2F7SA 3SX0A 3OIDA 1LU9A 4EJMA 3V2IA 3PXEA 2OY0A 4XQCA 1PWEA 1E2LA 4GITA 5BR8B 1FX1A 3H0CA 2YYZA 1E2PA 5KEIA 3L7LA 3UJ7A 1VPTA 4N8DA 1XC5A 4CXMA 4CCAA 3MKZA 5HIAA 3R23A 3CVOA 2O8NA 3E27A 2P9EA 3OIVA 1QZYA 1J70A 4L5EA 1PZFA 1JBKA 3B6EA 5CM9C 3AB8A 4DV6M 3HOTA 5BY2A 4AZWA 2JLRA 2PCJA 2QSGX 5FAXA 1FP4A 3HN7A 2GZDA 3SBOA 3KE2A 4EHDA 3IE2A 1FFSA 2BCEA 3DFKA 5EKUA 4HUQA 5CCEA 1GAEO 1UMDB 2HD4A 2PWYA 2WWGA 1WSWA 2HRBA 3L8HA 1ULSA 3H36A 5C1IA 3Q8XA 2ZZMA 4WAUA 2CF5A 2JVJA 2VHQA 1OMIA 1B74A 3UWMA 4MUHA 3RU3A 2OD2A 4RF4A 4G09A 3ZDFA 1NSYA 2QS9A 1TD1A 5C5EA 4DPKA 2VEOA 5HIKA 2ZBKA 4YHHB 5HLHA 1JAXA 4RE5A 3HCNA 3CR8A 2VLAA 1JA9A 2HWXA 1ZARA 2G0NA 4ZAZA 3IBYA 4IXWA 2O8CB 1O89A 1D4FA 4CM8B 4IOJA 4JIMA 1WB6A 1G59A 4H7FA 4RLHA 3DQZA 2C4VA 4A0GA 4R69A 4BB6A 2QZ8A 3L1IA 1MH4A 2KE5A 4X0GA 1ODKA 4XKWA 1K92A 4B7ZA 1JWBB 1NZFA 1S4QA 4BYYA 2DODA 1ZUNB 3EXFB 2HQ1A 4XCQA 1H1DA 4M1WA 1MD9A 2LNBA 2R6DA 2CUTA 4RM3A 3BA6A 2QVOA 3HG7A 3GFSA 1ZLJA 2J7OA 3ASUA 1JNYA 4QPNA 4M73A 1VSTA 3ZP5A 1XN1A 1ZMTA 4XSXF 4GYIA 3H3FA 2A9KA 3B38A 1BYUA 1K7FB 1P9NA 3SZMA 2ZU6A 1M5UA 3BH0A 1MW7A 1OTRA 5ALFA 1KFKB 1JT0A 1GZ6A 5IARA 1M76A 3MZ0A 5DASA 3AUYA 1KJWA 3GRRA 1AKQA 2KLHA 4WJKB 2I9KA 2CLKB 4JR1A 4U6SA 3FR8A 3COWA 5HS6A 1WSBA 4NBSA 2JANA 3KKOA 3Q3EA 4CKYA 4KIWA 1S02A 5I4BA 3WU0A 3ZGKA 1OZ0A 3MMZA 1OZHA 5DHFA 1QHNA 1AQLA 3KTDA 3W5HA 2XF3A 1GGKA 3BDAA 3MT0A 4QSMA 5SY6A 3IMEA 3VU9A 1NVVR 1DAGA 2Y1EA 2BMJA 2G3YA 1Q7CA 3WK8A 2HU9A 2YIJA 2GAIA 1TVKA 1YE5A 4QC2A 4OXXA 4MO2A 3ZHXA 3EA5A 1SUWA 3LAJA 4GWKA 2XYRA 2ZT8A 3TJZA 5IZCC 1GGVA 3WG9A 3IEVA 4CH7A 4ZI7B 2ALJA 3IO5A 3OAAD 2OFPA 2AA3A 1YXMA 4DV0B 3KZNA 4A1OA 3D5SC 4YAOA 3E9EA 4NQWB 1QNLA 3AEXA 5EJMA 2P69A 3I09A 3JQ8B 3H84A 2QAGB 1P2UA 3B6CA 4NNJA 3RJZA 2GAOA 1A77A 2QTTA 3DKPA 3U21A 3EYIA 3T7IA 1FMVA 4C4RA 5AWFC 2E18A 1SZPA 2YXNA 1TFRA 5JJLA 2PRZA 3H16A 4DIFA 2Y1DA 2RAFA 4X6LA 4CKXA 5HEKA 5EY5B 4H1WA 3SQXA 2O5RA 2SNIE 5IOZA 4XD7D 5BNGA 4GYYA 5CDFE 5FFZA 5JG7A 3EG9A 1DKPA 4LVUA 3HOVJ 4RESA 2NP7A 4Y2VA 1P39A 1CNMA 