2FNAA

Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
357
structure length
352
Chain Sequence
GMLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIMSGSEMGLLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSKCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel archaeal AAA+ ATPase SSO1545 from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Atp-binding protein
molecule keywords Conserved hypothetical protein
total genus 128
structure length 352
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01637 ATPase_2 ATPase domain predominantly from Archaea
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2fnaA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fnaA01
1SZPA 1DG3A 3OHMA 1KYWA 2L4MA 3W6PA 4LI0A 2IYWA 4IFBA 5KSYA 1IAQA 1DAHA 1W1WA 2ZR0A 1D6JA 4ESBA 4C0BA 2P5LC 3KQHA 4C0JA 4DLZA 3GW2A 1MRSA 4LPSA 3TKYA 4CT5A 2DWZB 4WXRA 4OHWA 1NRJB 4IFEA 4JIMA 3FKSD 1JALA 4QHSA 2E9SA 1BN5A 1GNPA 4R2IA 1E2LA 5HTKA 4OINF 3HPRA 4MGRA 4I7HA 4UVAA 2NQ2C 4M72A 1IN5A 3P7NA 1YZLA 1SMYF 1VIAA 2ZIAA 3CX7A 2WWWA 1P72A 4ASUD 4HF2A 2P67A 2ZSAA 3ELKA 1UBCA 3GFTA 4MKFA 4A2QA 4LHWA 2GXBA 2V54A 5EJEA 3NBYC 2ZNYA 4XD7D 1SXJD 5E7MA 1VTNC 4A1FA 4ZI3A 4DUGA 4Z1MA 1H8ED 1M7HA 2BMEA 3GLIE 3K0SA 1M8PA 2QM7A 4EFLA 4O2RA 3QXXA 4Q4JB 3MQ0A 4C7OA 2L02A 3RS0A 5C18A 2FU4A 4AG6A 5JBQA 1EWRA 1XGOA 2PJRA 4M9ZA 1F9NA 3GEIA 3OAAD 1XMVA 4IDPA 4AIJA 1E3MA 2K4JA 3FXUA 4IW3B 2YWHA 1GVNB 1Z22A 4LBZA 3BPVA 2G1KA 2GWHA 1FX0B 3H86A 4DB2A 1SVIA 1VHLA 4Q48A 1ZRDA 2EVWX 4WVFA 2VE8A 2WSSA 4DSUA 1NLFA 4URYR 5FR1A 2Q21A 3Q8XB 3UG7A 4JYCA 1P2UA 5DI9A 2ZAMA 3SEAA 4RB3C 4OHYA 2VRWA 3NBFA 4C0QC 1QHYA 3GX4X 1FPMA 3I8XA 2OO7A 2REOA 2G7UA 4UUVA 4UNSA 3FKSA 2AS5F 2IYYA 4IXMA 4JZKA 3THYB 2G0NA 5BS6A 4PANA 4ZYGA 3E6MA 3HRTA 5D4SA 1JPNA 1DUXC 2J7PA 4OQFA 4RKFA 3ADDA 3KXKA 3T5XA 3PG5A 4IOJA 2ECKA 4P4UA 4B44A 5KTYA 3SZPA 5J4HA 4TSFD 4RGXA 4YIIA 4HDCA 1WB9A 3C14C 1RE0A 3F8CA 2VC0A 3IRRA 2VSXA 5FL7A 3WU1B 1Z63A 2GJ9A 2XASA 1KI8A 4UHTA 1KGDA 4WZ6A 4TMXA 2C95A 1ZU5A 2QTFA 2XSZA 3U4QB 4P0TA 2PMUA 4FWTA 2A6HF 4GGGA 1L4UA 1NN1A 2O0JA 4JN6A 4WF2A 5FH9A 1WBBA 1E96A 3M4YA 3CF2A 1W46A 1CS4C 1G20E 3HIFA 4D0LB 2JLWA 3WMEA 5FLXZ 5GJVC 2UXNA 3QPTA 1KHTA 2W2VA 4H9GA 2P5SA 2MSEB 2WVJA 2YWGA 3GLFE 1I27A 1R1VA 2CEAA 1XJQA 2WOJA 2ZSEA 3VLFB 3BORA 4XSZF 4RD0A 4JLVA 2C04A 4Q03A 1LF0A 1SQ5A 4BYYA 2ONKA 2DFKB 1B9MA 5H1YA 3HUGA 5IRCD 5E18F 3BFXA 2K7LA 2PEZA 4G5SA 1HY3A 1T9HA 3X1YA 5FPYA 4B2LA 2CCKA 5FTJA 5FBQB 3NWJA 5KNBA 1F4KA 2IYQA 1D9XA 2VF7A 5FTMA 1LQ1A 4CEHB 3F8FA 1DELA 2HKXA 1Z6TA 1W4RA 3CUOA 3HTSB 3KFVA 3MWMA 5FFMA 3JZAA 3T1BA 5FOSA 1KKMA 4V0LA 4HOBA 1T2KA 2BC9A 4JKYA 3IO5A 2Z99A 4M0LA 2A69F 3U3RA 1JB1A 1YFHA 2WOOA 3Q5EA 2OXCA 3Q72A 1FMJA 1KU3A 2OLKA 5BPDA 3B7GA 1JXSA 3PITA 1WRJA 3QKUA 4TLDA 4MKIA 4P33A 2OZUA 1AS3A 2P5TB 2ZRIA 1PUEE 4KYUA 4O25A 4DDVA 1TU4A 3C1DA 1XEWX 2EWVA 2P5KA 3IIKA 3JVVA 2QPOA 4GO1A 5TVKA 5JHGB 3G73A 1KY2A 1X8LA 5BXQC 1SGWA 4WXHA 1NVVQ 5BYJA 4MRSA 1UF9A 2XVCA 2JDID 3NEYA 2QZ4A 2JCSA 1LDKB 1Z2CA 3A4MA 4TMKA 4AURA 4Q9IA 4BHPA 4ZYEA 1YG2A 3CH5A 3ZS8A 2ZVPX 4JLNA 4IKEA 1YU9A 3BS4A 1XEXB 3C41J 4BASA 4HAXA 5EE9A 3WGHA 1DE0A 1ZD1A 4BZXA 3DKPA 4UXJA 4PO8A 5EXTA 3I72A 1QHNA 1XWIA 3R60A 5AUNB 1W36C 4BLRA 2DVWB 1GILA 3SZTA 2G83A 2OQGA 2P6SA 3T61A 3K9GA 4MKHA 2C99A 1Z0DA 2AN9A 2ZSFA 1R00A 3WP1B 4ZKDA 1W7PA 2OZ6A 2XROA 4ZDIA 4P96A 3AGQA 1Z3IX 2NGRA 4QLCU 4LBWA 1U9IC 1ZG1A 2J0UB 2TDXA 5LD2B 4DCSA 1D8JA 5EE3A 4EJOA 2GJSA 4HV5A 2J7KA 4Y0AA 5J5CA 1ODDA 3GLGA 5LDDC 1NVMA 1N3BA 3OIUA 4LJAA 3S1AA 2L01A 3E5XA 3EUHA 1I4DD 3DOFA 1P4WA 1QVRA 1MDMB 2E1RA 2FFQA 3OEHA 4LG0B 3RAPR 4WX9A 3JAMZ 3CRW1 3IL2A 3ND9A 4WA7A 5J4LA 4Y15A 2XKPA 4M1SA 1E9AA 3QU6A 1VECA 1L0OC 1EV7A 3DKWA 1USSA 2RVCA 1N5LA 2OLJA 2PEYA 3GO5A 4G7OF 4FW9A 2ANBA 3F3YA 4UNRA 4URUR 1PLLA 4N9IA 1P3JA 1P7CA 1YIOA 2PFBA 5K8UA 4OJQA 3H3ZA 4KITB 3GLXA 2JT1A 2JASA 4HB4A 2O0YA 2QGZA 3E2IA 4PGHA 1TQPA 3V7RA 1YZKA 4V0KA 1XB4A 3QOPA 3WODF 5FBRB 2P0EA 3TK1A 5EQTA 1XNJA 3K70C 4G6QA 1XSDA 4BXUA 3J81k 3LA7A 5EUMA 1ZM9A 3QJYA 3KP7A 5L3VA 1GDDA 3IHWA 2ATVA 3KZYA 1XZQA 2V1DA 4CYMA 2ZETA 3IRQA 2LSOA 2BGCA 4L5JA 1HYQA 2B7CA 1W0KA 2XZPA 3QVUA 1C9KA 2H1LA 3TDZC 1YHNA 4S35A 1U78A 3REGA 2AXNA 4RD3A 2VP5A 4R9UC 4JVNA 4EQ6B 1VMAA 3R8FA 2FRHA 1YZTA 1OW3B 2FOKA 2VQSA 4B3CA 2HQRA 1BJAA 2V79A 1Z2AA 3SQXA 4Q4HA 2O3FA 3K9LA 4WZBE 3D5LA 3F72A 2IPQX 4PC6A 2GZHA 2ZRJA 3EG5A 3U61B 4QFMA 5DI3B 3WMFA 1P2SA 4D4LA 3LAJA 1O3QA 2HEIA 4HSEA 4GT1A 4PZLA 1XGMA 4HLUA 1YW9A 3ISPA 1Z0KA 5D5UB 3MEXA 4A15A 4IJAA 3PIRA 2H17A 1G6NA 1S6LA 3BWDD 4GP7A 4NE2A 2GXSA 2Z4SA 1MRNA 5G40A 1T4GA 3CB4A 4Q1DA 1QHHB 1E2PA 1B9NA 3BJ6A 5ELXA 3L9FA 1NVWQ 4NYMR 4UXNA 221PA 2H92A 1T39A 4QGAA 2HDNB 3R9IA 3ECHA 3KZ1E 2OEPA 3FB4A 3IKVA 3QOFA 1JXOA 5FBWB 2GZAA 3PENA 3WBKA 1TUIA 4M22A 1KK2A 3W6KB 1E2EA 1MKYA 2IEZA 2OFOA 2GIVA 4JQFA 3FYHA 3W3ZB 3SYLA 4MA4A 1EFRD 4B2IA 4D4JA 1UHMA 2XAUA 1LDJA 2DBBA 2QQ9A 1US8A 2I3BA 4YDSA 3ZIAA 4AG5A 5C2JB 2D45A 5HOOA 1MABB 2QGNA 2ZS8A 2BJVA 3FWYA 4DJTA 4LB5A 3TSZA 1W4MA 5J6XA 1TADA 2ZJOA 