2FNAA

Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
357
structure length
352
Chain Sequence
GMLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIMSGSEMGLLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSKCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein
publication title Crystal structure of a novel archaeal AAA+ ATPase SSO1545 from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Atp-binding protein
total genus 128
structure length 352
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01637 ATPase_2 ATPase domain predominantly from Archaea
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2fnaA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fnaA01
4QKQA 3BROA 1EFTA 3MRSA 2M30A 1AK2A 1S3SA 2LKCA 4WXDA 4JYBA 2BEKA 1RI7A 2QUFA 1QHHA 2G1JA 3QVVA 3CM0A 4CZ2A 4TMKA 5HS7A 3ZPLA 3FF5A 1Z0JA 1VHTA 3H4MA 1CJUC 1NSFA 1TPZA 3FKSD 1FWZA 3GLXA 2L02A 4P0TA 5LRRA 3LW7A 4P9FA 1K5DA 2GETA 3P27A 3PQKA 5C4GB 3TH5A 1ZM2A 2FSWA 1KDPA 3IRRA 3GLHE 4DCUA 4O2RA 4HBLA 1ZRDA 1WXQA 4FT8A 1TMKA 1VIAA 3TVDA 2X8AA 1U5TA 1D5CA 1ZD8A 2JSCA 2JCSA 3ZIAD 1DAGA 3ZQJA 1KK2A 2CNWA 2YZ2A 4AKHA 3FHOA 3UIEA 3HHHA 2VE8A 2EQBA 2GNOA 4IRUB 4R71A 3U6BA 2E87A 2HLDD 2MSDB 1R1UA 1XCBA 4A5NA 1KNQA 4ACBA 3NKVA 1J59A 3L7WA 2PMUA 2UKDA 2EYUA 1GG2A 4PO8A 4GP6A 4GBMA 1UBEA 2BWJA 5JHHB 5ERIA 3T1BA 2JJ1D 3L2CA 4MQBA 2ZI4A 1I1GA 2LF8A 3SI7A 1EESA 4G6QA 1KYWA 1ZAKA 4QJ5A 1UFQA 4XLPF 1AS2A 1R4AA 2N42A 3HHGA 1XJQA 3ADDA 3ZMSA 3KETA 3A1VA 1FYMA 2B7BA 1TU3A 4QBFA 1Q1HA 2WKPA 5F98A 4ON0A 2A5DA 5H68A 4G7HF 2WIAA 3BERA 3W6OA 4TTQA 2A5JA 1SMTA 2ZRMA 2VOPA 2ZIAA 3GLFE 2ZANA 1EGAA 1Z0FA 2F5EA 1W7AA 3RS5A 2QM8A 1N6NA 2GJ8A 2DFIA 4IW3B 3IHWA 4M0LA 4TSFD 1XTIA 3FKSA 1E9AA 3THYB 2A6HF 3FHTA 2OAZA 4ENKA 5EE9A 1JJ7A 2OV2A 2J45A 3ZMUA 4UNPA 2QZ8A 4FMDB 4Y13A 4PDKA 3QOPA 3PV0A 5AK0A 3RWOA 4BLTA 1FPMA 3PR1A 2IW3A 2Y0MA 3T5XA 4JVNA 4LJYA 4Q4LA 3WNBA 3KKNA 2ZITA 5D8KB 3AF1A 2ATXA 1R58A 4LK2A 3THOA 5EP1A 4Z51A 5DNYB 3ZIAA 4BZQA 2QSYA 2D06A 4L9VA 4RKEA 2FMYA 2ADUA 2JPBA 5H20A 1NVVQ 4TLCA 5F2EA 3GPLA 1OH6A 4GFDA 3TO9A 2D45A 4N0DA 2R7DA 4AG5A 5CVRA 4BFZA 3GLFA 2HLDA 2FOKA 5D6EA 1G3SA 2OQGA 4KN4X 3R0AA 1FYKA 3QPUA 1GM5A 2ZAMA 2DI3A 1KKLA 2ZJOA 1NJGA 2HTJA 2YSRA 4HF0A 1IY2A 2IS2A 1ZYUA 3FM3A 1XD2B 1J99A 1E9EA 3PXGA 2RN7A 2ATVA 2JJ1A 4C0LA 3RKWA 3MWJA 4G9YA 2FA9A 5ILSA 4AI6A 2CVHA 3U2QA 3NH6A 2IYTA 2DT5A 3AF4A 4L9SA 4EPRA 5JS7A 4QM7A 1SHZA 4II7A 4WXCA 4OIRF 1P4SA 1O7LA 3PENA 5LEJA 2Z0MA 5EXXA 1Y63A 3I0TA 2HJVA 4PTLA 3GVAA 5G41A 4TSFA 4DQ2A 2WWXA 3S1AA 1N6IA 4AD9A 3I8SA 1IXZA 3EPJA 1Z22A 3I1FA 4L9NA 2Q0HA 4DSNA 4RZ3A 3B7GA 3EETA 3RKYA 1Z0AA 2RH5A 2P3SA 3DM5A 4NHOA 4QXAA 5J4HA 2AFHE 3DZDA 1P2UA 2B8TA 3OIYA 4LB6B 1JHHA 4TL8A 5FH9A 2DWZB 4PZYA 2J1LA 2LWIA 4EJSB 4O6JA 1F2TA 5FR2A 5FBVB 5KOYA 3V4GA 3F8BA 1R5HA 3J81Z 4KI0A 1XMIA 2JT1A 2YC2C 2FU5C 2QTVB 2W58A 4YLGA 2VYFA 2J41A 3QKUA 1N0UA 1Z6GA 4MRPA 2Z99A 3KB2A 1ZM4A 4LGWA 1ZVQA 2ZJAA 3KJGA 4YIIA 1AA9A 4QHSA 1YFHA 5CB6A 1CF7A 2VOOA 4IDOA 4S05A 4UNRA 1P4WA 3ZN0A 3ZD6A 2ZRGA 1W2HA 3KKPA 2K4BA 4ZI2A 3KLNA 1TQ4A 2GCNA 5BN3A 1XBTA 4X8LA 3GXOA 3Q5DA 4PQYA 2ZI9A 5L3VA 1QHGA 5BN4A 1ZYRF 3W5IA 1KI2A 3CO5A 4JMPA 4B47A 1KQ9A 1SKYE 2YWFA 5AUOB 2ZJYA 3FX3A 3KP5A 4BNCA 1XTSA 1SD7A 1S9HA 1XTKA 2WPDD 3KUDA 1ZH5A 2QQEA 2ZREA 3PEUA 4WAUA 1LEAA 5DD4A 4RD6A 4OHYA 1XP8A 2ZETA 4KIGA 3U7HB 2FEZA 2GWRA 3K0AA 1KO4A 1IN8A 1GWNA 221PA 2RNJA 1ZRHA 3QJYA 2R3SA 4RGXA 1SD6A 2GCOB 3WY9A 3QKRB 5DN6D 1JGSA 4CIDA 2BMJA 5TRDA 3C1DA 2GZAA 1XXHA 3PUZA 3I72A 1E9BA 3K1PA 1ZNZA 2C9CA 3MWYW 3P1JA 3U60B 2EVWX 3EZ7A 4Q9IA 2NPFA 5J8FA 1ZG1A 1FMLA 1CS4C 2IBMA 1XSVA 4DIEA 3QG5A 1IJFA 1E2EA 2P5TB 1L4UA 5TB5A 4WCGA 4EIWA 3FE2A 2ZO4A 2QQAA 5GVSA 4B35A 1PVOA 2P5KA 3IILA 1O57A 1P61B 2QAGB 2QROA 2W6ID 3P4XA 4A9AA 5JFGA 2ZRLA 4W5JA 4OMYA 1I4TD 2WMNB 1HKQA 4KCGA 5CDFA 1VYUA 1KQ0A 3QEJA 3RKXA 1E2GA 1W47A 4DSOA 4DBLC 3ETLA 4PANA 1XPRA 3IHUA 2ZVQX 3KP7A 4DCVA 1O7FA 1PUJA 1G7TA 1E2HA 2F43A 4YMSA 4JN6A 2EFQA 2PZFA 3RHFA 1PUEE 1K79A 1ZC3A 2H09A 2WIBA 4K46A 4ZCLA 3CNLA 3J81K 1JR3E 4U88A 1ZNYA 2JLZA 3R9XA 2WPDA 4HZUB 1S96A 3F23A 5FOUA 4H1UA 1XGSA 3HTSB 2QPTA 3TE6A 1SVLA 4L16A 5EJEA 1DEKA 3FFAA 1S8NA 4UQOA 1Z3IX 3FPAA 4NCIA 3KFWX 2H6CA 2WV0A 1UJ2A 5DN6A 5DDGA 1J75A 1AS3A 1IQPA 2XEXA 1E94E 1FOKA 4M8NE 2O3FA 4EJVA 3LFUA 1LVAA 1N6PA 1OYYA 4XBFA 2NIPA 2P67A 3AGQA 2PBRA 4D4JA 2IUSA 1ESMA 2A61A 2FE4A 5KVRA 3D6TB 1RPZA 6PAXA 2GXUA 4M9QA 1ZCAA 3PIRA 5TXGA 4M9SA 2PCJA 4BHBA 3O3KA 3C18A 1P4XA 3QF4A 2X0LA 1T6SA 1MOZA 3P9KA 3LWFA 3I71A 1K6OA 3ICQB 2F9LA 4DUGD 1E0AA 1ZLKA 2QZ4A 2W6IA 2ZS8A 4CW7A 4KYUA 4KSCA 4MKIA 2V9PA 2OQRA 3DMDA 4A82A 4LZZA 4WZAE 2LF7A 4RFSB 2O52A 3IHLA 2AKAB 1G21E 3MJHA 1XMKA 3NC1C 1UKVY 2A9KA 3CNNA 3K9GA 1KYZA 2G7UA 3IWFA 1ZU4A 3FGNA 5JEDA 2JLUA 4A8JB 4EQ6A 4HX4A 5BN5A 4HQEA 3F21A 4BXUA 4BHPA 1U94A 4B71A 3EC1A 1Y3AA 3IKVA 2OXRA 5LB4A 1Q22A 3VNVA 1KU7A 1KMQA 1AS0A 2PCLA 4B32A 2AR7A 2BGCA 3DP7A 4LDJA 1E2IA 3PQCA 2OESA 4UNNA 1X3SA 1BI1A 2YHSA 3NDBB 2ZPTX 2O8DB 3CJNA 2OCAA 2NO1A 3DEFA 3TLXA 3RYTC 5D5WB 