2FNCA

Thermotoga maritima maltotriose binding protein bound with maltotriose.
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
379
structure length
379
Chain Sequence
KLTIWCSEKQVDILQKLGEEFKAKYGIPVEVQYVDFGSIKSKFLTAAPQGQGADIIVGAHDWVGELAVNGLIEPIPNFSDLKNFYDTALKAFSYGGKLYGVPYAMEAVALIYNKDYVDSVPKTMDELIEKAKQIDEEYGGEVRGFIYDVANFYFSAPFILGYGGYVFKETPQGLDVTDIGLANEGAVKGAKLIKRMIDEGVLTPGDNYGTMDSMFKEGLAAMIINGLWAIKSYKDAGINYGVAPIPELEPGVPAKPFVGVQGFMINAKSPNKVIAMEFLTNFIARKETMYKIYLADPRLPARKDVLELVKDNPDVVAFTQSASMGTPMPNVPEMAPVWSAMGDALSIIINGQASVEDALKEAVEKIKAQIEKGSHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of redundant maltotriose binding proteins from the thermophile Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Sugar binding protein
molecule keywords maltose ABC transporter, periplasmic maltose-binding protein
total genus 124
structure length 379
sequence length 379
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2fncA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2fncA01
3BFUA 3PUZE 5TP9A 1IXCA 3TYHA 1S9TA 3IJXB 3R26A 3SEWA 2OBGA 2UVHA 1B0HA 1FQEA 2I0BA 4R2BA 4GLIA 4R6HA 3TELA 5CM6A 3U92A 4YICA 3T22A 3SESA 1JEUA 2PBWA 1LB8A 2O68A 2F8DA 3OENA 4G68A 4KD5A 4NTLA 4EQBA 3PUWE 2V3QA 4F3PA 5I56B 4GRKA 5FTHA 2XXYA 3UN6A 2RCAA 3G3JA 3G7WA 1JETA 1YPNA 4GL8A 3TEPA 4PFYA 4F1VA 3TTKA 1WDNA 2QS4A 4FATA 1B5IA 4R6KA 5FHMA 4ZEDA 2ONRA 1LAFE 4M1VA 2DOJA 4Q8RA 4OFOA 3N26A 3G3FA 1TWYA 4BDRA 3W9WA 5IAIA 1MM7A 2GRVA 2NWJA 5DEXA 1I6AA 2O7IA 3TTMA 2QRYA 4POWA 1GVCA 1OQGA 3K1PA 4JWXA 3K6VA 3QUJA 4TLLB 5TPAB 3EF7A 3MPLA 4TOZA 3KZGA 3SEVA 4EF1A 5A5XA 4H8IA 1NMUA 3HCQA 4RK9A 2PYYA 4YKJA 4NWDA 1MY4A 4OWDA 1SYHA 4I9DA 2DWIA 3PU5A 4C0RA 2F6PA 2H9BA 1MQDA 4IO6A 5TPAA 1LAGE 1FTOA 4G2ZA 2I3VA 1H76A 1USYE 1FTMA 4QSDA 4M4GA 4DXBA 1FQFA 1SI0A 2Q89A 2OJTA 2X7PA 2ZYKA 2BJJX 4FECA 3FZVA 3KG2A 4H5GA 4LZ5A 3KN7A 3OXNA 5F7VA 3TAJA 1Y3PA 4ELRA 3FUZA 1LBBA 3PPPA 4U1ZA 4U23A 1MY1A 4LA9A 1BKAA 4NF8A 3OO7A 1EH3A 4PE5B 3TKDA 3CR9A 3O2AA 1NKXA 1WODA 1XT8A 3LBSA 1I6BA 2HAUA 2THIA 1P1WA 3JZJA 3M3LA 1Y1ZA 3O6IA 4X1DA 2ZYMA 5DTBA 3TPAA 2YJPA 3FGSA 3FV1A 3KN3A 5AA4B 1D9YA 3K6XA 4OHNA 3SEUA 2QPQA 3MP6A 1SBPA 2H99A 1NH7A 3ODBA 4NF8B 4HCYA 4EUOA 3ZKKA 1JEVA 2O1LA 3PPQA 4QFPA 1M5FA 4ISUA 3M3KA 2W7YA 4YKPA 2F7BA 2ZNSA 3EHTA 1FW0A 4HS7A 3A3UA 4YAHX 3VLVA 5K2XA 4NF5A 2GH9A 3PMXA 4HTGA 1A8EA 4LVQA 1YAEA 4L17A 5CMMA 3FATA 3E4RA 4DE8A 3TFLA 1VR5A 2CMOA 4BDMA 3S9MC 1IEJA 3ILUB 4F29A 1SW1A 3O66A 3V83A 1M5CA 2I48A 4OMBA 4C1UA 2Z22A 1LAXA 1A55A 1POY1 3MVYA 4JB7A 3SEYA 4ZE9A 5AA2B 3DM0A 3L6GA 2P2AA 3S9NC 3HPIA 1KWHA 4H1XA 1RYOA 4QHQA 2Y7KA 4ZZAA 3VV5A 1URGA 3HHGA 3KJ7A 3N94A 1N7WA 2HZKA 3KJTA 4N6PA 3RQTA 2G29A 2ONSA 2QS3A 3UP9A 4ELPA 2A5TA 3DELB 4XXUA 1SW5A 4FE8A 1QJMA 4LZ7A 1BIYA 3U1OA 3C4MA 3KFMA 1B7UA 3KN8A 4H5FA 3LUYA 1JVYA 4ZDMA 4G68C 5H8QB 5KDTA 1Y3NA 2V84A 4PQJA 4YKKA 1QUJA 5I2NA 2VHAA 3UK4A 1MPDA 1B0LA 1Y3QA 3IORA 4G68B 4O3AA 3V8XB 2I4CA 1R9LA 3FASA 4XKPA 3CG1A 3C32A 3EN3A 4GOTA 1FTJA 1FQDA 4PFWA 1N7XA 4MLVA 5FHOA 1IQ7A 3VFJA 2Y7RA 4IY6A 3LSWA 3IAZA 4P11A 2QL3A 3MP1A 2PX1A 2R71A 1MM6A 3FJMA 1MRPA 2F7CA 4X9TA 3OELA 4NF4B 4ZE8A 1GV8A 2IEEA 3QK6A 2LAOA 1TFDA 3HSTA 2F5XA 1GR2A 3RTWB 1VSOA 4O3BA 4BDNA 5I59A 4EXKA 1B3GA 3USDA 3MZ1A 1XS5A 3T9XB 1MH3A 2DXRA 3RTFB 1ZTYA 3LSLA 2I0CA 1AOVA 3EQ1A 3A09A 1B3FA 3BFTA 3Q29A 1IITA 1LCTA 3GLBA 3S2VA 1ZKBA 2REJA 1A40A 1H44A 5F1QA 1B58A 3RN8A 4F2QA 3OO9A 2XXXA 3CIJA 4DCYA 1IZ1A 2DE4A 3PD8A 3T9VA 3ZS6A 4U1OA 1JQFA 2H25A 1A99A 1POTA 2F35A 1S50A 1FQBA 4OEVA 3CFXA 1NH8A 3VXBA 3M3FA 4U22A 3E9XA 3Q26A 3VLUA 2QMWA 3Q27A 5AA3A 1MXWA 2F34A 4E0XA 1R6ZA 3ZSFA 3KOTA 4PFTA 2ZNUA 3SETA 4AQ4A 3K1NA 1IXHA 3K6WA 4H65A 2UVJA 5EHMA 3TQWA 2D21A 3B6QA 1II5A 4R73A 2H98A 3SKPA 2A5SA 5ISUA 4KR5A 4KPTA 4OXVA 1Q35A 4R9FA 5I58B 1LB9A 3PUXE 4NF6B 4R75A 4ZEBA 4F3SA 2XXPA 3O97A 5DVJA 4F3GA 4N07A 3VVEA 2F7AA 3MVWA 4OTEA 4IO2A 4Q30B 2DWJA 1Y9UA 4PFUA 4WEDA 4XKQA 2R9JA 3T9UA 1SW4A 1P1OA 2AIXA 1MQGA 3CSGA 1MY3A 1NNTA 4RPNA 3D4CA 3MC2A 1AL3A 1SW2A 1UTBA 2QSXA 5DVIA 5H8FA 1PEBA 3CVGA 3IOTA 4KHZE 1MQIA 2Y84A 1N76A 3MZBA 3GXAA 3QYTA 2CZLA 5H8HB 1HSLA 1NNPA 4JWYA 3PPRA 4U4XA 4LUBA 3S9LC 3FIRA 3QIMA 1MXUA 3DP6A 4YB7A 3KSJA 1J1NA 2XD3A 1DPEA 1MXVA 3W9VA 4Z7EA 1OLAA 2HAVA 4YMAA 4KFQA 1US5A 4F1YA 2QS2A 1MY0A 3MPKA 3OEMA 2R6GE 4DZ1A 1OLCA 4GD5A 1A7LA 1TT1A 1YCJA 2AYSA 2FYIA 2HFBA 2V25A 2XXRA 4QFNA 3RPWA 1B40A 2X26A 3PMWA 4OQOA 1MDQA 4BDOA 3O28A 4JWOA 3LSFB 2REGA 4GQOA 4OFJA 4AB5A 4Q0CA 1O63A 3U8QA 4KYSA 4R2FA 4EF2A 2E1SA 4ECFA 2Q9TA 2DE3A 3H6WA 3TCGA 4F19A 2PT1A 4F1UA 4XTCQ 1MQJA 2F36A 4F2OA 2O51A 5CBRA 2XXHA 3K01A 2Y7WA 1LLSA 3K1MA 4N13A 2DXYA 2ZXTA 5CMCA 1N84A 3QUFA 5CC2A 1DOTA 1QUIA 3M8UA 1PB7A 2XD2A 4NF6A 3C34A 2GFEA 3F11A 3K0VA 4MBPA 4R72A 1B3HA 4XKRA 1YTVA 3R7XA 3THIA 4LP2B 1URSA 1URDA 2HEUA 3UA8A 4XIGQ 1FQAA 5DVFA 2PT2A 3LC8A 1ZJLA 4WEPA 1H43A 4AB6A 1LFHA 1QKAA 2Q2CA 3BBRA 1SD3A 2XXWA 1B7HA 5L9SA 5I58A 1MS7A 1PDAA 3I6VA 3MVXA 4ESWA 2I6EA 3ONMA 4K3FA 4ND9A 1P1NA 4ELQA 3KGCA 3EHSA 1B2HA 3OSQA 5CI5A 5A5XB 4I62A 3Q28A 4WXJA 2O1MA 2V3TA 4UACA 4GFRA 3E3KA 1UQWA 5DEXB 2Q8JA 3FXUA 3IJOB 3TMGA 1OVBA 1EZ9A 3DP8A 5H8QA 1B5HA 3FVKA 1B9JA 3PPNA 4DDDA 1R9QA 3IO4A 3MWBA 3PD9A 5K2YA 3U93A 4GIZA 4BDQA 2FNCA 1MDP1 1B32A 3S4UA 4ESXA 1B7ZA 5I2KB 1SDXA 3FJGA 1Z7NE 2DE2A 3MBPA 4F18A 1BTJA 2O69A 3CFLA 3CI8A 4GF8A 1SI1A 2DVCA 5AA4A 3T66A 5I57B 1OQHA 1ATGA 3L6HA 4GL0A 1MY2A 3C36A 5KCJB 2QMXA 3CG3A 3IB0A 3KOSA 1MH4A 5H8SA 3SEXA 3SERA 4OESA 5AA2A 5I84A 4G77A 5EYFA 5J1DA 1HSEA 1QULA 1PBQA 4F3BA 1Y4CA 1XVYA 3HN0A 1MPBA 2RC9A 2XXUA 4NWCA 2DP8A 2VD2A 2HCAA 3IOWA 3N6TA 