2FNAA

Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
357
structure length
352
Chain Sequence
GMLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIMSGSEMGLLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSKCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Atp-binding protein
molecule keywords Conserved hypothetical protein
publication title Crystal structure of a novel archaeal AAA+ ATPase SSO1545 from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 128
structure length 352
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01637 ATPase_2 ATPase domain predominantly from Archaea
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2fnaA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fnaA01
4HUQA 3KQKA 2ZQ5A 4ZYEA 1N5IA 3VODA 2BM0A 3L2CA 1COWD 3BOQA 1VECA 3OZXA 3H3UA 2ZSAA 2FXAA 1HTWA 5FOVA 3THXA 5D5XB 2BMJA 5DD8A 3I1FA 4UNOA 1F2UB 1II8A 2OE2A 3T61A 1U9IC 3TW8B 4JQFA 2DYKA 5JVTA 5L3GA 1X37A 2J7PD 1U9IA 2EFGA 1I2MA 2JSCA 3C5CA 4MITA 1TEVA 2GDJA 3FX3A 2H17A 4FX0A 5D8KB 2TMKA 2WIAA 2QEQA 1A2BA 2ADUA 3JSOA 2GCOA 4MA4A 5AR1A 5DN6A 3IILA 3MWMA 2J0VA 4ARZA 1VKJA 3W34A 3J81k 3K0SA 2PT5A 1QO0D 3D0SA 3Q5EA 1IHUA 3QKSA 4KLZA 1E9EA 1E94E 1N5JA 1E2DA 2MMGA 1ZMXA 3WY9A 3LFUA 2A78A 3GMTA 4EMSA 4Q4JB 1ZM3A 3W8RA 4L9SA 2NO1A 1YZTA 1XMIA 4EPVA 2COMA 2HLDA 4AKEA 5E17F 2G6BA 3HOTA 3KL4A 3A37A 5GADl 4QM6A 2O3FA 3GFOA 1P4AA 2FWRA 4EGZA 5FI1B 1QVAA 3GFMA 4O6JA 1Q44A 3LA7A 1JXOA 1DEKA 4H9GA 4G6QA 1ZM7A 1VHLA 1OPXA 3TKLA 4DKXA 4XLPF 2RGCA 4PX9A 5DIFA 4P4TA 3RRYA 1Z0AA 4KU4A 3QSYA 1HT1E 4UV8A 4UVCA 2N46A 4GP7A 1Z0IA 3ROUA 3ZYCA 2M87A 3KJHA 3GLFE 3T8TA 4PAMA 1SD6A 3KKOA 4EJVA 1K78B 1YFHA 2GESA 4J0QA 2ZVPX 3C16C 5FOWA 2ZO4A 1RJ9A 4Z8YA 2PEYA 1CR2A 3QPVA 1ZG3A 5D4RA 3RJPA 2QTHA 4Q7JB 3FVQA 5J4YA 4JBYA 3I59A 2BWJA 1L7VC 2P5KA 5C18A 2WWGA 4U88A 4JMPA 4NHJA 2EVWX 4TSFA 3WTZA 2IS2A 4LYJA 3LQQA 4M71A 5KVRA 2HYDA 2P5SA 2V4ZA 2Z5FA 2FSFA 4HLUA 3Q72A 4ITRC 2QPAA 4IHSA 3WMFA 3QPHA 5EXXA 1BI3A 3FMSA 1Z5ZA 1X8JA 4TLCA 2VP2A 1DO0A 4OIRF 3DM9B 2GKSA 2O0KA 3HR8A 3RWOA 1HSTA 2GWRA 1T3LA 2F5CA 2JPBA 3NH9A 2NZJA 1T5LA 2G9WA 3BS4A 2W0SA 3FE2A 4MQBA 4RZ3A 4C30A 3P9IA 1N6IA 3U9GA 1HW1A 3SYKA 2ELHA 2O03A 2VBCA 4BE7B 2WKPA 4KYUA 4RD0A 4TL6A 3SBEA 1ESMA 2OU2A 5J8FA 2I1QA 2GJAA 4PHGA 1QGPA 2R65A 2GHIA 4CW7A 3GF2A 2DQRA 3B13B 1O3SA 2VLIA 1RIOH 4IW3B 2FA5A 2E1NA 4RB0A 2IPQX 1N6OA 4FHTA 5DUKA 2Y8EA 1ZU4A 5KNCA 2VIIA 4PANA 2CQKA 2RB4A 2J0UA 1NVWQ 6Q21A 2G88A 4UVBA 2VA8A 1NSFA 5D3MB 1SKQA 2OLJA 1BIAA 3C7JA 1B6AA 4YFNF 3BH6A 4DWJA 2DAOA 3M4YA 2IYWA 1HT2E 2BM1A 3F6OA 2O0YA 5KUTA 1P2SA 2DZOB 5HCIA 3M8FA 1TADA 4EFNA 5J47A 3TOBA 5L3SA 1S3JA 1R5OA 2Z4SA 4PZLA 4A0YA 3FZVA 1TLHB 3GX4X 2OSBA 5SZHB 4DVGA 5DCMA 4Z54A 1WP9A 2YJTD 3VU9A 2V1DA 1ZAKA 5HKKA 1M74A 1DPFA 1OHHD 4D0NA 2YWGA 4BPBA 1P6XA 2GQQA 1XJQA 4MYHA 4KAXA 4PTLA 3TUJC 3RANA 3W6OA 3LAPA 2WHXA 4LV6A 3PUXA 2CEAA 2VBWA 1H8HD 4TWZA 2O8CB 2MBFA 2WV9A 4PC1A 2RMKA 1NG9A 1GIAA 2OXCA 1SFXA 3K8YA 2PLRA 1T0FA 4OQXA 2QBYA 3OV8A 1G7CA 2AWOA 2H8KA 3QENA 4HZUA 4NYMR 3FXQA 4JLKA 3PUYA 4O0MA 4IOLA 4BFWA 1G5RA 4LHZA 1UB9A 1KI2A 3AVWA 1ELOA 1R4AA 1YHNA 1LJ9A 1LV7A 2RGGA 3RLFA 4PAQA 3NEJA 2A3SA 4LJ8A 1BYUA 2ANBA 4LYAA 1T38A 1AGRA 3L8ZA 1LTQA 5HPYB 2R7FA 4HF0A 4OJKA 3AV0B 3M8EA 1G3TA 2IYZA 2W57A 4HAMA 1E4YA 3QVVA 4QOSA 2RGVA 2YR2A 1CTQA 1YZKA 3CUOA 2ZR9A 5L3EA 3V00A 2J87A 4FXPA 2K7LA 2EFEB 4BEBA 2WIBA 2IJLA 4DT1B 2LF7A 2IXGA 4QGFA 3TMKA 1JQJC 3TR0A 5L3VA 4WK8F 1FP7A 2W6IA 3C8UA 3R7WA 3RI4A 1LEAA 2HCBA 1OMIA 2OG2A 2CHGA 1ZRHA 1G3YA 3FMQA 3QAHA 5ICCA 2D3WA 4HV5A 4UQOA 3U2QA 1ODDA 1ZREA 2PI0A 3K70D 5HDKA 4H0EA 1ZG5A 4I2OA 1GL6A 3TKYA 4KJZA 4MKHA 4YMVA 1YW7A 2UXXA 1TL7C 3K1MA 3W5JA 1X3SA 1KKMA 1FTNA 1W47A 1AZSC 1YZLA 1KMHA 3AF2A 2CWEA 3SR0A 4HX7A 1VCOA 2CL0X 4DSOA 3DXJF 4G7ZF 1L0OC 3NTUA 2RVCA 2GWHA 3MAAC 2QM8A 4CXFA 4PC3A 3MFKA 1U8YA 2P65A 1JEDA 2MC3A 1D5VA 4EIWA 5HVQC 1Q12A 4C0QC 4DUGD 4Q4AB 4TMWA 2FSGA 4EPRA 1RIFA 5K5OA 3SYNA 2AN9A 3GXOA 2VODA 2F1IA 3RRMA 5A2QZ 3LX8A 4RCZA 3BJAA 1MABA 4OHVA 2GZHA 5KSYA 4Q9IA 1CIPA 2X2FA 4LJ4A 1T6SA 1WMSA 1E0JA 4H1VA 1IXZA 4LJAA 5EXTA 4D0GA 4LHXA 4W5JA 4QHTA 3QXSA 5K5QA 4LGMA 3QKRA 2XAUA 4LJ9A 1W4BA 3QXHA 1OH6A 5P21A 4LZZA 3F23A 3RC3A 3V7RA 1W4CA 1TQDA 3WU1B 5F9HA 4D4MA 1RW4A 1US8B 3RKXA 2CLSA 3WU0A 2OAZA 5FUVA 2AXPA 2IA5A 1GXQA 3TR5A 2M8EA 5DYMA 4A2UA 2NO9A 3I5YA 4ESVA 3IEVA 1G3SA 2KJBA 1F1ZA 4MHGA 3IUYA 4CEIA 1G6NA 1KI4A 1HH4A 3O8RA 2UZKA 3WGHA 1XSVA 1AZTA 3HOSA 3KKNA 3KFVA 3W5IA 5DN6D 3GEEA 3FHTA 1II9A 3HSEA 4C3ZA 4BQAA 2VOOA 1J8MF 3MQ0A 1OH8A 1L3LA 1UBCA 3E6MA 1QHSA 2FE3A 2WJGA 4US0R 4N9HA 2BBYA 1NF3A 1W0JA 4LBWA 4ZV4A 2L01A 2HLDD 4WZAE 1HSJA 2BCGY 5DI3B 1H9TA 3KUCA 4QGGA 2X4HA 1G7TA 4E03A 2RCNA 3NRVA 3ZVRA 4RFSA 1BOFA 2WMOB 4A2WA 1CBUA 3LVQE 4Z1MD 4Q1EA 1TTTA 2FA9A 3LAWA 3VB2A 1CGPA 3F3XA 4EJSC 4L9TA 5F6FA 3RC8A 1ZUHA 3LBIA 3C18A 3D3QA 3VR2A 1YS7A 4EJSA 2Z4RA 4GCVA 2A69F 1GXPA 3E6CC 2RGAA 3OIYA 1B23P 1MKMA 1ZYUA 3BIFA 2HQRA 1CF4A 1DTSA 4KN7X 3F72A 1FMJA 1TNDA 4EPXA 3J80K 3X2SA 3EZFA 3K0CC 2ZAMA 4YC7A 5EXPA 