2FNAA

Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
357
structure length
352
Chain Sequence
GMLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIMSGSEMGLLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSKCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein
publication title Crystal structure of a novel archaeal AAA+ ATPase SSO1545 from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Atp-binding protein
total genus 128
structure length 352
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01637 ATPase_2 ATPase domain predominantly from Archaea
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2fnaA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fnaA01
2M87A 2P6NA 2GXQA 2GNOA 2ZAOA 4A3VB 4EFLA 1W7PA 3SI7A 1YZQA 4GP6A 1PUJA 3A6PC 2GEVA 1F2UA 1GL6A 1ZNZA 2DQLA 3L0OA 1XCMA 3RABA 4KODA 5E7JA 3RRZA 2ESHA 2J87A 3LFUA 2W0SA 2W2VA 2ZI6A 1DG1G 4M53A 3B85A 4PO8A 4DB4A 1ZM4A 2F1JA 2IPQX 2HF8A 4A12A 2OESA 2ORWA 4DDTA 1XXHB 3L8ZA 3U3JA 2OAP1 1QHYA 4B8XA 2WAXA 1Z2CA 2YC4C 3R9XA 5B57C 3M4YA 5E18F 3CKLA 1XTSA 3IWFA 1I27A 4MRRA 5BYJA 1LDJA 2E7XA 4C2UA 4OHVA 2QGNA 4L9VA 1GL7A 4LBYA 4Q4HB 2WIBA 4RJLA 5DGXA 2XITA 3TKLA 2JLYA 2JLRA 4HEJA 4JZKA 4QG7A 1QHHB 2RGXA 3GEIA 1F48A 1YQAA 2W6IA 2G3YA 1U8AA 2ZSAA 1O7FA 3GYHX 3RS5A 1ZUHA 1QRAA 4OMZA 3EZ6A 3Q72A 1TAGA 4GOKA 3MJRA 4HDCA 3X2SA 2RHMA 1GKYA 2ZE7A 4TL9A 5DI3B 3UMRA 3X1DA 5BN5A 1LJ9A 3TQNA 2VBWA 1KNXA 3V8JA 1D5CA 2VPPA 2MMCA 3KETA 4RD4A 4AK9A 2RGDA 2Z0MA 2A5YB 2K5UA 5JJIA 2FV8A 2OU2A 4JVNA 1FOEB 4V02A 3HIFA 3K70C 1GXQA 2L02A 4KT5C 3WMEA 4EM2A 1XEWY 5E95A 5HCIA 4IRIA 2CHGA 1YR7A 4WIAA 1CR0A 3ML6A 4TQUS 2QMOA 2IYUA 1TF2A 1VYVA 3EWSA 1XMIA 1SKYE 3M8FA 2GAOA 4R8HA 1EFTA 4Q7LA 5DSZA 1Z2AA 2YV5A 3ZS9A 1TTTA 3LO5A 3S1AB 1GRRA 4EFMA 2F1HA 3KXKA 3QP6A 4M1SA 3C7KA 1J75A 2ZR9A 3U4QA 3JSOA 1Q1HA 1KIMA 2FA9A 4JIMA 2L4AA 2EFDB 1XD8A 3TDUC 2HEOA 3VHXA 3B1VA 2VODA 2FZLA 1D8TA 5EJEA 3EA0A 1HKQA 1MO6A 3CJNA 4XRFA 1Z5ZA 1UKYA 1ZNYA 5HE9A 3VQTA 5AUPB 5B58C 4S2EA 2AXPA 3CNNA 2F1RA 3IBGA 2QM7A 4KHZA 4S35A 3PQJA 2WC2A 4TN1A 1G7TA 5DE3A 1W5TA 2PEYA 3ZVRA 2O8BB 1ZM9A 4KFSA 2XXAB 3THOA 3CPEA 2ZR0A 1Q21A 3I64A 1W2GA 1VG0B 4PXAA 3ZGXA 2YKGA 5EP2A 2JDIA 4IVQA 1GNRA 4XWOA 4ZIRA 4RB0A 1K8RA 3PQCA 2ZRLA 1B9MA 5FBWB 5AJXA 4BASA 1I2DA 3QKRB 3IL2A 1IN5A 2AXLA 2P6UA 3SN6A 4QM6A 4CDGA 2BDTA 1S3SA 5HLGA 4LHZA 3WXMA 3JZMA 3Q5EA 5HOOA 1FBUA 4FMDB 1JBKA 3R7WA 3TUJC 2OAQ1 1FL9A 1OSNA 3KJGA 1QPMA 1ZNWA 3I8SA 1UBGA 5DHFA 3ETLA 2RCNA 3WBJA 4JT4A 4IKEA 1LS1A 2G7UA 1G41A 2R65A 2OE2A 1Q22A 2J7PD 3WTVC 4UNPA 2C04A 2ZJOA 4TSFA 1OHHD 2HTJA 3LLMA 2EYQA 4DKXA 4OHWA 4IDQA 1UPTA 3RAPR 1FBSA 4LJ7A 1WQ2A 1UKEA 1X8JA 3THWA 2QENA 2NRAC 1Z7UA 1MKYA 2OSBA 4Z8YA 2FGJA 4XD7A 3W34A 2OUKA 2ODEA 3ZVLA 4ESHA 4AIIA 1FY7A 1DAIA 1US8A 2JLZA 2NZ8A 2QQ0A 3KL4A 3MUFA 5JRJA 4LC1A 3R8FA 1YU9A 5L3DA 4HOBA 3E70C 3LA6A 5TB5A 4XTRA 4CF7A 2CE7A 1Z0IA 1R2QA 2EU8A 1G3SA 1TU3A 4LY6A 4IVRA 4W5WA 3F0TA 2O8FA 4HF2A 1BI0A 2F3RA 5H68A 2BJWA 4E5UA 4KMFA 4F93B 3AVOA 4AD9A 2FFAA 5L3GA 3VX4A 4NONA 2VT2A 3D0SA 1T9HA 3V7SA 2C95A 2J41A 4A4DA 4A1FA 4DLWA 4P9UA 4R98A 2L4MA 3QBVA 4L0ZB 2XNDD 2D7DA 4UVCA 4UXIA 1TNSA 1QO0D 3KFVA 1MJBA 1UAAA 4D0GA 1WWXA 2MSEB 5TY0A 4PX9A 1Z22A 5JCZA 3N4MA 4UVBA 4EJTA 2RGNC 3CZQA 5EP4A 4O3MA 3EXAA 3OIVA 3RWOA 5FOWA 1P2TA 4TLDA 4BLRA 4F7WA 5DYGA 1CJMA 2PT7A 2J0UA 3GJ5A 1J99A 1VTNC 1O3SA 5C4GB 5BN3A 1TW2A 3GLIE 2OD5A 5JJKA 4P3YA 3SYLA 2WZQA 4FD2A 4A6DA 2M1BA 4PHGA 5DH9A 1L2TA 4NPHA 1W48A 3OE7D 4I7HA 4GZLA 2BBYA 3CO5A 3MWLA 1NJFA 2GCOA 3IHUA 3K9NA 3QQ5A 5LD2B 1G7RA 2WWGA 1HKTA 2V6JA 3QKUA 1FSEA 3AVWA 4EIWA 4HLDA 4JLPA 1R23A 1P62B 3GXOA 1E2FA 1VKJA 2XRNA 4Q9LA 5EZ6B 1K78B 4M0LA 3MGCA 3M8EA 3GCGA 3A1UA 3O8RA 1QZXA 1SULA 1U5TC 4KA4A 3AF1A 2UXNA 2EFNA 4P32A 3R60A 4IPAA 4QOSA 2F43B 3QJYA 3KKNA 1B6AA 4IRGA 3RDIA 4OBEA 3LY5A 2PMHA 5E7MA 5FTMA 1TQPA 2ZNZA 1KAOA 1W4RA 2GK7A 3VFDA 4GO1A 3QVUA 1R1UA 4QJ4A 4URYR 2K4JA 2Z5UA 4I09A 1ZG5A 1E0JA 3J80Z 1NG1A 2MA3A 1ZCBA 2EYUA 2GK6A 1XPRA 2EFPA 4AKIA 4NQWA 3RS0A 1LF0A 3I1FA 5K8TA 4KSBA 1E4YA 2EFQA 3ZMDA 2QY9A 1U2RA 3KP7A 1RYHA 1XB2A 1B9NA 4LLGF 1BKDR 1JPJA 4BLPA 5LB4A 3CNLA 4A2UA 2GEUA 1EESA 4HB3A 3MHVC 2O52A 4JJZA 4CICA 1E9SA 4TMKA 4CZ2A 4MUBA 2GBLC 3RS2A 2FMXA 2CYYA 4DSNA 4CEJA 4C0LA 4OHXA 3JTGA 1XP8A 2FEZA 4MGRA 1YZLA 2DVWB 4BHPA 4P33A 4B6EA 3CTAA 1Z47A 1YRAA 1AK2A 1RI7A 1W4CA 2VEDA 4IVNA 4RD2A 4CIDA 2IS2A 2IA0A 1U8RA 2IXEA 2B92A 3HSEA 2QRNA 3ND9A 4QGAA 3M9AA 3LXXA 4JVSB 2MLGA 5KO2A 1G8YA 1R7RA 4LV6A 1S6LA 1G6OA 3F8NA 1NMZA 2GEDA 1Z0JA 3A8TA 3B13B 3EZFA 3PUYA 4YMSA 4C2TA 2EJRA 3SS8A 1NHAA 2ZR7A 4G5OA 5KSYA 2QT1A 4PC6A 3WGIA 4A0FA 1ZVQA 1CGPA 2DPDA 4L15A 2REOA 1T4GA 1OKKD 2YYZA 3NRVA 1O3QA 1IN8A 1F6BA 1N6OA 3J7AO 1NBMA 4DRZA 3SFZA 1KDTA 4R2IA 2C6YA 4P4SA 1SXJA 2AFHE 2PX3A 1RIOH 4UVAA 4ZZDA 1FZPB 1Q0UA 3C41J 4MQBA 4WXRA 1IM2A 2PJPA 3L2OB 4C0KA 4A0YA 2MD5A 1P6RA 2QAJA 2N46A 4IHTA 4LOAA 3E5QA 5FFXA 3DZ8A 5C18A 1TW3A 3E6BA 4M2LA 4BPBA 1T3LA 2W2TA 3K9GA 1WI9A 4LI0A 1ZM2A 3M1IA 3BP8A 4O25A 3CWQA 3TOAA 4B71A 4E03A 2GF9A 