4Q4AB 4BLOA 2HYIC 2YSRA 4EQQA 4JBWA 2IA2A 2HT1A 1Z6YA 2WICA 3RRYA 4DLWA 1U5TB 1BYIA 1IJEA 2QI9C 5CK4A 1LNZA 5A0FA 2A78A 2CK3A 2KBFA 1MDMA 1BM9A 1NBMA 4UQOA 3W6OA 1PZNA 4YMUA 4WZAE 4ARZA 2I1QA 3DZDA 2X8AA 1WWXA 3V8KA 1P4SA 4IDOA 4YG2F 4U5XA 5DUIA 2DLLA 2QBYA 2K02A 2P65A 3L7WA 4MYCA 4X8LA 3HSRA 3SZRA 1IXZA 4ENMA 2J0UA 2PJZA 1JAHA 4P4TA 1N6KA 3X1XA 4HLDA 3R20A 3SR0A 2CW0F 2ZRKA 2BE5F 1QDEA 3BIFA 3EETA 1JJ7A 3BB3A 1QZZA 5HDGA 5B64A 2VHCA 2Q8KA 1K6OA 3REOA 1RRFA 3VFDA 1C1YA 3NBXX 2CNWD 3PV0A 3CPJB 4HDOB 4D4MA 2PBIA 4E22A 1J0RA 3HSFA 4L16A 5JI2E 2M30A 5CVIA 2PI0A 1OKKA 4MKGA 4PHHA 2CCGA 4CEJB 2DYKA 3EZ2A 1GKIA 4LC1A 1Q1HA 3VKWA 1GVJA 3ML6A 4RGUA 1PJRA 1E1RA 3WE3A 2EA2A 5ED4A 2KB0A 4E70A 1GITA 4Y0VA 5D8LB 3D0SA 1WRBA 3GUDA 3PUVA 4OHVA 3CUEF 5TB5A 1COWA 3NDBB 1FNNA 1F2TB 2F1HA 1ZM7A 3O2PE 2G77B 1XFAA 3BJOA 3DPLC 1FMLA 2ZI3A 2EV6A 3T8RA 4DSOA 4PDKA 3QP6A 1XD8A 2OU2A 5L3BA 2MSCB 3FMOB 1LTQA 2GAOA 3BFKA 2VP6A 1N6NA 5E7IA 5LBIA 4PR0A 4EPWA 2ZMEA 1W48A 1JXMA 4QM6A 1RZ3A 2CHGA 3MWLA 3B1ZA 2IYUA 5DYIA 2ZKZA 1NKTA 1KNXA 2RKOA 4KN7X 1T3HA 3DQVC 2EWWA 3BB4A 3CRVA 4B71A 2D1VA 5AIPA 1CR4A 2A68F 4TL7A 1FP6A 1NVVR 3B1XA 2J5OA 3KJHA 3PUWA 821PA 5JMTA 5HCNA 1HSJA 1P92A 1O57A 2ODNA 3AKEA 3BGWA 1SXJB 1NG1A 1ZC3A 2WTUA 3ZQ7A 1SAXA 4TLBA 3TO9A 3LSTA 3MD0A 4KVGA 2O8CB 4AI6A 4HEJA 1J8MF 2O8CA 4BRUA 4M9SA 1DAKA 1KOFA 2Y8EA 4HYYA 2ATXA 1CRQA 3DKVA 4M1MA 3GD7A 3WBJA 1TEXA 4D0PA 2A5YB 3ZMSA 3J80K 5GADl 4G3XA 4JL5A 4M1YA 1FWZA 3LQRA 1XPOA 4KYWA 3FMQA 1GZSA 2V7QA 2QENA 5HLIA 2EYUA 2AFHE 2ZYWX 2C5LA 2J9RA 2XEXA 5CM8B 3K8YA 4TYYA 3I53A 2IA5A 1TTYA 3QU3A 2QPAA 2F9MA 2KIUA 5CLLA 2K4BA 4OHZA 2DO7A 2QMHA 3NRVA 2ESHA 2IYRA 4NCJA 4Q7JB 3MLEA 5AUQA 1NG9A 2Y75A 2WMOB 3WY9A 4ZI2A 3QRFF 2XXAB 1XXHB 4WXDA 3BBPA 3IUYA 4Q4LA 4R1HA 4Q9LA 3CDHA 3WGGA 3QXSA 1YVDA 2W0SA 1J99A 1SULA 5TRDA 2WKQA 3QKSB 2H6CA 2H8KA 2KSQA 3TE6A 1E6CA 3GEHA 2HOEA 2LKPA 3OIVA 4IVPA 3UMFA 3QKTA 4K46A 5FFZA 3RANA 4B3DA 2OD5A 3VEPA 4OK6A 1MGTA 1G16A 2P6RA 4L18B 1JJVA 3HPQA 4XVUA 1AS0A 4DIEA 2OBPA 4IHSA 4PHTA 5ILUA 2WJGA 4AIKA 2BHRA 1KI7A 3KP2A 2ZUCA 4V0OA 3T1TA 1FZPB 2Q0OA 1NN3A 2H6BA 2JIZA 3THYA 2C8VA 2GEUA 3CO7C 3KJIA 5FUXA 4HAVA 2PX3A 2X0LA 4MTEA 3K0FB 1ESNA 5KUTA 2VC1A 4A0ZA 5EEHA 3TLXA 4L9WA 4JL6A 1M2OB 1CP2A 1ULYA 2Z6VA 4A0GA 4BQSA 3N2IA 5EXSA 1TW3A 1W0JD 2ZI4A 3BJIC 5EZ6B 2FPMA 1DAGA 3R6SA 3F22A 4MDEA 2VOOA 2V7QD 2QBYB 3QNUA 1B6AA 1AGPA 3QIAA 2O8FA 1XMAA 1YZNA 1S8NA 3L8YA 3OEED 4O5VA 2UZKA 4ZKEA 1G64A 1IY1A 3HRSA 2R3SA 1ETUA 1N2CE 1WCV1 5CM9C 5EE1A 4DNCA 3TGPA 1J59A 4QGFA 2IYVA 1OH8A 4RB0A 4A0YA 3ECOA 4ZYHA 4QWQA 4JLMA 4LJ8A 3GZ5A 1RC8A 3PEYA 2CMKA 2NO1A 4EPRA 1M6NA 1DP7P 2X1VA 4L9JA 4C7OB 1ZUIA 1R7RA 1D5VA 4G5GA 3DEFA 2JATA 4LHYA 4NL4H 5D4RA 3ECCA 3NBZC 3K09C 1YJ5A 5M04A 2BMDA 4QJ4A 2GTPA 4UXIA 1B0UA 1N0UA 1GWNA 3OE7A 4FWIB 1RRPA 2XTZA 3RI4A 5L3GA 3BH0A 2QSYA 4AIIA 1N0WA 4B48A 2WIAA 1II8A 1OB2A 1DPFA 3JTHA 1P9WA 1EK0A 3EC2A 4PAMA 1MO5A 3R0AA 5CB6A 1G5PA 1LF5A 3SHFA 3GFOA 1G9XA 4EKDA 4GOJA 2QORA 3DHWC 3W8NA 1RPZA 5F98A 3I62A 4ZIRA 3TO7A 1E99A 2NNNA 1G8FA 4RY2A 1R58A 1U0HC 2C77A 2QPTA 5AJVB 2VBZA 1MKMA 4CZZA 1KDPA 2FE4A 2QMOA 4MRNA 4MRPA 1M74A 1P2FA 1SVWA 1UCRA 2CL7X 2ORWA 1LV7A 2PCLA 4OQXA 1RRCA 2W00A 1KYIA 1B1BA 3L0OA 1XTSA 1NF3A 2IYLD 4MQ9F 1S7AA 3NC0C 4Q7LA 3X1DA 1GNRA 4JKIA 2R6DA 4QBIA 2JTVA 2YV5A 3MHVC 3HOSA 1OYIA 3V8JA 3LBHA 3MWKA 3CLOA 1S96A 3ROUA 3QEJA 3L0PA 3OFND 1XP8A 4EQ6A 2ZUDA 4YXWA 2FFHA 5J47A 5IF9A 2P5VA 1BO6A 2F5DA 2ZREA 5DGXA 4Z51A 5JZVA 4HDVA 1U8YA 4M6XA 2D2WA 3V00A 3LVRE 1XPRA 2MH9A 5E8IA 3U2RA 4ZCLA 2XXAA 4M73A 5DD8A 2GHIA 3TIFA 3IBYA 1MJAA 2E1NA 1JQLB 2Z3YA 3EA5A 4US2R 1W4AA 1BI1A 3NVAA 3AUXA 4R2HA 3CR7A 1OXXK 2GVZC 3FVQA 1SD6A 2BM0A 1ELOA 4KIBA 3TO6A 4BLQA 4FMDF 5KDLA 1O87A 2Z43A 1RW4A 2ZRLA 3BB1A 2F5EA 3MCAA 2EFCB 1NIJA 1T91A 2Q9AA 2FZ4A 1E9SA 2VN2A 3R8CA 4GNKA 2QTVB 4O0MA 4RAZA 1XEWY 3AEZA 4S2EA 5A2QK 2OG2A 2DPUA 4JT4A 4HX4A 2L54A 3IKTA 4DLYA 2WWXA 5JS8A 3ZDQA 2DT5A 3B9PA 3I5XA 4AVPA 1J9IA 4UVCA 1SXJA 5E8GA 1AS2A 1QHXA 2GKSA 3ASZA 3FPAA 4B73A 4EFMA 5CDFE 3AF1A 1S7OA 5LLQA 5AUOB 4HX8A 4IVNA 1R5OA 4B47A 2JPCA 1GUAA 4V03A 4XWAA 3C4JA 4GZMA 2ONJA 3O47A 4C4PA 3FHTA 4LMYA 1W7PB 4NYIR 1KY3A 4W5WA 2F55A 4Q66C 4P9UA 4TQUS 2GA8A 2BYVE 5HZHA 1W0JA 4AD8A 2XSZD 1R5HA 2HLDD 1K78A 3LWNA 3RS7A 2GWRA 3CX8A 2JLZA 2YZ2A 1KU2A 4F7ZA 1H9TA 1STZA 1LFDB 3Q5DA 2JJ1A 2YKGA 4EIWA 4KMFA 1OSNA 3WE2A 3QF4A 4GPTA 5CITA 1TAGA 4KODA 3CTAA 1D2EA 3W5IA 4EDHA 5KHOC 3QAHA 1F2UB 1R0WA 1SKQA 4LRTA 2H7VA 1YS7A 4AKGA 1DOAA 1O3YA 2A5GA 3W6JB 4WWCA 2IXGA 2O61A 2FNAA 2OCAA 2P6NA 1CTQA 4X8MA 3QF4B 5A4JA 4ILEA 3T5GA 3RRZA 1YRAA 2P3SA 1G3YA 4CEJA 3IILA 2HR3A 3B78A 3N4MA 5IT3A 2PCJA 3LV8A 5IDVA 1AQUA 2O0HA 1QGPA 2GK7A 1GHCA 3AVQA 2VSOA 4LJYA 1Q22A 1U0LA 3QPWA 3KE2A 2YYZA 1M34E 5JI6A 1P5ZB 3KL4A 1KGSA 1S3SA 3F3XA 1EFHA 5A2QZ 1ZNXA 2BV3A 3B60A 4MRVA 1Q12A 2C6YA 2GJAA 4LV6A 4C0KA 3BXZA 2IUUA 1KZGB 4G5QA 4Q00A 1N5JA 1JPJA 4TQAA 1W7AA 3QXCA 3FXRA 5BN5A 1T3LA 4PZJA 3V7SA 2IS4A 3PFIA 2PT7A 3AQ4A 4OMYA 1U99A 1BIFA 2FMXA 3B85A 3VMFA 1S29A 2AXPA 