4DB2A 3K0CA 4LD5A 4PR0A 4TT3A 2VBZA 4L0YB 3BXZA 1XP8A 4HX8A 1R7JA 3K69A 1R58A 2YNMA 4TSFD 4BASA 2ZEJA 5BPIA 4QBHA 5FPYA 2EFOA 1PLJA 4LK0F 3NXSA 2LWIA 2WMNB 4TYPA 4IRUB 3SOPA 2H94A 1GP2A 2EFDB 4CIDA 2GXUA 3PCRB 3L0PA 2P5VA 3IHUA 4IRIA 2L54A 4N9IA 5JR3A 4HLQB 4OIOF 2HTSA 3WBJA 3MEXA 4PAOA 5LD2C 2V1XA 1BH2A 3GJ5A 1Z6YA 3QE0A 4FD2A 3B1YA 3C15C 3BRWD 3LQRA 121PA 4UNPA 4QLCU 1ZNZA 4NCNA 2BEKA 1TMKA 1XRJA 1QG4A 1HV8A 3BP8A 5JJLA 3EYIA 5HLIA 1P73A 2QE7A 1DBSA 3IDQA 3O8BA 5LHHA 1BN5A 1XZPA 4XWAA 2VOPA 1U98A 1XTJA 1J70A 3BC1A 2VHQA 4G5OA 3OFNA 3T06B 2GTPA 1OXUA 3EZ6A 3IRQA 2QQBA 4FT8A 4PGHA 1YVDA 5BQTA 3QPWA 4N3NA 3MWYW 3LA2A 3X1XA 3U6BA 4D0PA 1H0MA 5CJPA 3KP2A 2QRNA 2W0MA 1SXJB 3EW9A 3W3AA 4KFRA 5IRCD 3F21A 2WJJA 4FIDA 4OOIA 1S3GA 3H0KA 4DLYA 1KDRA 4ZIRB 2VT2A 4WAUA 4C0JA 5HLGA 2OCPA 4YXWA 4ASNA 2DFNA 1FL9A 2IA0A 4MRSA 4ZDWA 5LEKA 1S96A 2XZPA 5HKKD 1IXSB 1KZGB 4ZCIA 3ZN1A 1NBMD 4AD9A 1QHHA 3CLOA 2FV8A 4A8JC 5G3ZA 4A8JA 2GXQA 4KIFA 5FUYA 3T12A 1CULC 3K1NA 2L0XA 2HYFA 1HE1C 4KSCA 5DHAA 1KAGA 2FEOA 2CG4A 2IYVA 3QXXA 3D7MA 4OI1A 4C0LA 1LNWA 3GJ3A 1ZW6A 3ERED 1EX7A 5D3QA 3TO9A 4G3XA 4HSEA 5AIPA 4RGUA 5TARA 3GLHB 1OJLA 2ORWA 3IO3A 3KB2A 5FBVB 2PJZA 1FUUA 3KJIA 4TYNA 5DI9A 4B47A 2JASA 3SQWA 4P9UA 3A1UA 3BWDD 3K9NA 1O3RA 1AN0A 5TY0A 3WP1B 5EJEA 2VBXA 2M45A 3B1WA 1W48A 1V4RA 3REFA 2P3SA 2PMDA 3VHXA 3NIBA 5F98A 3DVLA 2JLUA 2JATA 2VSFA 1Z63A 4GBMA 4HB0A 4W5WA 2QWWA 4Y15A 1SVKA 3HUGA 4KYWA 2C95A 4KCGA 1R0XA 3Q9VA 2XNDA 2RAPA 4B75A 3GLXA 4LSGA 1NIJA 3BWGA 3A4LA 1TF7A 1YTYA 3R4KA 4UV9A 2C03A 5DHFA 2BE5F 1NLFA 3P9KA 4U0YA 5D5VB 1UBFA 1DO2A 4L4UA 2EV0A 3ISPA 2RGXA 3AKCA 4YLGA 5AJYA 1XD8A 1KIMA 4IOJA 5LGNA 3EA0A 4JVNA 3GZ5A 5H6RA 3SZTA 4HF2A 1G3RA 2FFAA 3IRRA 1YRAA 2ZSEA 5JBQA 2C9CA 3ABTA 1HE8B 1KDPA 3ZQ6A 1T98A 4Y17A 1G4DA 4NPHA 5KYKA 1RNLA 4I4LA 1G5TA 4W7SA 2QAGA 1RE0A 1R2QA 2HCJB 3OIVA 1YLFA 2MSDB 3PEVA 4OKSA 2IS4A 1CRPA 4G01B 2L02A 1GUAA 4F38A 3MLEA 2ZPTX 3V8JA 1VMAA 4CEHA 2BOVA 4ZKEA 2VT3A 2QLZA 3RPQA 1FZPB 1LFDB 2IBMA 4FMBB 4URUR 2XIGA 1LB2A 3T35A 4BZQA 3E6DA 2XV4S 1T4GA 2PMKA 4MYTA 4ERNA 1SD4A 1S0UA 1W46A 2LKDA 2BHRA 3SHWA 5JEEA 1CS4C 1S2MA 1XX6A 1BC7C 4A2QA 5GJVC 2GIVA 3UPUA 4JBAA 4WZ6A 2ODEA 2P7VB 3ZMTA 1UKYA 1MO6A 1DDNA 1XTIA 1IUYA 2IEYA 1A2KC 1E9SA 1HUQA 1WQ1R 1FYKA 3U7GA 4B3GA 1HW5A 4TMTA 2GF9A 1EH7A 2IYXA 1XMSA 3P7NA 2KRFA 4EGYA 4IVRA 2R3SA 3K0FA 2R6DA 1SXJE 1W7PD 1AIPA 1S7OA 3AJIB 3L82B 3IHLA 3QVUA 3CJNA 2CK3A 1QZZA 4A92A 2RGDA 4HLYA 3O2PE 3AQ4A 1R5NA 3BH7A 4JT2A 1G3MA 1M7GA 5EUMA 3KDSE 1R23A 3VFZA 3L0SA 5FOXA 2WSSA 3LFKA 4IEIA 1OXTA 6PAXA 3C14C 2ISZA 4RZXA 4JBXA 4IXAA 4CHUA 4LC0A 1XGMA 4DCSA 1W0JD 1KY3A 1VG9B 2GVDC 2W6JD 4MDEA 3V8LA 1ZUNB 5JSZB 4NCIA 5AUPB 4IDNA 1VPLA 1J2XA 3PITA 1PLLA 4ZDJA 2OFWA 1AK2A 2YWEA 4CYMA 2QUFA 4B2PA 5J4VA 3GLHE 3AVUA 2JZYA 1QHIA 2Z0MA 5H70A 1K8RA 4AKHA 3BORA 1KA8A 3K0LA 1A1VA 1J90A 3DM5A 2BMFA 5AONA 1EV7A 2XZLA 5ICFA 2B8WA 3TSOA 4RD3A 2PBIA 1N6RA 1Z06A 3HRUA 4DJTA 4AG6A 3EWAA 3L0IB 4Q7KA 1LS1A 4JYBA 2P6TA 2AWNA 1YO5C 4YIIA 1PDNC 4NBSA 5SZKB 3T1QA 5KDOA 1NJGA 1CJUC 3TOAA 3FXUA 1SVSA 2OBNA 1IN4A 4BZPA 4B3DA 2A68F 5KO2A 2HYGD 1KU7A 4A3VB 3FKSD 2IC5A 4BECA 4DEYA 3A1VA 4M9XA 1W44A 2NS0A 5KSOA 1P4XA 2DHRA 3AVQA 4FWDA 2DFIA 1J59A 1Q21A 3JW4A 2B7BA 5DGXA 3OF5A 1P7CA 1ON1A 4CDGA 1I4LD 1RRCA 5L3QB 1WWXA 1S9HA 3VQTA 4G1UC 4IFEA 3TO6A 1E0SA 4KVGA 2CHQA 5FTNA 2L4MA 4G6DA 2F1RA 4EDHA 3HTSB 3IBGA 4QFMA 1VTKA 4DNCA 1QNTA 1M1YE 1QG2A 1WCV1 2E7WA 2J41A 3RYTC 3R9WA 1AQUA 2F3RA 3NDBB 4C7OA 3F8CA 4IRGA 1FUKA 4M4SA 5F9FA 5JWRA 2MLKA 3GJ0A 4I81A 4JIMA 3T1TA 4RB2C 2QE7D 4L9NA 2QT0A 1T8TA 3DEFA 1TEXA 3LW8A 1E0KA 3TQFA 1G18A 4LCBA 2NO0A 3T1BA 5BMZA 2PLYA 3C41J 4GMDA 3OFND 4MKGA 2QPOA 4ZI2A 3KQHA 5EP2A 4WXDA 3SE0A 3ZD7A 1LF5A 3FFBA 4MGYR 3U61B 1ZD1A 2KSQA 4JT4A 4FWGA 1ZU5A 3AP2A 1FW6A 2D45A 1D9ZA 2CVFA 2IHBA 3FYHA 2FEMA 5G53C 2JLRA 4MGZR 1QDEA 1GFIA 2QTVB 3IWFA 4IXMA 5IT9Z 2ONKA 2XXAB 5JWHA 3IEUA 1TQPA 1U0JA 2PCLA 1MOZA 4LY6A 1G6HA 1D2NA 2VEDA 3QXCA 3VAAA 4I98B 4UXNA 2GJKA 3HHHA 3AF4A 3I8SA 5LHIA 1KJYA 4XD7A 3O8CA 3IQXA 1JXSA 1E1RA 1FSHA 5E1ZB 4LBYA 4QNMA 1K6MA 3SQNA 2YV5A 1B4AA 2DCUA 4KI0A 5F3WB 2YYZA 4PO1A 4BNCA 3TQCA 4B3XA 5ICGA 2RKHA 1SHKA 2WJHA 1ZVQA 1ZM9A 2QORA 3W6NA 2VTKA 1JR3A 1NKSA 1BC8C 2ZRGA 4B71A 2DB3A 5TVKA 3NBZC 2ZYTX 2CL7X 3MUFA 4RJLA 3DPLC 1IAWA 1OB5A 1WI9A 4QL3A 5J4LA 3W6PA 3CNNA 5K8TA 3X1ZA 4Q9LA 3MCZA 3TSZA 1CF7B 1WXQA 2Q3HA 3QPTA 2EYQA 3C3WA 4C0HA 2X1VA 1RUOA 3LH5A 5AJXA 3K70B 2DWZB 3A58B 2WWWA 4OBEA 1E96A 3NBXX 4EQ6B 3AVYA 2PFBA 4AIJA 1D8TA 1XPUA 2W2TA 3F8FA 1OXXK 2QROA 3I4LA 1M34E 1E2JA 2EFNA 2ZJOA 3TDZC 1W5SA 3RS5A 3TVDA 3OIUA 1BOAA 3PG5A 2YSRA 4B3CA 2CE7A 2O8XA 2FNPA 3B7GA 3NG1A 3WRYC 4C0KA 1ZGJA 1E9FA 2IYUA 3AEZA 3CRW1 3CZQA 3V8KA 5ICEA 5CVRA 2ZNZA 2C8VA 2HUPA 3UATA 4CF7A 1S8FA 2DT5A 3FXRA 2OUKA 5D4SA 1W2GA 2VQSA 1KO7A 2XNSA 2EQBA 2ZYUX 4UHTA 1Z91A 1W36D 4IJAA 3WMEA 3ICQB 1F2TA 1IJFA 4LRTA 2ZJ8A 1E2GA 4WF2A 1SULA 1LDJA 2IL1A 3WTXC 1XB2A 5KTYA 3RTRA 3WTUC 3IQWA 1ZINA 3U3KA 4PSVA 4F4IA 3U44A 4LPSA 3EAQA 2ZBKA 4LHWA 4AG5A 4EPWA 3DKPA 