3LV8A 4DCNA 2O8EB 1ZNWA 3WRYC 4B48A 4Q4AA 1R8SA 4GMXA 5KDOA 2QBYA 1OMIA 2WOJA 3QOFA 1A82A 5H6QA 2J0UB 3LBHA 3VB2A 3N97A 2DQRA 4B09A 3OIWA 4N9IA 4WZBE 4QBIA 3PJRA 5A2QZ 1BJAA 2AXPA 3LBNA 2GEUA 1MJ9A 3TOBA 2ORWA 4GRAA 3IWZA 5TJJA 2WHXA 1OXTA 1OR7A 3EZ9A 4A0FA 4KDPA 3EZ2A 1OKRA 3E5UA 2DHRA 2ZYVX 3SZTA 4Q5IA 4NHJA 1E9DA 2YOHA 3EXAA 1G7RA 2W24A 4DUGA 3AVPA 2D4HA 4Q7JB 1LDJA 3PITA 4MGRA 2IYXA 1Z5ZA 1T2KA 3CH5A 3SNHA 4M1WA 2QGZA 2ZE7A 1GHCA 3HP1A 2ZTSA 4IOLA 1OHHD 1UADA 1G4UR 5AJYA 3TGPA 1SXJC 4IRIA 2QYOA 2RQPA 1I4LD 1DG1G 4KO8A 2A5YB 1Z63A 2O0YA 2NOAA 5CM9C 4BEBA 4A0RA 3K70D 5F64A 3F6VA 5JZVA 3FMSA 1X6VA 3UMRA 2HQRA 4PZZA 2Z9OA 1NRJB 4QGAA 5LBIA 3FOZA 4Q9HA 3QY0A 4LG0A 3BIFA 2XV4S 1AM4D 1CRPA 2RHDA 4Q4HB 3MZHA 4BRUA 1KO5A 4HAWA 5FOWA 2NRAC 4Q1AA 2OCBA 2YNMA 5LHHA 1WSUA 1TUIA 2B8WA 1LF0A 1J0RA 4PXAA 4C7OA 5CJ9A 4PCQA 1XZPA 1YR6A 3ZJYA 2VXZA 3VTKA 2CHVA 1NMXA 2FFAA 2GVZC 2OSBA 2CHQA 3GD7A 3RYRA 2QTFA 2CQKA 1ELOA 1H0MA 2Y8EA 2CL7X 2PT7A 4ZYGA 1UKZA 2EWWA 3PUVA 1WQ1R 3UG7A 4EPVA 3LLMA 4QL3A 3ZZUA 1DAEA 3NQOA 4B2LA 1HW5A 5FPKA 3CUQA 2J5PA 1G5PA 2CBZA 1IZ1A 3KKOA 2UXXA 2EJRA 1LB2A 1DELA 5EP2A 2WKRA 3WNCA 2J59A 4F93B 4LC0A 1OFTA 4LLNA 4LYJA 2FDCA 2EW1A 1IAWA 1F2UA 4W9MC 4HLUC 2QU8A 4J0QA 5BQ5A 4KIBA 5CLSA 1E69A 1OHHA 4RZ2A 1KU2A 5A2QK 4OIQF 3NVAA 5KHOC 2RGNC 4V03A 2OZEA 1X1RA 2VHTA 4B3XA 4D82A 3D5LA 3QXHA 3PVSA 4LYHA 2Z5UA 2RGCA 4PR0A 2IHYA 4RCYA 4CF7A 2IC5A 5CITA 1WF3A 5L8VA 1CF4A 2H27A 1TEXA 1VECA 2H8KA 1QNTA 3WHLA 3NH9A 1TQMA 2GXAA 1HTWA 4DT1B 4R1HA 1W4RA 4L5IA 1W49A 4D0PA 1E4VA 1U98A 1ZCBA 3GQBA 2IUUA 3KL4A 3OAAD 4HSEA 1G3MA 3OEED 3HSRA 5FL7D 1H8HD 1UBGA 2XX3A 3KX2A 1RZ4A 3DPLC 1S8FA 2W2VA 3V4FA 3VKGA 1O3SA 4MEYF 4JVMA 1QHHB 1U90A 1I27A 2JATA 5LGUA 4QG7A 3E3VA 5TDHA 4PAMA 5BYKA 2IRFG 3AVXA 3R4KA 4DZZA 1Z7UA 5FBLB 4G3XA 1IONA 3QPTA 3G3ZA 2KSQA 3SZPA 1N6OA 3N70A 4TYPA 3VX3A 1G4DA 3WGHA 2AXLA 2D74A 5KNCA 5E1WA 1DARA 4K81B 1G3RA 3AVVA 5ED4A 4M73A 1SVSA 3GJ3A 1IY1A 3WTSC 2XAQA 4XTRA 3DQVC 1T0HB 3QKRA 2JLSA 4Z8YA 1HKTA 3CLOA 1R22A 3QU3A 1U5TC 1U5TB 4Q19A 4E70A 3NBXX 2VA8A 4CEJA 5JJIA 5EQTA 4ZV4A 4TZ6A 3QKSB 3SC3A 2OCYC 2BMEA 4YDHB 3L9FA 5KDLA 2GK6A 3WE2A 3FMIA 3GJXC 2GVDC 3E6MA 3WHKA 2BKUA 5FI0B 1KDTA 4EFMA 4QGFA 2OEPA 1XSDA 3AP1A 4FMBB 2B0LA 5KK1A 3MFYA 2QAGA 2P7CB 1XZQA 3K69A 3CX7A 4M2LA 3RJPA 2WWWA 5B58C 1U0HC 4R7ZA 4DC9A 1NVUQ 1EG7A 3OEEA 1GKYA 3HPQA 1YLFA 1FSEA 2NO9A 2HCBA 3HSEA 1H8HA 5FL7A 4DLVA 3OV8A 2ACJA 1XMJA 1FMJA 1YJ5A 2AKYA 5FOTA 5JLJA 5FTMA 1E4YA 2D2FA 3R9IA 2IS6A 2JAQA 2HYFA 2AFIE 2HEIA 1AJEA 4RGSA 4LRTA 3LO5A 2ESNA 3RPQA 3CX8A 3O8RA 1PV4A 1EK0A 3AAFA 1GFIA 4LX0A 3GJ6A 4MKFA 5FTLA 5FR1A 1E99A 4XLNF 1XEWY 1FNNA 2ZMEB 4BLOA 4HZUA 2WWIA 5J4KA 5D6FA 2JJ2D 4POAA 4QC2A 2EV6A 2EV0A 1OV4A 3ND9A 2L4MA 1BH2A 1TNSA 5BW8A 5AJWA 4XWOA 3HRTA 4HLXA 2W85A 4LD5A 4IHQA 3FHCB 3GJ5A 2AL7A 1R10A 4DIDA 3N5CA 5L3QB 4IRGA 3RS7A 3MEXA 3GFMA 1ZINA 3L0OA 4RFVA 3DFGA 5CVJA 1OYIA 1HBXG 1W0JD 1ZM9A 1ZU5A 1O3QA 5E8IA 2QT1A 5FPHA 3OF5A 5LDDC 2VODA 3Q72A 2IYQA 3LX8A 4C2UA 1PJRA 4IPAA 3KP4A 2ONJA 1G5RA 1SFXA 1KO8A 2AWOA 2GRJA 1BS1A 2XNDD 3GJ0A 4CEIB 1U8YA 2Q21A 3CH4B 1XSXA 1ZUHA 3QE0A 4A12A 3LVQE 1KJYA 1P75A 5DHFA 4BH9A 1MO5A 1RRPA 3SYNA 3MCZA 5L3BA 4BECA 2VE9A 2IT0A 1XWIA 1BC8C 2X1VA 5KTYA 1GL7A 3HWSA 1OT3A 2OBMA 2V6JA 3H84A 4U0VA 3K9LA 1FP2A 2GBLA 1AZTA 4N3NA 3AB3A 3K0CC 1XGOA 4EQQA 2H6BA 1S9DA 2CMKA 3B85A 5BPIA 4ETSA 3GW2A 4OQNA 3SQWA 3BPVA 1DAKA 5JBQA 5HTKA 3VR6A 2O0KA 3WYGA 5JHGB 3H3UA 1GITA 1KSJA 4GT1A 4O25A 3ZGXA 1B23P 2DK5A 3K1JA 2Z4RA 2CE2X 3ZP5A 3MAJA 2AK2A 4LCBA 2DWOA 3EQLF 3A36A 4V0ME 2IEYA 1S2MA 4A8JA 4DLXA 4KT5C 2D2EA 3K0FB 4PC1A 5K8IA 3S1AB 2MBFA 2F1IA 1GSIA 2VP6A 3B73A 1LEBA 4HAYA 2EFGA 1J9IA 2ZRIA 2MSCB 3DV8A 2YWGA 3QIAA 2JJ2A 4Q03A 4KBFA 1DPRA 2JTVA 1D8JA 1W2GA 2DWPA 1GL9B 5G40A 3I62A 1F2TB 1KZGB 3O6BB 3PUXA 2G7HA 4O0MA 4NL4H 1CULC 4ITRC 3SEAA 4D0GA 2Z43A 2EFOA 2PMHA 1N0WA 3GFJA 5DYMA 3QU6A 1W0JA 4Q1CA 4DLZA 2Q9BA 3ADKA 4Q02A 4IDPA 5CLQA 1O3RA 1YKSA 1T0FA 1XU4A 1WRJA 1R1VA 1NG9A 2DPUA 1KI1A 1M2OB 2XNDA 1CF7B 1L4YA 4R79A 1RFLA 3GX4X 1XFAA 2CE7A 4DEYA 4CT4B 4CYDA 2IXGA 1U9IA 3X1DA 4ENMA 3O2PE 2ETHA 1E79D 1YE8A 2FSHA 2BBYA 1N6KA 2QRZA 2ZE8A 3BJIC 3WTUC 3LD9A 1UM8A 4ARZA 3T12A 2EYQA 1VHLA 3OOPA 4JIMA 5KNBA 5LD2B 1OXSC 1Q3HA 4P96A 1K7AA 4ZZLA 2G3YA 3HIFA 2JGNA 3AKEA 1Z6XA 2ZVPX 2VF7A 4FX0A 2BBWA 3K0AB 2DAOA 3SYKA 4BWYA 1HE8B 2DBYA 4EM0B 2KRKA 2WV9A 5KO2A 4XVRA 1TBXA 3BP8A 3F8CA 3GJ8A 3KDSE 4A2UA 1Q1EA 3K9TA 3GLIB 3C5CA 1GZSA 2F55A 3MUFA 1RRFA 4G6DA 1NI3A 4C4PA 2QMHA 3NG1A 5J40A 4JLBA 5DSZA 1XXHB 3WG9A 3QPWA 1W4AA 4HA8A 3D8BA 1OE0A 2P6NA 1ZBDA 5K5QA 4NTZA 1KDOA 3UKDA 1CR2A 4LMYA 5LRSA 4LV8B 2DFNA 4TN1A 2RVCA 5K5RA 4NH0A 3EYIA 4A2WA 5DYIA 1F3OA 1OH5A 2WWHA 3WTYC 2A5FA 2PL3A 3AUXA 2Q3HA 4K8OA 4IDQA 4YMUA 1CBUA 4A0ZA 2FSIA 2LDUA 3TK1A 2L54A 2QM3A 1KNXA 1KK1A 1WE2A 3TQFA 3WU1B 2E7WA 2MH2A 3B6EA 4FX4A 1QG2A 1LDKB 3BGWA 4HB3A 3E6DA 1T3HA 5B64A 2DPDA 1WKMA 2KWIA 4C0JA 3UPUA 3J81k 4ESVA 2FGJA 2FMXA 3ULQB 4W5WA 1VMAA 8OHMA 1G3WA 3BXZA 5IHPA 3AKYA 2QMUA 3T5GA 2XOKD 4XVQA 