2DQRA 2ZYTX 5UKDA 3WGGA 1ELOA 1X8LA 3LQQA 3AGQA 4GXOA 5ILVA 2AFIE 4L9SA 5CYOA 2COMA 3P7NA 1U6GA 2RGCA 1QHHA 3GLXA 1SXJE 3BH0A 3LD9A 4M4SA 2WKRA 5B30A 3KLOA 4U0YA 4W5JA 4BFSA 5TV2A 5DI3A 2A3SA 1FWZA 1E1QA 3KKOA 2QRZA 3ZZUA 3BFXA 4ENKA 1NJGA 5IT3A 2FQ3A 1Q57A 2GJKA 2L54A 3IIMA 4KDPA 1M6NA 1MGTA 2WTEA 1PDNC 1QHXA 3PG5A 2AWNA 2OILA 3W6OA 4ARZA 2IYLD 3FWYA 2ZS9A 4DLXA 2WPDA 4ZCIA 3DKVA 5B2ZA 1U81A 1W5SA 2WICA 3A4LA 4GBMA 4PR0A 2F7SA 3QI2A 4EPXA 1DPFA 3CRMA 2CG4A 1JE8A 4ZYEA 2ZANA 1BMFD 1VIAA 1FYMA 3CRVA 1RZ3A 3AKDA 1G4UR 4RZUA 4YMWA 4OINF 3FHOA 1E98A 4HAZA 1XMSA 4M72A 1E69A 4NCHA 5JZVA 1UEIA 1S1MA 3BB4A 3OIWA 2WSMA 4WW0A 1E6CA 4F92B 1ZD1A 2ZS8A 5H6RA 5FI1B 1KOFA 3H86A 4LJ5A 4I1VA 4NYMQ 2A2ZA 1XSXA 2V1DA 2OCYC 1F60A 4KBGA 1SVKA 2RKOA 2V1UA 2XNSA 1OFUX 3X1YA 3ECCA 3FHZA 4TMVA 3ELKA 1QG2A 1YZTA 5D4RA 4LSGA 1FP1D 4BHCA 1L3LA 2BVNA 1DAFA 4QNMA 1KK2A 1L4UA 3X1XA 2OA4A 2OG2A 1PP8F 1RUOA 2CCGA 2QSYA 3Q3JB 5AJVB 3NBXX 3VAAA 5IT9K 3I53A 1KAGA 2BIFA 3HJNA 2VH5R 2CJWA 2M30A 1YZUA 2P7VB 2KJBA 1I2MA 1QHGA 3NG1A 3O8DA 2IW3A 4DLYA 5KSZA 3ZMVA 2HLDA 2VYFA 3GEEA 4FMDF 4ZO4A 1ZW6A 2XXAA 4M71A 1RIFA 1AS3A 1OH7A 4QBIA 1SGWA 3P32A 2CHVA 1Z0AA 3GW2A 3I5UA 4DUGA 4PGHA 4DCTA 4IOJA 3MWMA 2H8KA 3QRFF 1CIPA 3A1TA 1XGNA 2QA5A 1KQ8A 3HYRA 3MLEA 2K86A 5E20A 1P4SA 4RZXA 4BFXA 2A78A 2XSZA 4L4UA 1JR3E 4TYQA 4AVPA 2O6GE 2O8EA 1KO5A 3VNVA 1H9TA 1HQYE 4D25A 3OF5A 2HWVA 1NLFA 1P2VA 2J0VA 2K7LA 2VIIA 1EG7A 1D2MA 4XOIA 1G5RA 4Q1BA 5DV5A 2V54A 2O8XA 1F4KA 5JSZB 3TBKA 3IGFA 1XDBA 4AKEA 5J8FA 3TKYA 1E94E 4OQMA 5KNCA 1W36B 2RGAA 2FXAA 2Y75A 5JHUA 4MYTA 3ZQ7A 4DNCA 4AYTA 4NCKA 5L3VA 4Z1MA 1ZREA 2IUUA 2C78A 4AYWA 1ZM7A 2NZJA 2LF8A 2QAGC 3N70A 4LB5A 3QOPA 2BGCA 1K5GA 3NKVA 4HUQA 4TLAA 2FFBA 3AKEA 4YDSA 4DC9A 1TX4B 3TAUA 1E2IA 1LVGA 1NMYA 3NIBA 4Q03A 5ED4A 4BE7B 1WE2A 1XTQA 3KW6A 2IYXA 2LWIA 2H1LA 1CBUA 5CIQA 1U98A 2O61A 1AQUA 2OM2A 3FKQA 4Q1DA 2DCUA 3DOFA 4GP7A 3U1DA 3EYYA 1TUIA 4URUR 4BWYA 1VHLA 1W0KA 1W36C 3TR5A 3NEJA 2DY1A 3WGHA 2IYWA 1KSJA 1LEBA 2DLLA 4WBSA 2XTMA 1RE0A 2QPOA 5LD2C 3TUIC 2JLSA 2ZJZA 1XTIA 2IBMA 4RB1A 3FM3A 3WTYC 5E8IA 1J2JA 2DFLA 5P21A 1JNYA 4N9IA 2FMYA 3Q9VA 2K4BA 1S3JA 1QHSA 2FEOA 2ZITA 3Q9LA 2R44A 4LJYA 4FWIB 4PFSA 4BAYA 5BN4A 1OXTA 4OQFA 5D4SA 2YC2C 4ZZLA 5K5RA 1Z0KA 3U60B 3J81k 3QF7A 4HX7A 1M7HA 3EASA 3OFNA 4II7A 3Q5FA 3VR6A 3K2ZA 3CX7A 4QBGB 1TF5A 1HY3A 1RUNA 2BC9A 5HZHA 5J4HA 3B2EA 3NBYC 1G17A 1LF5A 2BBOA 2R6DA 4HB0A 4NKRA 2HTSA 4RCZA 1M7BA 3SNHA 3QSYA 4US1R 1ONBA 3OEED 1NKTA 1IONA 4KV9A 2RQPA 2WMOB 3HOTA 3H2YA 1UDWA 4Z51A 2O03A 2FN4A 3EW9A 2VHCA 4EDHA 1GFIA 4MH0R 4C7OB 1FTSA 3P9CA 5DLQC 3TSZA 2WKQA 4JLJA 5HZKA 4DDUA 3HR8A 5EE1A 4HAVA 5FL7A 5GJVC 2LSOA 3B5JA 3ZS8A 5JHGB 2V9PA 4KIGA 5IF9A 3SQNA 1KKMA 4PZJA 1D9XA 4URVR 5J6XA 1X6VA 4LBWA 1ESNA 1RFLA 2FOLA 1E2XA 4L9WA 1XTJA 3QPTA 2ZSBA 1VHTA 1R8SA 3OEHD 3I4LA 5F98A 2DWOA 3QXCA 4UV8A 2HCBA 3AP2A 4CO8A 1H8HD 1G3RA 2ERYA 4HLUA 5CYPA 5H70A 3K70B 4M1MA 4D80A 2GTPA 1XMKA 4KVAA 2GETA 4WA7A 4FCWA 5JMTA 3F8MA 3E6MA 2A5JA 4JLNA 4M9QA 4PC2A 2PN6A 3ZLJA 1KI7A 2PCJA 1FMLA 2GXGA 3GD7A 1G291 4B3FX 2C99A 2MBFA 2GA8A 5LGUA 5AONA 1VG8A 2XAUA 1D8JA 1EH8A 3BFVA 2AL7A 2D45A 2D7CA 1KMHB 1UFQA 3SYKA 4LB6B 4ASUD 1FUKA 4MYHA 1XSVA 1KI2A 3GJ6A 3K09A 3TAHA 3CUQA 4M74A 3ZMUA 2I3BA 3PQKA 4DIEA 4FIDA 2YX4A 3CO7C 3EZ7A 2QTHA 2PBIA 2W6JA 3QOFA 3RSOA 1FX0B 4M6XA 2CLDX 1EH6A 4IXNA 3IILA 5FOTA 4N0BA 2D62A 4TWZA 4G3XA 3EQLF 4NCNA 4Z8XA 3MCAA 4X8MA 2VOPA 1A04A 2E1RA 3FMSA 4AWXB 2VP5A 4TMXA 2FGKA 1BIBA 1Z28A 5TDHA 4AC9A 1W4MA 3E5XA 4Q18A 2FBKA 3O47A 5KSPA 4EM1A 1W46A 2W2XA 4Q9JA 3SEAA 4Z54A 3EIHA 2XGXA 4Q7JB 1MO4A 4FWTA 4X8HA 5FOUA 4WXCA 4LX0A 4H9GA 4B43A 2ZRJA 1NP6A 2H16A 4I01A 4DLZA 3GEHA 1CR2A 5CIWA 3AVXA 4QXAA 2VLIA 1RPZA 1LY1A 2J45A 4M6YA 2Z9OA 2NNNA 2O0JA 4PAOA 1RRCA 2RV8A 1EFUA 3CUEF 2GJSA 1XDUA 4G94A 3I92A 3VEPA 1N5LA 4FHTA 3IBYA 3ADCA 2EWNA 4ON0A 2QNRA 3SZPA 3FVQA 4BFYA 4FN5A 1IXSB 1Z3IX 4WCGA 1W0JD 3K1PA 3U5ZB 1ZHFA 4PO9A 2VP0A 1X1RA 4M1WA 2KIFA 2G77B 3DO6A 2RVCA 4RGXA 5JHHB 2FU5C 4KLNA 3HU3A 3KQLA 4B3BA 1TU4A 3JSPA 3F6OA 3KKPA 3ZN1A 3QF4B 4DJTA 4ZYGA 3QKSA 4RCYA 4UNSA 4MRSA 2DK5A 3SYNA 1SAXA 1RJ9A 4DT1A 3VB2A 1J0RA 1YW8A 1FNNA 3I54A 4BQAA 1DELA 1N6IA 2XAJA 2KRKA 4G0NA 3AKYA 1MKMA 3VOEA 4PC3A 4F4CA 1IY1A 3MAJA 2XAGA 1CJKC 1FSHA 2CE2X 5EZ5A 5DCFA 2BKEA 2QZ8A 1FP2A 4DHEA 2EB7A 1CJVC 3KP3A 1N0UA 3V9PA 4B48A 3KB1A 4LK1F 1I1SA 2P5LC 1P4XA 1E2GA 1VCMA 4Q5IA 3ASYA 1SVIA 4DZZA 4B75A 2WTUA 1N5IA 2PX0A 2FZ4A 4D4JA 4CEIA 1K6MA 2CSOA 1G3MA 4IFBA 4TZ0A 3RRYA 4BLOA 5JWOA 1A4RA 3C16C 3KQNA 1FUUA 1Q44A 2XZOA 1OXUA 4JBAA 4MDEA 2XHKA 3H84A 4M1OA 5G40A 2OZ6A 2EW1A 3RS3A 3P4YA 3V4RA 1Z29A 2FSGA 3MCZA 1G4AE 3H0KA 5HVQC 4MGKR 3ZZ0A 1DTSA 4DLVA 2IS4A 4QHYA 1VYUA 4PAQA 3GJ8A 3HOSA 2J9RA 2YWGA 2ZAMA 1V4RA 5CVRA 3BB3A 1SVLA 1EX7A 4LG0B 2MC3A 1RVDA 4R9UC 3W9YA 2WWYA 2GXBA 3L0IB 1YKSA 1HBXG 2BCJQ 5HE8A 4MTEA 1Q1BA 1XJ0A 1DARA 2BMFA 2ZVPX 3AB3A 1IN4A 4FX4A 3BC1A 3TNFA 5AUNB 2ZM5A 2QL6A 1CTQA 2HCJB 1KI4A 4Q02A 1XEXA 1LB2A 4A0HA 1QZYA 2JGNA 2NPIA 2BMJA 2ZROA 4CGZA 5DHAA 4POAA 