2F9LA 4P9FA 5CVUA 1G21E 2D06A 1WSUA 5HE9A 2LKDA 3K0AB 1G3WA 4KFRA 3GJXC 4ZCMA 4CYDA 1QZXA 3PQKA 1E2IA 3I61A 1IN6A 2V6CA 1KI1A 4MH0R 2CK3D 1HE8B 5DHAA 3X2SA 3KKMA 3ZS9A 2ODWA 4NPHA 3ZD6A 3CH4B 3MG9A 2MD5A 1UBGA 4LJ9A 2IXEA 3FTQA 1TF2A 4OOIA 3ERED 1X8KA 2CCJA 4KFTA 2F43B 2W6ID 2QP9X 4Q1AA 3M7GA 3JVUA 1MO6A 4DSNA 3F8BA 3NHAA 4F91B 4EM0B 2GA1A 2JZYA 2FF7A 2GRJA 4GFDA 4KJZA 1JR6A 5DCMB 5SZKB 4AYWA 2G9WA 1Z9CA 2D74A 2QP4A 1D2MA 3QG5A 3UKDA 3RDIA 1JAIA 2REXB 4OQLA 3Q9SA 4QG7A 3AVXA 3LA2A 1T98A 5FD5A 3VU9A 5EP1A 3B9QA 3ETLA 3C7JA 1IW7F 1REPC 2G6BA 3RDPA 3PEUA 1ON2A 4M71A 4RZUA 3M1EA 4IEEA 4UV9A 3B1YA 2PLYA 5K8TA 2GNOA 3DEUA 5LB2A 3TBKA 5JWRA 1L3LA 4UNPA 4ASUA 3AP1A 1ZCAA 1DEKA 1FP7A 4PSAA 2Z33A 4OYHA 3B73A 3F8NA 2STWA 1JEEA 5JEEA 1UFMA 3B8HA 2VT2A 1SXJE 3M8EA 1TQMA 1E0KA 1YQTA 1MR3F 3O8BA 1W2HA 3QEOA 4ESHA 4W7SA 1MZBA 1UB9A 2JRTA 1K8RA 1KNQA 4DUGD 3ICQB 1I4TD 1PV4A 4QRHA 4LPKA 4XBFA 1WMSA 2CGPA 4YIFA 3ZVLA 1SFEA 3DV8A 4MQVA 4I0AA 1XU4A 2HTSA 2J5PA 2DHRA 2XKOA 1CU1A 2UZ3A 4PC1A 4Q01A 4E07A 4NONA 4Q9JA 2DWOA 2DCUA 5G53C 3U44B 5TY0A 4TLCA 1VCMA 3VR5A 2O8BA 3Q85A 1XTIA 2MMGA 2ZFWA 1CGPA 1QZMA 1SHKA 1SVLA 3EXAA 5B2ZA 1F1ZA 3WP0A 4TYWA 2D1HA 3KQLA 4BFVA 4Q47A 3W90A 3N70A 1UM8A 3MSXA 5JHUA 1W5SA 2CLSA 3KKNA 3GFLA 1VCIA 3T1OA 1E2FA 3ZQ6A 2UXXA 3TGNA 2ISZA 3ADBA 5H8WA 1MJ9A 1FC3A 2J45A 2IYSA 2JA1A 5LBQA 2YC2C 2D7CA 2ZI9A 4EAQA 3GLFB 1XZPA 1OYYA 1Z91A 2XITA 2DFIA 1OV4A 1CRPA 121PA 4P4SB 1Z0AA 4ON9A 5JS7A 5J8CA 3AGPA 4NCNA 3Q7PA 4ESJA 1QHSA 4PPFA 1R5GA 3E5HA 3W5JA 2XRNA 2NTYC 2WJHA 4LSGA 1FY7A 2VA8A 1WI9A 3UATA 2Z83A 2QRZA 2EFGA 2GETA 2PLRA 2QUFA 1P4AA 1Z07A 1R22A 5JSZA 3F21A 5K8IA 2OE2A 1EH6A 3SFZA 2PN6A 2P6UA 5L8VA 3JSOA 1G4UR 4D4KA 4F38A 1F6BA 5DYGA 4U02A 2NIPA 3WGIA 1NBMD 1DPUA 4IVQA 4Q21A 4QM7A 4MUAA 2IC5A 1UJ2A 2ZVQX 3HYRA 3L00A 5HCIA 5E3HA 1DO0A 1IJFA 3TAUA 2BKEA 1P60A 4B6EA 5LRSA 3DL0A 1DG1G 1HW2A 1NIPA 3IIJA 4UKDA 2W84A 3K9HA 4CVNA 3AUYA 2YU3A 5HLHA 4D25A 1MOZA 1XPUA 1DVRA 5FUVA 4DCVA 4U88A 3GFPA 2CNWA 3AP2A 4NH0A 1KI6B 1RRGA 2GXUA 4DQ2A 4OMZA 4CW7A 4HF0A 3UG6A 1ZRCA 2JLYA 2HS5A 2WJIA 3RYPA 2ZI5A 4XIGS 2WHXA 4LX0A 3I0TA 2ODBA 3EPLA 4BPBA 5DISB 3FMFA 5BQ5A 4BUJA 2XOKA 3UWOA 5K5RA 2OV2A 3CUQB 2ZPTX 4MEYF 1G8PA 1N6RA 2OCBA 4XOIA 1HSTA 1ZJ6A 4FI3C 4LDJA 2IS6A 3CLVA 1K5DA 4G9YA 4EJVA 4TMVA 1ZP6A 1AIPA 4LJ4A 2BMFA 2QNRA 1OIXA 3BH6A 4V0ME 1J7KA 4KV9A 5F1RA 3I92A 3BZ6A 1ZGAA 1QQIA 2KJCA 2VHUA 4FN5A 4NKRA 3K09A 3GLFA 4GBMA 5AK0A 1JI0A 2NZ8A 3T0YA 1WBDA 3L82B 4KIFA 2XTNA 3MZHA 3UWKA 3W8RA 2ZANA 4CEHA 2HFHA 1KO8A 3V4GA 3RWOA 1R0YA 2OCYC 4PQYA 1IBRA 1Y0UA 4LBVA 2IYTA 4C0LA 3V7CA 1CJTC 2D62A 3EZ7A 4HAUA 4NZYA 3H2YA 3AJIB 5FLXK 3EPHA 2VE9A 2IHYA 3E70C 1Q1EA 5CYVA 1IRGA 4Y17A 1J8YF 4ESFA 2CWEA 1UKZA 3WTYC 4MHGA 1Z8FA 4GCVA 3KXIA 3U44A 2O8BB 4AWXA 1G3QA 2UWMA 5G3ZA 3GEZA 2ZQ5A 1L2TA 4A3VB 1OXVA 4OIPF 2QLZA 1SVMA 1TQ4A 3FKQA 2J87A 3KFXA 1U81A 4POAA 1D8TA 2D3WA 2ZMEB 3EDPA 3WU0A 4L9SA 2ZITA 3EWSA 4LK0F 5ILSA 1QHIA 2GF9A 1QBJA 3LX8A 5FGMA 1ZVQA 2XOKD 2VIIA 1EH7A 4RCYA 1W4BA 3QPUA 4AYXA 1IZ1A 3TUJC 1E0AA 1R36A 2D4HA 3SS8A 3BERA 3E6CC 1BKDR 2WTEA 4D0GA 3RRMA 1UEJA 5AIQA 1ZM2A 2QP3A 2EFOA 3ZN0A 4LGMA 1XSVA 4US0R 1LVAA 5E4FA 2ZCWA 3MAJA 4TLEA 4DXAA 1UFQA 2W0MA 3BWGA 4LBYA 3CBQA 3EZFA 3CWZA 2F5FA 4I1SA 3K70D 4LCBA 4Q9HA 3H3UA 3HOTA 2B8WA 3T1QA 2RGDA 4ON0A 5H70A 3V9PA 1FT9A 4EV0A 1YKSA 4GXOA 1FLIA 2JLRA 5GVRA 4BHCA 3ZJYA 5LRRA 4CZ2A 3U7GA 4PPNA 2UVQA 2XAGA 4BQAA 1E17A 4YFNF 1NLZA 3THXA 1YR9A 2KKOA 4BFTA 3SYKA 2IEYA 2HWVA 4RKEA 2GESA 2ZRDA 1Q57A 2KI5A 1KMHA 2KRFA 2A3SA 3D7MA 3K0AA 4RD2A 2LWIA 1T0FA 2FEMA 4HLUC 4TL9A 4DZZA 1XBTA 1VTKA 1R8SA 3E97A 4ITRC 3C5HA 4AK9A 1XGSA 4RZ3A 3AB3A 1LNWA 1V43A 3FMRA 2NO7A 2GQQA 4Q4JA 2F7SA 4Q1FA 2BV6A 3ZD7A 4MGZR 3HHGA 1ZBDA 1C4OA 5IK2D 4FIDA 3CO6C 3AVPA 4BECA 4G0NA 3RNLA 4I01A 2ERYA 4JJZA 3AAFA 1E9EA 4G6DA 3KKOA 4OBEA 5BN4A 3O8CA 2HT6A 1US8B 2ZSBA 4A0RA 4L9TA 1ZINA 1S1MA 1G6HA 3CRRA 1DS6A 1GAJA 1ZRFA 4JMPA 4NYMQ 2NO0A 1I6XA 1KO1A 2C9CA 4B3XA 5LEJA 4JSYA 2OBLA 2HKOA 4U7BA 4XD7A 4URVR 5FTKA 3RYTC 1GL9B 1OF1A 4LYJA 5SZIA 5DDGA 2GEDA 2V6ZM 1U6GA 1YW7A 1KK0A 1IN7A 2FGJA 2QE7D 3LY5A 3J81Z 2V55B 5TMPA 1E94E 4HF1A 2W6JD 4MYHA 4AY2A 2HYGD 1KQ8A 4XWKA 3EZ9A 2JLVA 3LA6A 3T8TA 4GP6A 3UANA 3IWZA 5L3FA 2IT0A 2FZLA 2GAAA 4ZPXA 2L4AA 2AHOA 2LKCA 2WSMA 3D3QA 1I2DA 3K0CA 4LK2A 3IPXA 4LC0A 2CJWA 3P26A 1KSJA 1W5TA 1NKSA 3DMNA 2Y0MA 1T38A 1O3TA 1EXMA 5DN6D 1OB5A 4LRWA 3L0IB 3LFUA 5DUKA 4NYJQ 2QSZA 2PX0A 3ZH9B 1JR3E 4HAZA 3GP8A 3B1VA 4A6DA 4YFKF 3KTAB 2WKRA 3K1JA 2ZS7A 3HYTA 4PC7A 5UKDA 1G5RA 2ZXJA 4BZQA 2F3RA 1W7PD 1A82A 2AD1A 1E2QA 3M1IA 2CL0X 3K9TA 2QT0A 4Q1CA 1FOEB 1G8HA 3ZP5A 1SKYB 2DWQA 3QE0A 1F60A 4IHQA 1NJFA 4IJMA 5FD6A 4AWXB 4B2PA 5KNDA 4KNYA 3GJ4A 3RTRA 4NMMA 3BY6A 3REFA 3T5DA 1FP1D 4C0SA 1HUQA 1P9NA 2E7XA 2C9YA 3NHBA 2OQRA 2HYFA 1CF7B 4LRSA 4H1UA 4DKXA 5D5WB 5D3MA 4JLKA 1TLHB 3R0JA 1Q1QA 1X1RA 4MITA 5H20A 1T0JB 3GWZA 3Q7QA 2EFQA 1OR7A 4IXNA 1TQDA 3R9XA 5CJ9A 4R8HA 2IX3A 4GYIA 2ZEJA 4FX4A 3BFVA 1R0XA 4B09A 5LPNA 1E2MA 4Q02A 4LJ5A 1U98A 5D8KB 5EP3A 2RGGA 