2BKEA 3IKVA 3FDIA 2FSIA 4HAUA 5ED4A 4EM2A 1HBXG 1P2TA 4M1SA 3M7GA 4XWKA 5IT3A 1G16A 1Q1ZA 5JS8A 2OD5A 2GXSA 2PG4A 4JLNA 1WDTA 2OM2A 4CVNA 2YWHA 3FTQA 3TW4A 4U7DA 3PUVA 5AWFC 4B76A 3EYYA 3VKWA 2FH5B 3R0AA 2F43B 1V3FA 1G1MA 1RUNA 3KXIA 5DNYB 4UNNA 5JECA 2YVUA 4N0EA 3RS2A 4AY2A 2DPUA 2OQRA 1T91A 5ANRB 2VSXA 4DC9A 5DE3A 1W2HA 2FPKA 1G9XA 2NZ8A 4OYHA 4UKDA 1NY6A 4YFXF 2L4AA 3R60A 3QKUA 1O3QA 2WSSD 5DISB 1BYIA 1N25A 2XTMA 2K4BA 2CJWB 2K02A 2VHJA 4A36A 3T1OA 2WBLC 4BFUA 4B32A 3CRRA 2CO5A 1S7AA 2IP2A 2PL3A 1OYIA 3FMIA 5E7MA 3RAPR 2QP9X 4P33A 5TJJA 1KYZA 2DY1A 3K1JA 1JI0A 3V4RA 3RNLA 4A2PA 1KQ0A 1M8PA 3PV0A 4M1KA 3LLMA 3RRNA 4BXUA 3VNVA 3NH6A 1F5NA 2QM7A 4M21A 3ADCA 4Y0VA 2HYIC 3EPHA 2QP4A 2GA1A 3U3RA 3R8CA 4V0LA 4G8XA 3KTAB 4TN1A 4UJ3A 2IX3A 2CVHA 1EWQA 1RYFA 2H6CA 1R8SA 1ZCBA 3H84A 1JEEA 3KXKA 4TLBA 4A6XA 5FL7D 4MNUA 2G1JA 1VTNC 1R0YA 3WTSC 1SVWA 2LCFA 5CDFE 3TO7A 2AFHE 5GVSA 1P2FA 3V7SA 2MA3A 2A5GA 2ZXJA 1DAFA 2QT1A 2GVZC 3K0AA 3GP8A 3FOZA 2XEXA 2NG1A 1DAHA 2IW5A 4A0ZA 3NKVA 4DLRA 3THWA 1KHTA 2EA4A 1BMFD 4PHTA 4CT5A 5JRZA 4HDUA 4BLRA 3MZHA 4JSTA 2OFXA 2JLXA 2KIUA 2REBA 3X1WA 2ZVQX 1XD2A 4LGWA 1ZM2A 1LB1B 2DLLA 3KX2A 1FP1D 3RWMB 1X1SA 2JLWA 2IHYA 4A9AA 2ZRBA 1NN1A 3F8MA 3EG5A 3EPKA 3CIOA 4RKEA 3UANA 3LX5A 4JVLA 1KQ8A 3L2OB 4JBWA 5B57C 4JLJA 4LDJA 3JZAA 3R0JA 3PUWA 5FH9A 2VSOA 4KMFA 4Q7MB 4G7OF 2HJVA 5DUIA 1LEBA 1P3JA 1XGOA 2QAJA 2AK3A 3ZQJA 4K8OA 2XROA 5CLLA 4YG2F 2P5LC 4BGDA 4GDFA 2ZYWX 5B2ZA 5EE0A 2DK8A 4GO1A 4PDKA 1P9RA 4K46A 1IXRC 2XAGA 2XAJA 3CX8A 2EWVA 3SBDA 4AIKA 2BEJA 3SC3A 1IN8A 2FSWA 2H09A 1NRJB 1OE0A 3VU9B 1O3YA 4NYJQ 1XD7A 2HQNA 1XF9A 3EC1A 1E2NA 3GLFA 1U8RA 2N1BA 4OK6A 2BCJQ 3CO7C 2ODNA 3WNCA 4BQSA 1I4DD 2MH9A 4RAZA 3CUQB 2Q9AA 1OR7A 1U0HC 2O0HA 3KZYA 1J5YA 1X86B 3Q8XB 1JGSA 2VC1A 1Z9CA 2D2EA 3ASYA 3JTGA 1HYQA 4GT1A 5HE8A 1LDDA 1JR6A 2E1RA 1PLKA 2F9MA 4CO8A 2C9OA 1IJEA 4Z51A 3AGQA 4XD7D 1EFRA 4LJYA 2V8OA 3FMFA 2O8BA 1E1RD 1UHMA 1UPTA 2GK7A 1J75A 2KJQA 1XBTA 4YMWA 2DZNB 4O2RA 4QBGB 2LNBA 2G9NA 4BRWA 4POAA 4URYR 2JRTA 1KO8A 4IPAA 4P4SB 3PUZA 4M1OA 1KSJA 4MRPA 3M9AA 5TB5A 5C46F 1KK1A 5H8WA 4WX9A 1SMTA 3WHLA 1FBUA 3JTHA 2GA8A 4S05A 3HJNA 3GLIA 3UMSA 5FTJA 2IF0A 5E8IA 2Z83A 4URVR 2FBIA 2FFQA 3IIKA 3CTAA 3HPRA 1Z7UA 3G5UA 1H8EA 1MDMB 4EM0B 1T0HB 4LHVA 2AK2A 3BD9A 4U5XA 5JFRA 2FGJA 4U02A 4LRSA 5JRJA 2J1LA 2C96A 1YQAA 2CBZA 2PEZA 2HXYA 4FMCF 4LI0A 4HAZA 1XCMA 2O8EB 5J5CA 3ZMVA 5FB2A 2E1CA 1Z0KA 2BC9A 2G83A 2CL6X 2GBLC 2ODWA 2SHKA 1VG0B 2XJ4A 3BK7A 5F1RA 1F2UA 4ASUD 5AUNB 3DP7A 3QF7A 1KYWA 3CX6A 4L15A 3QG5A 5CB6A 1Z6XA 2QG6A 2J0QA 1F60A 1XXHB 3DKWA 1RRFA 4I09A 2BBOA 4TTQA 3VOEA 2IWHA 1ZC4A 3TSWA 4PZZA 3BROA 1NIPA 3J80Z 1XDBA 5ELXA 1R7RA 2JPCA 2OESA 2JLYA 3ZS9A 3RDIA 3CPJB 2BBTA 1SVOA 3FMRA 5L8VA 4Q4JA 4Y13A 2A5JA 3D8BA 2BGCA 4AIHA 4BYYA 2AHOA 2QGNA 3H1TA 3LWNA 3BJ6A 1Q1HA 2O6GE 2OAQ1 5FBQB 3SQXA 2WSMA 5FFXA 2LKCA 4EM1A 3LNCA 5FOSA 2O8DB 1W7PB 1U5TB 2LKPA 3F8BA 3U7EB 1P92A 3CRMA 3P27A 4TQUS 1XEWY 1VYUA 3RYRA 4WOPA 1KSGA 5FPKA 1HQCA 3WNBA 2C77A 2Y75A 5KSZA 1R1VA 5F2EA 1IY2A 3DEUA 5LB2A 2CLCX 4MRVA 2XTNA 2A30A 2NTYC 4G9YA 3L43A 4FWHA 4PZJA 4HB3A 1SD5A 4KIBA 2IXEA 4IXNA 2R6FA 1GDDA 4Q4LA 5FD5A 1FOEB 2QQAA 3IIMA 1O57A 5EE3A 5M04A 4LG0A 3I92A 5CIQA 1NBME 3EIHA 4LLGF 2A3RA 1XPRA 3EZ7A 2KBFA 4W9MC 4HBLA 4FCWA 1ZGAA 5ILUA 1K78A 1NVUQ 2FE4A 3O47A 1D2EA 2G3YA 3KKQA 4XVUA 4Z8XA 3LV8A 4R9UC 1BI2A 2DPDA 1E0AA 2FF4A 3COAC 3NHBA 4II7A 2D1HA 1F9NA 4Q9HA 2B0LA 1HY3A 1OSNA 1Z2AA 2ZRJA 3H92A 2D74A 1FYMA 2J59A 1P6RA 2D62A 3CO5A 4I02A 4RGSA 1G4UR 2XOKD 1OW3B 3ADBA 2XVCA 3GO5A 4NB5A 3TH5A 3SJCA 2QUZA 1A04A 3GJXC 5HTKA 3QEOA 4H1UA 3CUEF 4X8LA 2DU9A 2ZU0C 3T5GA 4OHYA 3BPXA 1N5LA 1NMYA 1G3WA 5SZIA 3W8NA 2JDIA 2WZQA 3OIWA 3NEUA 1M2OB 4WVFA 4C2TA 4DB4A 1UF9A 1U99A 1ZHFA 2RN7A 1NMZA 4PHHA 2IYQA 2W00A 3Q9LA 4P55A 3ZQ7A 4KA4A 3E6BA 1LNZA 3LBHA 3QEJA 4ZDIA 5F64A 4M1TA 1XSDA 1KI6B 1SVMA 2PT7A 1E9CA 4HLCA 1KYIA 5D3MA 4PCQA 4JS0A 4PQRA 5HCNA 4AK9A 3NDPA 2JCSA 1N0VC 1E2KA 2QMEA 3L00A 4ZDKA 1XJCA 2I3BA 2AKAB 2O5VA 4L0ZB 4EFLA 1IXCA 2WC2A 2PBRA 5DLQC 1VYTA 1F4KA 1R0WA 2IYYA 5H1YA 4CGZA 3N2IA 3P32A 1ZN2A 2ZSFA 2PMUA 3ZZUA 3K9GA 5E18F 1XXHE 5E3HA 3UK6A 2NRAC 5FLXK 1YR7A 3UMFA 2OLKA 1REPC 3IIJA 4BWYA 1TAGA 4AKGA 5LEJA 2AS5F 3THYB 3IGFA 5BYKA 4ENJA 1C4OA 2PMHA 1U90A 2ZI7A 4EUNA 2F55A 3KZZA 2KI5A 5E7IA 2JLVA 4JJZA 2QVOA 2ACJA 3KE2A 2ZIAA 5GJWC 1WBBA 3GJ7A 2Z3YA 2O8CA 2IS1A 4V0MA 2EFQA 3E97A 1FX0B 1J7KA 1F6BA 3QG1A 8OHMA 3ZLJA 2FDCA 4KBGA 1QVRA 4B2IA 2VHTA 4PQFA 5HS8A 4HOBA 3P4XA 4LB5A 1IW7F 4HLDA 4D0LB 1NN5A 2M5WA 1FP6A 4P3YA 3SYLA 1B0UA 1L4UA 3AVPA 1GTVA 4FCVA 2REXB 4L9WA 1DAGA 3CR7A 3KCCA 5IT5A 1BJAA 1X3UA 4IEEA 3T15A 2GF0A 1R5HA 1NN3A 2R8RA 2Z9OA 2IUTA 5CYVA 3KB1A 4JLMA 1OXVA 4TMZA 5EZ6B 1UFQA 5J4HA 1SHZA 2V3CC 1SKYB 4GXOA 2X2EA 3N70A 3K53A 1SVLA 5DV5A 3VR1A 3BFKA 4DT1A 4ESFA 3PEYA 1UEIA 2FN4A 3LDAA 3N97A 3IWZA 1GILA 2J5OA 1P61B 4RCYA 4RFVA 1W4MA 3E5QA 1E2QA 3ECHA 1HA3A 1OKKA 1EFRD 3REOA 1YE8A 2HT1A 3TLXA 5CJ2A 3CH4B 3ETLA 1GNRA 1N6LA 4RD2A 2GCPA 4PQYA 4RAYA 3WTTC 4BFVA 1ZLKA 2BIFA 