2F43B 1E79A 1Q3TA 1D9XA 1PP8F 4GITA 1P2TA 2FU4A 5B30A 4H0EA 5IT3A 3GEHA 4G8XA 4QLCU 5FPSA 3MMPA 1M6NA 5EE0A 2D7CA 1TQIA 3GFTA 4A3VB 4MUBA 4FCVA 2CJWB 3AGPA 1NVMA 2ZXUA 1EX6A 4HDCA 4BLSA 2P6UA 1GIAA 4RSGA 2E1RA 2JLXA 4CEHB 4U7DA 1XMVA 4PSVA 2G0TA 3HJNA 3TJZA 5LEKA 3HUGA 4CDGA 3BFVA 1NLZA 1E1RD 3H92A 1XMSA 4P33A 3TGNA 5C2JB 2PMKA 2BJWA 2EB7A 2G88A 2EFWA 1YR9A 4V0LA 3K0EA 2IYUA 4LC1A 3WMEA 5D3QA 1OSNA 1RW4A 1G19A 5TV2A 2W83A 2I3BA 4RB3C 5JR3A 3TDUC 1YW9A 4HZFA 2G9WA 4PSAA 3AF2A 2ORVA 3BOQA 3L8YA 3HTUA 3LX5A 2GAOA 2HV8A 2Y75A 3QF4B 3B60A 1MJAA 3SBDA 4WXHA 2BMDA 3VX4A 2BEOA 2W84A 2J46A 1QZZA 2RGVA 4YFNF 2AD1A 1TF5A 1KSGA 3LRPA 1UBCA 2HXYA 4MKHA 3WYFA 3HYIA 1N5IA 4WK8F 2QQ0A 3VOEA 4IFBA 2XROA 3LDAA 3OHMA 5TMPA 3NEUA 1HYQA 2D62A 1DBSA 3IC7A 1PZNA 1RVDA 3FVQA 4LBWA 4URUR 2OLJA 2CGPA 1ONBA 1E2LA 3PG5A 4ZDWA 2VTKA 2XB2A 4Z8XA 1R2QA 4LJ9A 2DFLA 1A1VA 1FPQA 2BV3A 1IUYA 3B1YA 1NP6A 2XOKA 3AVTA 2GZHA 2ZAOA 4QHYA 4OYHA 1MH1A 1ZIPA 2DU9A 4HLDA 2Z33A 4NYMR 4EQ6B 3ONWA 2BBSA 3T1VA 4AYWA 5FTKA 5BMZA 2GIVA 4LYFA 1Q1ZA 5LGTA 4A15A 3GJ7A 1KAGA 4Q7LA 3MJRA 4ESHA 2ZI3A 3PEWA 3VR4A 2KIUA 3REOA 2GQQA 3NC0C 2VP4A 3QKSA 4DKXA 4Z1MD 4G94A 2QT0A 1WP9A 1E2MA 1T39A 2DCUA 1W7PB 3CDHA 3LA7A 1MD0A 2G0NA 4JS0A 1FYLA 5ANRB 3RS0A 4Q4AB 5HLGA 2QBYB 1CRQA 3QEOA 2STTA 1E1RA 2BC9A 2MLKA 4D2IA 4BGDA 1UAAA 1FBSA 3F6OA 3FZVA 2DK8A 4EMSA 1X1SA 1N5JA 4DLYA 2AD5A 4DLSA 4Q66C 2WJYA 1YZKA 3JAMZ 2IWHA 3F3XA 2H57A 5EZ6B 4OK6A 3ZMDA 3I53A 2XXAB 4OI4A 3CB4A 2HOEA 1KI9A 1G3UA 4I0BA 3E2IA 2RDPA 2OA4A 3ABUA 3OESA 1TQDA 2FFBA 1HH4A 3U61B 4YMVA 3SBEA 3CTAA 5CYVA 1DAHA 1IOZA 4B6FA 4WA7A 2L4AA 2ZEJA 3RVBA 1IM2A 1R36A 4ZO4A 2D7DA 4C30A 5KSYA 3ICEA 1VG1A 2Q0OA 5BQTA 2ZMEA 1I6XA 3QENA 4LFUA 2DZNB 3M7GA 2O8BB 2W6JD 4UV8A 2JEOA 3CPJB 3N4MA 2P5VA 3T8RA 3CR8A 4PPGA 2A3SA 5UKDA 1Z28A 1KQ8A 2YC4C 1L7VC 3KFVA 2B21A 5CVVA 5L3QA 2R62A 3B82A 3MFKA 2ODNA 1YQAA 5K1YA 1OF1A 2H17A 2ODEA 2JDID 4TQUS 1JHFA 3RPUA 3T06B 3A37A 1U6GA 4LG0B 2FWRA 1KMHB 1LFDB 4F4JA 1SHKA 3E97A 4TTPA 3WODF 5HDNA 3JSOA 1Y0UA 3NIBA 3U44B 4CEIA 4LRWA 1X8KA 4FWDA 1LVGA 1T9HA 2ZR9A 4NU0A 4ZYEA 1OB5A 2XGJA 5L3DA 3FMPB 1W48A 4NP6A 4MQ9F 1KHTA 1R0WA 1ZD1A 3SR0A 2BJVA 4JQFA 3ABTA 2NNNA 4U7BA 5DUKA 3ZZ0A 4B74A 2OILA 5JJLA 4QOSA 2ISZA 1ZHFA 1VCOA 1XNJA 4GNKA 1QPMA 3FXQA 2QSZA 1GDDA 4G5QA 1X37A 2IP2A 3C14C 4OI0A 3IBGA 2RGBA 2IA1A 1MKYA 3ISPA 3JZMA 4TQAA 3KKMA 2ECKA 4PPFA 1YVDA 5GJCA 2IF2A 2EK5A 2ODWA 4B2IA 2IYRA 4NYMQ 3CUQC 3CUQB 2OT3B 4ZKEA 3SYLA 3IQWA 2HGCA 1UHMA 1OIWA 1Q1QA 2WICA 3EAQA 1CJVC 3K0FA 4H1VA 4B3DA 2HT1A 2O8FB 5DO9A 3B2EA 2KJCA 4EKDA 1SAXA 1W4CA 1YYVA 4N9HA 2PZGA 4JBYA 4IHTA 3FMQA 1F2UB 1YW7A 3QXSA 2E1CA 1UFMA 4XVUA 2W6JA 1NBMD 3QG1A 1AGPA 1XRJA 3VU9B 3JAMK 1ULYA 4TQ9A 4EJSC 2FNPA 2VIIA 5JS8A 1RUNA 1G8HA 4PC7A 3D31A 5DHAA 5AJXA 4YONB 3K70C 3U7GA 1ZM7A 4I7HA 3K70B 1IRFA 4XH9B 1CEEA 3MG9A 2XAJA 3KXKA 3F22A 4DSTA 2JDIA 1IJEA 3BFXA 1LS6A 3CZQA 3WBKA 1XCGB 3GLIE 2RGEA 4RZUA 2D3WA 2Q6TA 1QGPA 4JLKA 5TY0A 5A0FA 1XXHE 2BM1A 1R5BA 3VKWA 3AM1A 4F91B 5KSZA 2QLZA 1TW3A 4O2LA 4QNMA 3EWSA 3NWJA 4R2HA 3V8KA 3PEVA 4WXRA 3DEUA 2SHKA 1F1ZA 4ACAA 4RD1A 1TADA 2ZYWX 5E1ZB 3U6KA 3C5HA 1KIMA 4URZR 5JECA 4PHHA 3MAAC 2H7VA 5KYKA 3AVYA 1OYWA 4U0WA 1ZAOA 3R7WB 2B6HA 4OHWA 4Z1MA 1RNLA 3OEHD 1FZPB 2VP9A 1F6BA 4B75A 2C99A 2W2TA 3EARA 5CDFE 3HOTA 2F3TA 3RS2A 3OIUA 4DCSA 3Q9LA 5CM8B 4B44A 2VP0A 3GLIA 3QPVA 4A2PA 3QRFF 3AJIB 3NBYC 4UV9A 5K8UA 2J87A 2J3EA 5HCIA 1J2JA 4S2EA 5JI2E 1KZ7B 1CR4A 3B9QA 3TAUA 5J47A 5JWOA 1H9TA 2P2LA 5DI3B 4CEJB 1NIJA 1WBBA 4NMMA 2QM7A 1SVIA 1NBMA 5BWMA 3SXYA 3FYHA 2J7PD 2HFHA 2ZQ5A 2KRFA 4JLDA 4V02A 1X3UA 1S3JA 1SFEA 4Z54A 1KK0A 1KA8A 2VT2A 3FWYA 3I3SR 3NEJA 4P3YA 2J7KA 3ADBA 3W3AA 1TNTA 3Q9SA 4NB5A 4NQWA 2REOA 4QBGB 1J5YA 1DE0A 1WCV1 3A1SA 4YDSA 2QAGC 5KSOA 4S35A 1FNMA 1KY2A 4LV6A 2XSZD 2GAAA 4XSXF 1E98A 4B3BA 5ILVA 2QRNA 4ASNA 2V6CA 4US2R 1IRGA 2OBLA 3ZVMA 2QPAA 3C7JA 4CGZA 3QUSA 2O8CB 4M71A 4IRHA 4FWHA 2VBYA 5FD6A 1N3BA 2XITA 2XAUA 1LQ1A 3HR7A 1TF2A 3EYYA 1WI9A 4HW0A 1KI8A 5HS9A 1MABA 1JB1A 1E2QA 1HKSA 2OXCA 4ZI3A 1GRQA 3Q8XB 4KFSA 4N1AA 4HAVA 1KTVA 2H1LA 2J5OA 3WTVC 1SD4A 4L0ZB 2Q9CA 3VR2A 4B34A 1MT0A 2FJUA 1H8ED 4KYWA 1UPTA 1X8LA 1EH6A 2P65A 1HV8A 2ZI6A 5EUQB 1YZGA 3RSOA 1G8PA 2UWMA 1C1KA 2CJWA 2FGKA 3FKQA 1YR7A 3IO5A 3K9NA 3I5YA 3OEHA 4CEHA 1W7PD 4LJZF 4OIPF 3L0IB 3LVRE 3KQNA 1B1BA 4GCVA 4XSZF 1ZG5A 1BC7C 1YZTA 2VSXA 5HDKA 3IEUA 2ZI5A 4E22A 4G5RA 4UJ3A 1JECA 2CSOA 5GADl 2PEZA 1F4KA 5HR5A 2DB3A 2IYSA 4GI7A 4PQRA 4C9BA 5LB2A 2V1XA 2HWVA 1ANKA 4LJ4A 4OOIA 3LAPA 1S1MA 3QXJA 1C1YA 1T5LA 5JSZB 5KPDA 2R65A 2J7PA 4D26A 3CIOA 1KGSA 3KEQA 3TO7A 3JVUA 1CR0A 4M6XA 1I2MA 1Z2AA 4JZKA 621PA 1TLHB 3LXRA 1N5LA 1BMFD 5IDVA 3IIKA 2GBLC 3I64A 2OLKA 4OINF 3TSWA 1SD5A 3ZMTA 4G0NA 2J0QA 2XSZA 5G3ZA 1ZUNB 2QQ9A 3QNUA 1P3JA 2FPMA 3EA5A 1R5GA 4NCKA 1GILA 3I73A 4M6YA 4UXNA 1T38A 2NNYA 1KU9A 1BI2A 2GEDA 4NE2A 5ILUA 4HB2A 4TLAA 3BB1A 3TR5A 3CKLA 1KO1A 4BASA 4DJTA 4XRFA 1GXPA 4A8JC 2D2WA 1Z8FA 4JL5A 4NPHA 1G3TA 5A5GA 2OD5A 1UKEA 1RKBA 4OHVA 4OJQA 2RGXA 2BBTA 2O0HA 2ZUBA 