5F3WB 5LHIA 2IUTA 1R5HA 1U5TB 1YS7A 1CU1A 2NNYA 2Q6TA 5FUYA 5JSZA 3AKCA 4XIGS 2ZJ2A 3P9KA 4KN4X 1ZUIA 4HBLA 1A5TA 3N5CA 4K2EA 2DFNA 4QNRA 2FPMA 4S04A 3C14C 1VCNA 1CJTC 2QSZA 3X1ZA 3GLFA 5BS6A 4C0SA 5CITA 5KPDA 4IDNA 5E1WA 3ECHA 4RKFA 4HQEA 1WKMA 1XTKA 4ESVA 2M45A 2VHUA 1UKZA 1UBFA 3K9TA 2CCKA 1TNDA 2VF7A 1STZA 3IKJA 4IOMA 1KI3A 4EJVA 5IT9Z 4YMVA 4WWCA 3LAPA 1E9EA 2WOJA 3TSWA 4Y0VA 5F1RA 3BJ6A 4LD5A 4MITA 2DO7A 1G21E 2EWWA 4B3XA 4BFVA 2FSWA 4EJWA 1CF7B 3EWAA 3NDPA 4NU0A 3GLFE 1QZZA 3GMTA 3TR0A 2CHQA 1WCV1 1VCIA 1RYFA 2EFEB 1HTWA 4ZKDA 4EJUA 1BI1A 1D3YA 4LK2A 2DK8A 2P2LA 2ZRNA 2KJCA 2RDPA 4HDVA 2IX3A 3O8CA 3BPXA 3U9GA 1Z0FA 2RGGA 3VKGA 4R7ZA 4FWHA 5IK2D 2V3CC 1BOAA 2YOHA 1JXSA 2IUSA 1DAEA 1ZH5A 3ICQB 4DQ2A 2GWRA 2ORIA 3QG1A 2F2EA 2LF7A 4GGGA 2ANBA 2JCSA 4TTPA 2FH5B 2UKDA 1KI6B 1IY2A 4FWGA 5LBQA 2PLRA 5F9HA 2G1KA 821PA 3THXB 5D3MA 3GVAA 3K1MA 2ERXA 2Q9AA 4CHUA 2BBSA 4HAWA 5ILUA 1IXCA 1HURA 4KYIB 2OBLA 2PBRA 4NCJA 5AUOB 3DEUA 1GTVA 1Z83A 4MEYF 4B2IA 2XIGA 2XZPA 3REGA 1CXZA 3TQCA 5GVSA 3RTRA 1IQPA 2GZHA 4I99A 1XMAA 4LBZA 2Y8EA 3FMFA 2ZEJA 3R8CA 2VTKA 5GVRA 5EXSA 4L5IA 1U9IC 2ZRGA 5IHPA 4UJ3A 2J7PA 2QP3A 3W8NA 2A61A 3CPJB 5KPJA 3LAWA 2V8OA 1OHHA 2FF7A 4JLMA 4NH0A 4LPSA 3O3KA 1R5NA 2R7FA 4WXPA 2FX3A 2EFWA 3TMKA 2V79A 5LBIA 1W36D 2QM3A 2OAZA 2DZNB 1G3IA 3QBTA 1DP7P 4L18B 4LYJA 1J7KA 1JXMA 4YFNF 1Z9CA 2BCGY 2EK5A 5FI0B 3FFBA 1G3WA 1LB1B 2GZDA 3OIUA 4NYJQ 1N6LA 2RB4A 4TTRA 4JLAA 3EIQA 4Q47A 4B73A 1T39A 1G6NA 2ECKA 2IA5A 2W83A 5EUMA 3EDPA 3L0SA 3T06B 3WRYC 2CQKA 4P4TA 1UFMA 1PLJA 1ZD9A 2OZUA 1R4AA 3GO5A 2A9KA 4L5JA 1IAWA 1M8PA 3A1VA 3TGPA 3THYB 2XNDA 2REXB 4BH9A 5JECA 2RNJA 1G3TA 2YWFA 3K53A 3MG9A 4YQFA 3T1QA 3GFPA 2EV5A 2FFQA 2HKXA 2KIUA 1J8MF 1YJ5A 4A5NA 2CLCX 2FEMA 3K0FB 721PA 5SZKB 2VRWA 5FR1A 3E6DA 4YMUA 3IKVA 1KMHA 1G6HA 3K1NA 3MAAC 3VR1A 4O2LA 5SZIA 1NN0A 3WTWC 1GUAA 5FLXK 3DXJF 1OF1A 1G7SA 3OE7A 2BOVA 3CUOA 3CDHA 3T1BA 1BH2A 2CK3D 5A0FA 4C30A 1MABB 4MKFA 2RN7A 2C9CA 4EJSB 4MNUA 5ELXA 4G7HF 5DIFA 2EQBA 3AP1A 1XCPA 1L0OC 1X3SA 2YHSA 4LYAA 1TQMA 4AY2A 3V8KA 3EZ2A 4YLGA 4Y17A 3QP5A 2QORA 5CLQA 3KTAA 2ZO4A 2WJVA 3RRNA 3I59B 4JK1X 2ZCWA 5J5CA 4B6FA 5ICCA 4LPKA 5E17F 2B0LA 1A2KC 3GFMA 1G5TA 1KSFX 2IHBA 1GXPA 1ZC3A 3Q9SA 2FG5A 1KDRA 3SU8A 1J70A 3TQFA 1XD2B 1OPCA 4OK5A 5FFMA 4FT8A 3T1OA 3KDSE 1E3MA 4NMMA 3RPQA 1KI9A 4I1OA 2DAOA 2IYRA 4ERNA 2AX4A 2MMGA 2FE3A 2YZ2A 4MYUA 1IOZA 4W5HA 1E1RD 3BH6A 4B32A 1ZIPA 4C7OA 2QP4A 5JI3E 2PLFA 1HV8A 4YG2F 4IRHA 1OH5A 1X86B 1AS0A 3DQVC 2A7QA 5CK5A 4G6DA 3DF8A 4C0AC 4LBVA 2EV0A 3HR7A 1ZARA 2PH1A 3GPLA 4LJZF 2HEIA 4HLCA 3WRXC 3R20A 5KU1A 4ZI2A 5DNYB 1B23P 4WOPA 1X37A 3K70D 3NDBB 4IHSA 1ZLKA 2F9MA 1OYIA 3QNUA 3PXGA 3FXUA 4HV6A 2V1XA 5ILSA 1TQ2A 3AF0A 3DKPA 5EP3A 3FOZA 1P9WA 1IUYA 3WNCA 2PI0A 2NMVA 5AK0A 2A6EF 5BW8A 2QAGB 2DHRA 4PPNA 3SXYA 3T8RA 4MEXF 1HA3A 2JPCA 1KO1A 2CL0X 2KJQA 4UNNA 1FW6A 3F3YA 4TMTA 4Q1AA 3VR5A 4MGIR 1GITA 2IC5A 3UK6A 1BIFA 4C4PA 1W7AA 2LKDA 3AVTA 2P6SA 4LMYA 4MDFA 2IS6A 5EE3A 3F22A 3IRRA 2ORVA 4DSUA 1D2EA 5CK4A 4ACAA 2BM0A 1RRGA 2OCBA 5ICEA 5JJLA 3A37A 2VSXA 2O0KA 3A58B 2VN2A 5CVUA 5L3SB 1G3YA 3IIJA 3A1WA 3CBQA 1DAGA 4R71A 1OKKA 5EQTA 1XCVA 3LDAA 4EPYA 4WAUA 4NCIA 2RGNA 5FUVA 1U78A 3F23A 3GLGB 3B9QA 4G7OF 3QY0A 1LEAA 2Q8KA 3G3ZA 5LLQA 5A2QK 2I1QA 3A36A 2CVHA 3DMDA 4TLBA 4OHZA 1RC8A 5AJZA 3N97A 1XWIA 4Q48A 3ERED 4EJOA 3Q7PA 3GLHA 1SMYF 3W8RA 3GUDA 4LG0A 3DMNA 3CRW1 1P2FA 4CEHA 2VT3A 1S3GA 4M1YA 3U44A 3K69A 221PA 1FLIA 1ODDA 5EP1A 1YZGA 1AKYA 2CNWD 4IDHA 2XKOA 4RZ3A 3AH8A 5AUQA 3U2QA 4C0JA 4O5VA 3BJIC 5JEEA 2ZE8A 2ZTSA 3KFWX 1JI0A 1NKSA 1A1VA 3B1YA 1W4AA 1G3QA 4ENJA 1E2HA 1JQLB 4D81A 1GOTA 2GILA 3U61B 4WXDA 3GLHE 3C15C 2X77A 4RY2A 2STTA 3CH4B 3D8BA 1VTKA 1HE1C 3T5DA 2HQNA 1S8NA 1XN7A 3BWDD 3EG5A 2IYTA 4LGWA 1ZRHA 2F5EA 3KEQA 1NLZA 3FHTA 1HKSA 1LNWA 3P1JA 5G41A 5FPTA 1JJ7A 1CP2A 3BFKA 4MUAA 1T0FA 1NY6A 5ICFA 2GESA 1BMFA 2VP4A 2ZSDA 5EUQB 2IRFG 2BMEA 4RFVA 4O6JA 4JMPA 4YFXF 2KIMA 1XGOA 3ZJYA 3GX4X 4QGHA 1XGMA 2CL6X 3W6NA 2UZIR 2GZAA 2HDNB 4KFUA 4OK6A 3VKWA 1T5LA 1ZAKA 2UZKA 3WTUC 3WTTC 4TQAA 2DI3A 2X0LA 1VIYA 4AI6A 4NP6A 3W6JB 2GBLA 2QMEA 3KZZA 1ZRCA 2QE7D 4TMWA 4JKIA 4G8XA 1SHKA 3MZHA 3CIOA 4DIDA 1SFEA 3ONWA 1VG9B 4US2R 4ACBA 1OV4A 4LV5B 2J0QA 3ADKA 4HATA 3B73A 1Y63A 3T5GA 1OXXK 2B8WA 3F21A 4E70A 2JSCA 1XXHA 3U6KA 5CM8B 1L7VC 5KDDA 1NN3A 5L3FA 1TEVA 4G5RA 4CVNA 3B9PA 4RAYA 3CWZA 4WX9A 3DZDA 1KI6A 3ZDQA 4DLRA 4TQ9A 4PZZA 3REFA 4AYXA 2RGEA 1IN6A 5F64A 2ACJA 2XJ9A 1C9KA 2DFTA 1T2KA 4A0RA 1KYZA 2EFOA 2FSIA 2K02A 2ZMEB 2IXFA 1IN7A 1XNJA 4IXMA 3MRSA 2RHDA 1FNMA 4Q4HA 3TDZC 1OFHA 5JI2E 4M9XA 1Z06A 4MA4A 3COAC 1VCOA 1NBME 2ZIAA 3QXJA 4M73A 5LRSA 1XXHE 4NHOA 4X8LA 1EFCA 3TE6A 3V8LA 3PEVA 5JRZA 2MH9A 2A5GA 1T0HB 1XCGB 5AJWA 1N6PA 3BK7A 4UNOA 4JYCA 4OJQA 3L82B 3SDZA 1NVWQ 3EPHA 1U90A 4D4KA 3PCRB 2WWFA 2JTVA 3REOA 1O3RA 4AG5A 4DDVA 4V0NA 1JPNA 1ZCAA 1DUXC 1OFIA 3W5JA 1QNTA 1GDDA 2P5TB 2QTVB 4UNRA 5KTYA 2P6RA 3I5XA 1DBSA 4PDKA 3CRRA 2Q0OA 5DEQA 2QBYB 6PAXA 4OMYA 1GAJA 1KU7A 3L0PA 2W57A 1BO6A 1VDZA 2GDJA 3BE4A 3CNOA 