1XMSA 2W25A 1T3SA 5HDKA 1R10A 4A6PA 2D7DA 1RUNA 2ZRNA 2Q3FA 3K1NA 3WTWC 2E87A 3F5FA 4HLQB 4KSBA 4A8JC 4OI1A 3BDDA 4L4UA 3HR8A 1FQKA 3U9GA 1E1RD 1UBEA 4Q9KA 5TARA 3KJEA 4P55A 4EJSB 1RKBA 2QUZA 2KRKA 4K2EA 1EFUA 2VSFA 2JGNA 1B4AA 5DE3A 3MJRA 3EW9A 1N5KA 3OIWA 1F5TA 2DFLA 2RHDA 1MO4A 3AVUA 1O7FA 3LLMA 4ERNA 2V8OA 2IBMA 1YW8A 1XCMA 2G88A 3IBGA 4CXFA 1LS6A 3GVAA 4M9XA 3SE0A 4E09A 4II7A 2EV0A 1UADA 3CRMA 4WOPA 1L4YA 2H16A 1AKEA 4EVIA 1LVGA 3AF3A 3KKQA 2E1CA 5JJIA 3MCZA 1HTWA 3QVVA 3DPUA 2ZRMA 1N25A 1YRBA 1CKEA 3U3JA 2VBWA 1UKYA 4BLTA 4GDFA 1G8YA 5DSZA 1BI3A 5SZHB 5GVSA 3AVVA 5J4KA 4FHTA 4KUMA 4PAOA 4IDNA 5DV5A 5DH9A 5KNCA 1XTKA 1P75A 1E2DA 3GLHE 4NCIA 2VONA 1FTNA 5EEGA 3L8ZA 5TXGA 4DSTA 2CE2X 3B02A 2BMJA 2EWNA 4XTCS 4A6EA 3T1VA 2M1BA 1YLFA 3SXYA 4HB0A 3SNHA 3LXRA 4TL6A 3GFJA 1HW1A 1YZQA 4R71A 3TUZC 2X77A 2DZNB 4M8NE 4QJ3A 3NEUA 3KZZA 1KQ9A 1ZARA 4OQNA 3DPTA 1CJMA 3LFKA 2GJKA 5LHGA 3P9CA 4HATA 4YXWD 3ABTA 4PAQA 5E95A 1J2XA 4P4SA 2AK2A 3VR4A 1OXSC 1PP8F 2H27A 2YOGA 1D5CA 4UXHA 1NY5A 3CR8A 3IEUA 2PJPA 1HW5A 3TRFA 3A36A 4GL2A 3CF6R 4PQRA 3E5QA 1HKTA 3WRYC 1SVKA 1RUOA 1E9CA 2NAZA 4L5BA 1CR0A 2QVOA 3K1MA 1UKEA 3RKXA 3RS3A 3ZLJA 5F9HA 1XD7A 5SZJA 2J0SA 5JFRA 1DO2A 2ZSDA 2XIGA 2QM8A 3OV8A 3KLNA 4QBGB 2O8FB 1KMHB 2AKAB 4A12A 1X3SA 1Z83A 2A30A 4RFSA 1NJGA 1AM4D 2N1BA 1KO5A 2GCOA 1QZYA 3DM5A 4Q7KA 1KO4A 4IRIA 2ZR9A 2ELHA 3ZZUA 1TL7C 2BEKA 1JR3D 2FA5A 2BJWA 3HU2A 3PQJA 4XLNF 2IRFG 1IN4A 1TMKA 2R9VA 3A8TA 1X3UA 4MGIR 5F2EA 5JI3E 1XDUA 1E0JA 1DBSA 3WTUC 3CW2A 4KFSA 1HKSA 3BROA 4U00A 1FZQA 5AJZA 2IP2A 2ETHA 2XAJA 1AK2A 2C03A 2NG1A 1ONVA 3VFZA 1S4QA 3THWB 4EGZA 1SMTA 1A04A 3AF4A 5D6FA 3BAFA 5FOWA 3KQUA 2XGJA 1G291 5FL3A 4Q7MB 3SJBA 4LB6B 3U4QA 1JBKA 3RSOA 1I1SA 4AD9A 4MYUA 3VHXA 5K5QA 1Z6AA 3K9NA 3Q3JB 1GFIA 2K5UA 4HUQA 2OSBA 3W34A 1V5WA 3I5UA 4JVLA 4NCKA 4EPYA 1LB2A 4G5OA 2F1RA 4PFSA 4LLGF 1VG1A 3U5ZB 2DR3A 2J41A 5LGNA 3EWAA 3KUCA 2FA9A 4M1WA 4TT3A 1ANKA 3TSWA 421PA 4U0VA 2C96A 3GLIB 3TW8B 1XXHA 5C4MA 1KMQA 2HZTA 4LD5A 2ZYTX 3SJAA 1FOKA 1G3RA 4WAUA 2WC2A 2ZAOA 1WKMA 1FBQA 4C9BA 3ND8A 1LS1A 1OXUA 1RJ9A 1ODFA 1ZG5A 3C16C 4B3BA 2IK8A 1OH5A 1GL6A 4DEYA 3U6KA 5L3QA 4URWR 3KX2A 3GFMA 1LW7A 2FN4A 3SQNA 1X8JA 5BQTA 4M2LA 4V0MA 3COAC 2FPKA 4BRWA 3HWSA 4FD2A 1VG0B 4KVAA 3U6BA 1BI2A 1CULC 4NDZA 3TOBA 5JJLA 2B0LA 3I8SA 4KU4A 4XRFA 1PLJA 3OF5A 1FBUA 2D2FA 1RFLA 2Z0MA 5L3EA 1BC8C 5LGTA 1TX4B 1TF5A 3BJAA 4ZDJA 1Z06A 2IJLA 3OOPA 1Z08A 1XDBA 2Q2EA 3QUSA 1NVUQ 2BBTA 1BH2A 2CVHA 5KU1A 2IUSA 2DPDA 3LBNA 4B76A 5CDFA 3VR3A 4TN1A 1U8ZA 3AM1A 3RLFA 3RC8A 1E9FA 1UEIA 4HB3A 2XNSA 2HTJA 3KEQA 1GXQA 1ZREA 2VT3A 2HXYA 1F3OA 3FXQA 3P32A 3SI7A 2BBSA 3OE7D 1T5LA 3R9WA 1YYVA 1JECA 3E5UA 4HX7A 5BMZA 3L0SA 4IOKA 4A5MA 1ZGJA 3AVWA 4S05A 2XTMA 2DY1A 2YWEA 4Q19A 3ADCA 2O8DA 4MEXF 1HA3A 1AA9A 4WK8F 3CUQA 2C98A 5FFXA 1IONA 3GMTA 3LW7A 4B3FX 4UVBA 3ZMVA 2ADUA 5CIQA 3KP6A 2RGNA 4MGYR 5HS8A 4OQMA 5JCPA 1B23P 4M53A 2WPDD 4P31A 1XD2A 1BOFA 2J5XA 3ZZ0A 2J3EA 2ZU0C 1Z6XA 5HPYB 4KLZA 1AWCA 2A2ZA 2WWGA 2XB2A 3AVYA 4A2WA 2CSOA 1U2WA 1S1CA 4JLAA 3I59A 1FP2A 1T6SA 3LH5A 1CJUC 5J4VA 1F2TA 3GXOA 4KFCA 1ONBA 1JGSA 2A07F 3P1JA 4M21A 5BPIA 2ZRPA 3BP8A 4OJKA 4KIGA 2QAGB 4HZUA 4YMSA 3SOPA 2YHSA 4KBFA 2ZM5A 3F23A 2HEOA 1ZN2A 4RD1A 2KIFA 5EP2A 1K6MA 1G3TA 2EW1A 1R1UA 2AXLA 3MMPA 4EPVA 2WWYA 1YR7A 4QHTA 4A9AA 1K78B 2CHQA 1ZYRF 2VXZA 2WWHA 1E2KA 3HYIA 4KFUA 3TUIC 2P2LA 2EA4A 1SVSA 1ZC4A 3THOA 1ESMA 1JE8A 1VCNA 3U2QA 3IDQA 1S2MA 1VDZA 3DXJF 2VP2A 2VYFA 4TYPA 4YQFA 4D26A 3R4KA 2XZLA 1QVAA 2GK6A 1SXJC 3LD9A 4PSKA 4W5HA 4PQFA 1S9HA 3LX5A 4RVCA 4J0QA 2ZNZA 3PEVA 1P61B 3LQQA 1Q1BA 4LJ7A 1FNMA 2ORVA 2RCNA 3SBEA 3ZGXA 1ZAOA 1ZG3A 1G8GA 1R8QA 4NB5A 1TF7A 1GKYA 2GJ8A 3CNOA 2CG4A 2OA4A 1G6OA 2F6RA 2EFEB 2FV8A 3T15A 3OZXA 1CEEA 2ZJZA 2FBKA 2O03A 4TV7A 4KN4X 1GRRA 3R61A 5LEKA 5C46F 1IXCA 4LZZA 1ZHFA 3EIHA 1WQ2A 4ENKA 1WA5A 1ZMXA 2RH5A 4YC7A 5H68A 5CJ2A 3L2CA 2E7WA 4M74A 4MRRA 1Q44A 4U7DA 1Z1DA 1TTTA 2VP0A 1HQCA 1XSXA 1M1YE 4DLVA 5ICGA 1T8UA 1Q20A 1J75A 3QENA 3C15C 4ZV4A 1P73A 4JL8A 4KSCA 4FX0A 1FYKA 4N3NA 2Q9CA 3QF7A 4IDHA 2XUBA 1XCBA 2BEOA 2CYYA 2CE7A 1CR2A 2ZJ5A 1E9RA 3LDAA 2GA2A 3QXJA 5FUYA 3QBTA 2IW3A 2OT3B 4LLLA 4ZCIA 2DK5A 2QAJA 4ZDKA 1EFRA 5IHPA 3FHCB 2FEZA 2D2EA 2EFNA 1I2MA 1TNDA 3PUYA 4ACBA 2FPLA 4OIQF 2WSSD 3DDCA 5E1XA 5E1ZB 3DF8A 3FMSA 4LJ6A 1HBXG 3A1UA 4QBFA 2A5FA 2G9NA 4I99A 4CEIA 2P6TA 1VYVA 2QM3A 3KETA 3HDTA 4N0DA 4WIAA 3SU8A 5BN3A 1OH6A 1NSTA 4FWDA 4HZIA 5H6RA 1WE2A 3AP3A 4KLNA 2DQRA 4NU0A 5CLQA 4BEJA 4IXAA 5JSZB 3H4MA 2J46A 2NZJA 4JJKA 3GZ6A 3VR1A 1QNTA 2W57A 4A0HA 4GMXA 5IT5A 1FPQA 3HRUA 3H92A 3TVTA 2R6GA 3ZYCA 4L9NA 3AVTA 3CJNA 4C0HA 4DLSA 2V9VA 1KKLA 2TMKA 1U90A 3C5CA 2R6AA 5AWFC 2GCPA 4KXFB 1J5YA 2JIZD 2REBA 4E5UA 4OI2A 4TTQA 1ZAKA 3IKJA 4R7ZA 5K8LA 1IHUA 3N97A 2IF0A 2WKPA 3MAAC 4L9VA 4RJLA 3Q9LA 2VF8A 4UJ5A 3UXMA 4B43A 3T06B 4JSTA 4RB1A 3J7AO 1U0JA 2MLKA 2ZE5A 2VTKA 2OZEA 2IL1A 4JT2A 4TT3D 1VYTA 2YVUA 4ZIRB 1KAOA 3I1FA 1E1QA 1ZLJA 4TMZA 4NYIQ 4FCTA 2J0VA 2ZS9A 3VU9B 1UAAA 4U0YA 3AKYA 3SYNA 4JLBA 2PT5A 3IEVA 1G7SA 