4FIMA 1Y4TA 1SYIA 4KYEA 5I56A 2D3IA 3PUYE 3O29A 3T9HB 1FTKA 2ESNA 3I5OA 3H6VA 3PGFA 5EHSA 4KI0E 3K4UA 4IGTA 1N04A 1A54A 2Y7IA 2ZNTA 1HSJA 2NOOA 1MXXA 5CMKA 4KCCA 1AMFA 4O3CA 5ELVA 5H8FB 3U94A 4FEBA 4NE4A 4OENA 4RJZA 4C1TA 1OVTA 5BWJA 5I2KA 4TLMB 2ANJA 5AA1A 3G3KA 1JVXA 2VOZA 3RT8A 4QFLA 3T96B 3IX1A 3WAFA 5I59B 1MXZA 3HV1A 3PPOA 5I57A 1UTHB 4OZ9A 5KDTB 4DCXA 2DVZA 1M5DA 2VP1A 3TUSA 5ICTA 1QUKA 4YMBA 3TTRA 4EQ7A 1EU8A 1PC3A 1S7YA 3EHUA 4MF3A 2QS1A 3K00A 1XOCA 3FVOA 3GBAA 4KYDA 2UYFA 3T93B 3TQLA 5B7DA 2HQ0A 2XHDA 2XX8A 1B52A 3RY3A 3H03A 4U4SA 4UA8A 2UVGA 2XXTA 3A3CA 1B3LA 1TXFA 2RCBA 3H4ZA 4IO5A 3OSRA 4IO3A 4HCWA 4ZECA 2HZLA 3I3VA 3PMVA 2OLBA 3UIFA 3MW0A 1ZLQA 4U2RA 3H06B 4YU0A 1XC1A 2RC7A 4QSCA 3FVGA 1OMPA 2Y7PA 1LFIA 3IB1A 3IB2A 3DLNA 2XXVA 3EPEA 4LQ5A 1BLFA 1ELJA 1H45A 1USYH 2DWAA 2RF1A 2YLNA 5B70A 2XX9A 2XXQA 3KEIA 5CBSA 2V3UA 4GXSB 2I3WA 5ITOA 3TCFA 5HBCA 3CRBA 5H8NB 1I6QA 5JEIA 3IR1A 3FV2A 4RPOA 3OMBA 2GHAA 1MQHA 1ZBMA 2I4BA 2Q2AA 1A8FA 4OFLA 3KSXA 2UYEA 4G8HA 4YZZA 2RKMA 4LQ2A 2DS9A 4QFOA 2ALUA 3VVDA 4E0WA 1B51A 3WAEA 4IY5A 2OK2A 3N6UA 2OCUA 2Z8EA 3Q25A 4RA1A 2DWHA 5DYHA 5H8NA 4R6YA 4IO7A 4OETA 3VVFA 1P1QA 4PP0A 1P1UA 1Y1MA 2VD3A 1M5EA 1MG1A 1EZOA 4LATA 3LR1A 1DPPA 3C31A 5TU0A 5AA2D 1OIBA 1O64A 2NVUB 5FHNA 2H5YA 2O84X 1QVSA 1JW4A 4GVOA 4NMYA 3KBRA 3OOAA 1MXYA 3JV9A 4DLDA 2DSFA 3P7IA 1RKMA 3GBBA 3MZ9A 4RY1A 5TP9B 3OEKA 2KLFA 2B3BA 4FJPA 4IGRA 5JTYB 1RYXA 1XVXA 2XX7A 4OEUA 2Z8DA 1NL5A 1P99A 5L9MA 4PETA 3C35A 4WKMA 1MPCA 3FD3A 5LOMA 1Z7ME 2UXAA 4NEDA 4P0GA 5L8DA 3SDFA 3N5LA 3QXMA 3UORA 1EZPA 1D9VA 2DYXA 4YB6A 4F31B 1LCFA 1SVXB 4LZ8A 5ICQA 3VDFA 4H6DA 4OVJA 1US4A 1LBCA 5CMBA 2O6AA 5CRYA 2HXWA 3H6UA 4ZEKA 5ITPA 1FQCA 1QKBA 2WKYA 4FORA 2YPNA 1ZIUA 1D4NA 3U72A 1CE2A 2ZYNA 3FXRA 1GGGA 4F22A 3OD7A 2G93A 4F39A 4NF5B 4JSDA 5KCJA 5JK4A 3OO6A 1ZU0A 3C9HA 3TTNA 3VXCA 1ANFA 1R1NA 1LSTA 3RUMA 1B05A 4DXUA 5AE4A 2M8CA 1SQYA 3TODA 4R9GA 1IXGA 3G3IA 3HHFA 3JYRA 1DTZA 3MUQA 4JBZA 3QAXA 1UTHA 3HO7A 1Y20A 3TTLA 3UGWA 4MLQA 1TFAA 2RINA 3RT6B 1F9BA 3LSXA 3GZGA 1ZMGA 3H3GA 4QRZA 2A5TB 3AXFA 4EQ9A 4JXIA 1N3XA 3TDJA 1N0TA 3ZKLA 4ONYA 1NNKA 2B65A 3C33A 4XKNA 4I1DA 1IUDA 4GXAA 4RK2A 3RNNA 2XXIA 1XHYA 2AL4A 2OWTA 3K2DA 4BLAA 3VE1B 3BKIB 4U21A 3O9PA 4G8NA 3D4GA 4ELOA 4JSOA 4FAJA 3IL1B 1CB6A 5IKBA 1PB9A 3B6WA 3E13X 4IO4A 4ZZEA 5DT6A 4MFIA 2Z23A 3PV0E 5HM4B 3K02A 3CSBA 3TZAA 2Z8FA 5FTIA 4POXA 4H0WA 1DSNA 2DQVA 3RGYA 1FCKA 4DIGA 5I2NB 2V93A 3K6UA 2ABHA 3R6UA 1DTGA 4KQPA 3QSLA 2P1SA 2O7UA 4KCDA 4RYAA 2Q88A 4H8JA 5M2VA 3V5AA 1Q1KA 3MAMA 2F6GA 4G8MA 1FTLA 3FJ7A 4IB2A 4QF9A 3FXQA 5H8HA 3G3HA 1B1XA 3IO6A 4OERA 4DXCA 4HW8A 2NXOA 2B3FA 2ZYOA 4X1BA 4Z0IA 4EDPA 2UVIA 3MJNA 4QSEA 1BP5A 2PVUA 3IOVA 1VFDA 1D3KA 1JW1A 3B6TA 5L9OA 4P0IA 1VE4A 2OZZA 4TQUQ 4YB5A 2IA4A 2RC8A 1B1HA 4I8CA 4Q5TA 1VFEA 2I58A 4RNSA 3OO8A 2X7QA 3W15C 5HPQA 2H4IA 3MVZA 3MP8A 5BUUA 4NF4A 4BDLA 1B46A 1GTKA 2AL5A 2ZMBA 3TCHA 1UIUA 4ZEFA 2P0SA 1T0KA 1M5BA 1UIVA 1LGBC 3CFZA 3IOUA 3O6HA 4GWOA 5KZTA 4THIA 3O6GA 1LFGA 2F97A 2I49A 3PUVE 4FEDA 4EXLA 3V89B 2FA7A 2NUVA 1LAHE 1H3DA 2F78A 1IIWA 4X48A 4ZS9A 1B6HA 4YKIA 4ZEIA 1L5TA 3VLWA 1IXIA 3G3GA 4G4PA 3ECRA 3H7MA 3ILTB 1B4HA 2D5WA 4OYVA 3RLFE 2PMSA 1NFTA 3IK6B 1PBPA 3B7DA 1I69A 2OWSA 3S9EA 1WVJA 2ONKE 1AH5A 1UTBB 3FVNA 4JDFA 5JTYA 1QW0A 1B5JA 1NNFA 3MQ9A 1JW5A 2E0SA 1B3EA 4H67A 4LONB 4RXLA 4QFKA 3DP4A 1O7TA 2VGQA 3H6TA 1PB8A 4MH5A 1B4ZA 1N3WA 2QJEA 1AIVA 1DMBA 2GHBA 1JNFA 4R74A
chains in the Genus database with same CATH superfamily
3TYHA 3R26A 2ZZVA 3TELA 3T22A 2PBWA 2O68A 5KCJB 3OENA 3G3JA 1JETA 4GL8A 4F1VA 1WDNA 4OVSA 4Q8RA 4JVCA 5IAIA 1OQGA 4TOZA 4NAPA 3HCQA 4PAIA 2L5VA 1MY4A 2VPOA 4IO6A 1SI0A 4FECA 3TAJA 3KN7A 4U1ZA 2JJKA 4PE5B 3CR9A 1I6BA 2THIA 4X1DA 1P1WA 3O6IA 3TPAA 4OHNA 2QPQA 1SBPA 2H99A 1FBEA 4NF8B 4HCYA 3PPQA 4QFPA 1FPEA 3M3KA 2W7YA 4YKPA 3A3UA 4NF5A 4LVQA 3E4RA 3ILUB 1RDZA 5AA2B 4JB7A 2QS3A 4ELPA 5A5XB 3KFMA 1B7UA 4ZDMA 4G68C 5KDTA 2V84A 5I2NA 4YKKA 3UK4A 4G68B 3FASA 4ZE8A 1FTJA 4IY6A 1MRPA 1GV8A 3QK6A 2WYKA 5I7IA 4EXKA 2DXRA 1ZTYA 1AOVA 1B3FA 3Q29A 1LCTA 3S2VA 1H44A 1B58A 4F2QA 4DCYA 3PD8A 2DE4A 3T9VA 1LBYA 2H25A 1S50A 1NH8A 3VXBA 3M3FA 2QMWA 1MXWA 2WYPA 2F34A 4OA4A 2FBPA 3KOTA 2ZNUA 1II5A 2H98A 4MNCA 2A5SA 2Q8MA 4OXVA 4R9FA 4O7IA 4ZEBA 1IMEA 3O97A 5DVJA 4IO2A 3T9UA 1Y9UA 4XKQA 1MY3A 1NNTA 1UTBA 5H8FA 4KHZE 2Y84A 5H8HB 5FBPA 1HSLA 4U4XA 4GWZA 4PCDA 1RDYA 2XD3A 4Z7EA 2HAVA 4F1YA 3OEMA 4GD5A 1A7LA 3SEWA 2FYIA 4HE2A 1B40A 3PMWA 2QFLA 4OQOA 1MDQA 1FBGA 3TCGA 4XTCQ 1MQJA 2F36A 5CBRA 4N13A 2Y7WA 1LBXA 4GWSA 3RPLA 3EKIA 1DOTA 1PB7A 4NF6A 4MBPA 4XKRA 1FPDA 4LP2B 4XIGQ 4GBVA 5DVFA 1ZJLA 2XWOA 4WEPA 1B7HA 4ESWA 4ELQA 2R8TA 1B2HA 2HXRA 2HPGA 2V3TA 3ROJA 1UQWA 3DP8A 5H8QA 1B5HA 4BDQA 3U93A 1NV4A 3MWBA 3S4UA 4PBQA 1SDXA 3FJGA 3CI8A 4GF8A 1SI1A 4GL0A 3C36A 2QMXA 3KOSA 4G77A 1Y4CA 1XVYA 1MPBA 3IOWA 4FIMA 1SYIA 1NV7A 2D3IA 5I3SA 1A54A 2ZNTA 5H8FB 3U94A 4FEBA 1FPJA 5I2KA 3D1RA 3T96B 3WAFA 4N17A 3PPOA 4OZ9A 4DCXA 3TUSA 2VP1A 5ICTA 3EHUA 4MF3A 3K00A 5B7DA 2HQ0A 2XX8A 2UVGA 4IO5A 1B3LA 3HFUA 3OSRA 4IO3A 2HZLA 4MX6A 4YU0A 1XC1A 2RC7A 3IB2A 4LQ5A 3DLNA 1H45A 5B70A 5CBSA 2I3WA 3TCFA 5H8NB 5JEIA 3IR1A 3FV2A 4RPOA 2GHAA 2I4BA 1A8FA 5ET7A 3KSXA 4YZZA 4E0WA 1B51A 3WAEA 2OK2A 4RA1A 4R6YA 3E79A 4OETA 4PP0A 1MG1A 4LATA 1DPPA 5TU0A 3KBRA 3JV9A 4DLDA 1NV5A 2DSFA 1RKMA 3GBBA 3P7IA 5TP9B 4IGRA 1NL5A 1P99A 4PETA 1MPCA 3FD3A 5LOMA 1Z7ME 5J16A 2ZZXA 5ICQA 5CRYA 1LBCA 2O6AA 3LV0A 1FQCA 3E78A 3OD7A 3TTNA 3C9HA 1ANFA 1R1NA 1B05A 5AE4A 5EQ9A 3QMFA 4R9GA 3JYRA 3QAXA 1NUZA 2RINA 3LSXA 1ZMGA 3H3GA 2A5TB 3AXFA 4EQ9A 3C33A 1XHYA 3O9PA 