4G01B 4XSHA 5K1YA 1T38A 2JLVA 4A0XA 1KK3A 3HUGA 4U0WA 4JVMA 4YXWD 3RYPA 4ZYHA 4LJ4A 2UXXA 5D6FA 3RDPA 4B74A 4HYEA 3HHGA 2H94A 1DVRA 1SVMA 4W9MC 2IW5A 2Q0HA 1ESMA 1RKBA 2E1CA 2QPTA 1X3UA 3RVBA 3C1DA 3S1AA 3T5XA 1LQ1A 4ASNA 3L2CA 2R8RA 3SBEA 3ADBA 3LXRA 4LHVA 1NMXA 1R00A 2GXAA 4CXFA 2VONA 2PMDA 4WF2A 1ZG3A 5E3HA 5DO9A 4QBFA 2X2FA 3WYGA 3AVPA 1SD7A 4BXUA 1G16A 2L3DA 1R5OA 1W4BA 3M1EA 3CO6C 1RW4A 3FTQA 3FMRA 4EJSC 1KU2A 2FNAA 2ODWA 2QN6A 3TVDA 4BECA 1R58A 5F9FA 4YONB 3T8TA 4AIKA 1NVVR 3W90A 2HYDA 2NS0A 2QROA 2HKOA 1XJCA 2CGPA 1W47A 2O8BA 1MRSA 2ZRIA 3JVVA 3Q85A 1H8ED 4KCGA 1A2BA 1O57A 3E5UA 2CWEA 5K5OA 2MSDB 1FP6A 4JBYA 4M22A 1S0UA 1D6JA 2GJ9A 1P6XA 4N1AA 2WOOA 4P5OA 1GP2A 1SKQA 1U8ZA 3NEUA 2CVFA 2XEXA 2Z5FA 1DEKA 1R0WA 3SFVA 1WBBA 2HZTA 1NN1A 3N2IA 2FNPA 2GQQA 2QWWA 2PLYA 1XU4A 3EC2A 3CR7A 5FTKA 1MABA 2Q3MA 3QKRA 3BS4A 1QF9A 1USSA 2Q3HA 2VSFA 1ULYA 4L5BA 3BGWA 3RC8A 5DCMB 4B34A 3UG7A 5E8GA 1E9DA 3LFKA 1CRQA 3MEXA 1D8KA 1JAHA 2X1VA 4UJ5A 5FOXA 4WZBE 2DFIA 4DLTA 4Q4AB 4HAMA 2IWHA 2HXSA 3CLOA 3N2EA 2BM1A 3ZYCA 1PZNA 2JJ8A 4LJAA 2J1LA 1CR4A 3OEEA 5LB2A 4ZCLA 1KYWA 5BYKA 1YQTA 3D7MA 3G0HA 3DPTA 2PEXA 4I02A 2YU3A 3IWZA 3FWEA 5BOXA 1G8PA 1Q3HA 1XD2A 2YINC 4ESFA 1TTYA 5FPKA 2K27A 1ZM3A 1CS4C 3KP2A 1QDEA 3K0AB 3RLFA 3KKQA 1ZNXA 2WBLC 2IEZA 3TH5A 3EUHA 2ZKZA 5FGMA 2X2EA 5KNBA 2NYXA 1QHIA 2P65A 4IEEA 4HI0E 5TRDA 4J0QA 4DSTA 1YW9A 4HX8A 3QAHA 4A6EA 2IYYA 2O8CB 4PPGA 2C77A 1Q12A 3SJCA 2PG4A 5CJ2A 3W3ZB 1XPOA 2G83A 2ODBA 2VA8A 1OLOA 4NBSA 3BY6A 1MDMB 1E17A 3K9LA 1I4DD 3GJXC 3PIRA 1AQYA 2GVDC 3OEHA 1II8B 4URXR 3GFTA 4B3DA 3BORA 3EPKA 4MTDA 1M34E 3U7GA 1UBEA 1H8HA 3KUDA 3I71A 5HS7A 4AD8A 5FLXZ 2ZXJA 3I72A 3T1VA 2X4HA 5CLLA 4TL7A 2AD1A 4LLLA 3P20A 1QQIA 5CVVA 1BI3A 1LDDA 3H92A 4QJ3A 2PMUA 1FX7A 421PA 2HJGA 1ZAOA 4LFUA 1KI8A 3U7EB 5DISB 2F5DA 4PQRA 1GKIA 3FYHA 3RANA 4LYHA 4KIFA 4XJXA 2HS5A 3QPHA 3FGNA 5D5XB 2W25A 2F5FA 2VP9A 5HDKA 4XWKA 3L00A 5FBVB 4ASUA 5HDNA 1MRNA 4PC7A 1F2TB 2P4WA 1EK0A 2F9LA 4G9YA 3CW2A 4URWR 1SHZA 2NO7A 3BOSA 4H1UA 1G3UA 1S4QA 3C8UA 3ADDA 3O8BA 1SFUA 1GL9B 2A69F 1W7PB 5CB6A 1NY5A 1Z6YA 2NAZA 2HDCA 4LJ8A 1J8YF 1E2PA 2GVZC 2BWJA 1TQ6A 4R1HA 1F2UB 2QEQA 3HU2A 1N0WA 2AD5A 1J59A 3QPVA 5KDLA 5G3ZA 3RRMA 1WB9A 4WVFA 3AQ4A 4G6QA 4UV9A 1R5BA 1Q20A 1ZJ6A 4S05A 3F8BA 5GJBA 4A36A 4XWAA 1J2XA 5CVIA 2LKCA 1IXRC 3ZMTA 3J81K 1K78A 4JT2A 4KLZA 1JR3D 1AGRA 4OHYA 3ND8A 3WYAA 1S2MA 4MKHA 4D0NA 1UHWA 4UHTA 1VPLA 2DYKA 4B2PA 4A8JC 4D4MA 4OIPF 2STWA 4OQLA 3O6BB 2F43A 2GKSA 3KZ1E 4KBFA 1XJQA 1FT9A 2D2FA 2UWMA 1NI3A 3LNCA 4JVLA 5H8WA 1PV4A 4E22A 2SHKA 3TSOA 2BEOA 2EWVA 4PZLA 2CO5A 1J90A 3T0YA 1W0JA 1A82A 4I98B 2H57A 2P8TA 1L4YA 1F3OA 1OIVA 1MT0A 2ZU0C 2HLDD 2IYZA 2JJ1D 3LBIA 4PSAA 3OAAD 1J5YA 2OZEA 1Z07A 1HEIA 4OI2A 5FPSA 4BZPA 4HB2A 5E4FA 1M7GA 4RZ2A 1SKYB 1ZG1A 3KUCA 1ZLJA 2ZXUA 4GMDA 3EAQA 2P5KA 4U7BA 2GA2A 4TMZA 3SJBA 4LRSA 3I62A 3L7WA 3UKDA 4HLUC 4QGFA 3QKTA 3SJZA 4MKGA 1GWNA 3F72A 3W6KB 4GZMA 4TT3D 3Q7QA 8OHMA 4HAYA 3K0EA 2Z4RA 2H92A 1UKVY 2V55B 1E0KA 1S96A 3CONA 1T3HA 4BRUA 2JASA 3E3VA 3IHWA 3UATA 4QBHA 5HKKD 5D5UB 3CB4A 4A0GA 4HDQB 2DBBA 4YC7A 1OJLA 1Z1DA 2G9WA 5A2QZ 2QQEA 3D6TB 2BHRA 5BWMA 5J4VA 1OYYA 1UADA 2ZI7A 2KB0A 3NEYA 2QG6A 2EA2A 2QM8A 1XEWX 2Q9CA 3L8YA 3U4QB 2XOKD 4BZQA 4CYMA 4B09A 5JVTA 5CM9C 2XUBA 1QBJA 1KI1A 4B3CA 3IC7A 2D2EA 3PFIA 4A82A 1KO8A 4NZYA 5LPNA 3IEVA 4EM0B 3GFIA 3VU9B 1YS6A 5FO5A 3CF6R 5GJWC 2W0MA 3AEZA 5LGNA 6Q21A 3ZH9B 2EA4A 2XVCA 1XFAA 3LA7A 1E96A 3FKSD 1P7CA 1KDOA 1EXMA 2ODNA 2ZE6A 1W2HA 2LCFA 2GXUA 4DSOA 3T35A 4EFNA 2ANCA 5BPIA 3WU1B 4OL0A 4EUNA 4TLEA 3K0CA 2KBFA 4MGZR 3P4XA 1HW2A 1KGDA 2ZRHA 3CPHA 2E7WA 3AGPA 4ZDIA 2YOGA 4ZKEA 1UBCA 2L01A 3KE2A 4ZIRB 3KKMA 4RB2C 3VKHA 4IHQA 4D82A 3F3XA 3WTZA 2OXCA 3KXIA 4Q9KA 2VE8A 2Q9BA 3FMPB 3TLXA 2V7QD 1FYKA 4QWQA 3SC3A 2F6RA 1E9RA 2W24A 1CEEA 5A4JA 1S1CA 2CXXA 1GHCA 4GDFA 3R7WB 3ZN0A 4HA8A 1T8TA 1HT2E 2Z83A 2BYVE 2ZRDA 4B76A 1AGPA 1YZKA 4MHGA 4NYIQ 2ONJA 3KFXA 1U0JA 1E9AA 4DCVA 1N6NA 2QVOA 4Y13A 2DB3A 3PITA 2OLKA 5AIPA 1GVJA 4EGZA 5DYMA 3MZYA 1P5ZB 2OO7A 3B78A 4GT1A 1F5NA 4K8OA 2IYVA 3AVQA 1XEFA 4LWZA 4PAMA 3V00A 4AKHA 3KP4A 1XF9A 2IWRA 1P75A 1Z8FA 2FE4A 2ZYUX 4EPVA 2PT5A 3THWB 3G73A 1O7LA 3BJOA 2OQRA 3P27A 4KJZA 1A7JA 3WODF 2O0YA 4OK3A 3RI4A 1US8B 4CRWB 4FW9A 1YR9A 2I1VB 2NO1A 3QXHA 1LFDB 5C46F 3FZVA 4O0MA 2GJ8A 5CYVA 1N2CE 4PHFA 2Z3YA 4KAXA 3DP7A 3HSFA 1JQJC 4JQFA 1ON1A 4GI7A 4D2IA 4QM7A 1BYUA 3KXLA 4KN7X 2AK3A 2OT3B 1XD9A 1RNLA 2WV9A 2ZBKA 1B1BA 1PLLA 1I4TD 1PJRA 2P3SA 3BIFA 3LVQE 4UXJA 5FUXA 2A07F 5D5VB 1COWD 5IK2A 3GLIB 1U2WA 3UG6A 3VX3A 1N6HA 3GJ4A 4D26A 1XRJA 3KJEA 5LEKA 2XJ4A 5E7IA 5JCPA 1HW5A 3SOPA 2G88A 4URZR 2EFGA 4XVUA 4CZZA 4A2PA 4B33A 1R1VA 4XSGA 1IHUA 5H20A 1OR7A 2OCAA 2OXRA 2IP2A 1N6RA 3GFJA 1KZGB 3DHWC 5GJCA 3SHWA 1B59A 1WF3A 4JL6A 2BV6A 2NGRA 4N0EA 2JLWA 4OOIA 3B82A 4H1VA 4IDPA 5IRCD 2AN9A 2P67A 1BYIA 4KU4A 1N6KA 4XSXF 4W7SA 4EQ6B 3AVYA 2FBIA 4PHHA 1KNQA 3NVAA 5DYIA 1OKRA 1QBKC 4C0BA 3HPQA 3AVVA 5DCMA 3U2RA 2H6CA 3ABUA 2G7HA 3ASZA 2LNBA 4LDJA 4QFMA 4YIFA 1GNQA 3DFGA 1EFRD 