1A2BA 3MJHA 3MFYA 3E6DA 1Z6RA 3VHLB 5HS9A 1G1MA 4IF4A 3RSLA 2W6IA 1E2XA 1G3SA 3KB2A 2W2XA 2X4HA 3G3ZA 2IF2A 3FZVA 2EB7A 1TPZA 4BFXA 3BRWD 2PLFA 4LUCA 2YR2A 4A6XA 2C78A 4JS0A 2AWNA 2FMYA 2F43A 4HQEA 2Z5FA 3ZPLA 2YX7A 1EFCA 2FX3A 2CO5A 3B1WA 3DMDA 5HKKA 2JAQA 3BPXA 2HDCA 2NRAC 1E2HA 1AN0A 2A5JA 2I1VB 2PH1A 3QI2A 2H57A 1XRJA 4M1TA 1TNSA 4PTLA 2P4WA 4PPQA 2XGXA 1AZTA 2QAGC 3IQWA 3QY0A 4OHXA 3TQFA 4HUTA 1YZUA 5HR5A 3P20A 3U7FB 2QTHA 4ZO4A 3D31A 3IHUA 5FUWA 5KSZA 2EK5A 2ZE7A 4TTRA 3X1ZA 3RC3A 2FBHA 4IHTA 1II0A 2XHKA 3R7WA 3RS4A 4JBYA 2EU8A 1MJBA 2HYDA 1P6XA 5ICCA 4IPAA 4RAYA 1QRAA 4IRHA 1N6IA 2DI3A 2QWWA 4UV8A 3O8DA 2HCJB 4Q1BA 4PHGA 4BFUA 4BZPA 1KIMA 3AF0A 3FMIA 4OKSA 2F1JA 5EXXA 3GLHB 3EYYA 4KMUX 1DAEA 1EX7A 1G3UA 4XSGA 3FGNA 2IHBA 2DQLA 4EJSA 2EV5A 1YS6A 2OFWA 4KAXA 1E1QD 3IWFA 1OLOA 5KVRA 1DAFA 4M9QA 3CZQA 2DW4A 2PMKA 4FWGA 2XAHA 3I73A 1TU3A 1RIOH 1RVDA 3IIMA 1B59A 2ESNA 4Z2YA 2RQPA 4X8HA 4BH9A 2CQKA 3WXMA 1F5NA 5JFGA 2DWPA 1BIBA 3U1DA 4PO1A 3TQNA 4Z8YA 3I54A 4A82A 2RN7A 2Z5UA 1II9A 2FEOA 1Y3AA 4PZZA 4JYBA 2XV4S 2ZRCA 3IQXA 1NSFA 4L8GA 2PZFA 4EPTA 2ZJ2A 2M5WA 1HQYE 2YX4A 2IA0A 4HZFA 1C1KA 4XSXF 5JVTA 2VODA 1BMFA 3MFKA 1G7RA 3FHZA 3A1TA 1BBYA 2RV8A 3GCGA 2VBYA 2YPRA 1IY2A 4JVMA 4KYIB 3VNUA 3QSYA 5CVRA 1JEDA 1T5IA 3WTZA 1AZSC 3HRMA 5KOYA 5BOXA 1N6LA 1Z29A 2RGXA 2HV8A 4E03A 2MBFA 4MDFA 3GF2A 4P5OA 8OHMA 4MUBA 3O3KA 3N2EA 3SN6A 3VOEA 2ZRBA 5AR1A 2MLGA 4PCQA 1E79A 4HI0E 1NN5A 5EZ5A 3VQTA 1IM2A 2ZRAA 1OFIA 4D82A 5HDNA 2CVFA 4F4IA 4A2UA 3FMPB 3OFNA 1D9ZA 3SJZA 1P2TA 4DDWA 2GF0A 4KO8A 2K27A 5FOUA 4DCUA 1G3IA 1K79A 4K81B 3ULQB 5FTNA 2FWRA 1NY6A 5ILVA 3OAAA 1AJEA 4N9HA 1U8RA 1Z7UA 5ICEA 5B58C 3JZMA 1HURA 1ZU4A 2BCJQ 2Q6TA 3NKVA 1KTVA 2HUPA 3P9IA 4L0ZB 3CO5A 3SHWA 4LYFA 4HAMA 2RGAA 1UDWA 1HEIA 2X19A 1ZH5A 1AOYA 1G4DA 1JR3A 4AC9A 1NNEA 4RB2C 1TQ2A 1ZCBA 3L2OB 1VKJA 4GZLA 4DT1A 2ZUBA 3ASYA 1ZIOA 4DWJA 4OK5A 1WXQA 1SD4A 2VP9A 2XJ4A 2ZI6A 4WW0A 4PC3A 2ZJBA 4LWZA 5IK2A 1KSFX 3GLIA 3G5UA 3D8BA 3RS2A 2W58A 3WMGA 3NH6A 1E2GA 4EPXA 1Z0FA 4NHOA 1G18A 4D80A 3ZMDA 2NYXA 4HQMA 1KDRA 3TJZA 1H9GA 5FR2A 4B74A 2RGBA 1XTQA 3BOQA 3T34A 4HUQB 2OFXA 1E32A 2GAUA 3ZN1A 3K53A 2R8RA 1GNQA 2O8XA 5GJWC 4H0EA 2BVNA 2EQBA 3K1PA 1IXSB 1IN8A 4JVSB 2FG5A 4I02A 2KJBA 2BM1A 3TR0A 1DTSA 4G8XA 5IT9Z 1LB1B 1CJKC 2IYZA 2W6JA 4XWOA 1JHFA 2G7HA 5D3QA 1YE8A 3AKDA 4DLXA 3Q5FA 3PJRA 2GZWA 3NTUA 2KBEA 4M4SA 5G3YA 3PUXA 2IUTA 2O5VA 4V0NA 5HZKA 4KA4A 1Z28A 2OILA 4GSYA 1TUEA 2ANCA 2VLIA 5JWOA 4BHBA 2PL3A 2GCOB 2J59A 1GTVA 4ABYA 2EFPA 5FB2A 3IGFA 4AKHA 4OL0A 3EX7C 5DLQC 5LD2C 1Z47A 3EQLF 4MNUA 1H8HD 1GSIA 5K1YA 3NG1A 4A36A 4XH9B 1XDSA 2QQAA 2ASEA 4BGDA 2FU5C 1ZLKA 3WTTC 4EJTA 1BYUA 1XJ0A 2WM9B 4IOMA 4LV5B 5D6EA 3L43A 4NP6A 1IF1A 5JR3A 3UMSA 4DVGA 1E98A 1VPLA 2RGVA 1L7VC 3WTSC 4AKIA 5AONA 4LYHA 4RZ2A 1TNTA 3I4PA 3RIRA 5CYPA 1MD0A 5GJCA 1PLKA 4A0FA 2FDCA 5E7JA 5FPTA 1W36D 2NO6A 6PAXA 4C2TA 4TL8A 3JAMK 4I1UA 1QO0D 1XEFA 3MZYA 1G7CA 1NVXQ 1JNYA 2WZQA 1N0VC 4NBSA 1HT1E 4I1VA 5DNYB 1SVOA 2MSDB 3ZMZA 3CUQC 3FFAA 4QGHA 2M87A 1NHAA 3HTUA 2ZYUX 3FE2A 5JEDA 3TSOA 4AIHA 1Z0IA 2R2AA 1SD7A 3BD9A 4B33A 5D5VB 5B30A 3RRNA 1KQ0A 2F5CA 2FSIA 2FF4A 2WJJA 1FSEA 2CHVA 1E69A 4RCZA 1X37A 2V6IA 2WPDA 4DCTA 2QY9A 3I4LA 1S9DA 1FFHA 4X8OA 5FOXA 2RC4A 3EYIA 1MT0A 3VX3A 1G4AE 4ACAA 2RAPA 3VR2A 3PVSA 3K0FA 3WRXC 1FTSA 2J0QA 1F48A 1Z6GA 5ANRB 3VB2A 3UIEA 5KPDA 1Q21A 4EFNA 1AGRA 2GDJA 4I0BA 3C3WA 1R2QA 2OAQ1 1KJYA 3C7KA 4GOKA 2P8TA 3KFWX 5F6FA 1CIPA 5J40A 1KJWA 2PZGA 1EFTA 4ZH4F 3DVLA 5AJYA 1J90A 2CXXA 1RIFA 4Q4HB 4CF7A 2PQ8A 1KJZA 3KKPA 1H0MA 3QKRB 2ZBKA 1PDNC 1NBME 3BH7A 4PHFA 2KJQA 1WDTA 4QBHA 4D6PA 4G5RA 4TYQA 3PEWA 1ZD9A 2CL6X 2IYXA 1GKUB 1QBKC 2OM2A 2EYQA 1IXRC 1U3EM 4QNRA 1P9RA 1M7GA 3JW4A 3HP1A 4PPGA 3EAQA 4FMDB 5P21A 3RYRA 2DU9A 5HE8A 3IC7A 4KICA 4HBLA 5ICFA 3CNLA 2WBLC 4CT4B 2WWFA 2IS2A 2WV0A 5L3SA 3B82A 4EJUA 4OI4A 4Q18A 1TQ6A 5E17F 1OHHA 2FFBA 3HU1A 5DEQA 3M9AA 2LDUA 1A1VA 2V9PA 4RSGA 3BOSA 2KE5A 3VTKA 4B75A 4CDGA 2V6JA 1T8TA 3I71A 1CXZA 5AJWA 4CIDA 4QL3A 3AF2A 2VHTA 3ZIAD 2OESA 2FQ3A 2IVMA 1SKYE 1G41A 1P2VA 1DAIA 2XX3A 1OIWA 2VPPA 3CM0A 2B21A 5CVJA 1KI4A 3LVQE 4LJZF 4G1UC 1OPCA 4O6JA 3LXXA 4N1AA 3HHHA 2Q9BA 3UMRA 2OAZA 2STTA 2ZJYA 3LAWA 5HKKD 1LEAA 3KDSE 4ENJA 3EPKA 3WYAA 1W2GA 1E0SA 1FW6A 4LG0A 1OYWA 4ZYDA 2IT1A 4CO8A 4MQBA 4PZYA 2GXAA 2GXGA 3CIOA 4M1KA 4US1R 1U5TC 3KLOA 1GL7A 1M7BA 2V4ZA 1VHTA 1A2KC 3UK6A 1N6PA 1OFUX 2OHFA 5F64A 1U9IA 2W83A 4F92B 1R7JA 5L3DA 3W9YA 1GM5A 2CLCX 3FM3A 2Z9OA 4BAYA 1Q1ZA 1Z0JA 3OEHD 3SFVA 4C0AC 4PX9A 3EIEA 4JK1X 3DZ8A 1G3MA 2W85A 1TEVA 1Y63A 3B13B 4YMTA 2ERXA 1I5ZA 3LRPA 1NMZA 3TW4A 4EJSC 1KI3A 2L3DA 3RPQA 2HXSA 5FBLB 5JRJA 2HCBA 1I1GA 1GRNA 4LGWA 2M45A 1R4AA 4F4JA 5KSOA 1NL3A 2A5DA 2BEJA 3V4FA 3E1SA 1A5TA 1UBFA 5CVVA 1G19A 1J70A 3L09A 4QKQA 2IS1A 3A1WA 2FNPA 3VX4A 4XJXA 1W47A 3GLGE 4EGYA 4I4LA 1A4RA 1E4YA 4FMCF 2QQBA 3MGCA 4HZUB 1VG8A 4A2PA 3JTGA 1EWQA 2GVDC 4D0NA 4LY6A 1R5BA 3TR5A 3SDZA 1QF9A 3W6NA 5KDOA 2Q3MA 4Q5IA 3SBDA 1KDOA 2B8TA 3FX3A 3I59B 5AUPB 1Q3TA 4UJ3A 2AX4A 4OU0A 2PZEA 3QPHA 