4LHZA 3DPTA 3W6JB 1OIVA 3AV0B 2ONKA 2MD5A 3IO3A 1XJCA 2HEOA 1H8EA 2GESA 3IGFA 1JALA 1T0JB 4OK3A 3SJZA 3CRMA 5BOXA 4KLZA 1QQIA 4QWQA 4EGYA 1G6HA 4MITA 3SOPA 3X1YA 5A4JA 3H1TA 5FTNA 1H9GA 3C15C 3SHFA 3E6BA 2Q8KA 5KUTA 1YZQA 2CDNA 3T5DA 2IS4A 5L3EA 1W7PA 1KJWA 5J5CA 5E18F 5G3YA 2KB0A 1EV7A 4JJZA 4A6XA 2K5UA 1IXSB 1QHIA 4OHZA 4MYCA 1ZRFA 4KXFB 4TYYA 4L15A 2ODBA 1GNRA 4KNYA 3ML6A 1YZLA 5K8LA 2BEJA 5TVKA 1XTJA 3UXMA 1KO7A 2XXAA 1U9IC 2EWVA 2N46A 1AWCA 2ZSEA 1OJLA 2M5WA 2V1DA 4IJAA 1IXRC 2RGGA 4WW0A 4A5MA 1R6BX 2ZR7A 4KSBA 5CK5A 4BLQA 5HS8A 4BUJA 4A6PA 4LOAA 3CUEF 3ZH9B 1V5WA 1IAQA 1Z6TA 4WVFA 1BMFA 4ARZB 1X8JA 2YKGA 5IK2D 1QVAA 3OIVA 4AIIA 3L8ZA 4LPKA 4TZ0A 1JI0A 1U8ZA 3J7AO 3JSPA 1XB4A 2A3RA 4BYYA 1E2KA 4XTCS 1K5GA 4GZMA 5KU1A 4MQVA 5FUYA 1P72A 3OFND 5FPTA 3TUIC 2JLYA 3W8NA 1F60A 4O3MA 3SDZA 1I2DA 3I5UA 4MTEA 1BOFA 2VP2A 1UDXA 4HUTA 2O8BA 2CK3D 1GNQA 4H9GA 1HEIA 1LNWA 5HCNA 4URXR 2OHFA 2R6FA 4RKFA 3F72A 1U8AA 2IXFA 3ASZA 3WMFA 2P6RA 5D5UB 4AWXB 4HV5A 1G64A 2W0SA 2PH1A 4TMZA 4ZCMA 4Y15A 1KMHA 1G3QA 5FOXA 1HW1A 4WXPA 3VMFA 3JW4A 5HVQC 3U44A 5AIQA 1QVRA 2FE3A 3AVOA 3QQ5A 3RS3A 2CL0X 3SN6A 1Z0DA 1ZNXA 4E5UA 4Q48A 4FMCF 1U8RA 5D3MB 3TBKA 4M1TA 4XIGS 5C1BA 4MUAA 2PN6A 4RB2C 1FX7A 2GF9A 2Z6VA 4KFUA 4AYXA 2IXEA 3T34A 4URWR 4IKEA 1US8B 4PFSA 1JJVA 2P7VB 2LCFA 2VHQA 3RYPA 4MGYR 5CJPA 1FBUA 4E09A 3EPKA 2FXAA 2ZSDA 4RVCA 821PA 3PFIA 4HYEA 3CONA 4DHEA 1DG3A 3F0TA 3TR0A 3ECCA 2W00A 4LBYA 4MYHA 1VCIA 1GXQA 4HLCA 3IKTA 2NQ2C 2O8FA 5E8GA 5IK2A 2XAHA 2XB4A 4AY2A 4CT5A 3KB1A 3BRWD 1E2JA 2C78A 1W36D 1Q57A 3OFNA 2PT5A 4GOXA 2JLWA 2AX4A 3MWLA 2XZLA 1D8KA 3BH6A 5EXPA 2IHBA 2JZYA 1KY3A 2FX3A 1XDUA 3VU9A 2CK3A 2CEAA 4HAZA 1UCRA 3SJCA 3KQUA 1M74A 3M8FA 4JJKA 3H2YA 4U00A 4HB4A 4NYJR 2BHRA 4KYIB 4BFWA 1KI6B 4P31A 2L3DA 1JXOA 1T6NA 3EW9A 2XKPA 4GDFA 1AKYA 2REXB 3CRRA 1A2BA 2F5FA 3P4YA 4FD2A 1NKTA 4M1YA 2VN2A 4OKSA 4NONA 2ZRAA 2F1RA 4PAQA 5EZ5A 1T3LA 2CLDX 2ZRPA 4FINA 4U5XA 2RMKA 4QJ4A 4TYNA 2P0EA 2WAYA 3IIJA 1BKDR 4WZ6A 4IDHA 2PQ8A 4O5VA 4HQMA 4I0AA 3ECHA 2GXGA 1CIPA 4B6EA 4F7WA 2WTUA 3W3ZB 3TQCA 3K0LA 2F6RA 2PLFA 4IVQA 2K7LA 3BJOA 1A7JA 4QBHA 1NLYA 4D4LA 4QM6A 1B9MA 1DO0A 1TTTA 1SVMA 2HUPA 2KIMA 1Q12A 1RIFA 1ZC4A 2G6BA 5F9FA 3I4LA 3V8JA 3BBPA 3R7WA 5SZJA 1DS6A 1UBFA 2ERYA 2O5VA 2JJ8A 3EPHA 1REPC 2PEXA 1W4BA 3I58A 4JVLA 2IJLA 4F92B 3W6KB 1JQLB 2HR3A 4OI2A 2A2ZA 4KODA 3HDTA 3BE4A 2QP4A 1XTQA 2EFNA 2EA2A 3ZVLA 4ON9A 2J0SA 2ZRKA 3NHAA 1S6LA 2WJIA 3MWKA 4BE7B 2C6YA 4LYAA 4GZLA 5DI3A 5SZIA 2G9NA 5KNDA 3THXA 4CZZA 3W5JA 3KFXA 1S29A 4AYTA 4Q21A 1XCVA 2FV8A 1XF9A 5H6RA 5LHIA 1TNDA 4OIOF 2DBBA 2UVQA 3AKDA 3B1XA 1OLOA 2AN9A 3O8DA 4AURA 2IA0A 5E17F 3O8BA 4TLBA 4GXOA 4GPTA 2YINC 1G16A 4DLUA 1U99A 4MRRA 4OHXA 4UVBA 2O03A 2IVMA 1C9KA 3BY6A 4TLEA 4US1R 3AVUA 4D25A 1EXMA 4BAYA 4P4UA 1SQ5A 4AKIA 1G18A 2WVJA 1GRNA 1R00A 1E0SA 3ND8A 4DNCA 1MRNA 4MTDA 3K09A 3ZYCA 3D0SA 3LA2A 3F3YA 4F38A 3K0SA 1STZA 1TF7A 4TMVA 2C8VA 3IBYA 4JYCA 4V0OA 5HE8A 4B73A 2O8CA 4EAQA 2F7SA 5DV5A 2ZSAA 3ELKA 1YS6A 1P9NA 4BFUA 1ZD9A 2M45A 2QA5A 3IEVA 4HDUA 3T15A 1WMSA 1GL6A 3WRXC 4FI3C 5FOVA 4RB0A 4CHUA 3M4YA 4Q7MB 4IOJA 4WIAA 1BI0A 5DEQA 2OBNA 4JSTA 4LJ8A 1W1WA 3V00A 1NMYA 1YU9A 2HTSA 4LSGA 1EFRD 2EU8A 1SVKA 3EG5A 1YG2A 4ZDIA 1P62B 5JHUA 4NYJQ 5JRJA 1HUQA 4MGZR 2ZRHA 2BDTA 3EIEA 4FW9A 2V6ZM 5DUIA 1KSHA 4EPYA 5JJKA 4DLRA 5DCMA 2UZIR 5L3RA 4EPTA 3RLFA 2R6GA 3MQ0A 2JRTA 3AVWA 3M0EA 3G82C 3THWB 1D8TA 1NLFA 2HYGD 1GRRA 3V9PA 4F4IA 1VPLA 2G83A 4RY2A 5JSZA 2M8EA 2Q3MA 4TYWA 3DPUA 2C95A 4W5HA 2FF7A 4Y17A 4D6PA 1O87A 4BQSA 2ZCWA 2HCJB 1BN5A 3A1UA 5E4FA 1NIPA 4KITB 1FUKA 3PUYA 2IYWA 5JRZA 4Q5SF 4RD3A 2ZFWA 1II0A 4OQLA 3C8UA 4EFNA 2WJGA 1V4RA 4M9ZA 4A0HA 4B3FX 4NCNA 2IWRA 1MV5A 4GYGA 2YPRA 4EVIA 1RYHA 2JLRA 2QGNA 3ZMZA 3I32A 3FXUA 4TLDA 1WB9A 4LUCA 1D2NA 1XEFA 3S2WA 1DP7P 3BH0A 4GOKA 2CCKA 1HQCA 1SKQA 2E7XA 1GKIA 4Q9JA 3Q5FA 3U4QA 3EASA 4FMDF 3R8FA 3CX6A 3H86A 3K2ZA 3GJ4A 2DO7A 3IPYA 3PUWA 2OFXA 3V7CA 1VTNC 2KE5A 1FY7A 5BS6A 1G6OA 2GWHA 2ZU6A 2NZ8A 2FNAA 2ZNZA 2RC4A 1SFUA 1EFRA 1P2VA 1YS7A 1QZYA 1OPXA 2BM0A 4MA4A 4DB4A 1II8A 1R0ZA 2MMGA 2WKQA 4GYIA 4HLQB 2H5EA 3CWZA 4L9WA 3VHLB 2RGAA 4FN5A 3B8HA 2QP3A 1VTKA 2V9VA 4G5OA 5EUMA 3TNFA 3U3JA 4A92A 4BFTA 1FW6A 4JLOA 6Q21A 3B9PA 2DQLA 3KTAB 3RRMA 3ZVNA 2OG2A 3QXXA 2ZRCA 5LBQA 2FPKA 1G8GA 4Y0AA 5SZHB 4AIKA 2C9YA 1UEJA 3KQKA 2PBIA 2O8EA 1AQUA 1QDEA 2P5LC 1YZUA 4Z2YA 4XSHA 1E2PA 5CYPA 1YQTA 3ZLJA 3DKWA 3T35A 1ZRCA 3U1DA 3A1TA 4QGHA 5IF9A 3QBTA 1NG1A 2X77A 5LD2C 4FCWA 4UNSA 1LF5A 4YMWA 1NN0A 1YIOA 1ZUIA 2VT3A 4EJUA 2IYZA 4EV0A 4LHWA 5C46F 3PEYA 2ZJBA 2K02A 1ZREA 2ZBKA 3RTRA 1YZNA 1KGDA 3BB4A 4WF2A 1IXCA 2VH5R 1QBKC 5FFMA 2OO7A 5LPNA 4B43A 3RNLA 5JWRA 4PC2A 4B2PA 4AWXA 1I4DD 1G6NA 1R1TA 4BFYA 1PLJA 3CBQA 4AVPA 1S0UA 4FCTA 1XEWX 2CXXA 4RD4A 2YR2A 3I8XA 1XD8A 4LGMA 2A5GA 4QNRA 1J90A 2ERXA 2OAP1 2E9SA 5EXTA 2DZOB 2IA5A 2ZUDA 4U02A 5D3MA 4JT2A 1N2CE 2YX4A 5CIWA 4BFVA 2G77B 3I61A 2XJ9A 4X8MA 1MKMA 3H3ZA 2GXBA 4JBAA 2KJBA 4FXPA 3VLFB 4OJKA 1JR6A 4DDVA 3P32A 3I4PA 4TMXA 2R6DA 2KI5A 3EUHA 1G17A 1US8A 