1PB9A 3PV0E 3GYYA 3CSBA 3TZAA 3RGYA 3R6UA 3K6UA 2ABHA 2O7UA 1Q1KA 4N4UA 1FTLA 5H8HA 4OERA 4X1BA 4HE0A 1D3KA 3B6TA 5L9OA 2XA5A 2OZZA 4PDDA 2XXKA 2IA4A 1NV0A 4P1EA 3OO8A 3W15C 5BUUA 2AL5A 1M5BA 1YYZA 3IOUA 5I5PA 4THIA 2I49A 3PUVE 4N6KA 5IZ3A 1B6HA 4YKIA 1B4HA 2PMSA 1PBPA 1I69A 3S9EA 1AH5A 5JTYA 1B5JA 1NV2A 3LUZA 4P47A 1N3WA 1IXCA 1S9TA 1K9YA 1FQEA 2Y5KA 4YICA 1IMBA 1JEUA 4KD5A 4G68A 3PUWE 2V3QA 2XXYA 2RCAA 3G7WA 4N6DA 1EYIA 4MAGA 4PFYA 4FATA 4ZEDA 2Y5LA 2DOJA 4OVQA 3N26A 1FBHA 2GRVA 2NWJA 1I6AA 1GVCA 2B4MA 3K6VA 1KA0A 2FVZA 4H8IA 4RK9A 4YKJA 1SYHA 2DWIA 2KQZA 2H9BA 1FJ9A 1USYE 1H76A 4QSDA 4M4GA 4DXBA 1FQFA 2Q89A 2OJTA 2ZYKA 2BJJX 3OXNA 1RDXA 3FUZA 1LBBA 3PPPA 4ELRA 1MY1A 3OO7A 3TKDA 3JZJA 2HAUA 5DTBA 2ZYMA 2YJPA 3FV1A 3K6XA 1FPBA 3MP6A 3ZKKA 3SEUA 2O1LA 4XF5A 1KZ8A 3VLVA 3IFAA 2GH9A 1A8EA 5CMMA 1YAEA 1FPLA 4L17A 3FATA 4DE8A 3TFLA 3S9MC 1IEJA 3SZPA 1M5CA 3SEYA 1A55A 4I40A 1KWHA 1RYOA 4XEQA 2WX9A 2Y7KA 3VV5A 1URGA 4NF0A 3UP9A 2A5TA 3DELB 4XXUA 4FE8A 1BIYA 3ISPA 4O3AA 2B4LA 4XKPA 5A5LA 1FQDA 4MLVA 4P11A 3IAZA 2F7CA 3OELA 2LAOA 4PF8A 4GWWA 1MH3A 3EQ1A 1IMDA 2PFZA 3KBZA 3BFTA 4PFBA 3GLBA 1A40A 3RN8A 2XXXA 3CIJA 1IZ1A 5LTCA 2P3VA 4OEVA 3CFXA 4P8BA 4U22A 3RYDA 4PFRA 1R6ZA 3ZSFA 4AQ4A 4BDNA 5EHMA 2D21A 4KR5A 1IMFA 4F3GA 4PGNA 3MVWA 4OTEA 3VE1B 4PFUA 1MQGA 2QSXA 5DVIA 3CVGA 1N76A 3MZBA 1NNPA 1NUWA 4LUBA 4PDHA 3FIRA 3QIMA 1MXUA 4YB7A 1J1NA 3CHGA 1DPEA 1OLAA 4YMAA 2QS2A 1MY0A 3MPKA 4DZ1A 1TT1A 2AYSA 2V25A 4QFNA 4BDOA 3O28A 2VT5A 3U8QA 4KYSA 3H6WA 4F19A 2PT1A 2O51A 1LLSA 5CMCA 2ZXTA 2QVUA 1QUIA 3M8UA 2XD2A 3F11A 4R72A 3THIA 1YTVA 1URDA 3UA8A 1FQAA 4O8MA 1H43A 4P1LA 1QKAA 1SD3A 5ET5A 4OANA 3T1BA 4K3FA 3EHSA 3Q28A 4WXJA 1FSAA 2O1MA 4UACA 4GFRA 2OX3A 3IJOB 3TMGA 1OVBA 3PPNA 3PD9A 4ESXA 1KA1A 2FNCA 1B7ZA 1Z7NE 2DVCA 1OQHA 1ATGA 3CG3A 5H8SA 2RC9A 5I56A 2HCAA 1Y4TA 4KYEA 3PUYE 3T9HB 3H6VA 2MKZA 1DK4A 2NOOA 5ELVA 1AMFA 1LBWA 5AA1A 5I59B 3BIGA 4QFLA 1MXZA 4JVDA 5KDTB 1M5DA 4YMBA 3TTRA 1EU8A 1NV3A 2QS1A 2WEFA 1NUXA 3GBAA 3T93B 2UYFA 5F24A 1B52A 4NQ8A 3RY3A 4UA8A 2XXTA 3H4ZA 2RCBA 4ZECA 4H45A 2OLBA 3MW0A 1ZLQA 4U2RA 3IB1A 4DDDA 1USYH 1BLFA 1ELJA 2YLNA 5ITOA 5HBCA 1I6QA 3OMBA 4OFLA 1LEVA 4G8HA 2RKMA 3VVDA 4QFOA 2ALUA 3Q25A 5DYHA 5ET6A 3VVFA 1EZOA 5IZ3B 2H5YA 2O84X 4NMYA 3OEKA 5JTYB 1RYXA 1LBZA 1XVXA 4OEUA 3NOHA 5L9MA 4NEDA 4P0GA 5L8DA 2DYXA 4YB6A 1SVXB 4LZ8A 4H6DA 3H6UA 1YZ0A 1QKBA 2YPNA 1G0IA 4F22A 2G93A 5KCJA 1ZU0A 3RUMA 1IXGA 3MUQA 1DTZA 1UTHA 3UGWA 4JXIA 1N3XA 2BJIA 1NV1A 4G61A 3ZKLA 2B65A 3BKIB 4U21A 3D4GA 4ELOA 1FJ6A 3IL1B 3B6WA 3E13X 4IO4A 1FBCA 4MFIA 2Z23A 5HM4B 2Z8FA 4N81A 1DSNA 2DQVA 2XWIA 5I2NB 1DTGA 4RYAA 5M2VA 2Q88A 4G8MA 3FJ7A 3G3HA 1B1XA 4Z0IA 1VFDA 4I3YA 2RC8A 1B1HA 4RNSA 2X7QA 4BDLA 2FHYA 1B46A 1D9QA 1UIUA 1T0KA 4NGUA 2F97A 4FEDA 4EXLA 1LAHE 4ZS9A 1K9ZA 1IXIA 5I59A 3ECRA 3H7MA 1AWBA 3B7DA 1WVJA 3FVNA 1QW0A 4H67A 4X8RA 2VGQA 3H6TA 1PB8A 1B4ZA 4PE3A 1DMBA 3BFUA 5TP9A 2UVHA 1B0HA 4MIJA 4GLIA 4R6HA 4MCOA 4F3PA 5I56B 4GRKA 5FTHA 4PBHA 1YPNA 3TEPA 2QS4A 1B5IA 5FHMA 2F3DA 4OFOA 1TWYA 3W9WA 4AS5A 1MM7A 1FBFA 4MMPA 2QRYA 4TLLB 5TPAB 3MPLA 3KZGA 4EF1A 4DI4B 4PAKA 4NWDA 4OWDA 4C0RA 4I9DA 3PU5A 2F6PA 4DI3D 1MQDA 1DCUA 4G2ZA 1FTMA 3KG2A 1Y3PA 4U23A 1EH3A 1FRPA 3LBSA 1WODA 1XT8A 4C1UA 5T3JA 3FGSA 5AA4B 4IR8A 1NH7A 4EUOA 1FBDA 4ISUA 4NHBA 2ZNSA 3EHTA 1FW0A 2XWVA 1FTAA 4F29A 1SW1A 3KC0A 4ZE9A 3MVYA 3L6GA 3S9NC 4H1XA 4QHQA 4DIGA 3S9LC 3HHGA 3KJ7A 1N7WA 2HZKA 4N6PA 2G29A 1SW5A 1QJMA 3C4MA 3KN8A 4NX1A 3LUYA 4PQJA 2VHAA 3IORA 2I4CA 3C32A 5FHOA 2R71A 1MM6A 1TFDA 3RTWB 1VSOA 4O3BA 2WBBA 3MZ1A 1XS5A 2PCRA 3LSLA 3A09A 1XI6A 1INPA 1A99A 1POTA 2F35A 5LDZA 3VLUA 3Q26A 3Q27A 3SETA 4PFTA 5ISUA 1FPIA 4R75A 2XXPA 4N8YA 4N07A 2F7AA 4WEDA 2DWJA 2R9JA 4NN3A 1SW4A 4RPNA 3D4CA 3MC2A 1AL3A 1SW2A 1PEBA 3IOTA 3GXAA 1JP4A 4JWYA 4N91A 3DP6A 3FBPA 1MXVA 3W9VA 1US5A 1EYKA 1OLCA 2HFBA 4GWXA 2X26A 4OVPA 4JWOA 5IZ1A 4OFJA 2REGA 3B50A 4Q0CA 1O63A 5IZZA 4R2FA 5EYHA 2DE3A 4F1UA 4JVIA 4F2OA 3K01A 3K1MA 1N84A 3QUFA 3C34A 3R7XA 2GFEA 1B3HA 2ZZWA 2HEUA 1NI9A 2PFYA 2PT2A 2Q2CA 2XXWA 5I58A 1MS7A 1PDAA 2I6EA 4ND9A 3KGCA 2Q8JA 3FXUA 1EZ9A 1R9QA 5A5XA 4GIZA 1B32A 4GX6A 3MBPA 3RPLB 4F18A 5AA4A 5I57B 4HXVA 1MH4A 4OESA 5I84A 2KR0A 5J1DA 1QULA 1PBQA 4F3BA 3HN0A 2XXUA 2DP8A 2VD2A 3N6TA 1SPIA 3O29A 1FTKA 3PGFA 1HSJA 4O3CA 4C1TA 3BIHA 1OVTA 4PTKA 4TLMB 3G3KA 2VOZA 3RT8A 3HV1A 1UTHB 1PC3A 1XOCA 3FVOA 2CEYA 2XHDA 4MHFA 3H03A 5EHSA 4HCWA 3I3VA 3UIFA 3MSTA 3H06B 4QSCA 1OMPA 2Y7PA 1LFIA 2XXVA 2RF1A 2DWAA 2XX9A 2XXQA 3KEIA 2V3UA 4GXSB 3CRBA 2VPNA 1MQHA 1ZBMA 2UYEA 5IM2A 3PTYA 4LQ2A 4MNPA 2DS9A 3N6UA 2OCUA 2Z8EA 5H8NA 1P1QA 1P1UA 1Y1MA 2VD3A 3LR1A 1EYJA 5AA2D 1O64A 2NVUB 3IFCA 5FHNA 1QVSA 1JW4A 3OOAA 4O94A 3MZ9A 4FJPA 2Z8DA 3FXBA 3C35A 4P3LA 2UXAA 3SDFA 3QXMA 4F31B 5CMBA 4OVJA 1US4A 4ZEKA 5ITPA 4FORA 1D4NA 3U72A 1CE2A 2ZYNA 1GGGA 3U65A 4F39A 4NF5B 4HE1A 5JK4A 3VXCA 4DXUA 2M8CA 1SQYA 3TODA 4GWYA 3G3IA 1NUYA 1IMCA 4JBZA 1Y20A 3TTLA 4MLQA 1TFAA 3RT6B 5IGAA 3TDJA 1N0TA 4ONYA 1NNKA 3RNNA 4I1DA 1IUDA 4MEVA 4RK2A 2XXIA 2AL4A 4G8NA 4P56A 4FAJA 2DDKA 5IKBA 4ZZEA 5DT6A 4GX3A 3K02A 1FCKA 3QSLA 3MAMA 4QF9A 3FXQA 1IMAA 3IO6A 4DXCA 4HW8A 2NXOA 2B3FA 4EDPA 2UVIA 1YXIA 1BP5A 2PVUA 4TQUQ 4I8CA 4Q5TA 1VFEA 2I58A 4MNIA 5HPQA 2H4IA 3MVZA 3MP8A 1GTKA 3TCHA 2P0SA 3O6HA 3O6GA 1LFGA 3V89B 1Q9DA 1H3DA 4X48A 3VLWA 4ZEIA 4GX4A 4OYVA 2OWSA 4KXPA 1UTBB 4OVRA 4LONB 4I3EA 1JW5A 2E0SA 4RXLA 4QFKA 4MH5A 2QJEA 1AIVA 4NE4A 1JNFA 3PUZE 3IJXB 2OBGA 5CM6A 2I0BA 4R2BA 3U92A 3SESA 4NTLA 1LB8A 4EQBA 2F8DA 3UN6A 3TTKA 4R6KA 2ONRA 1LAFE 4M1VA 3G3FA 4LN5A 4BDRA 5DEXA 2O7IA 3TTMA 4POWA 3K1PA 4JWXA 3QUJA 