4ZZDA 3EZ6A 4N0EA 2LCFA 1XMKA 5DCFA 5CJPA 4Z1MD 5B57C 4Q5SF 1H8EA 1XD2B 1K5GA 5KO2A 4IEIA 2O6GE 4FCWA 4I1OA 1SFUA 2JEOA 4XLPF 1NMXA 5EXPA 5D5XB 1XMJA 1Z5ZA 2G3YA 1WP9A 2JJ2D 2FSWA 3I3SR 3PCRB 4NYJR 3F8MA 3WTXC 1OMIA 2QN6A 2JSCA 2BOVA 4LK1F 3G82C 2Y48A 2DTRA 1E4VA 4HA8A 1CR1A 3DP7A 2XZOA 1KSHA 4L5IA 4TSFA 4N0BA 3EC1A 2H94A 3P4XA 4NTZA 3RVBA 4B34A 4URXR 4ZDWA 2ORIA 2JLUA 3VR6A 4BFZA 4JBXA 4KDPA 2WMNB 3NXSA 3R7WB 4IVRA 1XN7A 1DARA 4ARZB 1E79D 2XNDD 4BWYA 1SHZA 2XAFA 2DK8A 2BWJA 2QEQA 2QU8A 4DDTA 4O3MA 2YOHA 1ZUHA 3K2ZA 3VNVA 3LWFA 2I4IA 2R6FA 5C4GB 1XX6A 2IW5A 2VOPA 3RHFA 3A58B 3X1WA 2GEVA 3P4YA 2KIMA 2EFHB 2ODEA 3FF5A 5FOVA 5FBVB 4KT5C 2XAQA 1H65A 1EX6A 1MABA 1NP6A 2ZTSA 3IPYA 1W4CA 3QP5A 3WNCA 4Q4ZF 4AKEA 1OPXA 3DOEA 3E6BA 4S04A 4LLNA 4UNOA 2ZROA 3B6EA 1XCPA 3SQWA 1D3YA 1DDNA 3WTVC 1XF9A 1XJCA 1XMIA 4DRZA 3ICEA 5L3SB 5CLSA 3KP3A 2FXAA 4TMTA 2HF9A 1LJ9A 2CDNA 3GQBA 4OIRF 1YTYA 1RYHA 1IRFA 4U0WA 1UPTA 4C3ZA 2JJ2A 3KP4A 3TKLA 3U3MA 1QHHA 5A5GA 3OIYA 2A7QA 2NOAA 5KDDA 2X2EA 1IY0A 1O3RA 1SFXA 3ZMTA 4HLYA 1T6NA 2NPIA 2LF7A 4HB2A 3T35A 2J1LA 2VBXA 1XB2A 3H0KA 1W49A 4FMCB 4OIOF 3WYGA 3DFGA 5DN6A 5KYKA 4HW0A 2QMEA 3V8LA 4EJWA 2AR7A 5K5OA 5CIWA 1COWD 4G7HF 2O8EA 4O2LA 4K8OA 5KK1A 3A1VA 1KDTA 1ZYUA 2B6HA 1XGNA 3LW8A 2ZI7A 1W0KD 4PC2A 4TYNA 3KQNA 4IOLA 2RKHA 1KYZA 3A6PC 4UNQA 4LV8B 4YLGA 4RFVA 3K0CC 1OKKD 3U7HB 3G0HA 4D2IA 3GFIA 1FYLA 4M6YA 2QRNA 3KP5A 5DD4A 3VODA 4RFSB 5FO5A 4TQ9A 1O7LA 2K86A 3AVOA 1QHGA 4QHYA 3CONA 5DHFA 1FX0A 2XJ9A 1XCVA 1NN0A 2FH5B 3ZVNA 3VAAA 4QJ5A 2V3CC 2MC3A 3O8RA 1DPRA 1HE1C 4I98B 1II8B 4F4CA 2PMHA 1KO7A 2H09A 4LOAA 4WXPA 5CYOA 1S3GA 2MMCA 5EUQB 4EUNA 2WV9A 3KW6A 1K7AA 4G7ZF 3OESA 4OK3A 4BFYA 4ESVA 3FM5A 4V02A 2GBLA 1OJLA 1CJVC 4DLUA 1YZGA 5LHIA 5CK5A 1UKVY 3M0EA 1LDDA 2RDPA 1R0ZA 2JJ1D 4B6FA 5KSPA 2NO9A 1JHHA 4XSHA 2JPBA 2QT1A 3HJNA 4EMSA 1G17A 1MO3A 2DFNA 2HF8A 3TH5A 2LNBA 3HSEA 4Y13A 4NQWA 1IOZA 5F9FA 1G5TA 1E2NA 1GG2A 1GP2A 2GBLC 2R6CA 2ACJA 3GJ0A 4YFXF 3GLGB 1OKRA 3CRQA 3VKGA 2MA3A 3RJPA 2COMA 2RHMA 1I4LD 2ZE8A 1O3SA 3MRSA 2UKDA 1OFTA 3RKYA 1TW2A 4IRGA 1C0WA 3CPHA 2GZDA 3ZQJA 1HT2E 5FI1B 3TVDA 3QBVA 4I81A 2R44A 1ZW6A 2WAYA 3U60B 2X2FA 3KEOA 4WXCA 5ERIA 2J7PD 2XB4A 3Q9VA 3TAHA 4JLJA 1UHWA 4TTPA 5BYKA 1FQJA 1V4RA 2GCNA 2GILA 1BOAA 2VH5R 4H1VA 4R98A 5BW8A 4DLRA 1TQIA 1Q3HA 2QQEA 4KCGA 5FL7D 3PQCA 4YMVA 5JCZA 3RWMB 3I58A 4TZ0A 1XEXA 1KK1A 1ZD8A 1EESA 4C2UA 1RZ4A 2AK3A 3LLUA 3J80Z 2VP4A 2RNJA 2FE3A 5J4YA 2QAGA 1IQPA 3EPJA 1LEBA 3KJGA 3F0TA 4GI7A 3E3VA 2YNMA 3BK7A 4HDQB 1RYFA 2N46A 1XCGB 3QKSA 621PA 3HU3A 2PMDA 2UZIR 1GOTA 4ETSA 4AYTA 3FOZA 4I09A 2DBYA 1W36B 6Q21A 2JLQA 1S8FA 1X6VA 2HJGA 2HGCA 4ASNA 2H18A 2L0XA 3LNCA 1WQ1R 3SJCA 1TBXA 4A0XA 4URZR 1OFHA 1D8KA 4DT1B 3ZVRA 4B8XA 5E20A 1GRQA 3NEJA 2FJUA 1GIAA 2HQNA 3W3AA 3EA0A 4LHVA 2ISYA 1HV8A 4NCHA 2ZJAA 3MUFA 3HR7A 2RGNC 4PSVA 3J81K 2O8DB 2MH2A 2P7CB 1ZNYA 2OCPA 1R5NA 4PO9A 3WNDA 1T0HB 1KSGA 1YR8A 3QQ5A 3TOAA 4A5NA 4B3GA 1FYMA 2DPXA 3EARA 3EIQA 2IWHA 3H84A 4GITA 1ZNZA 2WIBA 2QMUA 3GJ8A 2ZE6A 2YJTD 3ZZTA 4CRWB 1V3FA 1YR6A 2EFDB 4FCVA 4GYGA 4GOXA 5G41A 4FT8A 1W44A 2PEXA 4ENNA 4DIDA 3QXHA 2AL7A 4TWZA 2JDIA 4DC9A 4BEBA 3KCCA 4DDUA 4Q1EA 2G1JA 3FWEA 1N6HA 1CF7A 1XXHE 4G01B 4W9MC 4BE7B 1HKQA 4DLTA 2NNYA 1BC7C 1DAMA 521PA 1OH7A 2VHJA 2ZRFA 2DFTA 1ZUNB 5L3CA 3M6AA 1WF3A 4JBAA 1X86B 4KBGA 3F6VA 3TDUC 2NMVA 3PXGA 2Q3HA 3C18A 3A4LA 3GJ3A 1RNLA 1RI7A 5L3QB 3KQKA 2FSGA 1R23A 3JSPA 4F93B 5H6QA 2QG6A 3TMKA 4KHZA 2VHQA 4R79A 3GPLA 3CWQA 1RJ9B 3GJ6A 2VEDA 5CB8A 3A37A 3H1TA 5JRZA 3RS5A 3U3KA 4QNMA 4FWHA 1CLUA 2GXQA 3AV0B 4UNNA 4RGRA 2O8EB 5GJBA 3BC1A 4JLPA 2WWIA 5KPJA 4HV6A 2AKYA 2BBWA 4PGGA 2CJWB 5HS7A 1XTJA 5TV2A 2PG4A 2DAOA 3MWYW 1KU7A 2AD5A 4RS8A 4WBSA 1NI3A 4G94A 4EM2A 1VG9B 5DIFA 4LFUA 4QC2A 2CLDX 4BFWA 721PA 2A9KA 2R62A 1ZRHA 3FFBA 3WYFA 4OI0A 4NHJA 1CF4A 3WHKA 1P62B 1A7JA 3CKLA 1IAWA 4XVQA 2ZYVX 1KU9A 1OE0A 3MWJA 2ZRGA 1VCOA 2OUKA 3K69A 2V1UA 2RGCA 5JLJA 5C1BA 3THWA 1N6OA 4B32A 1HH4A 5HLGA 3ZVMA 2NPFA 1MH1A 1R1TA 2BBYA 2EJRA 2QE7A 2YOFA 1PUJA 1ZIPA 2ZRHA 5DCMA 3BE4A 1KAGA 1AKYA 1KI2A 3CPEA 3RKWA 2B7BA 3AKCA 4MTDA 4A8JB 3GLHA 2JLSA 2FMLA 1EG7A 4GMDA 1HXDA 5LGUA 4YONB 2BDTA 3NH9A 3LBIA 2G0TA 3CZPA 2CBZA 2F1IA 3FDIA 2ZJ8A 4MYTA 3WG9A 1FL9A 1U2RA 4A4DA 1JQJC 1N5IA 2A3RA 4D81A 2WJYA 5EP4A 1QG4A 2QROA 3DO6A 1E2JA 2ZU6A 4RD6A 4P32A 2JJ8A 2O0KA 1G7TA 3GJ7A 4EM1A 1U5TA 3I32A 3VKHA 3QPVA 4DCNA 5FPKA 5FPSA 1X1SA 4QGGA 1QPMA 1LY1A 5J8FA 2DZOB 3ONWA 4Q4AA 5L3RA 1FSHA 3RPUA 1S3JA 5HVQC 1OHHD 5EE5B 1H8HA 2IWRA 1J2JA 3THXB 2N42A 2QL6A 1Z05A 2R7FA 2FSHA 1BIAA 4LHZA 2LF8A 1IUYA 4QOSA 1Q0UA 4CICA 4TLAA 1BS1A 4XTRA 1PVOA 1NMYA 4A8JA 2ZR7A 4FXPA 1CBUA 2WJVA 3N5CA 2F2EA 3P27A 4DB4A 1GXPA 2RGEA 4P3YA 3TQCA 5FI0B 3LO5A 2VL7A 2R65A 1SD5A 2W24A 4GRAA 4HLCA 3GYHX 3GJ5A 4YMWA 4RGSA 1ZM4A 2FFAA 3NIBA 2HLDA 1D2NA 3ABUA 1QG2A 1S0UA 2BIFA 2Q0HA 2QA5A 1BMFD 3CNNA 4YDHB 4QXAA 5DO9A 1P4XA 3M8FA 4CGZA 2QYOA 3V4RA 5JECA 3D6TB 2RB4A 3A1SA 1OT3A 3FHOA 3TNFA 1F2UA 4BLSA 2A6EF 1BI0A 5F3WB 1P6RA 5DI3A 2BKUA 3RABA 4A92A 4W5JA 4DHEA 