2QMHA 3JAMK 2OHFA 1RPZA 4JSYA 1GKYA 1W0KA 4Q4HA 4YQFA 2P2LA 2ZS7A 5LRRA 4MEXF 3T34A 3RS3A 3ECOA 2I1VB 4HYEA 3X1YA 1IBRA 3V9PA 2ZNYA 5C1BA 4D80A 3S2WA 1E99A 3F6VA 2C78A 2ZANA 1P2UA 4LOAA 4DLZA 2ECKA 3KEOA 1ZCAA 5LB4A 4TZ0A 4AKIA 2P6NA 1CJMA 1E6CA 1S6LA 2YZ2A 3VMFA 1E4VA 1KSHA 1E9RA 2GNOA 3QXJA 2QQ0A 4TL9A 2EU8A 4D4LA 1U78A 5AUOB 2Z33A 2J45A 4F91B 1G291 3UXMA 3R6SA 5FPSA 1CR4A 3CRQA 4YMSA 2ATXA 3BY6A 1G6OA 2R2AA 3SS8A 3U3OA 5JWOA 3ZVLA 2IW3A 2QGZA 1OIWA 5HZHA 2V9VA 1G3UA 5IHPA 3B1VA 3P20A 3HHGA 3SJBA 1Z22A 1FSEA 1US8A 4XBFA 1IN6A 2HKOA 1U3EM 3EASA 3WTWC 1E32A 2J5PA 1ZIPA 5HS9A 1YZUA 3TDUC 4L5IA 4KNYA 1FQJA 1MO3A 2HDCA 2F6RA 4PPGA 4DCUA 3FGNA 3VLFB 4HYYA 4NKRA 3QOFA 4PPFA 1P60A 2IA1A 3NHAA 1Z05A 4ZI3A 4AWXB 5AK0A 1KGSA 1IY1A 2W25A 3NEYA 2J0SA 2GZDA 5CYOA 1FY7A 2DR3A 2VC0A 4BEJA 4TYQA 3K09C 3SZRA 2IUSA 4BLOA 3B73A 3HRSA 3K09A 1GRNA 1GNPA 4ACBA 1AA9A 1OYWA 5DI3A 2ASEA 4JLDA 3IO5A 2QY9A 3TIFA 4HAXA 1H65A 1DAKA 5H6QA 2VP4A 3E5HA 2AD1A 4LPKA 2NNNA 3LO5A 2XGJA 2E7XA 5K8LA 2ZE7A 3FMOB 4HDOB 2KIFA 2G0TA 4NDZA 5G41A 1KMQA 4ZCLA 3E5XA 1ONVA 1E9AA 1FPQA 1DG3A 2A5FA 3QRFF 4PC7A 2EV6A 4NQWA 3KEQA 5HS7A 4LUCA 2G1KA 1CRQA 2BMDA 1OF1A 1QRAA 3HYTA 4AYXA 5BQ5A 3QUSA 2GJSA 1S9DA 2XKOA 4B33A 3QPUA 2XSZA 4EKDA 2H6BA 1NLZA 3OESA 1PZNA 3ND8A 2IYRA 1USTA 4EV0A 5CB8A 1OB2A 2C5LA 1SKYE 3VR3A 4XSZF 3KQUA 1E2IA 4DQ2A 5E4FA 1IONA 2W24A 4LJZF 5CLSA 2UWMA 2HDNB 2W6ID 3P4YA 4MH0R 4M2LA 1UADA 2ZMEB 1EH8A 3GW2A 2P6SA 3BERA 4C0BA 4JL8A 2A5DA 4XSGA 1XDSA 2ZM5A 1E9BA 2ZTSA 2CDNA 3B85A 1SGWA 2AR7A 4YONB 1TU3A 4C0SA 4JL6A 4M1YA 4A4DA 4OI4A 4LLNA 1VIYA 4RB3C 1WKMA 1J99A 2TDXA 5BXQC 2J3EA 2Q21A 3CF0A 3LA6A 4Q02A 2FOKA 5LRSA 1XU4A 4OHWA 1OFHA 1GRQA 3E3VA 1Z0FA 2WV0A 3I5UA 1S1CA 1J2JA 3KKMA 5DH9A 2JDID 3WGGA 2FF7A 3ZIAA 3HU1A 2ZI3A 5KPJA 2Q9CA 1L8QA 3G0HA 3O3KA 5L3RA 4ZH4F 3A4NA 4X8OA 4EJOA 5EE9A 4QWQA 4HEJA 5JI2E 3IHWA 2JIZA 1SXJC 1Q57A 2WJYA 4LBVA 1YR8A 2DTRA 4PSKA 3RSLA 1SXJA 3OAAA 5FUXA 1S4QA 5BYJA 4NE2A 3K9LA 3B9PA 4P32A 2YPRA 1RYHA 1KU2A 2HJGA 1Q3TA 4ZIRA 2EA2A 2H27A 2OAP1 1FX7A 2XTZA 3IKJA 4CEJB 3SI7A 2DW4A 3BZ6A 2FPMA 5JHUA 2OCBA 3ZVMA 2VBYA 3I72A 4IDQA 4CZ2A 3EPLA 1XGNA 1GL9B 2RC4A 3I62A 2JTVA 1OLOA 5UKDA 3EIEA 3QF4B 2QMOA 1Z0DA 2V7QA 3CR8A 3T0YA 3N2EA 3U1DA 2FQ3A 1DUXC 1TQIA 3MSXA 3IPXA 3OE7A 4G5RA 1P62B 4NYJR 1YW9A 3Q7PA 4UUVA 4PPQA 3JSPA 4M22A 5JJKA 4JVMA 3KKPA 3LD9A 4G5QA 1IRGA 3I54A 2UZ3A 2NPFA 1JPNA 1UKEA 3GLHA 2Q8KA 4BZXA 1MD0A 4ESHA 4YMUA 2VP0A 3M1IA 3ZPLA 1AJEA 3SJAA 2WKQA 3U7HB 2GA2A 4HAVA 1R36A 4M6YA 2LDUA 1YZNA 1FTSA 4PXAA 2H5EA 1Q1QA 2M30A 1FMLA 1V5WA 4HB2A 3R8FA 1OFUX 3CRVA 1MKYA 1NVMA 2VN2A 2STWA 3DQVC 1DADA 4LB6B 2ZRLA 5E95A 2K27A 4HA8A 2D7DA 1KZ7B 1BO6A 3D6TB 3BDDA 5JCPA 2YHSA 1OIVA 4U0VA 3L7WA 4TT3D 4N1AA 4WWCA 1GG2A 4OQLA 4DDVA 1XEXA 3WYFA 1LY1A 2B21A 3HRMA 1VYVA 2CNWA 1VCMA 3CLVA 1CU1A 3ONWA 3ZZTA 4B3FX 3QOPA 5HOOA 4LRWA 3GLGB 3MFYA 5HE9A 4JLPA 1W1WA 3ELKA 3GD7A 3C1DA 3H3ZA 4I0BA 4OI2A 2C04A 3LXXA 1SZPA 2FMYA 3ECCA 5KDLA 1GRRA 4GYGA 2ISYA 2BJWA 1ULYA 2W2VA 2X77A 1O87A 2GXAA 1YQTA 1WE2A 2R6GA 2ZXUA 2DPXA 4ZCMA 4DIDA 1Y3AA 3U4QB 1PP7U 4G5GA 1XCPA 4EQQA 5DCFA 1UKVY 4ENKA 4A0GA 5FBLB 4TYWA 1YU9A 3AB3A 1GKUB 4DXAA 2EFHB 4DLSA 3B02A 3KFWX 3WMGA 2D2FA 2ERYA 4XSXF 1IN7A 1OIXA 2ZR7A 4TLAA 3QJYA 2XASA 5D5WB 1NP6A 4FMCB 1R1TA 5LBQA 4L16A 2R7DA 4WCGA 2PJPA 1A7JA 1YZQA 3EDPA 3ADKA 3GEIA 3S1AB 2WWFA 4HQMA 1FFHA 4LK2A 4OQFA 3HIFA 4HAWA 4US2R 3NBFA 4DDTA 2ATVA 2IT1A 1FYLA 2XAHA 3KP6A 2J5XA 4OL0A 1F2TB 1VHTA 2F3TA 1T3HA 4QRHA 2O8FB 1UCRA 5DYGA 1M7HA 1Z6AA 3AVOA 3SHFA 3LAJA 1G7SA 3VKGA 2YX7A 1JJ7A 4L8GA 4M1MA 4YXWD 5E20A 3E2IA 4MUAA 5AUQA 1JHFA 5JHHB 4F92B 4Q4ZF 3HDTA 5JCZA 2RH5A 3CBQA 1G17A 1XCBA 5D6EA 4Q18A 5A0FA 5BOXA 2IK8A 4PO8A 1XJ0A 1P9WA 1Z8FA 1MT0A 1Z6RA 3EUHA 1DAEA 1I1SA 2VRWA 4OQMA 3EWSA 1J8YF 5JJIA 3CM0A 4TV7A 4IOMA 2K4JA 5JZVA 1U6GA 3HSFA 1JE8A 5JSZA 4B74A 1UKZA 2C9YA 2BKUA 1JAIA 4ZPXA 3GFLA 4HZFA 2V6IA 4MYUA 1UBGA 5FD6A 4G0NA 4XTCS 4BFZA 4L5JA 1B9NA 3R9IA 3AF1A 2NPIA 1JPJA 4LHYA 4UVAA 1GKIA 4WIAA 2A7QA 3BE4A 4GP6A 4D25A 5EP3A 4E22A 1I6XA 1SAXA 1DG1G 1TQ2A 3PR1A 3GZ6A 5FI0B 1CLUA 1I2DA 1CXZA 2NO7A 5C4MA 5JS7A 1Q22A 4LJ5A 1LQ1A 5AJVB 3AVTA 2B92A 2WM9B 2AFIE 2ZREA 5KOYA 4BFYA 3GJ8A 3ADDA 5HDGA 2XSZD 4QNRA 4BHBA 4MGRA 2OEPA 2XNDD 2MLGA 3WP0A 2YU3A 3EZ2A 4Q1BA 3KLNA 4TMVA 2WJIA 2KBEA 2YOFA 3W6KB 1D8KA 1QZMA 4QG7A 2Q0HA 2ZKZA 4C4PA 4TMXA 5GJCA 1KY2A 3B60A 2FZ4A 1L4YA 4A82A 5FPHA 3TVTA 4K2EA 4JZKA 3B2EA 4A6EA 4ENNA 3FB4A 4QJ3A 3IL2A 3K1PA 1ZM4A 2H1LA 2Q3MA 1ZNYA 1KQ9A 4I1OA 1U94A 5FFMA 1EWRA 1WQ2A 4DEXA 1GAJA 3GLGE 4HUQB 3TE6A 3U2RA 4IJMA 2ZR0A 2KJCA 5L3QA 2RV8A 4ON0A 4M9SA 4Q47A 3NBYC 2EWWA 2V54A 2ESNA 3C4JA 2AXLA 1F5TA 2ERXA 2ZRCA 4GPTA 4R2IA 3THXB 2BV6A 4IVNA 1II8B 3W3ZB 2ZRIA 1BI1A 1BKDR 3TUZC 4WW0A 1BBYA 4FW9A 2WWXA 2JJ2A 3HP1A 4UXHA 4R71A 1XWIA 1JJVA 2V55B 1I5ZA 4BLTA 2K86A 4AYTA 1OH7A 5CVIA 1E79A 4Q9KA 2ETHA 2P7CB 2D2WA 3AUYA 5EE1A 2GCOB 2XHKA 4DIEA 1YJ5A 4M74A 2RGEA 1FC3A 3EIQA 5L3CA 1KDTA 2F9LA 1XB4A 3LA3A 5L3DA 1VG8A 5CIWA 4ARZB 2XKPA 3QKSB 2HEIA 3WNDA 3QI2A 1DS6A 