3SEVA 3EF7A 1NMUA 2PYYA 4GBWA 4UABA 5TPAA 1LAGE 2V4CA 1FTOA 4N8GA 2I3VA 2X7PA 3B8BA 4H5GA 3FZVA 4LZ5A 5F7VA 4N15A 2CZKA 4LA9A 1BKAA 4NF8A 3A29A 3O2AA 1NKXA 3M3LA 1Y1ZA 4PGPA 3KN3A 1D9YA 4AS4A 3ODBA 4GWUA 1JEVA 1M5FA 2F7BA 4HS7A 4YAHX 5K2XA 3PMXA 4HTGA 1VR5A 2CMOA 4BDMA 3O66A 3V83A 4PAFA 2I48A 4OMBA 2Z22A 1LAXA 1POY1 3DM0A 2P2AA 3HPIA 4ZZAA 1DBZA 3RQTA 3N94A 3KJTA 2ONSA 3U1OA 4LZ7A 4H5FA 1JVYA 5H8QB 1Y3NA 1QUJA 1MPDA 1B0LA 1Y3QA 3V8XB 1R9LA 5KZTA 5ESYA 3CG1A 4GOTA 3EN3A 4PFWA 4FBPA 1N7XA 3VFJA 1IQ7A 2Y7RA 3LSWA 4WKMA 2QL3A 3MP1A 2PX1A 3FJMA 4X9TA 4NF4B 2IEEA 4XFEA 3HSTA 2F5XA 1GR2A 1B3GA 3USDA 3T9XB 3RTFB 2I0CA 1IITA 1ZKBA 2REJA 5F1QA 3OO9A 3ZS6A 4U1OA 1JQFA 4O7MA 1FQBA 3E9XA 5AA3A 3K1NA 1IXHA 3K6WA 4H65A 2UVJA 3TQWA 3B6QA 4R73A 3SKPA 4KPTA 1Q35A 5I58B 1LB9A 3PUXE 4NF6B 4F3SA 3VVEA 4Q30B 1P1OA 2AIXA 3CSGA 2F3BA 5EQAA 1MQIA 3MYUA 3QYTA 2CZHA 2CZLA 3PPRA 3KSJA 4KFQA 1FPGA 2R6GE 1YCJA 2XXRA 3RPWA 1VDWA 3LSFB 4AB5A 4GQOA 4EF2A 2E1SA 4ECFA 2Q9TA 4PF6A 2Q74A 2XXHA 2DXYA 5CC2A 2HHMA 3K0VA 1URSA 4PC9A 3LC8A 4AB6A 1LFHA 3BBRA 3KC1A 5L9SA 3I6VA 3MVXA 3ONMA 1BK4A 1P1NA 3OSQA 5CI5A 4I62A 5DEXB 3E3KA 3FVKA 1B9JA 3IO4A 5K2YA 1MDP1 5I2KB 2DE2A 1BTJA 2O69A 3CFLA 4NG7A 3T66A 3L6HA 5ET8A 1MY2A 3IB0A 3SEXA 5AA2A 3SERA 2WBDA 5EYFA 1HSEA 4NWCA 2ESNA 3I5OA 4KI0E 5EQ8A 3K4UA 4IGTA 1CNQA 1N04A 2Y7IA 1MXXA 5CMKA 4KCCA 4OENA 4RJZA 1G0HA 5BWJA 2ANJA 1JVXA 3IX1A 5I57A 2DVZA 1QUKA 4MJOA 4EQ7A 2QVVA 3T0JA 1S7YA 1NV6A 4KYDA 3TQLA 2FIEA 1FPKA 4U4SA 3A3CA 1TXFA 3PMVA 1QGXA 3FVGA 3EPEA 2Q2AA 2QVRA 2FIXA 4IY5A 2DWHA 4IO7A 1FPFA 1M5EA 3C31A 1OIBA 4GVOA 1MXYA 4RY1A 2KLFA 2B3BA 2XX7A 3N5LA 4P9KA 3UORA 1EZPA 1D9VA 1LCFA 3VDFA 2HXWA 2WKYA 1ZIUA 3FXRA 4JSDA 3OO6A 2CZIA 1LSTA 3HHFA 3HO7A 4QBAA 1F9BA 3GZGA 4X04A 4QRZA 4XKNA 4GXAA 2OWTA 3K2DA 4BLAA 2XWKA 4JSOA 1CB6A 2OWZA 5EQ7A 5FTIA 4POXA 4H0WA 2V93A 4KQPA 2P1SA 4KCDA 4OVTA 4H8JA 3V5AA 2F6GA 4IB2A 4QXDA 1LBVA 2ZYOA 5DW8A 3MJNA 5EYGA 4QSEA 3IOVA 4H46A 1JW1A 4P0IA 1VE4A 4YB5A 2GQ1A 2CEXA 4NF4A 1FBPA 4PFIA 2ZMBA 4ZEFA 1UIVA 1LGBC 3CFZA 4GWOA 2P3NA 2FA7A 2NUVA 2F78A 1IIWA 1L5TA 3G3GA 4G4PA 4E0XA 3ILTB 3RLFE 2D5WA 1NFTA 3IK6B 4JDFA 2ONKE 1NNFA 3MQ9A 1B3EA 3DP4A 1O7TA 2GHBA 4R74A
chains in the Genus database with same CATH topology
3BFUA 3PUZE 5TP9A 1IXCA 3TYHA 1S9TA 3IJXB 3R26A 3SEWA 2OBGA 2UVHA 1B0HA 1FQEA 2I0BA 4R2BA 4GLIA 4R6HA 3TELA 5CM6A 3U92A 4YICA 3T22A 3SESA 1JEUA 2PBWA 1LB8A 2O68A 2F8DA 3OENA 4G68A 4KD5A 4NTLA 4EQBA 3PUWE 2V3QA 4F3PA 5I56B 4GRKA 5FTHA 2XXYA 3UN6A 2RCAA 3G3JA 3G7WA 1JETA 1YPNA 4GL8A 3TEPA 4PFYA 4F1VA 3TTKA 1WDNA 2QS4A 4FATA 1B5IA 4R6KA 5FHMA 4ZEDA 2ONRA 1LAFE 4M1VA 2DOJA 4Q8RA 4OFOA 3N26A 3G3FA 1TWYA 4BDRA 3W9WA 5IAIA 1MM7A 2GRVA 2NWJA 5DEXA 1I6AA 2O7IA 3TTMA 2QRYA 4POWA 1GVCA 1OQGA 3K1PA 4JWXA 3K6VA 3QUJA 4TLLB 5TPAB 3EF7A 3MPLA 4TOZA 3KZGA 3SEVA 4EF1A 5A5XA 4H8IA 1NMUA 3HCQA 4RK9A 2PYYA 4YKJA 4NWDA 1MY4A 4OWDA 1SYHA 4I9DA 2DWIA 3PU5A 4C0RA 2F6PA 2H9BA 1MQDA 4IO6A 5TPAA 1LAGE 1FTOA 4G2ZA 2I3VA 1H76A 1USYE 1FTMA 4QSDA 4M4GA 4DXBA 1FQFA 1SI0A 2Q89A 2OJTA 2X7PA 2ZYKA 2BJJX 4FECA 3FZVA 3KG2A 4H5GA 4LZ5A 3KN7A 3OXNA 5F7VA 3TAJA 1Y3PA 4ELRA 3FUZA 1LBBA 3PPPA 4U1ZA 4U23A 1MY1A 4LA9A 1BKAA 4NF8A 3OO7A 1EH3A 4PE5B 3TKDA 3CR9A 3O2AA 1NKXA 1WODA 1XT8A 3LBSA 1I6BA 2HAUA 2THIA 1P1WA 3JZJA 3M3LA 1Y1ZA 3O6IA 4X1DA 2ZYMA 5DTBA 3TPAA 2YJPA 3FGSA 3FV1A 3KN3A 5AA4B 1D9YA 3K6XA 4OHNA 3SEUA 2QPQA 3MP6A 1SBPA 2H99A 1NH7A 3ODBA 4NF8B 4HCYA 4EUOA 3ZKKA 1JEVA 2O1LA 3PPQA 4QFPA 1M5FA 4ISUA 3M3KA 2W7YA 4YKPA 2F7BA 2ZNSA 3EHTA 1FW0A 4HS7A 3A3UA 4YAHX 3VLVA 5K2XA 4NF5A 2GH9A 3PMXA 4HTGA 1A8EA 4LVQA 1YAEA 4L17A 5CMMA 3FATA 3E4RA 4DE8A 3TFLA 1VR5A 2CMOA 4BDMA 3S9MC 1IEJA 3ILUB 4F29A 1SW1A 3O66A 3V83A 1M5CA 2I48A 4OMBA 4C1UA 2Z22A 1LAXA 1A55A 1POY1 3MVYA 4JB7A 3SEYA 4ZE9A 5AA2B 3DM0A 3L6GA 2P2AA 3S9NC 3HPIA 1KWHA 4H1XA 1RYOA 4QHQA 2Y7KA 4ZZAA 3VV5A 1URGA 3HHGA 3KJ7A 3N94A 1N7WA 2HZKA 3KJTA 4N6PA 3RQTA 2G29A 2ONSA 2QS3A 3UP9A 4ELPA 2A5TA 3DELB 4XXUA 1SW5A 4FE8A 1QJMA 4LZ7A 1BIYA 3U1OA 3C4MA 3KFMA 1B7UA 3KN8A 4H5FA 3LUYA 1JVYA 4ZDMA 4G68C 5H8QB 5KDTA 1Y3NA 2V84A 4PQJA 4YKKA 1QUJA 5I2NA 2VHAA 3UK4A 1MPDA 1B0LA 1Y3QA 3IORA 4G68B 4O3AA 3V8XB 2I4CA 1R9LA 3FASA 4XKPA 3CG1A 3C32A 3EN3A 4GOTA 1FTJA 1FQDA 4PFWA 1N7XA 4MLVA 5FHOA 1IQ7A 3VFJA 2Y7RA 4IY6A 3LSWA 3IAZA 4P11A 2QL3A 3MP1A 2PX1A 2R71A 1MM6A 3FJMA 1MRPA 2F7CA 4X9TA 3OELA 4NF4B 4ZE8A 1GV8A 2IEEA 3QK6A 2LAOA 1TFDA 3HSTA 2F5XA 1GR2A 3RTWB 1VSOA 4O3BA 4BDNA 5I59A 4EXKA 1B3GA 3USDA 3MZ1A 1XS5A 3T9XB 1MH3A 2DXRA 3RTFB 1ZTYA 3LSLA 2I0CA 1AOVA 3EQ1A 3A09A 1B3FA 3BFTA 3Q29A 1IITA 1LCTA 3GLBA 3S2VA 1ZKBA 2REJA 1A40A 1H44A 5F1QA 1B58A 3RN8A 4F2QA 3OO9A 2XXXA 3CIJA 4DCYA 1IZ1A 2DE4A 3PD8A 3T9VA 3ZS6A 4U1OA 1JQFA 2H25A 1A99A 1POTA 2F35A 1S50A 1FQBA 4OEVA 3CFXA 1NH8A 3VXBA 3M3FA 4U22A 3E9XA 3Q26A 3VLUA 2QMWA 3Q27A 5AA3A 1MXWA 2F34A 4E0XA 1R6ZA 3ZSFA 3KOTA 4PFTA 2ZNUA 3SETA 4AQ4A 3K1NA 1IXHA 3K6WA 4H65A 2UVJA 5EHMA 3TQWA 2D21A 3B6QA 1II5A 4R73A 2H98A 3SKPA 2A5SA 5ISUA 4KR5A 4KPTA 4OXVA 1Q35A 4R9FA 5I58B 1LB9A 3PUXE 4NF6B 4R75A 4ZEBA 4F3SA 2XXPA 3O97A 5DVJA 4F3GA 4N07A 3VVEA 2F7AA 3MVWA 4OTEA 4IO2A 4Q30B 2DWJA 1Y9UA 4PFUA 4WEDA 4XKQA 2R9JA 3T9UA 1SW4A 1P1OA 2AIXA 1MQGA 3CSGA 1MY3A 1NNTA 4RPNA 3D4CA 3MC2A 1AL3A 1SW2A 1UTBA 2QSXA 5DVIA 5H8FA 1PEBA 3CVGA 3IOTA 4KHZE 1MQIA 2Y84A 1N76A 3MZBA 3GXAA 3QYTA 2CZLA 5H8HB 1HSLA 1NNPA 4JWYA 3PPRA 4U4XA 4LUBA 3S9LC 3FIRA 3QIMA 1MXUA 3DP6A 4YB7A 3KSJA 1J1NA 2XD3A 1DPEA 1MXVA 3W9VA 4Z7EA 1OLAA 2HAVA 4YMAA 4KFQA 1US5A 4F1YA 2QS2A 1MY0A 3MPKA 3OEMA 2R6GE 4DZ1A 1OLCA 4GD5A 1A7LA 1TT1A 1YCJA 2AYSA 2FYIA 2HFBA 2V25A 