2C03A 3ECOA 2MC3A 4UXHA 4PSKA 1UKYA 2NO7A 3FXRA 3UANA 1FSHA 4RD0A 3B13B 4HDOB 2YWHA 5HLIA 1P6XA 4EJOA 1P6RA 3WTXC 2DVWB 1VG9B 4KA4A 2XNSA 5G53C 1HY3A 1MABB 2GHIA 3RWMB 3TKLA 2QP9X 4AK9A 5HPYB 5EE3A 1P2FA 5FLXK 3VAAA 2VC0A 4KBGA 4LJ7A 1ON1A 1P9RA 2ZU0C 3LA6A 4R98A 2F3RA 1FOEB 1Z07A 2XJ4A 1PLKA 2ZROA 2PJZA 1R0YA 2ANBA 1W0KD 4LJ5A 1NSTA 5AWFC 2RV8A 2BYVE 2DR3A 4M74A 3RRNA 3ERED 4PPQA 3ZZTA 1KOFA 1TL7C 1LW7A 1BOAA 2X19A 2QTHA 1PP7U 4OQFA 1XDSA 1EFUA 1MDMA 2WJJA 5J8CA 4RAYA 5K8TA 1KI6A 2VBZA 5CVUA 5FPYA 2YWEA 1GUAA 4AKEA 1DVRA 5B2ZA 1E0KA 1NF3A 5E7JA 2YVUA 3Q5EA 2LSOA 3RS4A 4EPWA 3K9HA 2FEMA 5FFZA 1Z2CA 3Q3JB 4URVR 2CG4A 1JE8A 5JCZA 5CK4A 1XN7A 2BV6A 3MZYA 3NRVA 2OFOA 4HATA 4JLAA 5E7MA 1E9SA 2YOGA 2MH9A 3KXLA 1Z0IA 2NG1A 1TQ2A 3VODA 1ZJ6A 4KJZA 5FBQB 1ZGAA 2FN4A 1Z05A 4JT4A 2DFTA 2RGNA 4C0HA 1OKKD 1RJ9A 2JIZD 4Q1BA 4UVCA 1LY1A 3A4MA 3M8EA 4ZDKA 4KMUX 1FTNA 2BIFA 3FMFA 5ICGA 4PC6A 3M6AA 1VDZA 5C4MA 4LK1F 2VF8A 4NYIR 1ZG3A 2F2EA 4TV7A 4L0YB 3RABA 3U3MA 1B6AA 2PX0A 4B76A 3DL0A 2FZLA 1F48A 1RIOH 2HT6A 1EFHA 1JXMA 2N1BA 3LLUA 3QBVA 5E95A 3GF2A 1J7KA 2AHOA 3F8TA 1DUXC 1ESNA 5GJWC 4UKDA 1B4AA 1NVVR 1BM9A 3VEPA 1KAOA 4IF4A 3KQHA 4LI0A 3GLGA 4JLNA 2PEYA 4ILEA 1XGMA 4MRSA 4L4UA 3WGGA 4BLPA 2XVCA 4D0NA 4JLPA 5BPDA 1U0JA 3BFKA 3HYRA 4GOJA 2P5SA 3RC8A 5EP3A 1CU1A 1FP7A 1XGNA 1VYTA 1W0KA 1G9XA 3CF0A 2VC1A 4GGGA 2V79A 1CTQA 3IPXA 3KUCA 4KVGA 4HAXA 1W44A 2PX3A 3H0KA 3QI2A 4Q4ZF 4PZLA 4LHYA 1BO6A 5FD5A 2I4IA 4MGKR 3F8MA 2XTMA 2HYIC 3T1TA 2DFKB 1TU4A 2ZJ2A 3LQRA 3LXXA 1K6MA 1AKEA 3P7NA 2DLLA 4A0YA 3DKVA 1BIBA 3QP6A 4PC3A 3UMSA 1TTYA 4HV6A 4EDHA 3CZPA 4A6EA 2RCNA 4W7SA 3TUZC 2FA5A 1M7HA 1W5TA 1ZGJA 1FQKA 1A04A 1N6HA 1YTYA 1ZM3A 3BD9A 4PGGA 2OBPA 3IL2A 4HUQB 1LDDA 2QENA 4QJ3A 2NO6A 4C7OB 3B1WA 3J80Z 3WU0A 1ETUA 1GAJA 1G20E 4Q9KA 3LAJA 2F9MA 1N6RA 4I2OA 1HXDA 5L3CA 4DVGA 3KP3A 1OKKA 2JIZA 5FUWA 1USSA 5FGMA 2Q2EA 5DD8A 4BQAA 2ZE5A 3UWOA 4ERNA 2QWWA 1T8TA 3Q85A 2V6IA 2F1JA 2VL7A 3I59A 3C7KA 1JEEA 1ZP6A 2WOOA 4M1OA 2XZOA 4JL8A 4HF2A 4HX8A 2NO0A 4KN7X 5DH9A 3GLHA 4RS8A 5LHGA 2AS5F 2CL6X 2L0XA 4I09A 4RGUA 1W4MA 2GZWA 1U78A 2DPXA 1Q20A 1P60A 2GDJA 2KBEA 1U0LA 2ZJ5A 2HYDA 1HT2E 4CICA 3VNUA 2D1VA 1JBKA 1YR8A 1D2EA 2V4ZA 2V8OA 3HU1A 4CO8A 1V3FA 2CHGA 4MKGA 3THWA 2AXNA 3JVVA 1B9NA 2GA1A 1MGTA 2G1KA 2R44A 4YFKF 1DADA 2BVNA 1E9RA 2VLIA 2A6EF 4ENNA 3HPRA 4US0R 4Q18A 2FEOA 2NYXA 3GFLA 1FP1D 3V7SA 3ZS8A 2W0MA 4NBSA 3EX7C 4EM1A 3K1MA 4I4LA 4RJLA 1MR3F 4NYIQ 4YC7A 5L3SA 1P4AA 1ZLJA 3GEIA 3QF7A 5CLLA 3A6PC 3ZQ7A 4B8XA 3QXCA 4Q1FA 4DSUA 3DXJF 3B5JA 3VFDA 2NZJA 2EFCB 2EFDB 3EWAA 2YU3A 3RDPA 3D3QA 3MWMA 4HX7A 2KJQA 3TVTA 4C3ZA 5B57C 1N6LA 1PDNC 1TUEA 4NZYA 3GFIA 3TSZA 2IUTA 2ZRDA 4XWKA 1CR1A 1QG4A 4L8GA 5ICCA 4WX9A 4V0NA 3WP0A 4BHCA 3MCAA 1KU3A 3IQXA 2TDXA 3FMRA 2STWA 1QRAA 1QZMA 2EWNA 3ROUA 4OK5A 3HSFA 4C0SA 3BJAA 2IA2A 3K0CA 3NBFA 4B33A 3RRYA 2ORIA 1T4GA 3VR3A 2FRHA 3CF6R 3U7FB 3R9WA 2O61A 3JZAA 3JTGA 3FFBA 4WOPA 4BZXA 2A78A 5DIFA 3J80K 2GJ9A 4ASUD 1LV7A 2PG4A 2A68F 1USTA 1P73A 1FTSA 1W46A 4LWZA 3JTHA 1GNPA 2IYYA 2QNRA 4LLGF 2A30A 3T8TA 2XTZA 1BI3A 3KTAA 3ZDQA 4HDQB 5JEEA 4AD8A 1HSJA 2DW4A 2UZ3A 4TL6A 1E17A 3BS4A 4ABYA 1G1MA 1CKEA 1XPOA 1I5ZA 3NDPA 1Z08A 4DRZA 4DXAA 2IPQX 1RC8A 4GO1A 3RDIA 3WTTC 1NBME 2CCJA 4TYQA 4KAXA 4IVPA 1VIYA 4L9TA 1NHAA 1BIFA 1J70A 2HDNB 2JLVA 4N0BA 5DLQC 4OQXA 3TQNA 1UF9A 2CLSA 4ZDJA 2CO5A 3ZS9A 2QORA 1Q0UA 4AKGA 3N2IA 4TL9A 5FUXA 5D5VB 3IKJA 4DEXA 3NEYA 3A1WA 1L8QA 5LGNA 3ASYA 4LB5A 4DDTA 4LJ6A 3FHZA 4PPNA 3F8FA 2GEVA 1HA3A 3P9IA 1IBRA 3B1ZA 4BFSA 3X1WA 4LK0F 3R0JA 3W6NA 4P4SA 5AUQA 2MSEB 1L2TA 1OPCA 3C4JA 2VQSA 2C98A 3GO5A 2CVFA 2A7QA 1W36C 1W36B 2RKHA 1PUIA 1ZMXA 3THXB 2GKSA 4IXNA 3E5QA 3I54A 2D1HA 1SVWA 2B7CA 2VBCA 1E2DA 2HF9A 4D80A 1RYFA 5HZHA 4PZJA 1YRBA 4A36A 2FMLA 2J9RA 5M04A 2FF4A 2ZKZA 3GWZA 4LLLA 1IF1A 2XZPA 4KHZA 4ASUA 5TARA 3X2SA 4HB0A 1JQJC 3F5FA 1XD9A 3T61A 1MO3A 3CF2A 2YJTD 2VONA 2GXSA 5FO5A 4V0KA 1FX0A 1E1QD 2MA3A 4Q01A 3K09C 4AG6A 3T0YA 4KVAA 3WP1B 3CUOA 2HQNA 1JNYA 2IX3A 3LSTA 1OIXA 4BFXA 4L9JA 4XSGA 3FWEA 5E1XA 4ZPXA 5HDGA 3DMNA 1C4OA 4R2IA 5CIQA 5KDDA 1FFHA 3U2RA 1FC3A 3HRSA 1K78A 2P6SA 2DTRA 2RGDA 1G291 2HXSA 3NHBA 3C3WA 1KK3A 3ZQ6A 2ZRNA 3MLEA 1JR3D 3QVUA 4F4CA 1B0UA 2DWQA 1BYUA 1IHUA 4HLYA 4G1UC 4LJAA 1DO2A 4PQFA 1MJBA 2WC2A 3BAFA 4I1UA 1Z06A 1M1YE 4G5SA 1WQ2A 3P20A 4M4SA 1AZSC 4LRSA 4IJMA 3M1EA 3B78A 3LAWA 2WSSD 5EE5B 4FWTA 2WWYA 1E6CA 1UEIA 4JL6A 5BXQC 4IHSA 4ESFA 3UATA 4KFRA 4C0AC 2OAQ1 4IOKA 3MD0A 2FFHA 3SQNA 5DCMB 4X8HA 1G5TA 3KZ1E 3T1QA 4YMTA 2OU2A 3SFZA 2MLGA 3AKCA 3CRQA 4PX9A 4ENJA 2ZE6A 5HE9A 1KDRA 3K8YA 5IT9Z 3IUYA 2OUKA 2Q9AA 3TW4A 1KYIA 1XMAA 1IN6A 2H94A 2YX7A 3KP2A 1TW2A 3QPHA 2J0VA 2Z3YA 5E20A 2VPPA 3I92A 1AIPA 4P4TA 2XAFA 1UB9A 3B02A 3RAPR 3TKYA 4BPBA 2PZEA 3R6SA 3L0PA 1QHXA 4Y0VA 4DLWA 1X86B 1R8QA 4I99A 3CPEA 2H16A 2QUZA 3L82B 3UWKA 4KFCA 4BRWA 5FOSA 2WTEA 1T91A 1ZW6A 2VRWA 1EWRA 2JLQA 2LNBA 4IXAA 5FFXA 2KBFA 3TW8B 1E1QA 1F9NA 4UUVA 3WYAA 3W90A 5E3HA 4MDEA 2PJPA 3P26A 4QRHA 3VQTA 1R5NA 1EH7A 3EPLA 4KMFA 1XEXA 2L01A 1DAIA 