2GAUA 5A4JA 3HYRA 3FWEA 4UXIA 4V03A 4YIFA 4DLUA 5AIQA 3UG6A 4U7BA 4AIIA 1B9MA 4Q48A 4NZYA 2E9SA 4GSYA 4PFSA 1H8HA 2ZS8A 4KITB 2XXAA 1R22A 2WAYA 3KUDA 3ZP5A 4UNQA 4F93B 5CITA 4WXRA 2CK3D 1P72A 1OFTA 5CVJA 2V9PA 4WXHA 1WA5A 3LY5A 1XMAA 1KO5A 3MGCA 4U0WA 2BV3A 3QBVA 2CXXA 3DKVA 4GRAA 4XOIA 5BN4A 4IHTA 1QZYA 1XTQA 2ZJZA 1LS6A 3KLOA 3U60B 1KO4A 2R44A 3OE7D 2FFBA 4NONA 1U8ZA 4TMKA 4AURA 5SZJA 1PJRA 3PJRA 2XB2A 4RD1A 4Q01A 1G41A 1D6JA 2F5EA 1I1GA 1RJ9B 1VCIA 2XITA 4GZMA 2DWPA 2GILA 3BGWA 4A15A 3DZDA 1KGDA 1TUEA 3I59B 5ILSA 2F7SA 1E2HA 1TU4A 2GEDA 2Y0MA 1T39A 1QF9A 1RKBA 2W2XA 4RY2A 1CF7A 4O25A 5TRDA 1AS0A 4CT4B 4YDHB 3K70C 1WRJA 5CDFA 3W6JB 3VX3A 2BJVA 3BB3A 4EJUA 4M72A 1IRFA 4XVQA 3THOA 4EQ6A 1G8GA 3PQJA 2OO7A 3B5JA 3QKTA 1B1BA 2GXBA 2JT1A 4DHEA 1Z28A 3VEPA 4GITA 2WOJA 4A5NA 3U3MA 4M9QA 4ZYHA 2DO7A 1WBDA 3CW2A 2P0EA 4IVPA 2XAFA 5CVVA 5E1XA 2CNWD 3D5LA 2BBSA 3CKLA 4G7HF 3FFAA 2H92A 1IY0A 5LGUA 1ZRDA 1G8HA 1ONBA 4E09A 3TGNA 1DPRA 4IDHA 1R6BX 1TTYA 1KAOA 2AX4A 5J6XA 3DZ8A 2MD5A 4E5UA 3DFGA 3P1JA 1UM8A 4PGGA 3RKWA 4P4UA 2ZETA 1LF0A 3A1WA 2J0UB 5DO9A 2WTUA 4TZ6A 3UKDA 2AKYA 4MKIA 4KO8A 1DARA 2HF8A 4LJ7A 4DLTA 4KT5C 3NVAA 1W49A 4C0AC 1T9HA 4WBSA 2ZRNA 3NWJA 2X19A 4OINF 5BPDA 4KV9A 2YX4A 2A6HF 2FU4A 1RZ3A 4JLVA 5BWMA 5L3SB 2CCKA 1QHNA 2AD5A 3D31A 4JLAA 3GJ6A 3WXMA 3P9CA 3SXYA 1QZXA 1C0WA 3LRPA 3HPQA 5KDDA 1II0A 3U7FB 3AVXA 5DCMB 3GVAA 2HGCA 3KJGA 2R62A 2NGRA 2QSYA 4XH9B 3J81Z 1XMJA 221PA 1JB1A 3SNHA 2GJ8A 1FBSA 2G7HA 3UIEA 2HS5A 2O0JA 1N5KA 1QPMA 5L3FA 4A0HA 3I8XA 1E2PA 5LPNA 2XZOA 3AKDA 4HF1A 5BS6A 2V6ZM 1QBJA 1G20E 1STZA 2CMKA 2F43A 1HKTA 5D5UB 2XX3A 3CB4A 4XSHA 3HU3A 2FMLA 5E7JA 521PA 3BBPA 2DVWB 4NCJA 1ESNA 4W5HA 1NY5A 3ZMZA 4DCVA 2F2EA 2ZRHA 1SMYF 1D5CA 1Q1EA 3AF0A 4I0AA 3F8TA 4IF4A 2UKDA 3AGPA 2QBYB 3ULQB 1W4RA 3A1SA 3BAFA 4HZUB 4Q5IA 4Z1MA 2QI9C 4DRZA 1OH5A 3ZS8A 2WTEA 2IYLD 1VDZA 2KB0A 3I61A 3OOPA 2CJWA 1H9GA 1EK0A 4R98A 3NQOA 721PA 3SEAA 1BIFA 1TQ6A 2FSHA 3REGA 1UHWA 4Z2YA 3G73A 1ZRFA 1MRSA 4NU0A 4X8HA 4LG0B 2HOEA 2WJVA 2GEVA 3CONA 1IN5A 5KPDA 1JR3D 2CSOA 2XB4A 3I4PA 1PUEE 2ZRDA 2RDPA 5FLXZ 3F5FA 1S29A 4Q1DA 4URWR 3RS7A 4DZZA 2FPLA 2L3DA 5G40A 2P6RA 1ZRCA 3HWSA 5K1YA 2W85A 1EGAA 4US1R 3CWZA 4QBIA 4ZKDA 1EG7A 2H57A 1GITA 5FBWB 2W83A 2PN6A 4QC2A 3R7WB 1M6NA 4O3MA 3FPAA 3KTAA 4KFSA 2UXNA 1ZD8A 4HLUC 3EETA 3GJ4A 2H18A 3KETA 2CCGA 2R9VA 3V7CA 3Q85A 4ZZLA 2EW1A 3CPEA 4DDUA 2PZFA 4CYDA 3KQNA 3K2ZA 4TTPA 1E69A 3R9XA 2VHCA 4B09A 1KMHB 5JMTA 2ZRFA 3MRSA 1EFUA 2P67A 4P31A 3V4GA 4ZYDA 2D4HA 2GBLA 2HKXA 3GQBA 3K9HA 3OEHA 1JHHA 1QQIA 3ZMSA 2HV8A 4V0KA 3SFVA 1MO5A 3GWZA 3RHFA 3O6BB 3GLIE 5LGTA 3GCGA 5JFGA 2HXSA 5EXSA 1K79A 2QP3A 1G7RA 3FMPB 5BN5A 4MDFA 1MABB 1TNTA 3G3ZA 3FM3A 3LWFA 4AVPA 1E98A 1T5IA 3E70C 1GM5A 4YMTA 4UNRA 1KNXA 1R00A 1GOTA 2QQEA 3QKRB 1AS3A 2WVJA 1OPCA 1I4TD 4PO9A 1KK2A 4R7ZA 2G0NA 3WODF 1YIOA 2ZFWA 1Z47A 2Z43A 3G82C 4I1VA 1ZNXA 1EFHA 1U8AA 1DAIA 1KI9A 1SFEA 1P75A 4GFDA 2Y48A 2JJ2D 4HQEA 3JAMZ 4CEIB 2NOAA 3ZDQA 1MV5A 2JJ8A 1P5ZB 1CEEA 1E79D 5FR2A 2VP6A 4PPNA 4DCNA 1E2FA 1XN7A 1N3BA 1SVIA 4D4JA 5K8IA 4M6XA 4BLPA 3A8TA 1UBEA 1XCGB 4O2LA 2DQLA 4HDVA 1NBMA 2KRKA 4WZBE 4IKEA 4Y0AA 1R0ZA 1QHGA 5FOTA 2YC2C 4Q9JA 4AD8A 3CUQC 5B58C 3V4FA 3W90A 4BHCA 4LBZA 3L9FA 4AYWA 2GZWA 3CUQA 2QPTA 3CZPA 3FHCB 3OHMA 4KBFA 1DELA 1WF3A 4N0DA 3PFIA 2EFWA 2FFHA 3HU2A 3GUDA 1Z29A 1XDUA 4MEYF 1C1YA 2Z6VA 3A1TA 4PZYA 4RFSB 3TJZA 4LFUA 3RRZA 3ZVNA 3F22A 2GETA 4NP6A 4KFUA 3IPYA 2LF8A 3FM5A 3ZMDA 4JLOA 4IRHA 3KFXA 1ETUA 1U81A 4B6FA 5K8UA 2E87A 4KMUX 3TUIC 2EV5A 4EJSB 3WE3A 2FMXA 1NNEA 3SU8A 1IQPA 2QA5A 5H68A 4OHZA 1PV4A 3QU3A 4P4SA 4B6EA 4KVAA 1E2MA 2EFCB 2REOA 4I99A 5TXGA 3I71A 1DPUA 1D9XA 4D82A 4EAQA 1TBXA 2XGXA 4ESBA 5FTMA 5DEQA 3J81K 1JNYA 1N6HA 1Q0UA 1E1QA 5KK1A 2XRNA 2BMEA 4JK1X 1JALA 4I7HA 2FG5A 4FINA 4OHXA 3VKHA 5LLQA 2ZRPA 1XD9A 1GVNB 4Q00A 4CICA 1KU9A 3B82A 4TLDA 3KW6A 5FGMA 3KXLA 2ZRAA 1MDMA 3AP3A 5DSZA 3F0TA 1T8UA 5FL3A 2EWNA 1Z6GA 4ZYGA 2IRFG 2RGBA 1JQLB 1Z2CA 1K5DA 4R1HA 1OFIA 2NO6A 2PQ8A 1R8QA 2PH1A 3MCAA 3RDPA 4OK5A 2O8EA 2OBMA 4LWZA 1YG2A 3F3YA 2G77B 1KI8A 1J9IA 5EQTA 1YR6A 4MQ9F 4M53A 4Q4HB 2OQGA 2QU8A 5TDHA 3NC1C 5LD2B 3A6PC 2P8TA 4CZZA 2C6YA 1DOAA 3M0EA 1XMKA 1EFTA 1OV4A 2IVMA 3NC0C 4LLLA 1XXHA 3DO6A 5E1WA 5HZKA 4B2LA 1W4AA 4RKFA 3GPLA 1TQ4A 1E9DA 2NQ2C 5H20A 5J8CA 1PUIA 2J7KA 4I1UA 2WWYA 1L2TA 1B59A 1MH1A 1VIAA 2CFXA 2FZLA 2GRJA 4S35A 2ZJBA 4FWTA 2DK5A 2FU5C 4KFCA 2IEZA 5C4GB 4UJ5A 4BLQA 2I4IA 1KJWA 2YKGA 2MH2A 1P4WA 3KP3A 2YC4C 3L8YA 4JKIA 4A0FA 1KI7A 1RI7A 4A0XA 2VYFA 3DMNA 2NMVA 4F4JA 3R61A 4BHPA 2JA1A 2DWQA 2ZUBA 4GZLA 4AI6A 1SD7A 4QHSA 5EP1A 1U5TC 4A12A 2R6CA 2YINC 1T3SA 4LV5B 2O8DA 3BJIC 1W7PA 3FKQA 2EK5A 1U5TA 4A5MA 1SFUA 2DFLA 2GAOA 1G8PA 3I0TA 2VO1A 2ZE8A 3DHWC 1GNQA 1F3OA 1XEWX 4IOKA 4M73A 4XJXA 5JHGB 4TL7A 4XVRA 3ASZA 1AOYA 2YOHA 1FNNA 2YOGA 3TAUA 2R6AA 2OA4A 3Q5FA 1XGSA 1TPZA 3AP1A 3KP7A 4JLBA 2AXNA 3H2YA 3HR7A 1NKTA 1X8LA 1LDKB 1QHHB 2RQPA 2A2ZA 3EA5A 4I1SA 2PX0A 3RIRA 2CLDX 4OK3A 4E70A 5FO5A 1N6PA 4A8JB 3VX4A 5TMPA 1HXDA 2QNRA 2D7CA 3TGPA 2ODBA 