2XXRA 4QFNA 3RPWA 1B40A 2X26A 3PMWA 4OQOA 1MDQA 4BDOA 3O28A 4JWOA 3LSFB 2REGA 4GQOA 4OFJA 4AB5A 4Q0CA 1O63A 3U8QA 4KYSA 4R2FA 4EF2A 2E1SA 4ECFA 2Q9TA 2DE3A 3H6WA 3TCGA 4F19A 2PT1A 4F1UA 4XTCQ 1MQJA 2F36A 4F2OA 2O51A 5CBRA 2XXHA 3K01A 2Y7WA 1LLSA 3K1MA 4N13A 2DXYA 2ZXTA 5CMCA 1N84A 3QUFA 5CC2A 1DOTA 1QUIA 3M8UA 1PB7A 2XD2A 4NF6A 3C34A 2GFEA 3F11A 3K0VA 4MBPA 4R72A 1B3HA 4XKRA 1YTVA 3R7XA 3THIA 4LP2B 1URSA 1URDA 2HEUA 3UA8A 4XIGQ 1FQAA 5DVFA 2PT2A 3LC8A 1ZJLA 4WEPA 1H43A 4AB6A 1LFHA 1QKAA 2Q2CA 3BBRA 1SD3A 2XXWA 1B7HA 5L9SA 5I58A 1MS7A 1PDAA 3I6VA 3MVXA 4ESWA 2I6EA 3ONMA 4K3FA 4ND9A 1P1NA 4ELQA 3KGCA 3EHSA 1B2HA 3OSQA 5CI5A 5A5XB 4I62A 3Q28A 4WXJA 2O1MA 2V3TA 4UACA 4GFRA 3E3KA 1UQWA 5DEXB 2Q8JA 3FXUA 3IJOB 3TMGA 1OVBA 1EZ9A 3DP8A 5H8QA 1B5HA 3FVKA 1B9JA 3PPNA 4DDDA 1R9QA 3IO4A 3MWBA 3PD9A 5K2YA 3U93A 4GIZA 4BDQA 2FNCA 1MDP1 1B32A 3S4UA 4ESXA 1B7ZA 5I2KB 1SDXA 3FJGA 1Z7NE 2DE2A 3MBPA 4F18A 1BTJA 2O69A 3CFLA 3CI8A 4GF8A 1SI1A 2DVCA 5AA4A 3T66A 5I57B 1OQHA 1ATGA 3L6HA 4GL0A 1MY2A 3C36A 5KCJB 2QMXA 3CG3A 3IB0A 3KOSA 1MH4A 5H8SA 3SEXA 3SERA 4OESA 5AA2A 5I84A 4G77A 5EYFA 5J1DA 1HSEA 1QULA 1PBQA 4F3BA 1Y4CA 1XVYA 3HN0A 1MPBA 2RC9A 2XXUA 4NWCA 2DP8A 2VD2A 2HCAA 3IOWA 3N6TA 4FIMA 1Y4TA 1SYIA 4KYEA 5I56A 2D3IA 3PUYE 3O29A 3T9HB 1FTKA 2ESNA 3I5OA 3H6VA 3PGFA 5EHSA 4KI0E 3K4UA 4IGTA 1N04A 1A54A 2Y7IA 2ZNTA 1HSJA 2NOOA 1MXXA 5CMKA 4KCCA 1AMFA 4O3CA 5ELVA 5H8FB 3U94A 4FEBA 4NE4A 4OENA 4RJZA 4C1TA 1OVTA 5BWJA 5I2KA 4TLMB 2ANJA 5AA1A 3G3KA 1JVXA 2VOZA 3RT8A 4QFLA 3T96B 3IX1A 3WAFA 5I59B 1MXZA 3HV1A 3PPOA 5I57A 1UTHB 4OZ9A 5KDTB 4DCXA 2DVZA 1M5DA 2VP1A 3TUSA 5ICTA 1QUKA 4YMBA 3TTRA 4EQ7A 1EU8A 1PC3A 1S7YA 3EHUA 4MF3A 2QS1A 3K00A 1XOCA 3FVOA 3GBAA 4KYDA 2UYFA 3T93B 3TQLA 5B7DA 2HQ0A 2XHDA 2XX8A 1B52A 3RY3A 3H03A 4U4SA 4UA8A 2UVGA 2XXTA 3A3CA 1B3LA 1TXFA 2RCBA 3H4ZA 4IO5A 3OSRA 4IO3A 4HCWA 4ZECA 2HZLA 3I3VA 3PMVA 2OLBA 3UIFA 3MW0A 1ZLQA 4U2RA 3H06B 4YU0A 1XC1A 2RC7A 4QSCA 3FVGA 1OMPA 2Y7PA 1LFIA 3IB1A 3IB2A 3DLNA 2XXVA 3EPEA 4LQ5A 1BLFA 1ELJA 1H45A 1USYH 2DWAA 2RF1A 2YLNA 5B70A 2XX9A 2XXQA 3KEIA 5CBSA 2V3UA 4GXSB 2I3WA 5ITOA 3TCFA 5HBCA 3CRBA 5H8NB 1I6QA 5JEIA 3IR1A 3FV2A 4RPOA 3OMBA 2GHAA 1MQHA 1ZBMA 2I4BA 2Q2AA 1A8FA 4OFLA 3KSXA 2UYEA 4G8HA 4YZZA 2RKMA 4LQ2A 2DS9A 4QFOA 2ALUA 3VVDA 4E0WA 1B51A 3WAEA 4IY5A 2OK2A 3N6UA 2OCUA 2Z8EA 3Q25A 4RA1A 2DWHA 5DYHA 5H8NA 4R6YA 4IO7A 4OETA 3VVFA 1P1QA 4PP0A 1P1UA 1Y1MA 2VD3A 1M5EA 1MG1A 1EZOA 4LATA 3LR1A 1DPPA 3C31A 5TU0A 5AA2D 1OIBA 1O64A 2NVUB 5FHNA 2H5YA 2O84X 1QVSA 1JW4A 4GVOA 4NMYA 3KBRA 3OOAA 1MXYA 3JV9A 4DLDA 2DSFA 3P7IA 1RKMA 3GBBA 3MZ9A 4RY1A 5TP9B 3OEKA 2KLFA 2B3BA 4FJPA 4IGRA 5JTYB 1RYXA 1XVXA 2XX7A 4OEUA 2Z8DA 1NL5A 1P99A 5L9MA 4PETA 3C35A 4WKMA 1MPCA 3FD3A 5LOMA 1Z7ME 2UXAA 4NEDA 4P0GA 5L8DA 3SDFA 3N5LA 3QXMA 3UORA 1EZPA 1D9VA 2DYXA 4YB6A 4F31B 1LCFA 1SVXB 4LZ8A 5ICQA 3VDFA 4H6DA 4OVJA 1US4A 1LBCA 5CMBA 2O6AA 5CRYA 2HXWA 3H6UA 4ZEKA 5ITPA 1FQCA 1QKBA 2WKYA 4FORA 2YPNA 1ZIUA 1D4NA 3U72A 1CE2A 2ZYNA 3FXRA 1GGGA 4F22A 3OD7A 2G93A 4F39A 4NF5B 4JSDA 5KCJA 5JK4A 3OO6A 1ZU0A 3C9HA 3TTNA 3VXCA 1ANFA 1R1NA 1LSTA 3RUMA 1B05A 4DXUA 5AE4A 2M8CA 1SQYA 3TODA 4R9GA 1IXGA 3G3IA 3HHFA 3JYRA 1DTZA 3MUQA 4JBZA 3QAXA 1UTHA 3HO7A 1Y20A 3TTLA 3UGWA 4MLQA 1TFAA 2RINA 3RT6B 1F9BA 3LSXA 3GZGA 1ZMGA 3H3GA 4QRZA 2A5TB 3AXFA 4EQ9A 4JXIA 1N3XA 3TDJA 1N0TA 3ZKLA 4ONYA 1NNKA 2B65A 3C33A 4XKNA 4I1DA 1IUDA 4GXAA 4RK2A 3RNNA 2XXIA 1XHYA 2AL4A 2OWTA 3K2DA 4BLAA 3VE1B 3BKIB 4U21A 3O9PA 4G8NA 3D4GA 4ELOA 4JSOA 4FAJA 3IL1B 1CB6A 5IKBA 1PB9A 3B6WA 3E13X 4IO4A 4ZZEA 5DT6A 4MFIA 2Z23A 3PV0E 5HM4B 3K02A 3CSBA 3TZAA 2Z8FA 5FTIA 4POXA 4H0WA 1DSNA 2DQVA 3RGYA 1FCKA 4DIGA 5I2NB 2V93A 3K6UA 2ABHA 3R6UA 1DTGA 4KQPA 3QSLA 2P1SA 2O7UA 4KCDA 4RYAA 2Q88A 4H8JA 5M2VA 3V5AA 1Q1KA 3MAMA 2F6GA 4G8MA 1FTLA 3FJ7A 4IB2A 4QF9A 3FXQA 5H8HA 3G3HA 1B1XA 3IO6A 4OERA 4DXCA 4HW8A 2NXOA 2B3FA 2ZYOA 4X1BA 4Z0IA 4EDPA 2UVIA 3MJNA 4QSEA 1BP5A 2PVUA 3IOVA 1VFDA 1D3KA 1JW1A 3B6TA 5L9OA 4P0IA 1VE4A 2OZZA 4TQUQ 4YB5A 2IA4A 2RC8A 1B1HA 4I8CA 4Q5TA 1VFEA 2I58A 4RNSA 3OO8A 2X7QA 3W15C 5HPQA 2H4IA 3MVZA 3MP8A 5BUUA 4NF4A 4BDLA 1B46A 1GTKA 2AL5A 2ZMBA 3TCHA 1UIUA 4ZEFA 2P0SA 1T0KA 1M5BA 1UIVA 1LGBC 3CFZA 3IOUA 3O6HA 4GWOA 5KZTA 4THIA 3O6GA 1LFGA 2F97A 2I49A 3PUVE 4FEDA 4EXLA 3V89B 2FA7A 2NUVA 1LAHE 1H3DA 2F78A 1IIWA 4X48A 4ZS9A 1B6HA 4YKIA 4ZEIA 1L5TA 3VLWA 1IXIA 3G3GA 4G4PA 3ECRA 3H7MA 3ILTB 1B4HA 2D5WA 4OYVA 3RLFE 2PMSA 1NFTA 3IK6B 1PBPA 3B7DA 1I69A 2OWSA 3S9EA 1WVJA 2ONKE 1AH5A 1UTBB 3FVNA 4JDFA 5JTYA 1QW0A 1B5JA 1NNFA 3MQ9A 1JW5A 2E0SA 1B3EA 4H67A 4LONB 4RXLA 4QFKA 3DP4A 1O7TA 2VGQA 3H6TA 1PB8A 4MH5A 1B4ZA 1N3WA 2QJEA 1AIVA 1DMBA 2GHBA 1JNFA 4R74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFU A;  3PUZ E;  5TP9 A;  1IXC A;  3TYH A;  1S9T A;  3IJX B;  3R26 A;  3SEW A;  2OBG A;  2UVH A;  1B0H A;  1FQE A;  2I0B A;  4R2B A;  4GLI A;  4R6H A;  3TEL A;  5CM6 A;  3U92 A;  4YIC A;  3T22 A;  3SES A;  1JEU A;  2PBW A;  1LB8 A;  2O68 A;  2F8D A;  3OEN A;  4G68 A;  4KD5 A;  4NTL A;  4EQB A;  3PUW E;  2V3Q A;  4F3P A;  5I56 B;  4GRK A;  5FTH A;  2XXY A;  3UN6 A;  2RCA A;  3G3J A;  3G7W A;  1JET A;  1YPN A;  4GL8 A;  3TEP A;  4PFY A;  4F1V A;  3TTK A;  1WDN A;  2QS4 A;  4FAT A;  1B5I A;  4R6K A;  5FHM A;  4ZED A;  2ONR A;  1LAF E;  4M1V A;  2DOJ A;  4Q8R A;  4OFO A;  3N26 A;  3G3F A;  1TWY A;  4BDR A;  3W9W A;  5IAI A;  1MM7 A;  2GRV A;  2NWJ A;  5DEX A;  1I6A A;  2O7I A;  3TTM A;  2QRY A;  4POW A;  1GVC A;  1OQG A;  3K1P A;  4JWX A;  3K6V A;  3QUJ A;  4TLL B;  5TPA B;  3EF7 A;  3MPL A;  4TOZ A;  3KZG A;  3SEV A;  4EF1 A;  