3FB4A 3V4RA 4MNUA 1VG0B 1Z6RA 1C0WA 1IN4A 1KI7A 3KCCA 1G8FA 3A58B 1RE0A 4EPXA 4IOMA 1GVNB 1TQ6A 3U4QB 2GAUA 1B59A 4OMZA 1JPNA 3E70C 2DYKA 3LY5A 1JR3A 3L09A 5EXSA 3GUDA 1O3YA 4GSYA 4P55A 1HE1C 1GOTA 1GP2A 3P9CA 4MEXF 2FBIA 3KJEA 5EEGA 5AJVB 2WSSA 1II8B 1E9FA 4Q9LA 1WWXA 1KKMA 2WMOB 4R9UC 2JA1A 1HSTA 2ZS9A 2VP5A 2IW5A 3TOAA 1SMYF 2FPLA 2OZUA 1DAFA 2C5LA 2R9VA 1Z29A 2XRNA 4IEIA 2NAZA 1YW8A 1SGWA 1LB1B 3WXMA 5J4LA 3ZVRA 3E5XA 2TMKA 4DDWA 2KKOA 3CLVA 2C2HA 2O8XA 3GEEA 1U81A 4HUQA 4RZXA 2DY1A 1H65A 1NN3A 4YFXF 1R0XA 2ELHA 4LBZA 4MRVA 2Y48A 3R60A 1PLLA 4CYMA 1R23A 2VSFA 1EX7A 5JVTA 2V54A 4UJ5A 4U0YA 1R7RA 1QZXA 1T8UA 4CXFA 2RAPA 2P4WA 4ZIRB 4UVAA 1WDTA 4I98B 4RGRA 1TAGA 1Z6AA 4IEEA 4JKIA 2AWNA 2RHMA 1Z9CA 4UXJA 2UZKA 4MYTA 4OI1A 3GEZA 3AP2A 1E2FA 1D5VA 2WWFA 2GZDA 1CXZA 5IT9K 3EZ6A 3HYTA 4OQMA 3TMKA 4EUNA 2FG5A 4NCHA 4M1MA 3CPHA 521PA 1M34E 1N5KA 1GKUB 2C77A 5BYJA 1OW3B 4D0LB 2IYLD 1EH8A 2HS5A 4L5JA 3PCRB 2C96A 3EIQA 1KSFX 2CW0F 5F6FA 2RB4A 1ODDA 3BPXA 2YYZA 4P32A 4Q7KA 3SQXA 3BOSA 1DAMA 3HRUA 2J5XA 1MO4A 4AIHA 1EFCA 3FDIA 3LQQA 3THYA 3LBIA 3WBJA 1QHSA 4E03A 1P7CA 3X1ZA 3TO6A 5C18A 1ZARA 4RB1A 1D9ZA 1YRAA 2BBOA 2GTPA 2NTYC 2ZRJA 3TRFA 3CO6C 1SXJB 4P5OA 2GF0A 1D6JA 1D2MA 4I1VA 2P6TA 1QHNA 2ZXJA 1QHYA 3ZMVA 1U2RA 1E9CA 3HR8A 3EC2A 1M8PA 2ZRFA 2WWGA 4FIDA 5F9HA 5IT5A 1OFIA 2VBXA 3DDCA 1VKJA 2ZJZA 4EFLA 2O6GE 2V55B 4JBXA 4FWGA 1OXUA 2OZ6A 3TAHA 4HOBA 5FI1B 3UK6A 3U5ZB 1KI3A 1J2XA 3LNCA 2NS0A 2Q3FA 3KW6A 1EWQA 4BZPA 5HLHA 4NCJA 2GJSA 5FB2A 4EJTA 5DE3A 4QHTA 3UMFA 2JASA 3DVLA 4C2TA 2A69F 3SJAA 421PA 2ZM5A 3OE7D 1TX4B 3U3RA 3ZN1A 2BKEA 4RCZA 2CLCX 3VHXA 1XD2A 1ZIOA 2I1QA 2ZNYA 1OH8A 3KZYA 2GJKA 1Z0KA 5H8WA 1RRGA 2PJRA 1VCMA 4LHXA 2WAXA 4JLVA 4Q4JB 3X1XA 4PO1A 4ZKDA 4YG2F 4TTRA 1MDMB 3DM9B 1OXVA 5AR1A 1R7JA 3VR5A 4I01A 3SE0A 2XIGA 3CRVA 2IT1A 4B3CA 1Z1DA 2NGRA 1IN5A 5EEHA 2E1NA 1P5ZB 3BC1A 4YIFA 1A2KC 1JXSA 2ZSBA 1GVJA 3V8LA 4JBWA 5KPJA 4AIJA 3E5HA 4FHTA 3NBZC 4MRNA 1A5TA 3EZFA 4LPSA 3A4LA 3KJHA 5D4SA 2ZS7A 2PFBA 3BWGA 2ZYTX 3K1NA 4PAOA 1YO5C 1QO0D 3M9AA 5EE1A 3LWNA 2COMA 1NNEA 5J4YA 1FT9A 1CJKC 5AJZA 4UNQA 1RJ9B 1VCNA 4BEJA 2QEQA 4EJSA 5DCFA 3HU3A 5P21A 1L0OC 3MSXA 1NKSA 5L3GA 4LV5B 4MHGA 3O47A 2FSFA 2R7FA 3L00A 2XTNA 3DF8A 2VHCA 5GVRA 2XAGA 1MRSA 1N25A 2EFEB 3GFOA 3K53A 4FWIB 4I1SA 2Z4SA 3LFKA 2HJGA 4ZYHA 4KFTA 2OE2A 2R6AA 1NN1A 3GLGB 1P2SA 1T3SA 3MHVC 2IEZA 4JLJA 3UG6A 1Z6YA 4G7OF 3LW8A 2QAJA 1DTSA 4LHVA 1TQPA 5F3WB 1DPFA 1XTRA 3A8TA 2GA2A 2VHJA 3OE7A 1AQYA 1CJTC 3RI4A 1S3GA 1Z83A 2IL1A 5IRCD 1T5IA 1J8MF 3AEZA 1LTQA 4PHGA 4MDFA 2V7QD 2YV5A 3BK7A 1JPJA 4Q1DA 3F8NA 2VHUA 3EDPA 2R8RA 1HQYE 2QN6A 4I02A 1HURA 3REGA 1F5NA 1JAIA 2Z83A 4TT3D 3IRQA 4D4KA 2IS1A 3E6CC 1WA5A 1E96A 3U7EB 2GCOA 2F1HA 4QFMA 2QE7D 1XJ0A 3AP3A 3W34A 4HEJA 1E3MA 2ASEA 3GYHX 1P92A 3KEOA 1Q21A 1FUUA 4TL7A 4TMWA 5CYOA 5H70A 2XHKA 3R8CA 4K2EA 4LBVA 5D5XB 2IK8A 1Q1BA 1VG8A 4WWCA 4D81A 4RAZA 5KSPA 4MH0R 3QAHA 3KKQA 3AF3A 4UXIA 1CP2A 3BWDD 4HAMA 4M9XA 3U9GA 4OL0A 1XX6A 3DOFA 2H92A 1IY0A 4XOIA 3DKPA 3RANA 3C41J 3GFPA 3FM5A 1A4RA 3I59B 4KUMA 1QF9A 1WRBA 2OM2A 3U3OA 3DHWC 4PO9A 1SZPA 4I1OA 3CR7A 1G7CA 4IVNA 5HOOA 3Q9VA 5AUPB 2VEDA 5HKKD 3GLHB 2QQBA 3A4NA 3AQ4A 4C0BA 3ADCA 3GMTA 3OAAA 3OZXA 1SVOA 1ODFA 3QKTA 4IXMA 1LS1A 3BZ6A 3R61A 4AC9A 2OFWA 3CNOA 2X2EA 2H18A 4IFEA 2M87A 2QL6A 2REBA 4Q00A 1G41A 3BDDA 2YOFA 3B1VA 1T98A 3L2OB 4MGIR 4XWAA 3SFVA 3O8CA 1CJMA 2V7QA 3VR1A 1FL9A 3QP5A 1HW2A 2BCJQ 4RD2A 4A2QA 2WBLC 4OU0A 2QMEA 4TWZA 3HRMA 4MYUA 2O0JA 2V1UA 4F7ZA 3RRZA 2M1BA 2XASA 4TT3A 5FTJA 1G4AE 2IF0A 2PLRA 2ZR0A 4CRWB 4I81A 3SU8A 2LKPA 1AN0A 2QE7A 4P9UA 1FZQA 3I5XA 4GL2A 5JWHA 5L3SB 5D8LB 2QPOA 1JEDA 1OH7A 3RSLA 4L18B 1XCMA 2A07F 4UHTA 5SZKB 3TIFA 2GCPA 4JK1X 2KIFA 4M53A 2FFQA 2HDCA 121PA 5CVIA 1LNZA 4KV9A 3W6PA 3CW2A 2PMDA 2PLYA 1S7OA 3GLFB 4YQFA 4KIFA 4PGHA 4G7ZF 2WJVA 3IDQA 4NDZA 3U3KA 4S04A 1AGRA 1TEVA 2W2XA 5FUVA 3W9YA 2FBKA 1E2NA 3Q7PA 2BMFA 4A0XA 1KI4A 2BOVA 1FLIA 3AH8A 1NMZA 1OXXK 1COWD 4IDNA 1MZBA 3CWQA 3L0SA 4QGGA 4XJXA 4CVNA 4JVSB 1L3LA 5HKKA 5JCPA 1XCPA 2QG6A 5FLXZ 1U3EM 1G3YA 4LY6A 1BIAA 4ZH4F 1IN7A 1F5TA 4RFSA 2PI0A 4HF1A 2P8TA 1M7GA 1NL3A 1Q44A 3MGCA 3WE3A 2C04A 4HZIA 4NKRA 3W8RA 1VYVA 1SXJD 1E2XA 3QSYA 2XKOA 1S4QA 2ESHA 2QY9A 4PHTA 2CWEA 1NJFA 2ISYA 1V43A 2R6CA 3L43A 3AVQA 2C9OA 1S7AA 1I1SA 2Z5FA 3WTWC 2HKXA 1D3YA 2XUBA 3BORA 4DLTA 2EA4A 4YXWD 1OFHA 2HF8A 3SJBA 1YHNA 1CGPA 4ZZDA 5E7IA 2WZQA 4HDVA 3DZ8A 4EJWA 2O8DA 1S1CA 4A1FA 2XGXA 5J4VA 2F5CA 4ZIRA 2F5DA 1DOAA 3COAC 4GP7A 1FBQA 1QBJA 3E1SA 3GCGA 3KXIA 2R2AA 1WBDA 1SXJE 4ZCIA 5HZKA 1W5SA 2HZTA 1N0VC 4N0EA 3TDZC 1LJ9A 4M1SA 2J0UA 3SZRA 4UNOA 1II9A 1RZ3A 4C0KA 1J8YF 2I1VB 4FMCB 2W57A 4GMDA 3BH7A 1ZN2A 4KU4A 2ZSFA 3NTUA 1OFUX 4M1KA 3ZD7A 1M7BA 5DYGA 2GJAA 4P4SB 2X2FA 3LA3A 4HYYA 2HKOA 3PQJA 1IW7F 4V0MA 2GXQA 1Z91A 1G3IA 3DO6A 2ZUCA 1ONVA 5CB8A 3R20A 4PHFA 5EP4A 2FH5B 3DOEA 2EFHB 1COWA 3VKHA 1JAHA 4M21A 2K4JA 3WTZA 3BB3A 3FTQA 3KQLA 1HT1E 4X8OA 3VFZA 5ICFA 2K27A 1UDWA 5J6XA 2QVOA 1Z47A 3V7RA 4R8HA 3WMGA 5LLQA 4JLMA 5DISB 1SXJA 4G5GA 2ZJ8A 