3DMDA 4NMMA 2A07F 4URZR 3AKYA 3UMRA 2W6JA 4TTRA 4FMDF 1K5GA 1FPMA 3GFIA 4LV8B 4KXFB 2C99A 4M0LA 4S2EA 3RVBA 3FWYA 3N5CA 5FFZA 3TK1A 2J9RA 2JGNA 4V0ME 2RGNC 3I58A 1FQKA 3A4MA 5HLHA 3H86A 2RGNA 5D8LB 1AM4D 2KWIA 3B78A 4TQAA 1CP2A 2QYOA 2RNJA 1FNMA 4NYIQ 3KP4A 2HR3A 5E8GA 4BUJA 3QQ5A 1KK3A 3WE2A 1GVJA 4K81B 5FBRB 3I64A 4XLNF 1XFAA 3ND9A 1SQ5A 3CPHA 4WXPA 2UVQA 5EEHA 1NG1A 4HAYA 2PJRA 5K5RA 2IUUA 1S3SA 1TQMA 2QZ8A 1Q1BA 1NSTA 2ZSDA 3DL0A 1Z08A 3P26A 2IA2A 1T0JB 1MR3F 4ON9A 3FKSA 4Q4AA 3EX7C 4G94A 1H8ED 2EYUA 2IXFA 4KSBA 2MMCA 2F5DA 3WYAA 1P4SA 5FUWA 1GWNA 4ESJA 2V6JA 2JLSA 1ZD9A 2ZI5A 2STTA 2OXRA 2OZEA 1BM9A 4XTRA 2OT3B 1E2XA 1IAQA 2JLQA 2QAGB 4IVQA 1KI6A 3E5UA 5FPTA 4ACAA 4D6PA 4GOXA 4R8HA 4RVCA 1W36B 5AJZA 2FJUA 2Q3FA 1XPOA 3TRFA 1EX6A 1GHCA 4CEHB 4PSAA 4BLSA 3PQKA 2H7VA 2VPPA 3OEHD 1NVXQ 1ODFA 3ABUA 3SJZA 1G3QA 4JJKA 2D1VA 3B1XA 4D2IA 3GFTA 4RD4A 2ZE5A 4MTDA 3MZYA 1S1MA 3QIAA 4YDSA 2WAXA 4RB1A 4B8XA 1JECA 5B30A 4IDOA 1BS1A 2JEOA 3BPVA 3JVVA 1E17A 1EESA 1UEJA 3THYA 4L9JA 3FF5A 2JLZA 4U00A 1TUIA 1ZARA 3I5XA 2DBYA 4DDWA 4M9ZA 5DD4A 4RS8A 4Q5SF 1UJ2A 3RS4A 4NH0A 4Q1FA 1WSUA 1XTSA 1QHYA 1CJVC 3K0FB 1ZC3A 4HDQB 4Q7LA 2NYXA 3QP5A 1FX0A 3A36A 1FP2A 2VL7A 2ONJA 1J0RA 1QBKC 1Z07A 3M6AA 3DOFA 4BAYA 1R5BA 1OXSC 2HTJA 3MD0A 4EJTA 4QKQA 4C9BA 4N0BA 3WG9A 3DF8A 2VE9A 2D06A 1JBKA 4LX0A 4NCKA 1OKRA 1ANKA 3I3SR 4TQ9A 3VR6A 3GYHX 1Q3HA 2WPDA 3LLUA 1NLYA 5A2QK 1CR1A 2NIPA 3UG7A 1XTRA 5IK2A 4P96A 4A6PA 1Y0UA 2AL7A 2EFPA 5EUQB 1JAHA 4RZUA 4HI0E 4DSUA 4JL5A 1WB9A 3R20A 2IS6A 4Q19A 1UDWA 4Q1CA 2N42A 1ZNWA 4Q03A 1FOKA 1D2MA 3BJOA 2V6CA 2CCJA 2A9KA 3OEEA 4TL8A 3ZZ0A 4LK1F 1BI0A 1GZSA 4QGHA 1AGPA 1G8FA 1ZG1A 5KSPA 1O7LA 1KJZA 3HTUA 1AWCA 4L5BA 3SDZA 2M1BA 2C2HA 4Q1AA 4RGRA 3LW7A 4KN4X 3IC7A 1KOFA 2IT0A 1G8YA 1W5TA 2IYSA 2ORIA 1E1QD 1Z1DA 2ZE6A 2ZUCA 3Q9SA 4GMXA 4NCHA 2W58A 1DVRA 4L18B 1DAMA 3BFXA 4QJ4A 1D3YA 1CKEA 4AC9A 2RHDA 3KP5A 2IWRA 2FNAA 1XEXB 2HEOA 4BFSA 4MTEA 2OCYC 4B73A 5G3YA 4ILEA 1LW7A 1NVVR 4DLWA 2P5TB 2QAGC 1RC8A 4GGGA 4GL2A 4MRNA 1W36C 3AM1A 1YYVA 1O3TA 1EH6A 1G21E 2EB7A 4O5VA 1K7AA 2ZITA 5J40A 1UFMA 1IF1A 4OMZA 3MWLA 4S04A 4V02A 2A5YB 3X1DA 3BH0A 5FTLA 4GOKA 4HATA 4EPTA 4C7OB 2UZIR 3AUXA 2P4WA 2FBHA 2FOLA 4QM7A 1ZBDA 1N6NA 4BFTA 4HX4A 2ZJ5A 2BEOA 5DDGA 2WOOA 2CYYA 4QXAA 1NMXA 3MMPA 2JJ1A 2G7UA 3ZMUA 1AQYA 3I53A 4KIGA 1CR0A 3FHOA 4AWXA 3EXAA 3W9YA 5LDDC 1TF2A 1OT3A 2F5FA 2CW0F 3LVRE 4P9FA 1N6KA 1RFLA 4B34A 4LYHA 4B43A 3ZJYA 4KYIB 1YZGA 2QSZA 1R5GA 2ZRKA 4TLEA 4LYFA 3B1ZA 4OJQA 1A5TA 2ZCWA 621PA 1Q20A 1ZLJA 3BB4A 2PLFA 4NYMQ 1TF5A 3MJRA 1FBQA 5EEGA 4NL4H 1FT9A 4R79A 1LVAA 1YR9A 3VNUA 3WHKA 4BFXA 2RKOA 1Z83A 1MGTA 2DI3A 3GFPA 3Q3JB 4IDPA 2OZUA 3U3JA 5BN3A 3WTVC 1R10A 3Q5DA 2J46A 3BOSA 1V43A 4P0TA 3CO6C 4X8MA 4DLVA 2VF8A 4HUTA 1AS2A 1K6OA 3TNFA 2X0LA 3WYGA 5JLJA 1F48A 2HF9A 5JEDA 3WRXC 5HR5A 2VONA 2C98A 4Q21A 4MGIR 1E2EA 2CGPA 4BRUA 1S8NA 5AJWA 3T5DA 1MJ9A 2ZS9A 2ZAOA 3U6KA 3VTKA 2CHVA 5GJBA 3QNUA 3M1EA 4RZ2A 4NTZA 2VF7A 3VR4A 1M7BA 3BB1A 2DFKB 4RGXA 5CK4A 4D26A 1KI1A 1OKKD 2ZMEA 4M1WA 1D8JA 2OBLA 2XJ9A 3B6EA 3QY0A 4QBFA 3T1VA 5C2JB 3DPUA 2A61A 2DBBA 3DPTA 1TX4B 1VCNA 1YRBA 2B6HA 2QL6A 5FL7A 2FX3A 1YW8A 1N2CE 4BH9A 2JAQA 1RZ4A 3PVSA 1COWA 1W0KD 3MWJA 4DCTA 5IF9A 2ZI9A 2Z5UA 3ML6A 2Q0OA 4WA7A 4KHZA 2IF2A 1LVGA 4MYCA 1Z6TA 1BMFA 1P2VA 1X6VA 2GJ9A 3VHLB 1GSIA 3AH8A 1EFCA 5ERIA 1Y63A 5CYPA 2J7PA 3QBTA 1ZH5A 4HW0A 1IOZA 2FRHA 3EQLF 5CM9C 2ZJ2A 4EVIA 3WTYC 3AAFA 3L09A 2NAZA 1G5PA 2OFOA 3U5ZB 3RKYA 1MO4A 3SZPA 1CJTC 1G64A 1HW2A 5JI3E 3JZMA 3ZN0A 2GCNA 2HT6A 3PEWA 2GXGA 3CWQA 4QJ5A 3IBYA 3HYIA 2ORVA 1C1KA 5EZ5A 3SN6A 5FTKA 3GEZA 2GEUA 2OV2A 3PQCA 4PC6A 1PUJA 3MWKA 2ZRMA 2HWVA 3BFVA 3GEHA 2QQ9A 4A0RA 4EPYA 2KE5A 3CDHA 3MAJA 3T5XA 3DOEA 4LMYA 3QU6A 3U44B 4CEJA 4ENMA 4PHFA 1N0UA 1RRGA 1ZJ6A 3EZ9A 5D6FA 2WWIA 3AF3A 1NJFA 3DDCA 1ZAOA 5DYIA 2ZROA 2RHMA 4FX4A 2ESHA 2DWOA 3QF4A 2FGKA 5KNBA 1VG1A 1XMVA 4YFKF 4IFBA 4UNSA 4LJ6A 3J7AO 4EFMA 2V1UA 1HQYE 1FZQA 3UWKA 2MSEB 4V0NA 1HEIA 4GYIA 3PEUA 4KUMA 1NI3A 1T6NA 4P5OA 3B9QA 4MRRA 2ZUDA 3VFDA 2A6EF 2GZAA 1O7FA 3LBNA 2PZGA 5GVRA 3RS0A 1GL7A 4FN5A 4GOJA 2F1HA 3K9TA 2QN6A 2B7CA 2Q9BA 1XZQA 4HDCA 3WGIA 1KDOA 4TYYA 2W84A 1N0WA 3TQNA 5IDVA 1UAAA 4UXJA 3GFJA 4F7WA 3AVVA 4JVSB 3MJHA 4HZIA 3TBKA 2ZI4A 1XNJA 3CF6R 3HRTA 1U2RA 3PIRA 3RABA 2WPDD 1X8KA 4M8NE 4PC2A 4LC1A 4CRWB 4GI7A 4MQVA 4DSNA 1ZP6A 1HKSA 4Q66C 5B64A 1NHAA 2VP5A 1XSXA 3JVUA 2QMUA 3CNLA 5FR1A 5LBIA 2EJRA 3KQLA 1E2LA 1JR3E 2MSCB 1DP7P 2OBPA 1JXMA 1HURA 1TW3A 2ZSBA 4JN6A 5JI6A 5TV2A 4OMYA 2OCAA 4HB4A 2HZTA 3GLGA 3OEED 1ZYRF 4E07A 1KI3A 1WRBA 4KLNA 2QRZA 3I73A 1Z3IX 4MKFA 1ZIOA 2ZI6A 3CNOA 4D81A 3N4MA 3RYPA 2Q2EA 2O61A 5BW8A 1A4RA 821PA 4XIGS 1KK0A 3K0AB 4MUBA 4DBLC 1FWZA 3F8NA 1QHXA 1RRPA 5KNDA 3U4QA 1ON2A 2GK6A 3THWB 1A82A 2ZU6A 3I32A 4ASUA 4WXCA 1G4AE 1USSA 3QP6A 3RPUA 2QZ4A 2FEZA 1BIBA 1NN0A 5CJ9A 4V0OA 4JKYA 3EARA 3AKEA 5CK5A 3H4MA 3B8HA 1XD2B 3RSOA 3ZIAD 1U2WA 1KNQA 4OI0A 4C2UA 2Z99A 1TNSA 1KO1A 4B3BA 3ICEA 1T2KA 3EC2A 3TAHA 3CF2A 2V79A 4XWOA 2PEXA 4KICA 3S1AA 2K5UA 1G3IA 2BDTA 