5A5X A;  4H8I A;  1NMU A;  3HCQ A;  4RK9 A;  2PYY A;  4YKJ A;  4NWD A;  1MY4 A;  4OWD A;  1SYH A;  4I9D A;  2DWI A;  3PU5 A;  4C0R A;  2F6P A;  2H9B A;  1MQD A;  4IO6 A;  5TPA A;  1LAG E;  1FTO A;  4G2Z A;  2I3V A;  1H76 A;  1USY E;  1FTM A;  4QSD A;  4M4G A;  4DXB A;  1FQF A;  1SI0 A;  2Q89 A;  2OJT A;  2X7P A;  2ZYK A;  2BJJ X;  4FEC A;  3FZV A;  3KG2 A;  4H5G A;  4LZ5 A;  3KN7 A;  3OXN A;  5F7V A;  3TAJ A;  1Y3P A;  4ELR A;  3FUZ A;  1LBB A;  3PPP A;  4U1Z A;  4U23 A;  1MY1 A;  4LA9 A;  1BKA A;  4NF8 A;  3OO7 A;  1EH3 A;  4PE5 B;  3TKD A;  3CR9 A;  3O2A A;  1NKX A;  1WOD A;  1XT8 A;  3LBS A;  1I6B A;  2HAU A;  2THI A;  1P1W A;  3JZJ A;  3M3L A;  1Y1Z A;  3O6I A;  4X1D A;  2ZYM A;  5DTB A;  3TPA A;  2YJP A;  3FGS A;  3FV1 A;  3KN3 A;  5AA4 B;  1D9Y A;  3K6X A;  4OHN A;  3SEU A;  2QPQ A;  3MP6 A;  1SBP A;  2H99 A;  1NH7 A;  3ODB A;  4NF8 B;  4HCY A;  4EUO A;  3ZKK A;  1JEV A;  2O1L A;  3PPQ A;  4QFP A;  1M5F A;  4ISU A;  3M3K A;  2W7Y A;  4YKP A;  2F7B A;  2ZNS A;  3EHT A;  1FW0 A;  4HS7 A;  3A3U A;  4YAH X;  3VLV A;  5K2X A;  4NF5 A;  2GH9 A;  3PMX A;  4HTG A;  1A8E A;  4LVQ A;  1YAE A;  4L17 A;  5CMM A;  3FAT A;  3E4R A;  4DE8 A;  3TFL A;  1VR5 A;  2CMO A;  4BDM A;  3S9M C;  1IEJ A;  3ILU B;  4F29 A;  1SW1 A;  3O66 A;  3V83 A;  1M5C A;  2I48 A;  4OMB A;  4C1U A;  2Z22 A;  1LAX A;  1A55 A;  1POY 1;  3MVY A;  4JB7 A;  3SEY A;  4ZE9 A;  5AA2 B;  3DM0 A;  3L6G A;  2P2A A;  3S9N C;  3HPI A;  1KWH A;  4H1X A;  1RYO A;  4QHQ A;  2Y7K A;  4ZZA A;  3VV5 A;  1URG A;  3HHG A;  3KJ7 A;  3N94 A;  1N7W A;  2HZK A;  3KJT A;  4N6P A;  3RQT A;  2G29 A;  2ONS A;  2QS3 A;  3UP9 A;  4ELP A;  2A5T A;  3DEL B;  4XXU A;  1SW5 A;  4FE8 A;  1QJM A;  4LZ7 A;  1BIY A;  3U1O A;  3C4M A;  3KFM A;  1B7U A;  3KN8 A;  4H5F A;  3LUY A;  1JVY A;  4ZDM A;  4G68 C;  5H8Q B;  5KDT A;  1Y3N A;  2V84 A;  4PQJ A;  4YKK A;  1QUJ A;  5I2N A;  2VHA A;  3UK4 A;  1MPD A;  1B0L A;  1Y3Q A;  3IOR A;  4G68 B;  4O3A A;  3V8X B;  2I4C A;  1R9L A;  3FAS A;  4XKP A;  3CG1 A;  3C32 A;  3EN3 A;  4GOT A;  1FTJ A;  1FQD A;  4PFW A;  1N7X A;  4MLV A;  5FHO A;  1IQ7 A;  3VFJ A;  2Y7R A;  4IY6 A;  3LSW A;  3IAZ A;  4P11 A;  2QL3 A;  3MP1 A;  2PX1 A;  2R71 A;  1MM6 A;  3FJM A;  1MRP A;  2F7C A;  4X9T A;  3OEL A;  4NF4 B;  4ZE8 A;  1GV8 A;  2IEE A;  3QK6 A;  2LAO A;  1TFD A;  3HST A;  2F5X A;  1GR2 A;  3RTW B;  1VSO A;  4O3B A;  4BDN A;  5I59 A;  4EXK A;  1B3G A;  3USD A;  3MZ1 A;  1XS5 A;  3T9X B;  1MH3 A;  2DXR A;  3RTF B;  1ZTY A;  3LSL A;  2I0C A;  1AOV A;  3EQ1 A;  3A09 A;  1B3F A;  3BFT A;  3Q29 A;  1IIT A;  1LCT A;  3GLB A;  3S2V A;  1ZKB A;  2REJ A;  1A40 A;  1H44 A;  5F1Q A;  1B58 A;  3RN8 A;  4F2Q A;  3OO9 A;  2XXX A;  3CIJ A;  4DCY A;  1IZ1 A;  2DE4 A;  3PD8 A;  3T9V A;  3ZS6 A;  4U1O A;  1JQF A;  2H25 A;  1A99 A;  1POT A;  2F35 A;  1S50 A;  1FQB A;  4OEV A;  3CFX A;  1NH8 A;  3VXB A;  3M3F A;  4U22 A;  3E9X A;  3Q26 A;  3VLU A;  2QMW A;  3Q27 A;  5AA3 A;  1MXW A;  2F34 A;  4E0X A;  1R6Z A;  3ZSF A;  3KOT A;  4PFT A;  2ZNU A;  3SET A;  4AQ4 A;  3K1N A;  1IXH A;  3K6W A;  4H65 A;  2UVJ A;  5EHM A;  3TQW A;  2D21 A;  3B6Q A;  1II5 A;  4R73 A;  2H98 A;  3SKP A;  2A5S A;  5ISU A;  4KR5 A;  4KPT A;  4OXV A;  1Q35 A;  4R9F A;  5I58 B;  1LB9 A;  3PUX E;  4NF6 B;  4R75 A;  4ZEB A;  4F3S A;  2XXP A;  3O97 A;  5DVJ A;  4F3G A;  4N07 A;  3VVE A;  2F7A A;  3MVW A;  4OTE A;  4IO2 A;  4Q30 B;  2DWJ A;  1Y9U A;  4PFU A;  4WED A;  4XKQ A;  2R9J A;  3T9U A;  1SW4 A;  1P1O A;  2AIX A;  1MQG A;  3CSG A;  1MY3 A;  1NNT A;  4RPN A;  3D4C A;  3MC2 A;  1AL3 A;  1SW2 A;  1UTB A;  2QSX A;  5DVI A;  5H8F A;  1PEB A;  3CVG A;  3IOT A;  4KHZ E;  1MQI A;  2Y84 A;  1N76 A;  3MZB A;  3GXA A;  3QYT A;  2CZL A;  5H8H B;  1HSL A;  1NNP A;  4JWY A;  3PPR A;  4U4X A;  4LUB A;  3S9L C;  3FIR A;  3QIM A;  1MXU A;  3DP6 A;  4YB7 A;  3KSJ A;  1J1N A;  2XD3 A;  1DPE A;  1MXV A;  3W9V A;  4Z7E A;  1OLA A;  2HAV A;  4YMA A;  4KFQ A;  1US5 A;  4F1Y A;  2QS2 A;  1MY0 A;  3MPK A;  3OEM A;  2R6G E;  4DZ1 A;  1OLC A;  4GD5 A;  1A7L A;  1TT1 A;  1YCJ A;  2AYS A;  2FYI A;  2HFB A;  2V25 A;  2XXR A;  4QFN A;  3RPW A;  1B40 A;  2X26 A;  3PMW A;  4OQO A;  1MDQ A;  4BDO A;  3O28 A;  4JWO A;  3LSF B;  2REG A;  4GQO A;  4OFJ A;  4AB5 A;  4Q0C A;  1O63 A;  3U8Q A;  4KYS A;  4R2F A;  4EF2 A;  2E1S A;  4ECF A;  2Q9T A;  2DE3 A;  3H6W A;  3TCG A;  4F19 A;  2PT1 A;  4F1U A;  4XTC Q;  1MQJ A;  2F36 A;  4F2O A;  2O51 A;  5CBR A;  2XXH A;  3K01 A;  2Y7W A;  1LLS A;  3K1M A;  4N13 A;  2DXY A;  2ZXT A;  5CMC A;  1N84 A;  3QUF A;  5CC2 A;  1DOT A;  1QUI A;  3M8U A;  1PB7 A;  2XD2 A;  4NF6 A;  3C34 A;  2GFE A;  3F11 A;  3K0V A;  4MBP A;  4R72 A;  1B3H A;  4XKR A;  1YTV A;  3R7X A;  3THI A;  4LP2 B;  1URS A;  1URD A;  2HEU A;  3UA8 A;  4XIG Q;  1FQA A;  5DVF A;  2PT2 A;  3LC8 A;  1ZJL A;  4WEP A;  1H43 A;  4AB6 A;  1LFH A;  1QKA A;  2Q2C A;  3BBR A;  1SD3 A;  2XXW A;  1B7H A;  5L9S A;  5I58 A;  1MS7 A;  1PDA A;  3I6V A;  3MVX A;  4ESW A;  2I6E A;  3ONM A;  4K3F A;  4ND9 A;  1P1N A;  4ELQ A;  3KGC A;  3EHS A;  1B2H A;  3OSQ A;  5CI5 A;  5A5X B;  4I62 A;  3Q28 A;  4WXJ A;  2O1M A;  2V3T A;  4UAC A;  4GFR A;  3E3K A;  1UQW A;  5DEX B;  2Q8J A;  3FXU A;  3IJO B;  3TMG A;  1OVB A;  1EZ9 A;  3DP8 A;  5H8Q A;  1B5H A;  3FVK A;  1B9J A;  3PPN A;  4DDD A;  1R9Q A;  3IO4 A;  3MWB A;  3PD9 A;  5K2Y A;  3U93 A;  4GIZ A;  4BDQ A;  2FNC A;  1MDP 1;  1B32 A;  3S4U A;  4ESX A;  1B7Z A;  5I2K B;  1SDX A;  3FJG A;  1Z7N E;  2DE2 A;  3MBP A;  4F18 A;  1BTJ A;  2O69 A;  3CFL A;  3CI8 A;  4GF8 A;  1SI1 A;  2DVC