2FSFA 2JATA 3LX8A 1PVOA 1P72A 2FPLA 4JKYA 3EZ9A 2EFHB 3HHHA 4FMCB 1T8UA 1Z63A 1XZQA 3GJ3A 1P2SA 5TJJA 2KSQA 2ZJYA 1GRQA 3TIFA 4V0LA 3GFOA 1N5KA 2QMHA 1REPC 2E1NA 3ZIAD 3CX6A 3PEWA 1UHMA 2GJAA 3BROA 3UANA 5GADl 3KP5A 1SVWA 4Q9HA 5TXGA 1BC7C 2L0XA 2V6ZM 1LS6A 1XB4A 3ZVNA 4AURA 3MQ0A 1G9XA 3BD9A 1OMIA 5HLHA 2HFHA 3E97A 1P92A 1M2OB 3NHAA 2G6BA 1H65A 2BJVA 3QVVA 3AF4A 4ITRC 4BGDA 3PVSA 2YWEA 1FOKA 2HJVA 1F1ZA 5IDVA 4PC1A 5DD8A 3UWOA 4I4LA 1JGSA 3LV8A 4GCVA 2P7CB 5DN6D 4ZDWA 2GZWA 5FTNA 1G8FA 4Q00A 4B2LA 3M6AA 1LDKB 4EQQA 2ZVQX 3RWMB 4HUTA 2WSSD 1GRNA 2PZFA 4Q4JB 2C8VA 2ZSEA 1BJAA 1GSIA 5C2JB 2NTYC 3ISPA 2OLJA 3MSXA 3FMIA 5HCNA 1OYWA 4TYNA 4DEXA 1M74A 2P0EA 3GWZA 1E9FA 2JEOA 2R2AA 2RMKA 2ZE5A 3QE0A 4Q4LA 4CEJB 2WKPA 2R6GA 3DPLC 3QXXA 1C4OA 1XZPA 2JJ2D 5F2EA 3ZQJA 4ENNA 2EFCB 1QG4A 2A5DA 1W44A 4LZZA 3RKWA 2ZRFA 2DT5A 3DV8A 3WNBA 4WZAE 2HYIC 3MFKA 2AKYA 3TVTA 4DLSA 2MLKA 2CEAA 4FCVA 1S7OA 5JS8A 2ZI4A 4U0VA 1E79D 1L8QA 2H18A 3AAFA 2B7CA 1O3TA 4IXAA 3A4NA 2CK3A 3C4JA 4M9ZA 1ZIOA 1YG2A 1NVMA 1AA9A 2WIAA 1X8KA 2WJYA 2C98A 3HRMA 1E2DA 4OQXA 4KITB 4F4JA 1XSDA 1GKUB 1T98A 2ESNA 4GOXA 1T6SA 2HUPA 3OZXA 4UXHA 4IW3B 1KK0A 1ZYUA 4I2OA 2FF4A 4KO8A 2XAQA 2ELHA 2LKPA 3AF2A 1II0A 4KYWA 1I6XA 3EX7C 4P4SB 1SXJB 3QXSA 2BEJA 1XBTA 4JLBA 1JJVA 1WBDA 1LW7A 1MO5A 4F38A 5A5GA 4NYMR 4IF4A 3I61A 3LA3A 4DWJA 1G64A 1PLKA 1B4AA 1OW3B 2QPAA 5M04A 3VR4A 3NBZC 2J0SA 5EXPA 3R0JA 1E1RA 2FFHA 2A30A 4RGRA 2CDNA 5ERIA 2BBTA 4EPTA 2VBZA 4G5SA 3QEJA 5JWRA 1U9IA 2AR7A 2DU9A 3JAMK 4PHTA 4XLPF 1BM9A 1E2EA 1JHFA 4HLXA 4OYHA 4LK0F 2IXGA 4GMXA 5JFGA 4Q1FA 4HV5A 4GL2A 1BN5A 4HF1A 3CH5A 2HQRA 2J7KA 5FD5A 4TYPA 2VQSA 4ARZB 1G8GA 4RB3C 4A92A 4BEBA 2J5XA 2ZFWA 3GFLA 5JEDA 1TUEA 3B1ZA 4MRPA 3SE0A 1ETUA 4PQFA 2HYGD 4MQVA 2HT1A 3X1WA 2JLUA 3QU3A 3E1SA 4JS0A 4BFWA 2H17A 4A15A 3UMSA 5FOSA 3TK1A 5K8UA 4HX4A 2EVWX 1WSUA 1MV5A 2VL7A 2OFOA 2WWWA 1WRBA 3BWGA 4G1UC 3R6SA 1S29A 3QUSA 3U6BA 3J81Z 1WQ1R 3U3OA 1HXDA 4D6PA 2D1VA 1G19A 2YNMA 2FBHA 4C0HA 2HF9A 2ZU6A 5IT5A 4DLUA 4TYYA 4AG6A 5J40A 4IDOA 1DS6A 2M8EA 5L3EA 1JALA 2J59A 2QQ9A 1FX0A 3KQKA 3KEOA 1HQCA 4KVGA 1OIWA 2ZETA 3HTSB 2G0NA 1W7PD 1C0WA 4IVPA 3U44B 4R79A 3TW8B 5L8VA 3EPLA 3VU9A 3FXQA 1II9A 4IJMA 3SHFA 4AWXA 4LV8B 4JLDA 3HYTA 1IJFA 1FFHA 4A6XA 3AJIB 4ABYA 2ZRPA 1E2QA 2TMKA 4UXNA 4NL4H 4ENMA 4MYCA 2CJWB 2CL7X 3HPRA 2OV2A 2YJTD 2XGJA 4KSCA 3GP8A 2A3RA 2ATXA 2XAFA 3RJPA 4RAZA 3HWSA 5D5WB 2R9VA 1XDSA 5D8LB 1OXSC 1MD0A 3JZAA 3KJIA 1IRFA 4BRWA 1UEJA 3TRFA 2CNWA 4Q01A 4LJ6A 5H6QA 3O2PE 2FRHA 2GA1A 5LGTA 1ZYRF 2BEKA 4RS8A 2O8DB 5EXTA 1HT1E 4HAXA 2O3FA 4L9TA 4BFUA 1KQ9A 3FMQA 2YSRA 1YTYA 3GF2A 1XX6A 5ANRB 1ZINA 2IT0A 3HTUA 1FMJA 1TMKA 2O8EB 2ZRAA 1BIAA 1X1SA 3WG9A 4ZYDA 1KTVA 2KI5A 3OOPA 5JR3A 2DPUA 1DAKA 2W6ID 2JLXA 2UZ3A 2Y48A 3AF3A 2ONKA 4EGYA 3G5UA 3EYIA 1P9NA 1XTRA 3AUXA 2IJLA 3IO5A 3R61A 2VBYA 1SD6A 2VBXA 1YHNA 3QF4A 2IA1A 5F6FA 3AVUA 3BPVA 2ZSFA 1Q1ZA 2XTZA 4OI1A 3PEUA 3DM5A 2GRJA 2W00A 3K1JA 1Y0UA 4HAUA 1NIPA 4LRWA 1WA5A 5KYKA 3MWYW 3RPUA 3AV0B 2HYFA 1DE0A 2WJHA 5CLSA 1BBYA 4D4LA 1ZP6A 2IK8A 2VHQA 5L3RA 2GXSA 1YIOA 3VR2A 4BLTA 5J8CA 3JW4A 4GYIA 3M0EA 3RKYA 1KJWA 4HUQB 3WBKA 1RRPA 3QEOA 4P0TA 4C0QC 1XMJA 2WJGA 4LHWA 3ZD7A 2GF0A 3HP1A 4OKSA 2OBPA 5D6EA 4QLCU 1U0HC 2QE7A 3FDIA 5EE9A 4XBFA 5SZJA 3FXRA 1N0VC 4QKQA 4RKEA 2E9SA 4B3GA 3FF5A 2ATVA 3Q5DA 4I1SA 1UJ2A 5BQTA 4QL3A 2FOKA 3GLIA 2VC1A 4JJKA 1CKEA 4UKDA 3IRQA 3TOBA 1W1WA 1B0UA 1P3JA 3MD0A 3PUXA 4U02A 2W84A 2QTFA 1ZU4A 3QIAA 3VODA 4N3NA 1PP7U 3EARA 1YYVA 1WDTA 3LVRE 3TW4A 3FX3A 4EKDA 2ZJBA 5KDOA 2OBMA 2ZI9A 2ZRCA 3LRPA 3DKWA 4V0KA 5JFRA 2VSOA 3B1WA 3B6EA 3ZQ6A 2FSHA 4QC2A 5FBQB 4AKGA 3E5HA 3PUVA 5HR5A 4EPRA 3SBDA 4FMCF 3A4MA 1UM8A 2X8AA 1KJYA 3KZYA 3U7FB 4EQ6A 3B7GA 2Q3FA 2G1JA 4F7ZA 2XKPA 2OCPA 4YDHB 2A6HF 1R5GA 1UF9A 2JDID 1LVAA 5D3QA 1TQIA 3C3WA 1I5ZA 3LH5A 5FBLB 1SZPA 1GVNB 2B7BA 2PL3A 3GQBA 3OESA 1HE8B 2XROA 4MQ9F 3LWFA 5KK1A 1U3EM 1OB5A 2FPKA 2IT1A 2F55A 4IOKA 3GJ7A 1YW7A 1U5TA 1PUIA 1Q3TA 3WHLA 3HU1A 1D9ZA 2A5FA 3WU0A 2JT1A 1V5WA 2WWIA 4HLQB 4A8JB 2XAHA 3LA2A 2Z4SA 2RH5A 4P31A 1LTQA 4DCUA 2XX3A 3IKTA 2WAYA 2VOOA 1NLYA 3KCCA 5EEGA 3V7RA 1WXQA 1OPXA 3LW7A 3C5HA 3MMPA 4BFTA 3IHLA 5KSOA 4TSFD 4JL5A 4RD3A 2R6AA 4YXWA 5CJPA 2RC4A 3I73A 4TZ6A 3NH6A 4IFEA 4DEYA 1XGSA 2C03A 4PPQA 4PZYA 1NF3A 5DDGA 3NH9A 3D5LA 3LQRA 1KQ0A 3H1TA 4XD7D 1TQDA 4CT5A 2ZUBA 4Q66C 4OI0A 1TLHB 3HYIA 1USTA 1KO7A 4B44A 1VECA 3T34A 4JN6A 1YO5C 3WE3A 2H6BA 5FFZA 3KP6A 4OIRF 1CF7A 1IZ1A 4L16A 2PCLA 4PO1A 4UQOA 4Q4JA 3IQWA 3RSLA 3WMGA 2LDUA 3KQUA 1HSJA 3F8TA 5EXXA 1I1GA 4MKIA 3FB4A 4C3ZA 5DUKA 1HH4A 2NIPA 2QQBA 3EIEA 2KBEA 2VF8A 5HS8A 2IHYA 4P96A 2ZQ5A 5LRRA 121PA 5ICGA 2CBZA 5FPHA 5E1ZB 2WM9B 4YMTA 4Q4ZF 4BYYA 5K5QA 1FYLA 4BNCA 3VLFB 4HF0A 5CVJA 4OIQF 2VP6A 5BQ5A 4GPTA 1SFXA 4H0EA 1H8EA 2ZYVX 4QRHA 4G7ZF 2XASA 3WYFA 3WMFA 4JSYA 4NYIR 3VMFA 2KKOA 3LSTA 4UNQA 2ISYA 4FX0A 2WVJA 3SJAA 1SXJC 3THXA 1XD7A 3QU6A 1IAQA 2AWOA 3DPUA 1NG9A 3ZVMA 3B02A 3CUQB 1QZMA 2C96A 2IF2A 4A5MA 3ZMZA 5LDDC 3NBFA 3UPUA 2AHOA 2D4HA 2RGVA 3I4PA 1KU3A 2GIVA 4HZUB 