1OHHA 5HDNA 2JIZD 5CLQA 2KKOA 1W7AA 2KIMA 1SXJD 3LXRA 3OAAD 4JYCA 3EPJA 5CVUA 4RSGA 1PVOA 2QENA 2IYTA 1MJAA 4MGKR 5EE5B 2O8FA 4OU0A 5KHOC 1KSFX 2P6UA 3O8DA 2OILA 2FBKA 3MG9A 1XEFA 5CM8B 1YKSA 1ZUIA 1NL3A 2BYVE 2O52A 2VHUA 4RD6A 3UWOA 5KU1A 4B35A 3PENA 4B44A 3ZGXA 2Q6TA 1IM2A 2XUBA 4ETSA 2PZEA 1KU3A 3C5HA 2JJ1D 2ZJAA 3DV8A 2V7QD 421PA 4XRFA 1AKEA 2VH5R 2PCJA 3CX7A 4G5SA 1YS6A 4A1FA 3GLFB 1R1UA 1RVDA 2CE2X 2H16A 3CH5A 3L0OA 5A5GA 1X1RA 3PXGA 1IZ1A 3T8RA 1PP8F 3IKTA 2NNYA 1MZBA 5FOUA 3LSTA 1MJBA 4OIPF 4URXR 2BVNA 4FI3C 5EP4A 4R2HA 2B8TA 2OZ6A 4FWIB 3WBKA 1DE0A 1UDXA 1E3MA 3FHZA 3E1SA 4EJWA 3Q7QA 4NHOA 4D4KA 4F7ZA 4QGAA 4QHYA 4ZO4A 2QM3A 4I01A 2LSOA 5LHGA 4ZZDA 4DSTA 2O8BB 1OYYA 2BBWA 4KODA 2WKRA 1AKYA 1KTVA 1Z0JA 2ZYVX 3ZH9B 1KKLA 4A6DA 4HLXA 1G19A 1CJKC 5IK2D 3C7KA 4FMDB 3KZ1E 1XCVA 3K0EA 3MHVC 4OIQF 1HKQA 1P9NA 2PX3A 2VP9A 2XOKA 2X8AA 2VE8A 3SFZA 1EXMA 4NYIR 3VR5A 4ABYA 2XAQA 4OQNA 2HFHA 4F4CA 4DLXA 1TW2A 2DFTA 3GLIB 4HV6A 2WICA 1MRNA 1U0LA 2ZJYA 3KJEA 4DUGA 5L3BA 4GNKA 4FCTA 2ANCA 4KDPA 2F1JA 1NVVQ 4B48A 5J4KA 3HSRA 1I27A 3ZD6A 2WWHA 1XTKA 5ILVA 4L9VA 1C9KA 2QTFA 2GAAA 4IHQA 5IT9K 2VXZA 4KFTA 1FLIA 2YWFA
chains in the Genus database with same CATH superfamily
2O9LA 4GPBA 2BM0A 1F3LA 4QFBA 1LSSA 1HTWA 2BMJA 2D4AA 1HTTA 3BPSA 1H4SA 4QU5A 1N5JA 1DJPA 2HMWA 1XG5A 4E30A 1VP3A 4HNQA 3GFOA 1UK9A 5FRMA 2B61A 4ZU3A 1SCAA 5DIFA 2EZIA 2JL1A 4KPGA 3IT2A 2VQEM 3ROUA 1UXOA 5JT1A 1RJ9A 4Z8YA 4QYIB 4J2TA 1A5BB 2WWGA 1JHRA 4LKRA 2QTGA 4EDFA 4IHSA 3M6UA 4PSUA 1U2TA 3QVMA 4C30A 1SK8A 2C83A 3IX7A 2BPOA 2O03A 4RD0A 3EMVA 3SBEA 1X1QA 3NV9A 4KO2S 1QGPA 2NADA 2VLIA 1N6OA 4RB0A 2CQKA 4YJ3A 1U8BA 5GAJA 1BIAA 2X0RA 2A0UA 2IYWA 1LBSA 3GTLJ 4MJ7A 4DDHA 1KPHA 1TADA 1ZAKA 2C2YA 1G5FA 3C5EA 3KAKA 2FS1A 2WHXA 2VBWA 1GUZA 3AILA 1NG9A 1G7CA 3BF7A 4NYMR 4FKMA 3PUYA 1R0SA 3PM1A 4WVLA 4HF0A 3UHOA 3V00A 5L3EA 2GK3A 5L8RF 3ABRB 3OTWA 2EFEB 3K4PA 4BEBA 3H9QA 1YBHA 1LEAA 3K0BA 2NOJB 4LHEA 1Z73A 2UXXA 3B3GA 1ISPA 3SZUA 1DJNA 1L5KA 3G0OA 2GWHA 3G7NA 1U8YA 4K0RA 3EGWA 5F3DA 4NH4A 4YCSA 1WMSA 4H6WA 1BR1A 5K5QA 1U2GC 4XRMA 1EP9A 1W4LA 3GPBA 3TM5A 5FJIA 1AD2A 4IAOA 4HDSA 4GOMD 1HOTA 1GAWA 3RHZA 4F6LA 1HH4A 4J01A 3TW0A 1JFSA 2OQVA 3TL4X 3W5IA 1I2CA 2VOOA 1L3LA 2WRZA 1QHSA 4CTMA 1XNQB 4LBWA 4WZAE 5I51A 2AB0A 3LXUX 4A69C 1ZD3A 2YJ6A 3SAJA 4GRDA 1ZUHA 3E6CC 3BIFA 2A4MA 2Q6LA 1FMJA 3WMRA 3UGQA 3BCSA 3J80K 2J9ZB 4YC7A 5EXPA 2CNKA 2Q8QA 2YNMA 1R7JA 1PZFA 4B3MM 4HLQB 5JR3A 4FGWA 4UNPA 3IJPA 2R1VA 3BP8A 5JAHA 4C7BA 3OFNA 4LXQA 1B6RA 5FWYB 2ADOA 4D0PA 1Z4KA 4LFCB 1L4FA 1W9MA 4WAUA 4YCMA 2J9FB 5HBRA 4LG2A 2BGUA 4ZDWA 2E5NA 2FPPB 5JE8A 1KZGB 1SNYA 1QMGA 1HDGO 2QJTA 3PUFA 4JC5A 1Y33E 1SCUA 4C0LA 5KWJA 3CNEA 2JASA 5B2FA 4FKZA 2X0NA 5TY0A 1SPXA 2VBXA 7MDHA 1W48A 2I54A 2R5YA 3VHXA 3R3WA 4E7OA 4EYGA 2ZT7A 3IH3A 4PZ9A 2VKTA 3ISPA 4UAGA 3IMKA 1LTHR 4AVYA 1UG0A 4DZTA 1FU8A 2C9CA 5KYKA 5AD1A 4W7SA 3RC7A 2QAGA 1VL5A 3Q3SA 1VMAA 2GEJA 4P1ZA 3AERA 3E6DA 2PMKA 1S0UA 2R87A 3BHMA 3SOZA 3R5SA 2C1EA 4AZ3A 3TPZA 2BZTA 3VNQA 1D1SA 1B6SA 4M6WB 2QIOA 5KAIC 1K6EA 4Q0MA 3NPAA 5KWEA 3L0BA 3HM5A 1VG9B 1B8IB 4LNUB 3PITA 3EG9A 5JADA 4B2PA 1KS2A 2KHHA 4AJLA 3I83A 4RLQA 1E6LA 2A4KA 2HJWA 1DBIA 3OT4A 3M89A 1MQ9A 3I2FA 1IBLB 1XRPA 3HBFA 1NDHA 1SVSA 3HLTA 2CSUA 3COZA 3UNXA 5AW6A 4G5YA 1A88A 1PYOA 4EFDA 1RRCA 1LNQA 4X97A 1UC8A 3KQSA 4IFEA 1VJ0A 1QNTA 1WCV1 2C94A 3RYTC 3CLKA 2MLKA 1N7HA 4N9WA 1NM5A 2DSTA 5FWNA 5BMZA 3G49A 4UEJA 5EP2A 2JGRA 4JT4A 5JSFA 1GQOA 1BJZA 3FYHA 3W3AD 1OTHA 3O74A 4RDUA 5DCYA 1QDEA 5B1HA 3IWFA 1KAEA 1TQPA 3L8EA 2VEDA 3HHHA 3AF4A 4MEBA 3G79A 1YO6A 5A7HA 2YYZA 4RF1A 5ARCA 3NBZC 1OZGA 3PNBA 2YFHA 1DEOA 5K8TA 4Y9DA 3LQFA 2J5RA 3GXBA 2EZTA 3M2TA 3PYMA 3AVYA 4WKNA 1YQDA 2YY6A 1M34E 2SKCA 1C30A 4BJ1A 2WU8A 2LZ0A 1WCYA 3CVWA 1G5HA 4MIMA 4WKGA 5BSMA 2LP4Y 2ZBKA 3DKPA 2HTEA 4KZPA 2HMYB 4QPOA 1CNEA 3OZRA 3MKLA 2FH5B 4Q1VA 1DOZA 3CSDA 4CCAA 5DE3A 1O97D 4UKDA 3LS2A 4JI7M 2WSSD 4MGKE 3DZKA 5CVCA 5A5VA 4L85A 1M6VA 3CCSI 4E7LA 2EBWA 4YQYA 1J97A 3I4MJ 3U3RA 1SURA 4TN1A 2O1XA 5JNUA 1XAJA 2PV7A 1BHJA 1SBZA 4RO0A 2ZK7A 1SZCA 4IRMA 4YJHB 4ESEA 3SASA 2AMLA 3SAUA 1NOIA 1T8RA 3HXTA 1VE5A 2R7LA 2QM0A 5B57C 5JSYA 1QH1B 5AXCA 4AP5A 5CAEA 3PDCA 4IH9A 3ANXA 4GDFA 1Z88A 3QLVA 2H1CA 5EMKA 5HFNA 1OE0A 3JQAD 2WV1A 1XD7A 4UBNA 1E2NA 3N0VA 3WJ2A 3FBNB 3A3KA 1FTZA 2WT8A 1HYQA 1U0TA 4CCKA 1DTEA 2FX2A 5J5VA 3AGQA 3L1IA 1J75A 3S7ZA 4QBGB 3HEAA 3T3PB 3RTCA 1EFLA 5T8KA 3EULA 4AM8A 4JQZA 1ZK4A 3MK6A 3B7ZA 3H4IA 3HPRA 1Z7UA 1RXIA 1OTRA 4WZZA 4RTKA 1M1UA 2ZULA 2C96A 2L19A 2PNFA 2YZMA 4TUYB 5EY5B 4Y1GA 2GRUA 5DK6A 1E3HA 4DG9A 5FBZA 5HLTA 3IURA 5L8VA 2BGCA 3GBGA 2FMHA 4G0ZA 4MLOA 2JD1A 3WNBA 2C77A 2C3MA 1UMQA 2ECCA 1MTZA 1NBME 4KK3A 5GZ3A 1PK9A 1Y7TA 2FE4A 3HB5X 3O47A 3IPCA 2YVQA 3EXIB 1L5NA 3SDGA 1F9NA 5DTRA 3QX9A 4B40A 1OSNA 2D74A 2CJYA 4X95A 1OW3B 3CG4A 3D3EA 2ZU0C 3GBVA 1YZ3A 1U99A 2WAAA 2DY0A 3KJNA 3R7LA 4JS0A 1D4ZA 3NDPA 2OCEA 3G2IA 1S01A 4L0ZB 4PBSA 1JQDA 2ZSFA 3C43A 1IZ9A 4ZOLF 3CW9A 3M8JA 1RXSA 1P9OA 3S7TA 2O7OA 1F0PA 2NSJA 3SQDA 2F55A 2KI5A 3M4XA 