2W2TA 2SHKA 2HJVA 4RZXA 3T12A 2QZ8A 1OXTA 4IRUB 4B35A 2C9OA 4JLDA 4LHXA 5TDHA 1EGAA 1DADA 3EASA 4FMBB 1NLYA 2OBNA 3K0EA 4L15A 1PUIA 3A4NA 4RD4A 2JLXA 2A61A 1PP7U 1L8QA 4MGKR 4FINA 2H5EA 2OBMA 2FOLA 4LYAA 4BNCA 5IT9K 3IHLA 4JLOA 4M1OA 2EFWA 4CEIB 4KI0A 3KUDA 4I2OA 4C30A 3F8TA 2FBIA 3K0LA 2RMKA 4TZ6A 4XVRA 3IO3A 2WAXA 3WNBA 3C8UA 5JWHA 1KI9A 3F6OA 2BBOA 4IDQA 3NQOA 2AFIE 2BCGY 2YWFA 5DYMA 5FOTA 4TMWA 5LB4A 1VYUA 4F7WA 1FUUA 1ZNWA 2B92A 2FGKA 2FSFA 3B2EA 3CF0A 2IXFA 4ZZLA 1FBSA 1FX7A 3B5JA 2NS0A 5TJJA 4HLXA 1KZ7B 3GEEA 5BWMA 3ZMUA 2IA1A 4PXAA 1UDXA 1XTRA 3KB1A 3S2WA 4HDUA 1U8AA 5AJXA 1R6BX 5LHHA 1USTA 1ZM3A 3ADKA 3CX6A 2F3TA 3OEEA 1VIYA 1YQAA 2VBCA 3U3OA 3P9KA 3LAPA 2KWIA 4L0YB 5D3MB 5E1WA 2R7DA 1FUKA 2VO1A 3S1AB 5JHHB 3KXLA 4DEXA 5FTLA 2CFXA 3SC3A 2QQ0A 4CHUA 2V1XA 1MV5A 2OAP1 1ON1A 4Z54A 1EH8A 2XNDA 3NDPA 3PR1A 2ZXUA 2AWOA 4DBLC 3K70B 1KI6A 2PBRA 2M8EA 1KK3A 3QG1A 2ZO4A 2Z4RA 1AQYA 3I64A 4BLPA 4Z8XA 1E9BA 2C2HA 1KA8A 3LA3A 3WHLA 2YINC 1E9DA 3DM9B 3I5YA 3NC1C 3UPUA 5FPHA 1U94A 2YC4C 3U7EB 2P7VB 4BFSA 2O52A 1YO5C 3KTAA 3QKRA 4HAYA 3PUZA 4HYEA 2OXRA 2DB3A 1XD9A 5JJKA 4HAWA 3O6BB 1OIVA 5EE0A 3AH8A 4WCGA
chains in the Genus database with same CATH superfamily
1H6DA 2I4LA 2PT9A 2RBGA 2Z09A 4IQFA 1QV9A 2V5VA 2F17A 2BTOA 4AVZA 4R2JA 3C5VA 3VR5D 2ZSEA 4UVAA 1VIAA 1KVSA 2Z98A 4PZPA 2L9RA 5L3ZA 5EJEA 4XQ9A 1VTNC 1UDAA 3AR5A 4DUGA 4Z1MA 3E8XA 4IGIA 2BMEA 2Y68A 2J5RA 3NC4A 4FYPA 1F9NA 1CUHA 4MDHA 2G1KA 2HQAA 2WU1A 2WSSA 1NLFA 4IIFA 1OQAA 4BXXJ 3PUIA 4RB3C 3GX4X 4JI3B 4RV9A 1Q7GA 2BUCA 2UYQA 2J7PA 2NQTA 3KJXA 3WU1B 3HMKA 1IC6A 5EJCA 3RYFA 1E96A 3OZEA 4GNRA 1LLFA 1TVMA 1UDCA 3GLFE 1XJQA 2WOJA 2IAIA 1LPAB 4QICA 1ZH0A 5BPVA 3DHNA 3ZK7A 2O7NA 2FEKA 1MGPA 4X0EA 1ABBA 3ZC3A 5EZHA 4JR0A 2JBAB 2KXEA 3HXQA 1DG9A 1WRJA 2EWVA 4DR3B 2M9HA 4TMKA 4JHLA 1FE8A 1GRCA 1YU9A 4J7XA 5DHPA 3WGHA 4BZXA 1THGA 3BIXA 5EXTA 1UAGA 3I72A 2G83A 2OQGA 3T61A 1DV2A 4ZDOA 5D5HA 2C99A 3GFFA 2FG6C 1TLTA 3BEDA 3LTEA 4NU8X 2J0UB 5BQPA 2E5NA 2B63J 1OAAA 3O82A 3W5AA 3B8EA 3DOFA 2XDVA 3LWBA 2ZBRA 3ND9A 3QU7A 4CL3A 2X0IA 4M1SA 2FEXA 1W0CA 2FD5A 1QA6A 3VYUB 1PLLA 3GCDA 5A06A 1XB4A 3WODF 1J6UA 4B7UA 4V1CA 1XSDA 3AUTA 4ERXA 3QJYA 1GDDA 5IXSA 3IAM1 1XIVA 1ZW1A 2BGCA 1W0KA 3HDHA 4YJ2A 1VLZA 2HQRA 1ZI9A 1GU1A 2WU3A 1G20B 4PC6A 3Q7RA 3G2QA 3ZDYB 3EG5A 4D4LA 4PYOA 1ERDA 4F72A 2B2XA 2PKRA 5G40A 4LIVA 4MQUA 4Q34A 1TCUA 3BJ6A 5JCOC 4NYMR 4UXNA 3FB4A 5IOZA 4RZHA 1K75A 3PRYA 3W6KB 1UJNA 3W3ZB 4NBWA 4B40A 5C2JB 4O4LF 3U37A 2FOIA 1Z6YA 4MUKA 2CMDA 2IZ0A 4JC4A 1PX0A 5K09A 2Q1WA 3FY4A 2J0UA 5KX5B 2BE5F 1U3UA 2PSDA 3BB3A 4LF8M 4BNGA 1WJEA 1EX9A 4F2GA 3RM3A 3MT0A 3OCCA 4DLNA 2NT4A 4B7FA 1IIBA 2IKQA 1DCFA 1N5MA 3PUVA 1KEWA 1F2TB 1IZ9A 4YCMA 3QP6A 1ZJ4A 5BNZA 3R6WA 4RF5A 4N5NA 3MJVA 3CRVA 4N18A 5DT9A 2ZT7A 5AIPA 1FP6A 2Q2OA 4FEAA 1RESA 3CURA 4TLBA 3WGJA 3H3JA 4HNTA 3GPUA 3UTCA 5IJWA 2DGDA 3LQRA 3SEZA 4IH4A 5AYVA 2HMTA 1RKQA 4MRMB 3PS9A 2XZTA 3I5AA 3PHCA 4K05A 3L25A 1WJBA 2ARKA 3IAS1 3QKSB 2EWMA 1XZNA 2I78A 3HPQA 3QMVA 1S2NA 3BJZA 5EERA 3G89A 2EO2A 1U0FA 8ABPA 4H7DA 2OPBA 3N2IA 3DNMA 1S8NA 2H1RA 1OH8A 1XMOM 2XGDA 3ABLH 2CZCA 4A0YA 2CMKA 4N9WA 4CKZA 4RO0A 4LHYA 3WR5A 2E2WA 4YT5A 5BWBA 3I4CA 2CB0A 1IBKM 1KPIA 1S02A 1P9WA 2BKXA 2R97A 3I62A 5F98A 2QPTA 1U0HC 2AV6A 4CZZA 1KDPA 2D1TA 2P9CA 2Z2IA 1DEHA 4JX5A 3TLJA 1S7AA 1U3WA 4HTFB 4YRIA 5IF9A 4M73A 3SIXA 3DV2A 3DDUA 1FIAA 2AMFA 4R2HA 1MBJA 2OCGA 1RI1A 5B36A 3R8CA 4JKOA 4RAZA 5A2QK 3IKTA 3L02A 4B73A 4YFYA 4IVNA 1Z18A 1Y7IA 1OZHA 3TLGB 3D81A 1ADCA 2Q28A 2GCIA 1R5HA 2CJYA 3LWNA 3MS2A 3ANMA 1R0WA 1B2LA 2LFBA 4KPUB 4IIYA 4YUAA 5A7FA 1NHWA 4E32A 3HB0A 4M3NA 3AYZB 4KE7A 2QDXA 4HEHA 3JASA 5CBPB 6REQB 1EM8B 4FEGA 1ZAEA 2IS4A 3ZY3A 1TKCA 2YW9A 1HE2A 1Q92A 2XVXA 3HH8A 2H2WA 4P9FA 5CVUA 3FOCA 2X4DA 1WCWA 1YS9A 3H7IA 3ZHZA 3A03A 2D7HA 5DHRA 3FTQA 4OOIA 3T9EA 1P7YA 3OVMA 3ZOBA 1JKPC 2ENUA 2V7GA 3AM4A 3V8VA 2ZJ7A 1BA5A 1L5YA 1UOQA 3DD1A 2XUJA 3OCZA 3ZCQA 2OVFA 1REPC 1MG0A 3B1YA 5KMGA 3TBKA 5LB2A 4ZMRA 2Z33A 4QGBA 1WD7A 5ERXA 1YQTA 2GN8A 3JSXA 1CZRA 5K6TA 4CM9D 2O19A 1LJUA 2ILVA 4OOFA 1GLVA 3Q85A 4HJXA 4N65A 3BDIA 1IWOA 1PWYE 3KQLA 3W90A 5EMHA 1OREA 5IJAA 3QU9A 1DJMA 1FC3A 4R9NA 3IBTA 4F06A 3JAMA 3ZR4B 3TPCA 4S0XA 4LSGA 1KP9A 1KBQA 1TE2A 2P6UA 1JLLA 3PD7A 1YS4A 3K1AB 3K6GA 4G1CA 2Y76A 3L00A 1E0DA 2HQ5A 3BR2A 1IJFA 1JA0A 3FGPA 3USES 3R4VA 1G8KA 4LDQA 4OLBA 2FN9A 2WHXA 3PI7A 1G21B 4TT8A 5BQ5A 4BUJA 1K6YA 4ZU3A 4XLLA 3KOYA 5CNKA 1K5DA 1PNQA 4P5PA 3K96A 3TOXA 5ALJA 3NHKA 2GHQA 1R0YA 4CNBA 1CIJA 3LYLA 2RNGA 3E70C 3IMCA 1C4XA 3I6QA 3ORYA 1JKJB 1SVMA 5KIAA 3FISA 2XPWA 5EMMA 4M0WA 2AOTB 1BCSB 4HNAB 2OV3A 3J81S 2Z57A 1EH7A 4HAOA 3BERA 1X2MA 4JROA 2VPZA 1FNCA 4MB0A 4U39A 4LCBA 1ZONA 2JJYA 4EV0A 2KHZA 3B2QA 1YR3A 4JH0A 4YFNF 2WAQA 1QIEA 3UHPA 3VK8A 2B35A 1Z8HA 1R8SA 5CB4B 4CQMA 2QXUA 3AB3A 2DMTA 4Q1FA 5LQMA 4BECA 3JYHA 4LKOA 2DYSH 3NP7A 2DT8A 3D8RA 5K51A 1V3UA 5DDGA 1SU4A 2A6TA 3X2QH 5TMPA 4HF1A 4AY2A 1P1IA 4RA9A 2KYRA 3P71T 3CF4G 4OXQA 2PX2A 4WJZA 1VQ9I 2WKRA 4PC7A 2YZ7A 4DIBA 1F60A 3V1LA 5FD6A 2XKKA 