A;  5AA4 A;  3T66 A;  5I57 B;  1OQH A;  1ATG A;  3L6H A;  4GL0 A;  1MY2 A;  3C36 A;  5KCJ B;  2QMX A;  3CG3 A;  3IB0 A;  3KOS A;  1MH4 A;  5H8S A;  3SEX A;  3SER A;  4OES A;  5AA2 A;  5I84 A;  4G77 A;  5EYF A;  5J1D A;  1HSE A;  1QUL A;  1PBQ A;  4F3B A;  1Y4C A;  1XVY A;  3HN0 A;  1MPB A;  2RC9 A;  2XXU A;  4NWC A;  2DP8 A;  2VD2 A;  2HCA A;  3IOW A;  3N6T A;  4FIM A;  1Y4T A;  1SYI A;  4KYE A;  5I56 A;  2D3I A;  3PUY E;  3O29 A;  3T9H B;  1FTK A;  2ESN A;  3I5O A;  3H6V A;  3PGF A;  5EHS A;  4KI0 E;  3K4U A;  4IGT A;  1N04 A;  1A54 A;  2Y7I A;  2ZNT A;  1HSJ A;  2NOO A;  1MXX A;  5CMK A;  4KCC A;  1AMF A;  4O3C A;  5ELV A;  5H8F B;  3U94 A;  4FEB A;  4NE4 A;  4OEN A;  4RJZ A;  4C1T A;  1OVT A;  5BWJ A;  5I2K A;  4TLM B;  2ANJ A;  5AA1 A;  3G3K A;  1JVX A;  2VOZ A;  3RT8 A;  4QFL A;  3T96 B;  3IX1 A;  3WAF A;  5I59 B;  1MXZ A;  3HV1 A;  3PPO A;  5I57 A;  1UTH B;  4OZ9 A;  5KDT B;  4DCX A;  2DVZ A;  1M5D A;  2VP1 A;  3TUS A;  5ICT A;  1QUK A;  4YMB A;  3TTR A;  4EQ7 A;  1EU8 A;  1PC3 A;  1S7Y A;  3EHU A;  4MF3 A;  2QS1 A;  3K00 A;  1XOC A;  3FVO A;  3GBA A;  4KYD A;  2UYF A;  3T93 B;  3TQL A;  5B7D A;  2HQ0 A;  2XHD A;  2XX8 A;  1B52 A;  3RY3 A;  3H03 A;  4U4S A;  4UA8 A;  2UVG A;  2XXT A;  3A3C A;  1B3L A;  1TXF A;  2RCB A;  3H4Z A;  4IO5 A;  3OSR A;  4IO3 A;  4HCW A;  4ZEC A;  2HZL A;  3I3V A;  3PMV A;  2OLB A;  3UIF A;  3MW0 A;  1ZLQ A;  4U2R A;  3H06 B;  4YU0 A;  1XC1 A;  2RC7 A;  4QSC A;  3FVG A;  1OMP A;  2Y7P A;  1LFI A;  3IB1 A;  3IB2 A;  3DLN A;  2XXV A;  3EPE A;  4LQ5 A;  1BLF A;  1ELJ A;  1H45 A;  1USY H;  2DWA A;  2RF1 A;  2YLN A;  5B70 A;  2XX9 A;  2XXQ A;  3KEI A;  5CBS A;  2V3U A;  4GXS B;  2I3W A;  5ITO A;  3TCF A;  5HBC A;  3CRB A;  5H8N B;  1I6Q A;  5JEI A;  3IR1 A;  3FV2 A;  4RPO A;  3OMB A;  2GHA A;  1MQH A;  1ZBM A;  2I4B A;  2Q2A A;  1A8F A;  4OFL A;  3KSX A;  2UYE A;  4G8H A;  4YZZ A;  2RKM A;  4LQ2 A;  2DS9 A;  4QFO A;  2ALU A;  3VVD A;  4E0W A;  1B51 A;  3WAE A;  4IY5 A;  2OK2 A;  3N6U A;  2OCU A;  2Z8E A;  3Q25 A;  4RA1 A;  2DWH A;  5DYH A;  5H8N A;  4R6Y A;  4IO7 A;  4OET A;  3VVF A;  1P1Q A;  4PP0 A;  1P1U A;  1Y1M A;  2VD3 A;  1M5E A;  1MG1 A;  1EZO A;  4LAT A;  3LR1 A;  1DPP A;  3C31 A;  5TU0 A;  5AA2 D;  1OIB A;  1O64 A;  2NVU B;  5FHN A;  2H5Y A;  2O84 X;  1QVS A;  1JW4 A;  4GVO A;  4NMY A;  3KBR A;  3OOA A;  1MXY A;  3JV9 A;  4DLD A;  2DSF A;  3P7I A;  1RKM A;  3GBB A;  3MZ9 A;  4RY1 A;  5TP9 B;  3OEK A;  2KLF A;  2B3B A;  4FJP A;  4IGR A;  5JTY B;  1RYX A;  1XVX A;  2XX7 A;  4OEU A;  2Z8D A;  1NL5 A;  1P99 A;  5L9M A;  4PET A;  3C35 A;  4WKM A;  1MPC A;  3FD3 A;  5LOM A;  1Z7M E;  2UXA A;  4NED A;  4P0G A;  5L8D A;  3SDF A;  3N5L A;  3QXM A;  3UOR A;  1EZP A;  1D9V A;  2DYX A;  4YB6 A;  4F31 B;  1LCF A;  1SVX B;  4LZ8 A;  5ICQ A;  3VDF A;  4H6D A;  4OVJ A;  1US4 A;  1LBC A;  5CMB A;  2O6A A;  5CRY A;  2HXW A;  3H6U A;  4ZEK A;  5ITP A;  1FQC A;  1QKB A;  2WKY A;  4FOR A;  2YPN A;  1ZIU A;  1D4N A;  3U72 A;  1CE2 A;  2ZYN A;  3FXR A;  1GGG A;  4F22 A;  3OD7 A;  2G93 A;  4F39 A;  4NF5 B;  4JSD A;  5KCJ A;  5JK4 A;  3OO6 A;  1ZU0 A;  3C9H A;  3TTN A;  3VXC A;  1ANF A;  1R1N A;  1LST A;  3RUM A;  1B05 A;  4DXU A;  5AE4 A;  2M8C A;  1SQY A;  3TOD A;  4R9G A;  1IXG A;  3G3I A;  3HHF A;  3JYR A;  1DTZ A;  3MUQ A;  4JBZ A;  3QAX A;  1UTH A;  3HO7 A;  1Y20 A;  3TTL A;  3UGW A;  4MLQ A;  1TFA A;  2RIN A;  3RT6 B;  1F9B A;  3LSX A;  3GZG A;  1ZMG A;  3H3G A;  4QRZ A;  2A5T B;  3AXF A;  4EQ9 A;  4JXI A;  1N3X A;  3TDJ A;  1N0T A;  3ZKL A;  4ONY A;  1NNK A;  2B65 A;  3C33 A;  4XKN A;  4I1D A;  1IUD A;  4GXA A;  4RK2 A;  3RNN A;  2XXI A;  1XHY A;  2AL4 A;  2OWT A;  3K2D A;  4BLA A;  3VE1 B;  3BKI B;  4U21 A;  3O9P A;  4G8N A;  3D4G A;  4ELO A;  4JSO A;  4FAJ A;  3IL1 B;  1CB6 A;  5IKB A;  1PB9 A;  3B6W A;  3E13 X;  4IO4 A;  4ZZE A;  5DT6 A;  4MFI A;  2Z23 A;  3PV0 E;  5HM4 B;  3K02 A;  3CSB A;  3TZA A;  2Z8F A;  5FTI A;  4POX A;  4H0W A;  1DSN A;  2DQV A;  3RGY A;  1FCK A;  4DIG A;  5I2N B;  2V93 A;  3K6U A;  2ABH A;  3R6U A;  1DTG A;  4KQP A;  3QSL A;  2P1S A;  2O7U A;  4KCD A;  4RYA A;  2Q88 A;  4H8J A;  5M2V A;  3V5A A;  1Q1K A;  3MAM A;  2F6G A;  4G8M A;  1FTL A;  3FJ7 A;  4IB2 A;  4QF9 A;  3FXQ A;  5H8H A;  3G3H A;  1B1X A;  3IO6 A;  4OER A;  4DXC A;  4HW8 A;  2NXO A;  2B3F A;  2ZYO A;  4X1B A;  4Z0I A;  4EDP A;  2UVI A;  3MJN A;  4QSE A;  1BP5 A;  2PVU A;  3IOV A;  1VFD A;  1D3K A;  1JW1 A;  3B6T A;  5L9O A;  4P0I A;  1VE4 A;  2OZZ A;  4TQU Q;  4YB5 A;  2IA4 A;  2RC8 A;  1B1H A;  4I8C A;  4Q5T A;  1VFE A;  2I58 A;  4RNS A;  3OO8 A;  2X7Q A;  3W15 C;  5HPQ A;  2H4I A;  3MVZ A;  3MP8 A;  5BUU A;  4NF4 A;  4BDL A;  1B46 A;  1GTK A;  2AL5 A;  2ZMB A;  3TCH A;  1UIU A;  4ZEF A;  2P0S A;  1T0K A;  1M5B A;  1UIV A;  1LGB C;  3CFZ A;  3IOU A;  3O6H A;  4GWO A;  5KZT A;  4THI A;  3O6G A;  1LFG A;  2F97 A;  2I49 A;  3PUV E;  4FED A;  4EXL A;  3V89 B;  2FA7 A;  2NUV A;  1LAH E;  1H3D A;  2F78 A;  1IIW A;  4X48 A;  4ZS9 A;  1B6H A;  4YKI A;  4ZEI A;  1L5T A;  3VLW A;  1IXI A;  3G3G A;  4G4P A;  3ECR A;  3H7M A;  3ILT B;  1B4H A;  2D5W A;  4OYV A;  3RLF E;  2PMS A;  1NFT A;  3IK6 B;  1PBP A;  3B7D A;  1I69 A;  2OWS A;  3S9E A;  1WVJ A;  2ONK E;  1AH5 A;  1UTB B;  3FVN A;  4JDF A;  5JTY A;  1QW0 A;  1B5J A;  1NNF A;  3MQ9 A;  1JW5 A;  2E0S A;  1B3E A;  4H67 A;  4LON B;  4RXL A;  4QFK A;  3DP4 A;  1O7T A;  2VGQ A;  3H6T A;  1PB8 A;  4MH5 A;  1B4Z A;  1N3W A;  2QJE A;  1AIV A;  1DMB A;  2GHB A;  1JNF A;  4R74 A; 
#chains in the Genus database with same CATH topology