4LCBA 4ON9A 4RGUA 3ROUA 2NOAA 1KKLA 2JAQA 3B60A 4FMBB 4RVCA 4TL6A 2QQAA 2B8TA 2Y0MA 1EFHA 3FE2A 3I8XA 2R3SA 3BDDA 3HRSA 3DL0A 1S7AA 3E2IA 1E2KA 3A1SA 3LW8A 4Q1EA 3CRQA 3B8HA 3WHKA 4CT4B 3SQXA 1P60A 1E9CA 1GNPA 3FHCB 4Q5SF 5AJYA 3UWKA 4I81A 3T1TA 2GAUA 3R9IA 3CM0A 3MFYA 1R6BX 2REBA 5KHOC 1NSFA 3TGNA 5C1BA 1E9BA 2HR3A 1CJUC 3BRWD 3M7GA 1R10A 4KXFB 3RYTC 1P4AA 3IPYA 3WY9A 3OV8A 1YVDA 4GNKA 3F6VA 3ZP5A 1V3FA 1TNTA 4LUCA 2QI9C 2J46A 1IY0A 4KICA 1G18A 3K9HA 1P9RA 4GFDA 4LHXA 2CMKA 2Q2EA 1G5PA 4ETSA 2V4ZA 2VHTA 4RFSB 2CW0F 2ZREA 1N25A 2X19A 4FI3C 2ZYWX 5AWFC 5G3YA 4DCNA 2OEPA 4EVIA 3CF0A 1YRBA 4ZV4A 3THYA 3QKSB 1ZGAA 1OT3A 2ZI5A 3GJ0A 3ZZTA 1U0LA 1RJ9B 2ETHA 1ZMXA 2BMDA 2NO9A 2NPFA 3RS4A 3S2WA 2PEZA 4AIJA 1R1TA 1Z6TA 1MO3A 3NHBA 5FBRB 2PQ8A 3K0FA 5DUIA 3RNLA 1GG2A 1UB9A 3QPUA 3BB1A 1FPMA 4G5QA 1OIXA 4OI4A 1NNEA 5L3QB 1EGAA 2P5SA 1XCBA 2GAAA 3LX5A 2R7DA 1DPRA 1GIAA 1EX6A 4Y15A 2RKHA 3RKXA 3TO6A 1N5JA 4I1UA 2F5CA 3UXMA 3LLUA 1AS2A 3BOQA 2W58A 1ZD8A 3PV0A 1OH6A 4M9SA 2MH2A 1NVUQ 2DW4A 1SMTA 4CEIB 3KQHA 4EJSA 4TV7A 4V0OA 1G8HA 4GITA 1DPUA 2DWZB 1NIJA 3D31A 2ZNYA 4RD1A 1KDPA 5KUTA 2BKUA 2QZ4A 3CR8A 4IEIA 1ZBDA 3BH7A 3WP0A 2AS5F 5FL3A 5EEHA 2VBCA 1GM5A 3F8FA 2NQ2C 2V9VA 3DVLA 2M5WA 3I3SR 3I59A 1G4DA 3JAMZ 1O87A 1JR3A 3I0TA 3GZ6A 1IRGA 1NBMD 2DBYA 1JAIA 2RAPA 4ZDKA 4Q1CA 3PEYA 1DOAA 1SXJD 2J5OA 3C5CA 4A2WA 1CLUA 4D0LB 2ZUCA 4DT1B 2YVUA 3EA5A 1FTNA 5BXQC 4HZFA 4Y0AA 3NC0C 4DXAA 3WTXC 4GYGA 2O8DA 4FCTA 3ICEA 3VFZA 5FD6A 2QP9X 3OHMA 2R6FA 1E4VA 2B21A 2WHXA 5L3CA 1FBQA 1OXVA 3CLVA 3AUYA 2QGZA 1Z91A 5FUWA 2V6CA 1JXOA 1KY2A 4HQMA 2IA2A 1BI2A 3WE2A 3ZPLA 1XEXB 3ECOA 2ISZA 2FMLA 1QHNA 2JJ1A 3OAAA 4P55A 3P26A 1ZN2A 2WV0A 1DAHA 1QVRA 4G5GA 1YFHA 4NE2A 4GSYA 4LLNA 1N3BA 4LC0A 2F3TA 1E1QD 2A68F 2F1IA 3KLNA 3AP3A 1S9DA 4TYWA 3FFAA 4A0ZA 2QMUA 4TLCA 1LV7A 5KVRA 5TVKA 1HW1A 1RZ4A 5TARA 4IRUB 5JS7A 4NTZA 5L3BA 5FOVA 2WPDD 1FQKA 3GLFB 3T12A 2XB2A 5AIQA 4TT3A 2JLQA 2CCJA 4Q19A 4PSKA 1YZNA 2H7VA 2QAGA 4P4UA 1ZRDA 3V4FA 3K0SA 2HT6A 1KSGA 1KSHA 1C1KA 2P6TA 2NO6A 1MJ9A 3FPAA 3TUZC 1K5DA 2D2WA 1JEEA 4M1TA 2PZGA 5HKKA 1F9NA 3LBNA 2ZUDA 5HLIA 4ESBA 1TQ4A 2C9OA 1KY3A 4L8GA 4EV0A 4B47A 2XB4A 5J4YA 1T0JB 2B6HA 2PJZA 3RC3A 2EV6A 4PGGA 2XOKA 1MZBA 5L3SA 3EPJA 1KMQA 5J4KA 4HZIA 4WXHA 2FDCA 3F8CA 4BEJA 4US0R 4ZPXA 1NSTA 3EETA 4M8NE 1FZQA 3C18A 4NYJR 3GLGA 2VE9A 3FKSA 2DZOB 3NC1C 1IXZA 4X8OA 1R0YA 1S9HA 1TADA 2YX7A 2HGCA 1K7AA 2Z6VA 1T91A 1D5VA 1E2LA 3V7CA 4DBLC 3EC1A 3H4MA 3U7HB 3NWJA 1G20E 4F91B 5FH9A 4LGMA 1E99A 2JIZA 4PANA 5EE5B 4ZCMA 5K8LA 2ASEA 1EV7A 4LYFA 1KA8A 521PA 5D3MB 1HSTA 3K8YA 1KGSA 1JHHA 4ZH4F 3PJRA 4DUGD 5CB8A 1SD4A 4QGGA 3GLGE 1Z0DA 2V7QA 4HYYA 4QJ5A 4XTCS 5CDFA 5JWHA 3ZD6A 3VNUA 4PPFA 1AWCA 1AZTA 1AIPA 2IYSA 1MH1A 3BBPA 3IPXA 1JR6A 1ON2A 2XSZD 3W6PA 3IO3A 3WTSC 4WZ6A 2ADUA 2IVMA 3I58A 2R62A 4QHSA 4P9FA 1XMVA 1YR8A 2ZI3A 3LWNA 2JA1A 1WP9A 2IS1A 3U3KA 4HLYA 5SZHB 4A8JA 4MRVA 2XZLA 4OU0A 5TMPA 3B1XA 2J3EA 3KJHA 5C4MA 3KX2A 1SQ5A 4JYBA 1NL3A 1KZ7B 3PENA 2CFXA 1ANKA 5CDFE 3H3UA 1H0MA 1Z6AA 2E87A 1Q1EA 1TEXA 5H1YA 2FU4A 4KFCA 3QENA 1KK1A 3U3RA 3F5FA 3WP1B 4FINA 3SR0A 1NVXQ 1R0ZA 4JBWA 2ZPTX 1FC3A 3NQOA 2TDXA 4NB5A 1BOFA 1BS1A 1QVAA 1W49A 1Y3AA 3DDCA 1Z05A 2HV8A 2W85A 1CR1A 3MJHA 3FMOB 3ZMSA 1AOYA 4LHYA 4ZDJA 2D1HA 4PCQA 3BZ6A 1U99A 2QT0A 3D3QA 4ZI3A 2AKAB 1XPUA 4Z2YA 2DWPA 4I0BA 1OE0A 2DTRA 4KUMA 1YLFA 2HOEA 2ZJ8A 2GCNA 1DAMA 1Z6XA 4C9BA 4O2RA 2C9YA 1WRJA 1MOZA 3P9IA 1COWA 1KHTA 1VG1A 2D74A 5G53C 4D0PA 3K09C 3TO7A 3H3ZA 3R4KA 3CUQC 5LEJA 2BBWA 3SZRA 5HDGA 1T6NA 1QGPA 2VP2A 2VHJA 1TBXA 4F4IA 2Z43A 1W0KD 4XH9B 1OH8A 3RS7A 4M1KA 1AKEA 2YPRA 1CRPA 4HW0A 2OFXA 5EE0A 5KNDA 1R36A 2FJUA 4CW7A 4V0MA 3GEZA 1CULC 2NO0A 1IBRA 3TJZA 5FB2A 1BC8C 1YE8A 4RD6A 2VO1A 2WWHA 4KYUA 4XVQA 1AZSC 621PA 4RD0A 2VC0A 2ZMEA 1VMAA 2AXNA 1MJAA 1ZRFA 1EH7A 2ZRKA 2JIZD 4OQNA 1ONVA 3V4GA 4AIHA 3HDTA 4HZUA 4K81B 4Q7MB 5JLJA 3K0CC 3FM5A 1RRFA 2QU8A 2Z33A 4U00A 3TO9A 2GHIA 3DEFA 4JLVA 3WNDA 4GOJA 4U88A 1G1MA 5LHHA 4V0ME 4A2QA 1EFRA 5FTLA 3IQXA 2ZJAA 4PSVA 2D3WA 2JRTA 1HYQA 2NG1A 2KE5A 2PMKA 4KMUX 1E2JA 5HS9A 5CJ9A 3OFND 4MGYR 1ZU5A 2BE5F 3JTHA 4MRNA 4IJAA 4N9HA 2FWRA 2QYOA 2V6IA 2WMNB 3KTAB 4OJKA 4U7DA 2DR3A 3SZTA 1PUEE 4YIIA 3G82C 3ZIAA 4B35A 2OQGA 2XTNA 3HRUA 2PJRA 1TPZA 2OHFA 3E6CC 3ABTA 3ULQB 1DDNA 2RGBA 2OFWA 3IEUA 2QBYA 3L43A 2FA5A 2WWXA 5AR1A 2D06A 2WJJA 3U3MA 3W5IA 4BFZA 1HUQA 3SQWA 3K0LA 4XVRA 2AK2A 2GCPA 4HDOB 1AM4D 3VHLB 1F5TA 3GZ5A 1YR6A 2CLSA 2IYQA 1SVOA 4CYDA 1Z6RA 3MWJA 2J5PA 1TL7C 3NTUA 1E2NA 4HB4A 4BLSA 4A9AA 2JZYA 5BPDA 1JEDA 2IEYA 5FL7D 1UDXA 3UIEA 4M21A 5DN6A 4Q7KA 4RGSA 2H27A 1OFTA 1DG3A 4V03A 5JBQA 3BERA 4HDUA 1UCRA 1R8QA 2N1BA 1P61B 2WSSA 4RFSA 3T61A 1S8FA 2H5EA 2VXZA 3RIRA 1Z08A 4JL8A 3I5YA 2O8FB 1O3YA 2N42A 3IIKA 3L09A 5LHGA 2H09A 4N0DA 4EPWA 3L9FA 3W3AA 2XV4S 1IJEA 1ZUNB 1ZGJA 1T5IA 2JPBA 2PZEA 1NN5A 3PUWA 4EMSA 2JJ2A 4BHBA 2R6CA 1R7JA 4Q9IA 1E2MA 3HSRA 2G9NA 3J80K 4BLQA 2QUZA 3C7JA 4DCSA 5DI9A 1AJEA 4OIOF 4JLKA 3IUYA 1V43A 4JLOA 4ILEA 5L3QA 1DO2A 1R22A 5J4LA 1E32A 4Q21A 1IF1A 1U8YA 