4I2VA 1WBBA 2O8CA 3DWGA 3PP8A 2E5ZA 1JLKA 5K0ZA 3CR7A 3HB1A 3OR1C 1R5HA 3HJHA 3WWDA 3GY0A 4DT1A 2FN4A 4RCYA 2HHCA 2K6GA 1UQTA 3ZI4A 2HAEA 2GCPA 2QXUA 3DR3A 5SY4A 4U5QA 1XQ9A 1JTFA 4QTTB 3FG9A 4YJ3F 3I12A 4LOAA 3VU3A 4W9NC 2WZDA 1F0KA 2QRMA 4EKGA 4ZICA 1M66A 3UXMA 3BY6A 3P0FA 1OIWA 4Y9TA 3SJBA 1LRLA 1G2OA 1T34A 1FFEA 3VPRA 1X1EA 1Z05A 1QSGA 5DYTA 4Q3KA 4RNCA 2MINB 4WXEA 3FLEA 2VKEA 4HDOB 3AI1A 2ID6A 2ZUEA 1NFQA 2I80A 3GGSA 4EKDA 4TWIA 3HKZN 4ZK6A 4N9QA 5AMXA 1W4ZA 2VDPB 2W24A 2XMSA 2L7FP 2Y99A 2FJ0A 2AXQA 1SGWA 3M5CA 4LOLA 1WKMA 1SG0A 5KYGA 3JR4A 4JP2A 3M34A 5LRSA 1RR6A 1V8DA 4OHWA 3I5UA 1S1CA 3CGGA 2OAGA 2QRPA 3G0HA 3A4NA 1Z26A 4HEJA 4L8VA 4CMEA 4LBVA 4PSKA 2P1ZA 4Q3CA 4IIJB 2HRZA 1JG1A 4ENTA 4JI2B 3NVDA 2JTVA 1VF9A 5LNK6 3KOZA 1Y7LA 3MFQA 3ZPLA 3U7HB 1F4VA 3K9PA 2ZAGA 3GU3A 2E4WA 5MGBA 3IQFA 2K27A 4HA8A 3D8LA 1GKLA 1ZRMA 2ZDQA 4WV3A 3GRPA 2B21A 2JVHA 1M83A 5I3ZA 3H4VA 5HE9A 3H3ZA 3T3MB 3HTXA 1Y3AA 4ENKA 1RCUA 2WJ4A 2ZIWB 1GKUB 1QAMA 3OTOM 3QE3A 2J5KA 4B81A 1X3LA 1FFHA 4OQFA 4XVHA 1T9KA 1F2TB 5EJ5A 5EPUA 2JA2A 2EERA 3GHHA 5LUAA 5E20A 4ZARA 4EY4A 5MN5A 5JCZA 1QHHD 5LU9A 4XYLA 2GPSA 1TD1A 3HJAA 4B4CA 4J0KA 3FZNA 2BKUA 1JAIA 1E0DA 4L5JA 3OJEA 2WSIA 1X80A 1PRBA 1K4KA 5KOYA 3IPRA 4CODB 4BHBA 3V2HA 2PVSA 2V26A 4JLUA 1Y6JA 1QPBA 2P8JA 4C4PA 4D41A 4UTZA 3DE7X 3TVTA 3IG8A 4ENNA 1K83J 1EWRA 1N3LA 3TE6A 1UJBA 2V5UA 2EWWA 2ERXA 2ZRCA 4WA8A 1ZIYA 3PCTA 2H06A 1BBYA 2EJSA 1N2OA 4R71A 2OBBA 1JIKA 4G4GA 3LA3A 2HL6A 2JFGA 4D0SA 3P2MA 4UNQA 2D2VA 2V9PA 3NOOA 3GPCA 1SANA 3DKVA 1QZYA 2BKVA 2XW6A 4HGOA 4AX4A 1E1KA 4Q01A 3MSCA 1V1RA 2DWPA 3DZDA 1E2HA 3K70C 3OQVA 1QLHA 3W6JB 3NB0A 2X2PA 2X40A 3UT5A 3PQJA 1YONA 3DFKA 3OEWA 4M9QA 1MBKA 5LQSA 2IOQA 4ZN6A 2CNWD 3D5LA 3GMEA 4EHBA 2P81A 1TTYA 1OYOA 2WQZA 2FN3A 3JR7A 4C3OB 3UKDA 1O77A 4DLTA 3NVAA 3INTA 3I51A 5JPCA 4L57A 2PIAA 2CCKA 2VAXA 1C3LA 3G17A 4Y4RA 4OLHA 1N9KA 1ZKMA 4A0HA 1UOOA 1ZESA 2AN1A 4HF1A 1G20E 3ZHOA 1J0BA 4RH1A 3ZIUA 3ZV7A 3AGPA 4IEJA 1OH5A 2IV7A 3I23A 2WTEA 1YB2A 2V45A 3I04M 4ISBA 2NSLA 2HOEA 4RPCA 4N49A 4QOIA 1H05A 3GO4A 4DZZA 1QM5A 2W85A 3V1UA 3WLFA 4CYDA 3RODA 5JMTA 5LP6F 3B8EA 1EFVA 3RGSA 2HKXA 3OEHA 4HEA1 2GA9A 1OFGA 2OCIA 2IODA 3FMPB 1YE5A 3G3ZA 4AVPA 3LWFA 2YJNA 3CZ5A 5KC9A 1GOTA 2QQEA 3UN1A 1AS3A 4PO9A 4R40A 4XSVA 3HO8A 5AOCA 2CD7A 1KOLA 3OZCA 3ZDQA 2AE2A 1P5ZB 1N3BA 1XN7A 1XCGB 4HDVA 2FLKA 3CUQC 3FWNA 5JZOA 1AQLA 3OHMA 4KBFA 1HLFA 1WGLA 5LZ8A 1Z21A 5MFZA 5EZSA 2LF8A 2Y93A 2QW8A 4KMUX 1YUBA 3SU8A 2QLJA 4HR7A 3NKLA 1J9EA 5DEQA 3IHPA 4O4JA 3ZDZB 4I7HA 5B3JA 3WRVA 4RQTA 3EMKA 1MP0A 2FCAA 4H1TA 4YCBA 2RGBA 1JQLB 1R8QA 2I5PO 1P0MA 5BWCA 3OWOA 4KGDA 4H77A 5KWSA 1KMMA 4CZZA 3KT0A 4UTRA 1GADO 5E1WA 5FRNA 4B2LA 5J8CA 4S35A 2ZJBA 2EV9A 2FU5C 3WQRA 4KFCA 2I4IA 3IAS2 3F8WA 1FVFA 4L4RA 2W48A 4A8TA 2O8DA 2PKXA 4CV0A 3W2HA 4W9RA 3DHWC 1OROA 4XKJA 2XT6A 3ASZA 1H23A 1JKOC 4PXYA 3H2YA 3QVWA 3KYDA 1EQUA 2AC4A 3M6IA 2ZJ0A 4UULA 4URZR 2IBTA 3HJSA 2XUQA 4JT9A 3BL8A 4N82A 5JNLA 3NYQA 2WJPA 4DRXB 1TAHA 5FLEX 3EIWA 3PI6A 1M2VB 2QYOA 4LGYA 4TKUA 1XE3A 4KMRA 2R1TB 3E7DA 2IGMA 2QZ8A 1H8ED 4PF1A 4W9NA 2AF4C 2ZBVA 1E2XA 1S7CA 1FLAA 3A4YA 3KL2A 2QPLA 4R8HA 5K7ZA 4TS3A 2B7LA 5JXWA 4NCXA 2HZBA 1F4IA 2ZCUA 1K3FA 4ZOQI 4NXMM 2R4TA 3VJRA 3D5RC 2B69A 1QK5A 1SA0B 4N3CA 2Q45A 2H8WA 1IE3A 4MW7A 4P83A 2DFHA 5KINB 4MVJM 5DNAA 3A6EA 2ORED 3DF8A 3A25A 1JBKA 2VXOA 5A2QK 1LSOA 1SZJG 1MVOA 5JMWA 1JAXA 3WKEA 3W5HA 3OEEA 4TL8A 4ETIA 1U9CA 2LIPA 5F04A 4ES6A 2DG2A 2EKBA 5IJ0B 3N28A 1KOFA 2E5FA 2W58A 4L18B 1LZKA 3BK1A 5IVIA 5I8WA 2VQ3A 4MTEA 1PFKA 5IWAM 4CM9A 4DLWA 2DTEA 3W8DA 1CDDA 1I2BA 1YYVA 3U9TA 2EB7A 4O5VA 2H2HA 3C74A 4K5QA 2YYAA 5LR6A 4BFTA 4HPQA 3Q7IA 1T4BA 2DCMA 2VXYA 4M9CA 1UDAA 3OVMA 1F7VA 4DV7M 1DT5A 3SIPA 4AJIA 1AMOA 2PLFA 2VHEA 3MJRA 5CFNA 2CXOA 4GICA 4W5RA 3U3JA 1AXRA 4MMZB 4UZSA 2VF8A 4J4HA 4KWHA 2VONA 4X6YA 2KQRA 3IP5A 1KHHA 3AEKB 3M1EA 1KR5A 2ZMEC 1O03A 1RKXA 1R9MA 1HYGA 3QY0A 1A97A 3PR3A 3EUAA 3BA6A 3C3JA 1RZ4A 3DG9A 4U9HS 5F1PA 1NMEA 3ML6A 1FFGA 2C1ZA 1EQ2A 2E1MB 1NUAA 1ZEMA 2OFOA 3VTZA 2BFFA 1CJTC 2C84A 1MBFA 2HF7A 4LZOA 4LRTB 1PUJA 1YX3A 5HIKA 4JVOA 5BMVB 5DGCA 4WP2A 1DRKA 4AFNA 2RHMA 4JI4M 2ESHA 3JQAA 1HQYE 4ND7A 3PEUA 1OR8A 1QGED 1OGIA 1UT8A 2WEKA 3B9QA 3HY3A 2QXYA 3TQTA 1K08A 3GFJA 4F7WA 4HX5A 2QCOA 3HRTA 2HZDA 3QP9A 4EEXA 3FDFA 1EGMB 4GI7A 1MRZA 3KHKA 1HKSA 3ZQUA 4GM4A 5U9CA 1HURA 2FXIA 2A0WA 4OMYA 2B78A 3D43A 4OMUA 2G5GX 1KK0A 2QZZA 1PJLA 1ZXLA 1ON2A 2GK6A 3B2NA 3GAZA 2B8EA 4L5EA 3ZHRA 2K5UA 3LOQA 5BRNA 3GFRA 4JYCA 4BBAA 2RAFA 3B6KA 1J9GA 1GN8A 1EE2A 1VJ5A 4QUBA 3FNEA 3OLQA 5DMXA 2WAQN 2VH5R 3CX7A 3ONDA 3PC6A 3RTAA 2P41A 1YB1A 3HWWA 2YDXA 3UFBA 2JI4A 1VL2A 4FI3C 4NV0A 2UYOA 3NU1A 2QM3A 3KZIC 4GXRA 3PTZA 1KKLA 4FR0A 5IK2D 4YFVA 4AZTA 1LQTA 4E4YA 3GG2A 3GMIA 1TW2A 3T5AA 2DFTA 3IDZA 1U0LA 3HSRA 1QNFA 1N9ZA 3ZD6A 5ILVA 3TTUA 4ZCSA 4BCCA 5LSAA 4L28A 1BXRB 2FXAA 4GEKA 1I2MA 3PDIB 2O20A 4HMQA 3WK8A 1EXDA 1E2DA 4JBNA 4EMSA 4ZC8A 2VQGA 4EPVA 2DOEA 1R49A 4DW8A 1Y6ZA 3G1LA 5FI1B 5KZMB 4OU7A 1QKJA 4DKXA 3PUBA 5B7NA 3RQSA 5BVGA 3V8NA 2B9EA