4DWVA 4ZVPA 4YH1A 3O2PE 5L3QA 1ZINA 2R6ZA 4LFCM 4JQZA 2JVHA 2ZBGA 2JCSA 1YHQI 3QLTA 1SBIA 3N86A 2FQYA 4OBBA 5A0TA 3EXHB 3HI6A 4BLUA 1W85A 4UEOA 1OH6A 3P2JA 3B6IA 3FF5A 4J6FA 3D02A 2JHFA 4RIGA 2ZTSA 1C3EA 2JLUA 5LZ5A 4RTRA 1VC2A 3K0LA 4U00A 3ECSA 4K2EA 2OPBA 2J30A 1RE1A 3R6WA 4J0FA 3I4VA 2CWWA 3DSRA 1TKCA 3N07A 3UKOA 1X74A 5EXXA 2YWFA 2OCDA 2L6OA 4M55A 5I3CA 2IITA 2QPTA 1WXEA 3K1YA 4XB1A 3VBEA 2VH2A 2ZIFA 3SVLA 5E26A 3LBHA 1CERA 4BE1A 1OH5A 1T5LA 5FNVB 3BMXA 3WK9A 2CDCA 5DSTA 1H4VB 5IP7J 2Q4RA 2RJOA 2F5DA 3FXLA 3JQ7A 5D01A 4YUWA 3NHLA 3PC3A 2XQKA 1CDOA 4J90A 1Y1RA 4HDRB 5ESXA 1HG0A 1PRYA 4Q3KA 4H60A 3MJRA 1JR2A 4FD2A 3D7MA 4DLYA 1E2EA 1R22A 4ARAA 1Y5IA 2WAYA 3GFRA 5CU7A 4QGHA 4UBMA 1HT2E 1IFYA 5B4TA 2YXPX 2CFIA 4PO8A 2ZJ1A 4AYXA 4OH7A 2EKDA 2XROA 3LUGA 2B30A 1TLFA 2NW6A 2ROQA 2FJ1A 5FORA 3N76A 3W77A 3GLGE 5CNKA 2ATVA 3I12A 2H1LA 3GJYA 1Z3CA 3PNBA 1RQ2A 4Z1MD 3EULA 2O8BA 3GN1A 1TM2A 3V2UA 4JI3B 4LDQA 3AY3A 5DCMA 4CMJA 3LY8A 2GM9A 1P4JA 1Z7GA 4X7PA 1RAFA 2G9RA 2DECA 1JDVA 1PL0A 3F6VA 5DD8A 2WYHA 4X94A 1KQ0A 6PFKA 3QEAZ 3EC2A 1CFZA 2P90A 3T5PA 2M30A 1D9ZA 4W97A 1IZ1A 5H5JA 5KYUB 1QRUA 2A86A 3G68A 3I6YA 1ONBA 1G2HA 4REMA 1M0TA 3OY2A 3BJOA 3SVZA 1TH2A 1JUSA 3X1JA 1E9RA 3HKCB 3NVKI 2OG1A 4N3CA 1OAOC 2I2XB 2PG3A 2Q0QA 4RD1A 4IJAA 5JXWA 1T9ZA 3AG6A 4L8LA 3EGWA 4F96A 1VGQA 3S2ZA 3JAKB 2XT6A 4HW0A 1FLDA 5IT0A 1WVGA 4BU2A 2LTPA 3GNTA 5BQOA 3AYXB 5IWAB 2CEKA 3SSMA 5EEHA 3NWPA 5F1JA 3TPZA 2R4EA 3WVNA 4B8YA 2DJIA 4BBZA 5CLJA 3VO8A 2BMFA 2FFHA 4HX9A 3RDPA 1Y3CE 4MIKA 2JGEA 3FCOA 1EH6A 4ZDIA 4FJ0A 2C42A 1XF9A 1WU7A 2ZRBA 1FB5A 4GM1A 4U2BA 4WN3A 1OIXA 1RLMA 2JFOA 2ZUWA 4GMQA 2BFBB 3K4LA 1H69A 5IUJC 4HATA 4TWBA 3V3KA 2H8KA 3ZQJA 3WZLA 1P4RA 4C4AA 1W5EA 4LG0A 5FWYB 1UOQA 1YF3A 3DLPX 4KE8A 3WL4A 2XASA 1UJNA 10MHA 4QXRA 3BTOA 4G0ZA 3K6RA 4RGUA 5C34B 5ALYA 1T9GS 3QG5A 4DQVA 4BUCA 1MB3A 1QRRA 1SY7A 5C32A 4RKEA 2X86A 3KZIC 1HLFA 2VQ3A 1DDNA 5EWMA 4GD3Q 1V3FA 3WFJA 2XCSB 4WLVA 4LJ4A 3TTVA 2CYBA 3CISA 4RK1A 4PGAA 1ZUNA 4IHAA 3L0IB 