3REFA 3MTBA 1EH5A 2E7XA 4Q3NA 4WWHA 2VPYA 5C7OO 5D5WB 4JLKA 4MITA 1Q1QA 4Q9DA 4AQYM 2IX3A 5G4KA 4KPFC 2C4KA 3OUZA 3ZKWB 2GPTA 3I2HA 3EUEA 3AIOA 3RW9A 4U6SA 4ZT6A 1BXZA 3U9GA 2YWBA 2QUZA 3OQNA 4K2EA 3DEAA 1ZKGA 4JV5M 4C2MJ 2QD1A 2I2XB 1B6RA 4KR0A 1S6YA 1UADA 5B1BH 4C6HA 1QPGA 3MQ4A 4UDYX 1BI3A 4QTUB 4IDNA 2G1AA 4D9BA 2J9GA 1MJHA 1JLHA 2QZZA 3VPGA 2XT6A 3FDYA 3PYLA 3L2VA 1CD5A 4BFLA 3HE3A 1KQ3A 4IHYA 5I9TA 2XXBA 1WSDA 1YJ8A 4YXWD 4MIYA 2IH2A 1J2XA 4P4SA 2HIMA 5GM2A 4L95C 1EBUA 1TCAA 1X19A 1RUOA 3I0ZA 1NW9B 4QPCA 4A12A 2VRNA 1KO4A 4IRIA 4EPWA 2B1JA 3T7TA 3BROA 1FZQA 4OQPA 4RDHA 2XGJA 5F51A 3U4QA 4AD9A 3ASUA 2VNSA 4M1WA 4NOLA 4U0VA 1VPTA 1XXHA 3OE5A 3UZUA 1NX9A 4WKBA 1M2WA 2MSWA 5T7BA 4BMCA 4ZAFA 5IP9J 3A9WA 3GFMA 4UVEA 4JEIA 4M2LA 2V1CA 7MDHA 4RIEA 3DL2A 1VG0B 1KDZA 2JA5J 1R0CA 2NUTA 5KU1A 1BH2A 3RC8A 1Q2XA 3AUSA 1ZREA 1VGQA 3DMPA 1T5LA 4XW2A 1S2OA 4B3FX 2Z4TA 2VJIA 4WJKB 1KFBB 1C3OA 3CVJA 3WZMA 1U2WA 4XNFA 4OJKA 1T0PA 2ZM5A 2HEOA 1AD2A 3ZHUA 3QTBA 4IBJA 3N39C 3JR3A 1X77A 2HHAA 3UFBA 1Z2DA 1ESMA 3B9BA 1OCZH 4D26A 4JBHA 4XN0A 1U7OA 4DV1M 1ZAOA 1R8QA 1G6OA 3DWEX 4MHOA 1WQ2A 2XF2A 2BH2A 5CJ2A 3RAFC 1YRYE 1SFOJ 1MJNA 1RXSA 1BW9A 1TNDA 3BXOA 3IEKA 3LBAA 3OOWA 4KLNA 4A8HA 2W57A 3DOJA 1JT6A 3K2EA 3FWKA 1IEWA 2DI0A 5AWFC 3W3AH 4YRMA 3MAAC 2IF0A 5K01A 4M7RA 2VF8A 2YQZA 4KQGA 4RB1A 2IL1A 1YR2A 2YVUA 5AFSA 5EPUA 3FTCA 3M1LA 3RSLA 1QONA 4K5QA 5DCLA 2EB7A 4JS0A 4ZCTA 3H5AA 3ZPLA 4Z4CA 2ZWIA 5AJYA 2BZSA 4ZVTA 5ILGA 2XGXA 1XKXA 3U7FB 5FUWA 2WFZA 2O7RA 3X1ZA 1II0A 2H51A 3CTWB 1Y3DE 1YDEA 2HA7A 2HJRA 2P77A 4Z0NA 1GGEA 1L1EA 2ROQA 2XE6A 1DAPA 3HDVA 1OX6A 1MAHA 2QSHX 2BGUA 3TQNA 1EUZA 2YMMA 4A82A 4M6VA 1P0PA 3RK4A 2X0KA 2A7XA 4BO7A 2WK1A 1NSFA 7CATA 5IANA 5GAHJ 1C1KA 3A1TA 3U4DA 3JD4A 3FHZA 3TFWA 4OA5A 4OIFA 1T5IA 4L5CA 3MCWA 3GF2A 2PR7A 1VGRA 4B4KA 2XMZA 5CH5A 2ZSIB 1POGA 3SJZA 2AQFA 2EARA 4F2WA 1AJEA 1HURA 3NKVA 2RGAA 1UM9B 3NGXA 4J4BA 3IYLW 1CP3A 1Z3XA 2E35A 4EB6B 4YRCA 4HUQB 4YJFB 4DPMA 1Z5UA 4JVSB 1GO2A 3O2JA 5DN9A 2FX0A 2OTJI 5EPEA 1LSJA 1KERA 4BHBA 2JJ7A 1MC1A 5DX8A 1WZNA 3AIIA 4CJ6A 3S2FA 1WUKS 2WM9B 1ZLKA 4FHDA 4YRTA 3NTVA 3H0GJ 3ENWA 1W36D 4BEHB 4KMRA 2LKXA 1KFJB 4BGVA 4Y4RA 3HBMA 4MUMA 3C58A 2R2AA 3MEQA 2DQSA 4A0SA 3RRNA 1GNSA 3D3WA 1X37A 1JIJA 1PQUA 4X8OA 1MT0A 2F4MB 2BH9A 2GM3A 1UT5A 3IUEA 5J40A 4ZH4F 3BH7A 1YK1A 3PEWA 3AHHA 2OB2A 5P21A 1SD1A 3Q12A 1GYPA 2WBLC 1TQ6A 1E66A 1UJ6A 3PGKA 1T8TA 3PJFA 3C70A 4GVXA 5BSRA 4N1AA 2HOSA 2UUAM 2Q9BA 2STTA 3MBOA 4ENJA 1W2GA 2W4SA 4W9NC 3VH3A 3MZ0A 4O4IA 4PX9A 3OMYA 1G3MA 3JQ7A 2ILTA 2DTXA 1MX5A 3V34A 3E1SA 2BZGA 2QJOA 3DXXA 3TRJA 1V8ZA 4FMCF 1KYTA 2XLBA 4LY6A 5D5QA 2WB4A 1OBVA 1O6ZA 1ZK0A 1YBHA 5CJPA 3AFMA 3K7EA 4L51A 3DBHA 1Y6FA 1EGVB 3G82C 3I83A 3GROA 4URHA 4L5IA 3LL7A 5AHRA 1JIIA 5I9MA 4X62M 3MIIA 2EIKH 4ARZB 2G82A 3AX6A 4L9AA 1M1NB 5EJAA 1MJGM 1JFLA 1RMQA 1L5LA 2CYAA 3KSJA 3H04A 3I3LA 3IURA 3VMMA 2XNJA 3A27A 3T7DA 1GCUA 2AI3A 1UPTA 2JJ2A 1QHHA 3U4HA 2IBSA 3X1MA 4MUYA 2UXDB 3M83A 2J1LA 4L8WB 4CKWA 2B3DA 3CUKA 4Y2JA 1P4JA 4UULA 3A6PC 5JXGA 4BMVA 4LV8B 1TPYA 3GRVA 1TVEA 1GV1A 1QHGA 2BFNA 1UBMS 4TXLA 4QJ5A 4HEA6 1MB9A 2D59A 1QIMA 2EIHA 4O1MA 4B46A 1DRUA 4DLUA 1VFNA 4MI1A 3M0EA 1R0ZA 5JNUA 1L3IA 1QGYA 4X7BA 2EQ5A 2M5ZA 1LJ8A 4NPAA 4LDZA 4CV1A 4PQGA 4PSCA 3HB4X 5EHXA 2YHUA 4CL2A 5BYKA 2QSUA 3C3KA 5AKHA 3ZWMA 3TL3A 4M3FA 2M4GA 2N46A 3EK2A 4P86A 2NU9B 4A0XA 3ZXIA 2R47A 2HQNA 4XIIA 3PDJA 5ALDA 3ZC7B 4OXRA 4PLZA 5KYTA 5K8CA 2FN3A 3EIQA 1P39A 3Q3GE 2QMUA 2ZE6A 2EFDB 2NAPA 4P83A 3IUQA 3QXHA 2VIXA 2BFBA 2VQCA 1DKRA 1A88A 2MYSA 4MSUA 4DBLE 1ZUNB 3CG4A 3TDUC 5F1PA 3C18A 5CXSA 2AMJA 1WSBA 3C43A 3TMKA 1WJGA 2CU7A 4FWHA 2XCOA 5GJBA 3H5NA 4P3KA 2JFFA 1FJXA 3TQOA 4W9NA 3K69A 3GX1A 5JLJA 4Z7NB 2QE7A 2HB6A 4WCFC 4CKBB 4UTVA 2B7BA 2LVQD 1CPYA 1HXDA 1XVIA 4H3KB 2COBA 1NVBA 4NU6A 4S1NA 2WJYA 4OHBA 5D00A 5EP4A 5D8DA 4P32A 2EG5A 5FPKA 4KPEC 3HL0A 3RPUA 1X3LA 3O3CA 3NGLA 4UTXA 4OFBA 2M2EA 2QOEA 1SBIA 4AUMA 4FBMA 3T3MB 3GYHX 3ZZNA 1D2NA 1E7WA 2X3UA 4EEZA 1BAPA 4QULA 4C29A 1XLTC 4G0YA 1PR1A 2DP4E 4WE3A 5JE8A 2UXBM 2D7GA 3K0EA 1LGYA 1MQ8B 4RH1A 3TTVA 2C7QA 1F36A 4FDMA 3SBJA 3IALA 2OAGA 2ZBFA 5DYMA 1VYUA 5BNTA 1U4OA 1VKZA 2ZTVA 4FXOA 5AJXA 3O91A 2EJWA 1ZHHA 4OQQA 4XCXA 4FGZA 5COQA 2VO1A 5E3LA 5T64A 1IM5A 2G08A 1EH8A 3GAAA 3O8LA 3G5AA 3H18A 1P2DA 4JI2M 3I64A 3LA3A 1RKVA 4O4LA 4NWIA 3PUZA 2OF7A 2XGEA 1H0SA 4WOBA 1GCAA 1GCOA 3SMPA 5K0LA 2AC7A 4DLZA 4RXMA 5KTTA 1NRJB 1V45E 1GNPA 5HTKA 5HKOA 4HPWA 3N28A 3ELKA 1MH3A 4UE2A 5AKKA 1Y5LA 3COYA 5HRAA 3ONEA 5EY5B 3GLIE 5GPCA 3CMEI 1A5JA 3RH0A 1CZOA 1Z22A 3HXMA 5HXAA 2VE8A 3ETDA 1JQ5A 3SEAA 3A6EA 4UNSA 3FKSA 3EMVA 3GRAA 4KP7A 4RKFA 4P4UA 4HQLA 1E6UA 4HDCA 3C14C 4TS3A 4DUZB 2GJ9A 1Q3CA 2M60A 2QM0A 2C95A 1HFKA 1EA5A 2GM4A 1WBBA 4WF2A 3GP3A 4XKJA 2QTCA 3WFJA 1T08B 1ZUNA 3BXEA 2C04A 4Q03A 1NJ1A 2K7LA 1T9HA 3DTYA 1F0YA 2C5GA 3HY4A 1Z6TA 1W4RA 3JZAA 1U4NA 4EKGA 2IEIA 1NYQA 4MZXA 3QELB 1CQJB 3C85A 3FIWA 4FX5A 4ZI7B 1NULA 4HGOA 2YU9J 1AS3A 3TPZA 1PUEE 4EB8A 4RHUA 4ND4A 3T0GA 3QY9A 3IIKA 3OT1A 3LC0A 2OP1A 1I7LA 2