4OBEA 2FSGA 1E32A 4A4DA 1GTVA 3M1IA 1XPUA 1FX0B 3D7MA 4TMTA 2ZRBA 3HU2A 1SULA 2FZ4A 4Q1EA 5GJVC 3KLOA 2VO1A 4YXWA 1DDNA 5D4RA 1NVXQ 2ANCA 3BJ6A 3KJIA 4WBSA 2QMOA 2ZYUX 3G5UA 2CCGA 3G73A 5AUNB 4Q4HA 1XB2A 5L3FA 2WM9B 3GZ5A 3WNDA 4ESBA 3RIRA 4DB2A 4XD7D 2EV5A 1ON2A 1K78B 1KJZA 2QI9C 4ESJA 1XD7A 2VSOA 2EFPA 1K8RA 2X4HA 3CO7C 4EGZA 1SKYB 5AIPA 3N2EA 5DGXA 2K86A 1G8YA 3T1OA 1NY5A 1DPUA 3CRW1 4A6DA 2W25A 3KP6A 1BBYA 1P9WA 2ZI7A 3G0HA 2GA8A 5ELXA 1UHWA 3HOSA 4URYR 3FMOB 1CLUA 2WJHA 5CJ2A 2V3CC 4HI0E 1BYIA 2AK3A 4Q4JA 2RKOA 4HAUA 4B3GA 2JPCA 5AONA 2WSMA 2CYYA 4Q47A 1E0JA 2B92A 2BCGY 2OCPA 4JSYA 3GZ6A 5FBRB 3RC3A 3WGIA 1FP6A 3Q7QA 5JI3E 1XDBA 3LH5A 3AUYA 4IVRA 4DWJA 3GP8A 3GLGE 1OB2A 2FBHA 3SS8A 3SHWA 4L5BA 1O3TA 4M22A 721PA 4BLRA 1FQJA 4KICA 2UXNA 4JKYA 5JFRA 5JI6A 2CNWD 1R5OA 1AOYA 5F1RA 4HLUA 2FOLA 1NN5A 4G01B 3NXSA 4EM2A 4ZYDA 2IYVA 4DCTA 5JMTA 2BE5F 5H1YA 2NMVA 3AF0A 5ICEA 4E07A 1RUOA 4DDUA 1NVWQ 3EA0A 1G7SA 2CFXA 2GILA 4A0GA 1MO6A 5FBWB 2GK7A 3KZZA 5DI9A 1NY6A 1U2WA 2FQ3A 1XEXB 4KLNA 4DT1A 5GJBA 2NPIA 3REFA 5K5OA 2MMCA 4M72A 5FL3A 3TUJC 4D4MA 3TSOA 4XD7A 3EIHA 2VBWA 2LKDA 3C16C 3IIMA 1RRCA 3KE2A 4C0QC
chains in the Genus database with same CATH superfamily
3L7YA 5B7PA 1WSBA 1PJBA 3DBLA 3ZI4A 2BGKA 3LRTA 2BEVA 3TH5A 4CCSA 3K2QA 4YP7A 4LMBA 3W7BA 3EY9A 3W4JA 3ZLVA 3C9PA 2E48A 2IP1A 3FZYA 2NADA 4DTIA 1AC5A 3BDVA 3PLAE 3GP1A 4JYKA 5JHHB 4LFAM 1I1GA 5M3FJ 1GSOA 3SYMA 3HHGA 3SZOA 1V4VA 1DPGA 3PQDA 4MV4A 4X84A 4H6WA 1SMTA 1LK5A 2VOPA 2JG3A 2C2OA 1A71A 1N8KA 2I4LA 5CCBA 4CU5A 5D8KB 2Q8NA 1ZSNA 4L9VA 5F2EA 1TJ5A 2H7XA 1JLLB 1FYKA 3HJRA 5BORA 4CLEA 2ZJOA 2N0SA 4HF0A 4LIUA 3P9XA 3RKWA 2PJRB 5E6UB 2DT5A 1PT5A 4EPRA 2A4KA 4MA5A 4PTLA 1ZK4A 4MS1B 4RZ3A 4E1AA 3E4CA 4DYDA 3DZDA 4GECA 4LB6B 5ANRB 3HTXA 5AVUA 3NM6B 3ESRA 2WKSA 1L5KA 4QHSA 4GM4A 1RE1A 3G17A 2R4GA 1XBTA 3WDKA 4F8YA 2ZI9A 2Z9DA 1HTBA 1XTSA 2WPDD 2N47A 3DLTA 4KQ9A 3F2IA 5DMHA 1MFZA 5ULLA 3OTWA 3ZDAA 3I4VA 1PYDA 3CSDA 2QCOA 2H48A 3H8JA 4JQSA 4K8RB 1Q6YA 4U6NA 1AGYA 1U31A 1PDWA 3BGOS 4YRFA 2IBMA 1IJFA 2OWEA 5TB5A 4EIWA 1QIDA 2ZO4A 3SARA 3FGPA 5GVSA 4A9AA 4PN3A 4UUAA 4W5JA 4XWWA 5CKTA 1SELA 1MMNA 3DBOB 3U7RA 1E2HA 3WNVA 1KFJB 3EEBA 5ERXA 3E8MA 5I51A 1XZFA 2FPIB 1LSSA 4YV2A 4BL0B 4FNAA 3FXLA 2H6CA 2WV0A 2XQJA 1MJ5A 1FDVA 1K7YA 2NVBA 1S01A 2V5AA 6PAXA 1KFEB 3EG9B 3I01A 3NV9A 9ATCA 1E0AA 2EO2A 4KR0A 3H42B 3DMDA 4OHFA 2LF7A 5KIAA 1DX6A 3IWFA 1ZU4A 3P52A 3O7MA 2C5GA 5LB4A 4BNMA 4CMGA 4UNNA 4IZIA 1BI1A 1T0UA 4OSPA 4DBQA 3QOFA 2G76A 4PE5B 4B09A 3PC8A 2ON6A 1A9PA 3TOBA 3R5HA 3EZ9A 3E5UA 3EFEA 2HD4A 1E9DA 1BOOA 4W5RA 2BVLA 2DI0A 3AVPA 3G88A 2L2DA 4Y6PA 2QGZA 2YWCA 2VWPA 4M89A 1OHHD 2PMEA 5GPBA 4PVCA 2C2KA 5KPRA 4Q9HA 1Q0TA 4PSWA 1TUIA 2HMUA 4AN4A 2PUVA 3U4IA 1OLXB 2FFAA 2GVZC 3BR2A 3VMMA 2CL7X 1C8LA 1RXWA 1JKIA 1LSOA 2FMFA 3UG7A 1OCZH 1IZ1A 2VSQA 1Z7WA 3C70A 2CJFA 4IR7A 3SLGA 3CZ4A 1S5LC 1NVMB 4REQA 4V03A 2B61A 5KUTA 4PR0A 3PRHA 2XSDC 4NZPA 5FLXS 2H06A 3HZRA 1VLMA 1QYVA 5CNKA 4L5IA 1E4VA 3OOWA 1W75A 2XX3A 3KX2A 2F1OA 1I3MA 2JATA 1ODIA 5BW6B 2IRFG 1U0OC 3E0QA 1QKKA 3FTEA 1T8PA 2YW9A 3VX3A 3ZIUA 4IIJB 3NT4A 2BTEA 3C48A 2A0FA 3AB7A 1Z13A 5CFMA 3QKRA 2VRNA 1FIPA 4G3OA 3CLOA 4D99A 3PNMA 1DT5A 4BAGA 4DM3A 3PHGA 1I39A 5F5LA 1X2EA 4DWOA 5FAKA 2M9MA 4H7EA 3MIZA 2HPIA 3TZBA 3HSEA 5EJ8A 2HR1A 2AFIE 4RGSA 3SZMA 1FVXA 1Y37A 2NW6A 1C3LA 1FNNA 1ORYB 1Y8ZA 2VF2A 1E1NA 1M2WA 3L6OO 4NICA 2YWBA 4DBZA 3ZZNA 5I9IA 2J9YB 5HJEA 2CKMA 1VKNA 3QE0A 1GLGA 4BNKA 3HWSA 4OQNA 1IHDA 3TSCA 5HTKA 4YRQA 2FZWA 1GCAA 1DC3A 1ZI9A 4ZO8A 4A8JA 1S2MA 3DXYA 4PC1A 4HAYA 3WHBA 3K9WA 4JB2A 2MSCB 1P7ZA 2JJ2A 1RAIA 2X42A 3OQIB 2VQGA 1GL9B 3F4LA 3PUXA 2IIBA 3V97A 1U7TA 3C6MA 5DHSA 3WLLA 2PRYA 5IZCA 3K4PA 4DLAA 4U8GA 4WCFC 4P80A 1TT7A 3VU8A 5I7AA 2CE7A 4CYDA 5GZ3A 3UWMA 5IX8A 2QRZA 4DV0M 4CQJA 3WTUC 1NW8A 3I83A 4CF6A 5CDGA 1UQUA 1XDDA 4P96A 4HNRA 4JI1B 3AHFA 5INTA 1U7UA 2XRYA 2VF7A 4FTHA 3O5AA 4UZSA 2R00A 2P62A 1CQXA 2F55A 5DSZA 4CF5A 3OYKA 3RQIA 3C6XA 1KDOA 3GVXA 3SEFA 1AKRA 2Q5HA 3TK1A 1PS0A 4NZMA 3WU1B 4XM3A 4P4GA 3L8EA 4BNJA 3U62A 4F72A 3OX2A 1RJWA 5B30A 3QUCA 4HJXA 4JP8A 3RU9A 2PVCA 3WK6A 5EE0A 3VR4D 3GRYA 3T6PA 3OR2C 3AGPA 3G2LA 3D8LA 4L8FA 4RSGA 4CEHB 2OLEA 1UQRA 3GNQA 3B9RA 3I37X 1MAWA 2R7NA 4JEMA 1KL7A 2HWYA 2WFZA 1TCBA 3I04A 3LX5A 3THSA 4ZGWA 3CG0A 3ZQKA 2D62A 1S3FA 2V5VA 1E2LA 2LKSA 1YJXA 2DU9A 3T1VA 1UWVA 4U4AA 3TOCA 4Q7LA 4HQKA 5TQ2B 5DCUA 4L78A 3N8DA 3QKSA 1N2GA 4X63A 3KT8A 1MEEA 3DHNA 4C0XA 3ZXYA 3OA0A 4GQAA 4FQGA 4KK3A 3RKRA 3JAMA 3VPFA 3ABUA 2J5RA 4YQYA 3QQPA 4A27A 1M0TA 2VVTA 3KQSA 3WRXA 2Q1SA 2QOEA 3DMYA 4YEJA 1KTIA 3QENA 1GT0C 2OUIA 4AZFA 5GADJ 4RHCA 5AVYA 2AMJA 4EHJA 5A9SB 3H19A 1Z28A 4M0CA 4E4TA 2B21A 3H3FA 1WX1A 3WGLA 5K1YA 1TDZA 3L93A 4XQ9A 2C4MA 1JW9B 3G5LA 4HDSB 3NIWA 2CC2A 3HDYA 4NU0A 1W48A 4EX6A 5FPPA 4PRLA 4G09A 1N8SA 1R0KA 5CM2Z 1IZ7A 2GRUA 5KPTA 1YBFA 1UJ4A 2DKNA 3CUQC 3PQ8A 3IQWA 1JFFA 1W4CA 2PZGA 3GAMA 5K0TA 2PQ6A 2Q5JA 4Q15A 3VGJA 3WK5A 1VQ9I 1JX6A 5AI5A 3MG9A 4DSTA 3BFXA 4DJDC 4KEAA 2XMSA 1BJZA 2P1RA 3HCPA 5E26A 3V8KA 4ACAA 