2O5VA 3R0AA 1P4WA 1E79A 1Q1QA 5KOYA 4Z1MD 1KU9A 4FWDA 1KJZA 2GWHA 2J0UB 1JECA 4KNYA 3T15A 4DVGA 2KRFA 2QLZA 3QPWA 1DO0A 2ZJ5A 3BJAA 4L0YB 3CX8A 1K6OA 1J9IA 1VYTA 2W6JD 3JVUA 2G0TA 4JSTA 1KO4A 2BV3A 3UMFA 2ZS7A 2Z99A 1GZSA 4BQSA 4GRAA 1D2NA 3VR3A 1GILA 2GCOB 4Q4AA 3R9WA 1E0SA 1IW7F 4DB2A 4BUJA 4XLNF 2KWIA 2YWHA 4HSEA 5FTJA 4TTQA 5FR2A 5HTKA 1MR3F 1C1YA 4KFTA 4ESJA 1AN0A 1LNZA 4L9JA 2C5LA 2P5VA 4NHJA 4YFKF 5E1XA 3K0AA 4R2HA 3GLHB 1NRJB 1ZC4A 3BXZA 4K46A 4CEHB 2I4IA 1G7CA 2UVQA 2ZRBA 4QHTA 3VTKA 1SD5A 4LJ9A 5K8IA 3Q8XB 1R0XA 3DOEA 5J47A 2O8CA 1U94A 2DFKB 1EWRA 5JI6A 1P73A 1T3SA 2IF0A 4KIBA 1ODFA 4L9NA 4I0AA 4WK8F 1MDMA 1FQJA 1Z6GA 2Q21A 2O0HA 3KB2A 1NVVQ 1OB2A 1II8A 3QG5A 4RSGA 5B64A 2OBNA 1CF4A 1KYIA 3RHFA 4KFRA 3OIYA 4JBXA 3AM1A 4DDWA 1DADA 2MSCB 2DPXA 3NXSA 2HXYA 3HRTA 3LAJA 2DWQA 3CF2A 4PQYA 2YOFA 2PFBA 1K79A 1FPQA 3BAFA 3IDQA 4KI0A 4BZXA 1WMSA 3PUZA 4U5XA 3RYRA 5D8KB 3LBHA 1EWQA 1H9GA 4UUVA 3CZPA 3DM9B 3I32A 1TF7A 1JB1A 2QUFA 4XSZF 5DD4A 2ZRMA 3PR1A 4FXPA 4NDZA 5FPYA 4A6PA 2C2HA 4E07A 5HPYB 1SVSA 2WJIA 4EAQA 5BMZA 4PTLA 1F2TA 3MWKA 1I4LD 4TL8A 4IOLA 4E09A 1E0AA 1FP7A 2IL1A 4LRTA 2YR2A 1P2UA 1M1YE
chains in the Genus database with same CATH superfamily
3MOSA 4BKRA 2KNAA 4MW7A 3VXKA 1PT5A 5H3HA 3B85A 4UU0A 4WXMA 5JSUA 2W7TA 2GA9A 4I99C 4HGYA 1I27A 4QXOA 3KEMA 1QHHB 3ZQQA 3EPRA 3MTBA 3ABZA 4UEJA 3GNLA 4JKOA 1TWCJ 3A1CA 5EGSA 1ZXLA 5JD6A 2ETVA 4EYQA 3KTDA 4WZZA 1PM5A 4RH3A 2HA5A 3H4TA 2VF4X 1D7OA 2BDEA 5CYFA 1KIMA 3AJEA 2LXEA 1DNPA 3JPYA 4RK1A 1MORA 1D0IA 3C6YA 3D7KA 5B58C 2AXPA 4HGQA 1YOBA 3I01A 1WLYA 3RYIB 2BFBA 3HKCA 3PQCA 3LFTA 1JDBC 3L8FA 1PL8A 2P6UA 3FNHA 2BDTA 4FLEA 4OHKA 4YLYA 5AW8A 1GPJA 2WK1A 1CVIA 1BKYA 1LS1A 4G4IA 1JIQA 1GA6A 1QH8B 2EZ9A 1T1JA 1R15A 4M3NA 1DBVO 3W4JA 1RCTE 1T0BA 2AG1A 4K5QA 4G4SO 1ZRNA 4TVBA 1VPDA 3ZW8A 4HF2A 1MNQA 4E5UA 2BJWA 1MNEA 2WU0A 4AD9A 2C95A 4QYIA 3EHEA 4C7BA 1JXAA 1UBUS 4XLCA 1RYDA 2WP0A 2OV8A 5AW1A 1P0CA 2VDJA 4FEEA 4YRSA 2FSPA 1HKTA 1T26A 1FSEA 5JVGF 4LSMA 1HT3A 5JDIA 1K78B 3O8RA 3A1UA 1T5SA 2QTGA 5THKA 2WB4A 4OBEA 1TQPA 1M2OA 4MUIA 2D3TA 2ASVA 4KSBA 5FLMJ 1Z38A 1O0CA 1EESA 3T3GA 5L4NA 5BT9A 4O3FA 4FMPA 4B6GA 2VSYA 2J5KA 3PRKE 5HILA 4D74A 2NQ8C 2IS2A 4HBGA 1Y4SA 1U7TA 4LV6A 4CL2A 3PUYA 2D2VA 5LJLA 2I8LA 3LTEA 3UY4A 4XWGA 1FZPB 3C41J 4O4JF 2PJPA 1JFVA 3OOUA 1WM1A 2HHHM 4NY1A 2O2DA 4O25A 1ZM2A 5CMLA 3V1UA 4L9SA 2DPMA 1U6GA 2RGCA 5CG1A 3A11A 3I34X 1NQOA 2P3LA 3IR6A 1U0BB 1KAQA 1M6NA 4DLXA 4EA9A 3V8MA 1N2CB 4OOEA 2KNZA 1A7AA 1Z5VA 1U81A 2YN4A 1NPYA 4I1RA 3CRMA 5CXSA 1RXUA 3ZIUA 3T7CA 2ODTX 3PI6A 5ESDA 4H08A 2WWVD 2XF3A 4KXLA 3TW8A 1L8AA 4QNMA 1KK2A 3CH6A 3HJNA 5ALXA 2BTEA 1Y6IA 4ZYAA 1QYRA 3I83A 4DUGA 4QICA 2R4GA 3A6GA 4IM7A 3EUHC 2O54A 1VI5A 5LBTA 1KO5A 3VR0A 4Y3UA 3TZEA 1NDHA 4W5RA 1EG7A 2O8XA 2HDHA 3BFPA 1XDBA 3EVCA 3TKYA 1E94E 1FOXA 2RGAA 2HK7A 5HRUA 4H7FA 4BHTA 4CH7A 4B3SM 3KPJA 3N70A 4DC9A 3MT0A 4PAWA 5AKHA 1MMDA 3TWOA 1WW8A 3NEJA 1KSJA 1LEBA 3ZK8A 4ZT4A 5P21A 1GPWB 2ZITA 3IVCA 4LJYA 2VC2B 4C5BA 3H1CA 3OMLA 2QK4A 1H66A 1R1DA 7ADHA 1VKHA 1BWRA 1HY3A 1E20A 4M1EA 3DYVA 1NDQA 2RQPA 5BYAA 2EIKH 3ELDA 1D5WA 1FTSA 1IQRA 4RX1A 4XRSG 2XAAA 1VLVA 3B5JA 3D3WB 5KU7A 3R6GA 1R8SA 5HQ3B 3F4BA 4M1MA 4KVAA 2OZPA 4ZC8A 4PC2A 3ZLJA 3IB6A 2CNKA 1UBTS 2C99A 1JG6A 3FBIB 5KQ8A 3IQDB 5HQJA 3U4DA 4ASUD 1XSVA 3DLCA 1B72B 2XSJC 2QTHA 1S4MA 1GZ3A 5CA0B 3ZWXA 4ZQHA 3IILA 4L6CA 4X8MA 3LHSA 3OZSA 1Z28A 3S2GA 3O47A 4EM1A 1NW8A 4X8HA 1Z67A 4HNUA 1VFPA 2XRMA 4BNIA 2Z9OA 1WKCA 2OB2A 3IBYA 3HM2A 4ON0A 2F3QA 3G2MA 3GVIA 3FVQA 5FUQA 1YL5A 2XZUA 5THQA 3NDIA 1OI2A 3DO6A 2RK4A 4I8XA 2FU5C 1BFKA 3JSPA 1Z6ZA 1M1NA 1PR1A 3ILVA 1SAXA 3RTGA 3NBMA 1MKMA 5CDHA 2CE2X 1NZFA 2ZTCA 2YS7A 1RLJA 1K89A 4LK1F 4KR3A 5LP6B 2WJZB 1PK9A 4IFBA 2KPOA 3IVAA 4Q82A 4BLOA 3BREA 3SAUA 1QJ4A 4DPLA 4UM7A 4RZIA 2BE9A 5LP1A 1NUUA 3L7YA 1BFDA 5K0FA 3OBBA 4MGKR 1VYUA 3GJ8A 4C06A 3GD5A 4Y1RA 4R9UC 3W9YA 2GXBA 1DJOA 5HE8A 3WJAA 4OGGA 4MS1B 2QL6A 1CTQA 3GQBB 1UT6A 4A0HA 4UVIA 5EJ5A 1KEEA 2BD0A 4LXIA 2VF7A 4ZMSA 2P7IA 4LX8A 1ZIDA 3JQ7A 4MITA 1VZ0A 5FAXA 4TUYA 4NU0A 1S02A 1HTWA 4BTLA 1U2SA 2UVDA 3OIGA 3O8CA 1U8CB 4X1KB 2E71A 3ENWA 3M70A 1V5IA 3D6HA 2LKSA 2ORIA 2NSJA 4JUFA 1U65A 1IY2A 2PLRA 3A10A 4CHUA 3V8EA 1LTHR 1DKOA 4QUJA 1DGHA 5LU8A 2GZHA 1NT4A 4W5NA 1X7YA 5AXBA 2R7FA 1IIBA 5LOVB 2V79A 5ELLA 2OAZA 1TJ5A 4GZ6A 1IQUA 2PH3A 2WHEA 3FTNA 1TVKA 4QU9A 1ISFA 4AG3A 3CVWA 3HRIA 5IDYA 4D3DA 4XJVA 4BP9A 3IA7A 4XR6A 4C4AA 4X41A 5KC9A 2HZDA 5JECA 3TOSA 5ARDA 5SZKB 3P71T 3WOVA 1G6HA 2FWBA 3WTWC 2GPSA 2JKYA 4EABA 1LDGA 2V03A 2HPAA 5D7BA 2OBXA 1SC3A 2O7QA 5DIFA 4AY2A 2VPWA 2O5EA 2QORA 3E9ZA 4Z49A 5ENDA 3GFMA 1PW7A 3HOUJ 2OUMA 1GZVA 3BTVA 3H35A 2VKQA 4M9UA 1ZIPA 4U7TB 4IIJA 3T7KA 2PU7A 2PKYX 4MRAA 3TNDA 1IQ0A 1DRUA 1ZKMA 4LBVA 3IQGX 3WRXC 3BWXA 3GNSA 3K70D 4K1XA 1ZLKA 5REQB 1JLHA 3EXEB 1D0KA 3CQ9A 2QX8A 3LSJA 4LMYA 3U0VA 3A37A 2O0KA 1J9EA 1G20B 3IIJA 4N40A 3LDAA 4LF8M 1FTTA 3PF9A 5LZ4A 1KEPA 5KYNA 2VQDA 2D5VA 1BXRA 2CVHA 2Y1LA 1XVAA 3J81A 4UTXA 3DMNA 2A4MA 3AUKA 4O5VA 3F74A 4X91A 3OO0A 1G9TA 