1ENZA 1U8TA 2QP3A 2KYRA 4M54A 3FMQA 1BHQ1 2XZFA 4HMQA 4O02B 3A0RB 2C83A 1OFUA 4HGPA 2GF9A 5E1WA 4LIPD 2L09A 2XSDC 1HYEA 3UMMA 3LX5A 3PC2A 1TM7E 1J5EB 3TAHA 2HA4A 4HADA 2OTJI 3AVXA 2MCFA 2FDXA 1M6VB 1IBMM 2BV3A 3SIXA 4V0RA 2E34A 3C6MA 2RC5A 1XYGA 3PWSA 3UB4A 2Q6VA 1XDSA 1U3CA 4FTWA 2WPDD 2W8BB 5E6UA 5JBIA 1F6DA 4KNYA 4TMYA 4JYMA 3AMVA 4UNRA 2Q6LA 1AUQA 4F1WA 4FYIA 1GEGA 4A3MJ 3O1IC 4RVCA 3SM3A 1IJKA 1RZRA 4HWTA 3HEBA 1ZAEA 1W59A 1FOWA 2IWHA 5IT9K 1ZV1A 3PNPA 4RAZA 3CVVA 1NPYA 1Q14A 2SKDA 2G83A 2X1MA 2ZYIA 4KACA 3JARB 4RF5A 4B3RB 3GFVA 3TZEA 4JMPA 5FKNA 1J9IA 4BGEA 4PYNA 5CNIA 3EPZA 2DA1A 3VVBA 5A2GA 4HV5A 4FOTA 1APLC 1CQTA 1KJQA 2GOMA 1EK2A 1IHDA 4MXDA 4PHGA 1K98A 2K5UA 4UCQA 1WH7A 1VLVA 3QE3A 3UICA 3H8WA 2OV2A 4NC6A 3HDHA 1NV8A 1FUIA 3SFTA 3W8FA 4CKEB 3GXBA 3FYUA 3M2TA 1A4UA 1RHQA 4NVRA 3LSRA 5DBEX 4BLCA 4AZVA 3SI7A 5FXMA 2BFFB 2CBZA 1YL6A 3ZS9A 1V1RA 2YNMC 1OKKD 3JQ8A 2DHRA 1R9JA 1E32A 2MBFA 4IINA 3FOEC 1GSOA 1R50A 1IN7A 5IT9S 4CTKA 1KYZA 2YX7A 3U40A 3HBMA 5DNWA 3P5BA 1KZ7B 1CUSA 4PLPA 4MVJI 2QKMB 2NUAB 4X63A 4DC9A 4EYGA 4KPEC 5KYWA 4LCBA 3CRNA 4B9EA 4I1OA 3ESZA 4Z9FA 3R7WB 5T5QA 3MRTA 2GF0A 2PXHA 4YVFA 2XVZA 3K35A 1E58A 5TV2A 4LBZA 3QLUA 2BE5F 1VQNI 4OTZA 3OIPA 3D8LA 5REQA 3MZ8A 4D5FA 2GPSA 2H6BA 3EUFA 1J1IA 1HC8A 4U7WA 1NNUA 4HDKA 5ITWA 2ID4A 2FZGA 5AVVA 2Z8YA 2Y30A 5CEFA 5NULA 2H11A 4OXKA 2FP4A 4YHHM 4MYUA 2EKLA 2XRMA 4KN6A 5K20A 2RKHA 1M2VB 2DWUA 1Z9CA 1SFKA 2Q2OA 3ELBA 1DLJA 4NR0A 3CWZA 1LFPA 3GFJA 1Z3YA 4KK4A 5L6LB 3HMQA 3PLNA 3TBKA 3G0GA 4TKMA 3J7YJ 3VKUA 4KL8S 4P9NA 1ISFA 1G8FA 2PFKA 1NY6A 4LGWA 2PUWA 4N9HA 3IQEA 1ZOLA 3ERED 1Z05A 4C2AA 3H6HA 4IQ8A 1V5IA 1PJJA 4AMVA 3UOGA 2CQ7A 2XMCA 1E9FA 1QVTA 4F04A 2BOLA 2XSJC 1JJ7A 2ZJFA 1KDOA 2AN5A 2B9EA 4PVDA 4PRZA 2DUMA 5HGXA 1LV7A 2OHIA 1XMAA 1V8BA 2WTEA 2AOVA 3TEMA 1KFCB 2D7GA 1T8TA 5CLFA 2G09A 1X7WB 5KU1A 1T9DA 1K06A 5LZ7A 1TVMA 2QRMA 3S55A 4GWLA 2QRPA 4D4HA 1ZG1A 3AR4A 2HKJA 1ZNQO 2QTFA 4F91B 3MJ4A 4CDGA 3UVEA 1YRLA 4EW2A 3ZDBA 3HCAA 5BSTA 4WFIA 4G7HF 2ZYWX