3VR2D 4B3RB 3HHPA 4F3KA 3V76A 1HOXA 1I10A 1KIAA 1OROA 5BSTA 1ZOLA 5DLPA 4B75A 1VKRA 1T5DX 3D6UA 3ZJVA 4P84A 2X9QA 3SCZA 1QK4A 2GN1A 5F7XA 2Y9PB 1CS0A 5LP1A 4ZVVA 2HAEA 3AU8A 2JZ1A 1BVYF 3QE9Y 2WFLA 1J5YA 3MSCA 4GLFA 4O2BA 3DFMA 5KYVA 5AW1A 2RK3A 2Q8QA 2RGCA 4M9UA 1AX9A 4N4AA 1SR8A 2X6RA 3RSOA 1PJLA 3AOGA 3S1LA 5JMWA 1ZJZA 2NVWA 5HDKA 1N2OA 5LB2A 4BLUA 2UYCA 4LJ4A 4RDCA 2KZVA 3RVNA 2HRQA 2F5SA 1BMFD 3U3DA 1D2RA 4G0NA 4IG9A 3JASA 1BI2A 4R68A 4HC4A 2W2PA 5B5SA 3LPAA 4EMBA 5GM1A 3X1YA 2FPGB 5A4JA 1ESZA 1V4BA 2R45A 2VTDA 3O4GA 1W7PA 1BQ3A 2V7BA 3PSIA 4MI3A 2DCMA 3X2FA 3T9FA 5JPDA 4KNYA 4FEEA 1XTJA 1PL8A 5CK5A 4XJVA 4BKQA 3VRHA 1Z6TA 3CVYA 4YNBA 1O97C 2Q3DA 1ZMRA 5HF6A 3WFZA 1XNRM 1PR6A 3UAXA 1GNQA 3S93A 4B1FA 3WMFA 2VDLB 5AW5A 4HV5A 2W0SA 5CH3A 3VMFA 3JW4A 3U44A 5AKEA 1QVRA 2FE3A 3AVOA 2YVQA 3EGVA 4R3WA 4XIGS 2ATEA 1D0XA 3RYPA 1HDDC 1M34A 1WGLA 2R7VA 4KRXA 4DW6A 2V4UA 4IBEA 3D8SA 5B12A 2W00A 4CKZA 1CQIB 1C9YA 4AY2A 2VNJA 3BRWD 4C5BA 1OI2A 4LCJA 2QN1A 3ZGKA 1NJ8A 2JIMA 4HB4A 2OK8A 1KH3A 4IGFA 2XKPA 3P4YA 5IPFA 1PJ8A 3WISA 4QJ4A 4IDHA 4O5VA 2GXGA 4B6EA 2NOGA 1UBNA 1C7FA 3IULA 4NCBA 1VQMI 5LIRA 1QX4A 2PS3A 2RGHA 2WTXA 1I0IA 4O2AB 1Z4JA 4JDPA 2UUBB 5A03A 3NHAA 4S1TA 5SZIA 4YRGA 3KJXA 4LE1A 2DBBA 1MC8A 2YU9J 4GXOA 3JTMA 1K08A 1G16A 1ECBA 2XWSA 4P4UA 1BVRA 3RYIA 5FADA 4KO4S 4K9PA 1RQ7A 4V0OA 1FRNA 2IE0A 1GRCA 3FBIB 3MJ4A 2QA5A 4BZZA 1GL6A 3VO8A 3C7AA 4LG2A 3QYFA 1V47A 2HGSA 2JGMA 1Y1VJ 1HDEA 3GCMA 3CDIA 1B3BA 1GCUA 4INZA 4EHFA 2Q3MA 2Y0QA 3V8RA 3L6DA 1E7MA 2IWRA 3ABMH 4RK7A 4Y1RB 2VKHA 3OYGA 4XYLA 3H36A 3IE0A 3T7EA 4OHOA 4R7TA 4FD3A 3J2PB 3M6MD 2KE5A 2XCOA 1YS7A 2BM0A 1ZFNA 4LWOA 4M3DA 3WE7A 2PKXA 3A6FA 3U6PA 2C3OA 1YK1A 3RFVA 5IPAA 2YS7A 2HU8A 4Z4FA 2PX5A 3JRHA 1GTRA 3A1TA 1VL1A 4UAUA 3HCBA 3OIGA 2RHCA 4B7GA 2K02A 3IERA 3HVIA 3FXOA 2OO7A 4OA5A 2DQYA 4WESA 1I4DD 3W1EA 5FLYA 3G68A 3P4UA 1VE9A 1XD8A 5DJ5A 1OIPA 1JUDA 4YRJA 2G77B 3I4PA 2C03A 4FK8A 2VJKA 1IN1A 1FSHA 1NDHA 4TXLA 1BE8A 2VQDA 3IR5A 4EJOA 1XQ1A 4IZ6A 3QBJA 1P2FA 2GEJA 2XPCA 4MVXA 3O8LA 1WPGA 1PLKA 3L8HA 1K3WA 3F6BX 1NSTA 1BR2A 4I0WB 1PP7U 2R85A 4MUEA 1MSFC 4H7DA 4KUGA 5FFZA 2G1AA 5EYPA 2J7OA 3IQFA 3EZYA 4FUTA 2BP7B 2R0IA 2JIZD 2GM5A 3M6AA 3CW8X 4W1SA 4BU1A 2AHOA 5H4HA 4CA0A 2PEYA 4F2HA 2HPVA 2XGGA 1O8BA 2P5SA 3RC8A 4GPBA 1QG6A 3RVLA 3H0KA 3IT0A 3QITA 3R76A 5AM2A 2UUAM 2VH2A 4EDHA 1HGXA 4A6EA 4W7SA 2YW2A 4HUQB 1KRWA 3OMLA 4IKPA 1YFZA 3I4CA 2Q2EA 2NXWA 2ZE5A 5DM1A 5GQSA 3ICCA 3IRUA 4G4QA 2IEGA 2AS5F 3GFFA 4RAFA 3HRKA 3T3EA 1W4MA 1VLJA 1GO5A 4G9BA 2JD0A 2O2ZA 2V4ZA 3H2HA 1JIIA 1JUMA 5D3ZA 2XWJI 2Y6UA 4F1IA 4EM1A 1ACJA 2XMBA 1FYWA 1DBIA 4ZAFA 4A8TA 1I01A 4AJOA 2XGDA 2EFCB 2AUMA 2CW8A 4MYSA 1DG9A 5T4BA 3VH4A 3V3TA 4MQEA 4B33A 3BT9A 3SKXA 4NLLA 2FRHA 1EIZA 1BE0A 1UXGA 3LBYA 4EG6A 3I2IA 3IH4A 3JQFA 1FTSA 1ZXBA 3BS4A 1CKEA 1DIOB 1RLJA 1NBME 4F85A 4K03A 2JLVA 1E3JA 3TOVA 3ER6A 2CO5A 4ZZIA 2H29A 2AMFA 3TW0A 3HM2A 4JBLA 5BR4A 3C3JA 1XIVA 1H89C 2B1IA 2MSEB 2VXCA 4FE4A 3QTBA 5FF9A 3I54A 4L3WA 1EVQA 4EKEA 2H3EA 3JAWB 1DKOA 4LLLA 3DAGA 3LHFA 1P7YA 1WB5A 1FSFA 4DREA 3K09C 4TPKA 5JV5A 2IX3A 2I80A 1HL3A 4DIOA 2MOKA 2ZRNA 1A4UA 3QVUA 2I2DA 4C0AC 5EHGA 2A67A 4DBGB 3OJEA 3FUXA 4ENJA 5DNUA 4BPBA 1H1TA 1SBNE 1UJ6A 2QUZA 1AG9A 5DS9A 3DYVA 1W8DA 4GE3A 2LNBA 3AONB 4BBZA 2KBFA 1OCRH 1U0FA 3ZCSA 3MQFA 1TQ6A 4LOIA 2WU4A 4KWCA 2QDKA 3AUJB 4ZVLA 4XM1A 1EA5A 5I9BA 1WWXA 1KKMA 5HF8A 4U7FA 5ABPA 2CMPA 4GVLA 3MLBA 3GLVA 4CFYA 2KKOA 5ALIA 4DQKA 5BSWA 1N5DA 1V45E 3JR4A 3ZRGA 1CXZA 5IT9K 3GBGA 3JQQA 2AN1A 2C77A 5A1JA 2HS5A 4J00A 2LNHC 4KE6A 2YYZA 2XF6A 1EFCA 1E3TA 1DKRA 3TLMA 1P7CA 2G70A 4N8DA 1K97A 3T54A 2ZYHA 1QOZA 3HB9A 4B3SM 1H5UA 3UK6A 1L5VA 4NCJA 4BCCA 3IMFA 3U3RA 2ZNYA 5AXCA 4EF6A 1G5QA 1OXVA 4YJ2F 2I9KA 3VR5A 3CN9A 1NDQA 3CMEI 2HCTA 4GR5A 4JBWA 4KQ1A 2P8JA 4O1MA 2PRSA 4GRIA 4G5HA 2I4OA 4LPSA 4NQRA 3HJSA 5AI4A 3VR0A 1LUJB 1FT9A 1LPSA 1L0OC 2NVTJ 3MSXA 1NKSA 1GPKA 2R7FA 3DF8A 1ZD5A 1ZK8A 2HJGA 4FLFA 1P1FA 1K0FA 2QAJA 2JFGA 3EXHB 5DSXA 3TTUA 1T5IA 4DGQA 3PF9A 5FPQA 1JS1X 1XZCA 3REGA 1E62A 4TT3D 1WA5A 3QQAA 4FVTA 3A7DA 4HEJA 1E3MA 1Q21A 4C6TB 4IDGA 4PFPA 3C5VA 4UXIA 3AT1A 3ECAA 3U9GA 4FYYA 2FOIC 1T5BA 3N6VA 1Q0QA 3MVPA 5HKKD 2VEDA 2QQBA 4IXMA 3U21A 1EGVB 3HY4A 2M87A 1N3YA 1RM4A 2RSLA 2YOFA 4O4LF 3VR1A 3QLVC 3H16A 2SECE 1G4AE 1V7PC 2GDZA 1FZQA 3MBIA 4ZQEA 1S2GA 1A6QA 5IKMA 2HDCA 2NT3A 3BQZA 1NI4A 3CW2A 1JYSA 3D8RA 2R7ZJ 1P29A 4FS3A 3EULA 3ZZMA 1NM5C 2X5XA 1O97D 2LIVA 1QIKA 4NJMA 3U1BA 1AV6A 4YV7A 3QSYA 1HL7A 4QG3A 4ZQCB 1JDZA 3OCWA 3GT3A 3WHCA 1MFPA 3F5DA 2WZQA 1PJTA 4UAJA 4EK9A 1DL5A 3G9TA 1W5SA 2VXBA 4G23A 2PNJA 2F17A 5B37A 3C6ZA 1K8QA 1SOVA 4P7KA 4CM8A 5B1DA 4Q7JA 1YR2A 4X8OA 2FEKA 3VO2A 3GP3A 1JUSA 5CLGA 4U5QA 2B1RA 4EARA 1W87A 4C7KA 1DU6A 2UU9M 1LSJA 2ZYUX 4WERA 5L3FA 4LNUB 1NY5A 1DPUA 3S44A 1VKOA 1LTMA 2RK6A 1L4FA 1MBJA 3L8DA 3P5SA 2B83A 3ZQGA 1CNFA 4IYRA 1JDUA 1Y81A 2IRWA 4BB9A 3BTVA 3IALA 3UHOA 2Q1XA 3SIXA 1JG6A 3WJ1A 4LJSA 5DI9A 5EZYF 1XEXB 3FD8A 3TI7A 2KRCA 4XD7A 2VBWA 3C16C 2H2FA 3ILSA 4HL4A 1E6KA 3AI7A 3KWMA 1CJUC