1A1VA 5F3WA 2EQRA 2KZSA 4B7AA 4CSWA 4WXDA 2STTA 1W25A 3IOEA 1XN7A 4BVFA 2ZBGA 3U1TA 1HKSA 1JQ3A 1LNWA 3RGSA 4V1CI 1H5QA 1CHNA 5TT1A 4LZWA 2KIMA 3ZJYA 2KLOA 4KFUA 3TFQA 4M0WA 4AI6A 1Y0NA 3MMXA 1ZRCA 4ER6A 4G8XA 3PRHA 1RD4A 4US2R 4LV5B 5FEUA 3FSEA 1H23A 4E70A 2EKPA 4XKVA 1E3WA 3DZDA 1Q39A 2CRGA 4AYXA 5JW6A 2FSIA 3C2BA 1I8TA 4H0CA 1KFJB 3P4UA 3MRSA 4NHOA 1SKUA 4HDKB 2MINA 2R7OA 2AN5A 4JJGA 3U62A 1IATA 3NT5A 4JOSA 3L82B 1PZMA 4LOIA 1EBUA 1JI8A 2HA2A 3U44A 2FSVA 1VDZA 4MLCA 1NZDA 1Z25A 4KX5A 4YUAA 4E7ZA 2Q0HA 3GUHA 1X3UA 1R37A 1V0JA 3S1AA 4ASNA 3L2CA 2DAIA 2DY0A 1ID1A 2DBZA 2X42A 1B8IB 1IHDA 2H3HA 2XTJA 3OE5A 5F9FA 4K2AA 4BJ3A 4IOAF 1KOJA 4P5OA 1F4VA 3BJEA 3QQAA 2EKZA 3WIBA 3T9BA 2GQQA 2IY8A 2PLYA 1QVZA 1USSA 3MEXA 3BWEA 3GG2A 2JBHA 4XIIA 2ILVA 3GQ3A 1OV6A 2PEXA 2YU3A 3OMXA 3U4GA 2OC6A 1QDEA 3TDNA 5FGMA 3CP8A 2P65A 1XPOA 3BTJA 3PIRA 3U7GA 1M34E 4PLVA 5AHRA 2AD1A 1V8FA 1DKMA 3IS3A 1CQWA 3QTLA 1L5FA 3FGNA 4MJLA 1JKJB 2Q5EA 1F2TB 2QQ8A 4LXQA 3FHJA 1V16A 3CW8X 5CBPA 4P53A 2WU1A 1DQUA 2BWJA 5K20A 5CFQA 5HKBA 2G9UA 2Z56A 5CTJA 3A2KA 2M34A 2WAOA 2KL4A 1KONA 5FKKA 1MZVA 3I4FA 4BQQA 1SY7A 4GLLA 2DUWA 4PFPA 4ZQGA 3L4JA 2GCIA 2QN9A 3VAYA 2JHGA 4N0MA 1L4YA 3S40A 1VIDA 4H6PA 5D2CA 1IHXA 3P2KA 3WFJA 2IGMA 1Z07A 4JLWA 1ZG1A 4BNXA 4ARAA 4YRBA 3LK7A 4U7BA 3S14J 3K9QO 3B6MA 1E0KA 3PNPA 3AX6A 2JASA 5FUMA 4YC7A 5JJLA 3TTVA 2EA2A 3TPCA 1PF7E 2YS9A 3GFIA 4EHDA 4NEHB 4JYAB 3EJWA 4H4CA 3LA7A 3HCEA 4OGFA 4M8SA 1DHTA 4NF2A 2E7WA 3GN1A 5CA1A 4IHQA 2OXCA 5KQRA 4YO8A 1VL6A 3LECA 4CIWA 2WYHA 2ZJRF 2EGGA 5C34B 1E3SA 3H18A 1AGPA 1E9AA 4DCVA 2DB3A 4KPYA 3PITA 2OLKA 3MZYA 3KVVA 3KP4A 3FF1A 1KJNA 3BTOA 2FKNA 5J2TA 5TQ0B 3DP7A 1JQJC 4FDMA 3DCNA 4NENB 2R93J 1Z82A 4BMSA 4RPIA 5FUXA 4NEQA 4P3XA 3SEQA 4EUHA 2HTFA 1PRYA 3AM3A 4X5OA 1IHUA 1N6RA 1WUHS 2XCRB 2JLWA 4MR7A 1RQNA 5B55A 1HFEL 1R4NB 2J32A 2FZKA 1YQEA 3ZWMA 3WV5A 2EFHB 3EDMA 1A9YA 5KJEA 4DR1B 3GJ3A 4HNGA 1PJBA 1O8CA 3UK7A 3RZOJ 1POXA 3ZJ5A 4GGOA 4N7MA 1T4MA 1JTVA 4G4JA 4B3JA 1KMMA 4FWBA 1G8FA 2ZVQX 1ETOA 2PZFA 1BJAA 4QOGA 3FMVA 4LMBA 1L2BA 2WKPA 4CEJB 2M2EA 4YRRA 4CZCA 3ZE9A 2ZRFA 2V58A 4IRMA 3KEFA 2MLKA 4D8WA 4RQBA 5JS8A 3AAFA 2B7CA 4IXAA 3A4NA 4OBXA 4B9EA 1P3DA 3NHWA 1O03A 1OBHA 4MH0E 4R5MA 3L5OA 2BTQA 1JAYA 8MHTA 4WK2B 1UDBA 3K0BA 4QGSA 5GONA 2GSDA 3AFGA 4O2BF 3PD7A 5ALOA 1MPXA 4HV5A 5TS2A 4BBRJ 3CH5A 1LD3A 4HYTA 2H1KA 1WOMA 3VVLA 1I7QB 1SCIA 1U4NA 2C1ZA 3GRKA 4MM3B 5DHUA 4C0HA 3C6ZA 4DLUA 4TYYA 1PNOA 4X3PA 2JBAB 1FX0A 1OIWA 3P2JA 4EX6A 1T4CB 4PZAA 2TMKA 2VQCA 4O4IB 2CJWB 4KDFA 2Q1YA 1E8NA 2GPTA 3ZD9A 2IAIA 3G2BA 4CCWA 3BQNB 3U5ZA 2ZRAA 3CZ9A 5FKJA 4B31A 3TGLA 1SUWA 1WVRA 2VBYA 2VBXA 4N4NB 3FVWA 2X86A 4H17A 4F9TA 1WSBA 1TJ4A 3ANYB 5TPWA 4I4TF 3UW1A 4B81A 1UFZA 3RTDA 1NVTA 1X7WA 3ZQHA 4P0TA 5AKLA 1X1AA 1U0HC 3LC7O 4B3GA 3ILSA 4FOOA 1UJ2A 2VZ0A 3IRQA 1PCXA 2VAWA 3AIKA 3TSAA 4N3NA 5AK5A 1PP7U 4HGZA 1FFWA 2GFQA 2ZT5A 4QZVA 1P5JA 4DLLA 1PGNA 4B5KA 4R8LA 5HR5A 3RT7A 1WULS 3AHEA 4TT8A 5B36A 4XGNA 2M6LA 3QAUA 4K6GA 4P36A 3IXLA 2XQJA 2HLNA 3QMWA 2IT1A 3WHLA 2RH5A 3NOOA 5KYYB 5K7FA 3VC3A 2BWBA 2V6GA 1ISPA 5IC4A 2X13A 3I73A 4TZ6A 4ADSG 3RVSA 1CUUA 4J2TA 2ZUBA 4Q66C 4B35A 3KP6A 3W5IA 5EXXA 4QXMA 1F06A 1DV1A 1MBZA 3OOJA 1JG7A 1FE8A 3WYFA 1XJWA 3HKPA 4CM4A 3W2HA 4A5MA 3ZMZA 3UPUA 1RAHA 3FN4A 1EFHA 4WH0A 3I8XA 1E2KA 2M6RA 3UNXA 1MA0A 5BV2P 3CM0A 1EZ1A 3IPYA 1MW7A 3DULA 1JHUA 2P90A 3AG4H 4QVIA 1M0TA 2CMKA 2V4ZA 4EG7A 4X66M 3V3TA 4EF4A 3KJQA 4EVIA 1PDWA 3QKSB 1ZGAA 1OT3A 3GJ0A 3RS4A 2H1CA 3UK1A 3ESYA 1Z8DA 2PEZA 2PQ8A 1YJXA 3WRWA 2HFKA 3A9CA 4I1UA 3SR3A 3PV0A 3H9JA 2X9NA 2H85A 1BJTA 3B89A 2D0IA 5LWHA 2FQWA 3R44A 1Z33A 3RKRA 4IJVA 2QMYA 2Z2ZA 4L27A 3DVLA 4EVQA 2QGUA 3JAMZ 4XPIA 2P6PA 5ICSA 1YRHA 5FQNA 4CM3A 5E1BA 1KZHA 3EQ2A 3NONA 3CCMI 3FI0A 3HCRA 3KLNA 1B8PA 5D5QA 4IRUB 4C6SA 4M1ZA 3NVMB 2XB2A 5H5JA 1WXGA 3MA0A 2D2WA 1Z75A 2X4LA 3ZU6A 4JI5B 1OY1A 2XB4A 2GAFA 3CVOA 3VRHA 1Y1KE 3GFBA 3PT9A 4Q9NA 4UMEA 1JEYA 3C8ZA 4Z7QB 4NYJR 4JP0A 2HMTA 1R0YA 4Y6LA 2Z6VA 2GS9A 3HL4A 1NZJA 4EDFA 3R4VA 1OIPA 5JWHA 4XOTA 4L0MA 4WMLA 3H0DA 4UTVA 4HRIA 5CM2Z 1MB9A 3IEPA 3W2WA 1M2VA 1C29B 2CFXA 1Z6AA 4NDAA 2M9MA 1TGYA 3WP1B 5LZ8A 2RI0A 3DKRA 1BS1A 1G2HA 2W85A 4IIUA 3DAFA 1OE0A 4J8PA 3OLCX 3CISA 3L7AA 1KHTA 3BSWA 5LEJA 4UZFA 4IQ8A 2P78A 1RWOA 2XDWA 3R0VA 3HE3A 1VMAA 2JIZD 4OQNA 4K81B 3RYHA 1MT3A 1ZSNA 2LG4A 1WZUA 4ZQIA 4Y6OA 4YLEA 2OOSA 4IJAA 1TE2A 3G5TA 4EK9A 2DR3A 1V96A 4M0UA 2NXCA 3ABTA 3OYLA 2F4MB 2WWXA 1L6RA 3DWEX 1AM4D 3GF4A 3GZ5A 1TL7C 2F8SA 4Q7KA 3BCAA 5KKCA 3B7NA 1O3YA 5LHGA 1FP4B 3T7DA 4Y2SA 2O3JA 2P6OA 2IH5A 1FSZA 5DI9A 2QNBA 2EILH 4M6WA 4Q21A 1K7XB 1L2DA 2ADFA 3BJZA 4N18A 2ZJ5A 1J5EM 1V9CA 1JE0A 3TW6A 2AJDA 2B5OA 3E2MA 4MQ6A 5B3JC 1NHGA 2BGIA 1Q11A 1WH7A 4KOEC 5FYDA 4ESJA 4XRRA 5C8YB 4QX6A 4HZGA 4XCVA 4FK8A 4G09A 5AP9A 1VGRA 2IDMA 4L9NA 3OJWA 3RHFA 1IVYA 2C57A 2HXYA 1EJBA 4FT4A 3E48A 3QMMA 5B7NA 3CZPA 3L6CA 3QYFA 5IJ9B 1V35A 2OSVA 4RU1A 5BMZA 3S15J 4HVTA 1WZCA 1RAIA 2PUTA 1FP7A 4EFKA 3WMEA 3KL2A 3G6KA 3VOTA 4QYTA 5E7JA 3KQOA 3U3JA 3U81A 4FZJA 5FJJA 3M4YA