 3TYH A;  3R26 A;  2ZZV A;  3TEL A;  3T22 A;  2PBW A;  2O68 A;  5KCJ B;  3OEN A;  3G3J A;  1JET A;  4GL8 A;  4F1V A;  1WDN A;  4OVS A;  4Q8R A;  4JVC A;  5IAI A;  1OQG A;  4TOZ A;  4NAP A;  3HCQ A;  4PAI A;  2L5V A;  1MY4 A;  2VPO A;  4IO6 A;  1SI0 A;  4FEC A;  3TAJ A;  3KN7 A;  4U1Z A;  2JJK A;  4PE5 B;  3CR9 A;  1I6B A;  2THI A;  4X1D A;  1P1W A;  3O6I A;  3TPA A;  4OHN A;  2QPQ A;  1SBP A;  2H99 A;  1FBE A;  4NF8 B;  4HCY A;  3PPQ A;  4QFP A;  1FPE A;  3M3K A;  2W7Y A;  4YKP A;  3A3U A;  4NF5 A;  4LVQ A;  3E4R A;  3ILU B;  1RDZ A;  5AA2 B;  4JB7 A;  2QS3 A;  4ELP A;  5A5X B;  3KFM A;  1B7U A;  4ZDM A;  4G68 C;  5KDT A;  2V84 A;  5I2N A;  4YKK A;  3UK4 A;  4G68 B;  3FAS A;  4ZE8 A;  1FTJ A;  4IY6 A;  1MRP A;  1GV8 A;  3QK6 A;  2WYK A;  5I7I A;  4EXK A;  2DXR A;  1ZTY A;  1AOV A;  1B3F A;  3Q29 A;  1LCT A;  3S2V A;  1H44 A;  1B58 A;  4F2Q A;  4DCY A;  3PD8 A;  2DE4 A;  3T9V A;  1LBY A;  2H25 A;  1S50 A;  1NH8 A;  3VXB A;  3M3F A;  2QMW A;  1MXW A;  2WYP A;  2F34 A;  4OA4 A;  2FBP A;  3KOT A;  2ZNU A;  1II5 A;  2H98 A;  4MNC A;  2A5S A;  2Q8M A;  4OXV A;  4R9F A;  4O7I A;  4ZEB A;  1IME A;  3O97 A;  5DVJ A;  4IO2 A;  3T9U A;  1Y9U A;  4XKQ A;  1MY3 A;  1NNT A;  1UTB A;  5H8F A;  4KHZ E;  2Y84 A;  5H8H B;  5FBP A;  1HSL A;  4U4X A;  4GWZ A;  4PCD A;  1RDY A;  2XD3 A;  4Z7E A;  2HAV A;  4F1Y A;  3OEM A;  4GD5 A;  1A7L A;  3SEW A;  2FYI A;  4HE2 A;  1B40 A;  3PMW A;  2QFL A;  4OQO A;  1MDQ A;  1FBG A;  3TCG A;  4XTC Q;  1MQJ A;  2F36 A;  5CBR A;  4N13 A;  2Y7W A;  1LBX A;  4GWS A;  3RPL A;  3EKI A;  1DOT A;  1PB7 A;  4NF6 A;  4MBP A;  4XKR A;  1FPD A;  4LP2 B;  4XIG Q;  4GBV A;  5DVF A;  1ZJL A;  2XWO A;  4WEP A;  1B7H A;  4ESW A;  4ELQ A;  2R8T A;  1B2H A;  2HXR A;  2HPG A;  2V3T A;  3ROJ A;  1UQW A;  3DP8 A;  5H8Q A;  1B5H A;  4BDQ A;  3U93 A;  1NV4 A;  3MWB A;  3S4U A;  4PBQ A;  1SDX A;  3FJG A;  3CI8 A;  4GF8 A;  1SI1 A;  4GL0 A;  3C36 A;  2QMX A;  3KOS A;  4G77 A;  1Y4C A;  1XVY A;  1MPB A;  3IOW A;  4FIM A;  1SYI A;  1NV7 A;  2D3I A;  5I3S A;  1A54 A;  2ZNT A;  5H8F B;  3U94 A;  4FEB A;  1FPJ A;  5I2K A;  3D1R A;  3T96 B;  3WAF A;  4N17 A;  3PPO A;  4OZ9 A;  4DCX A;  3TUS A;  2VP1 A;  5ICT A;  3EHU A;  4MF3 A;  3K00 A;  5B7D A;  2HQ0 A;  2XX8 A;  2UVG A;  4IO5 A;  1B3L A;  3HFU A;  3OSR A;  4IO3 A;  2HZL A;  4MX6 A;  4YU0 A;  1XC1 A;  2RC7 A;  3IB2 A;  4LQ5 A;  3DLN A;  1H45 A;  5B70 A;  5CBS A;  2I3W A;  3TCF A;  5H8N B;  5JEI A;  3IR1 A;  3FV2 A;  4RPO A;  2GHA A;  2I4B A;  1A8F A;  5ET7 A;  3KSX A;  4YZZ A;  4E0W A;  1B51 A;  3WAE A;  2OK2 A;  4RA1 A;  4R6Y A;  3E79 A;  4OET A;  4PP0 A;  1MG1 A;  4LAT A;  1DPP A;  5TU0 A;  3KBR A;  3JV9 A;  4DLD A;  1NV5 A;  2DSF A;  1RKM A;  3GBB A;  3P7I A;  5TP9 B;  4IGR A;  1NL5 A;  1P99 A;  4PET A;  1MPC A;  3FD3 A;  5LOM A;  1Z7M E;  5J16 A;  2ZZX A;  5ICQ A;  5CRY A;  1LBC A;  2O6A A;  3LV0 A;  1FQC A;  3E78 A;  3OD7 A;  3TTN A;  3C9H A;  1ANF A;  1R1N A;  1B05 A;  5AE4 A;  5EQ9 A;  3QMF A;  4R9G A;  3JYR A;  3QAX A;  1NUZ A;  2RIN A;  3LSX A;  1ZMG A;  3H3G A;  2A5T B;  3AXF A;  4EQ9 A;  3C33 A;  1XHY A;  3O9P A;  1PB9 A;  3PV0 E;  3GYY A;  3CSB A;  3TZA A;  3RGY A;  3R6U A;  3K6U A;  2ABH A;  2O7U A;  1Q1K A;  4N4U A;  1FTL A;  5H8H A;  4OER A;  4X1B A;  4HE0 A;  1D3K A;  3B6T A;  5L9O A;  2XA5 A;  2OZZ A;  4PDD A;  2XXK A;  2IA4 A;  1NV0 A;  4P1E A;  3OO8 A;  3W15 C;  5BUU A;  2AL5 A;  1M5B A;  1YYZ A;  3IOU A;  5I5P A;  4THI A;  2I49 A;  3PUV E;  4N6K A;  5IZ3 A;  1B6H A;  4YKI A;  1B4H A;  2PMS A;  1PBP A;  1I69 A;  3S9E A;  1AH5 A;  5JTY A;  1B5J A;  1NV2 A;  3LUZ A;  4P47 A;  1N3W A;  1IXC A;  1S9T A;  1K9Y A;  1FQE A;  2Y5K A;  4YIC A;  1IMB A;  1JEU A;  4KD5 A;  4G68 A;  3PUW E;  2V3Q A;  2XXY A;  2RCA A;  3G7W A;  4N6D A;  1EYI A;  4MAG A;  4PFY A;  4FAT A;  4ZED A;  2Y5L A;  2DOJ A;  4OVQ A;  3N26 A;  1FBH A;  2GRV A;  2NWJ A;  1I6A A;  1GVC A;  2B4M A;  3K6V A;  1KA0 A;  2FVZ A;  4H8I A;  4RK9 A;  4YKJ A;  1SYH A;  2DWI A;  2KQZ A;  2H9B A;  1FJ9 A;  1USY E;  1H76 A;  4QSD A;  4M4G A;  4DXB A;  1FQF A;  2Q89 A;  2OJT A;  2ZYK A;  2BJJ X;  3OXN A;  1RDX A;  3FUZ A;  1LBB A;  3PPP A;  4ELR A;  1MY1 A;  3OO7 A;  3TKD A;  3JZJ A;  2HAU A;  5DTB A;  2ZYM A;  2YJP A;  3FV1 A;  3K6X A;  1FPB A;  3MP6 A;  3ZKK A;  3SEU A;  2O1L A;  4XF5 A;  1KZ8 A;  3VLV A;  3IFA A;  2GH9 A;  1A8E A;  5CMM A;  1YAE A;  1FPL A;  4L17 A;  3FAT A;  4DE8 A;  3TFL A;  3S9M C;  1IEJ A;  3SZP A;  1M5C A;  3SEY A;  1A55 A;  4I40 A;  1KWH A;  1RYO A;  4XEQ A;  2WX9 A;  2Y7K A;  3VV5 A;  1URG A;  4NF0 A;  3UP9 A;  2A5T A;  3DEL B;  4XXU A;  4FE8 A;  1BIY A;  3ISP A;  4O3A A;  2B4L A;  4XKP A;  5A5L A;  1FQD A;  4MLV A;  4P11 A;  3IAZ A;  2F7C A;  3OEL A;  2LAO A;  4PF8 A;  4GWW A;  1MH3 A;  3EQ1 A;  1IMD A;  2PFZ A;  3KBZ A;  3BFT A;  4PFB A;  3GLB A;  1A40 A;  3RN8 A;  2XXX A;  3CIJ A;  1IZ1 A;  5LTC A;  2P3V A;  4OEV A;  3CFX A;  4P8B A;  4U22 A;  3RYD A;  4PFR A;  1R6Z A;  3ZSF A;  4AQ4 A;  4BDN A;  5EHM A;  2D21 A;  4KR5 A;  1IMF A;  4F3G A;  4PGN A;  3MVW A;  4OTE A;  3VE1 B;  4PFU A;  1MQG A;  2QSX A;  5DVI A;  3CVG A;  1N76 A;  3MZB A;  1NNP A;  1NUW A;  4LUB A;  4PDH A;  3FIR A;  3QIM A;  1MXU A;  4YB7 A;  1J1N A;  3CHG A;  1DPE A;  1OLA A;  4YMA A;  2QS2 A;  1MY0 A;  3MPK A;  4DZ1 A;  1TT1 A;  2AYS A;  2V25 A;  4QFN A;  4BDO A;  3O28 A;  2VT5 A;  3U8Q A;  4KYS A;  3H6W A;  4F19 A;  2PT1 A;  2O51 A;  1LLS A;  5CMC A;  2ZXT A;  2QVU A;  1QUI A;  3M8U A;  2XD2 A;  3F11 A;  4R72 A;  3THI A;  1YTV A;  1URD A;  3UA8 A;  1FQA A;  4O8M A;  1H43 A;  4P1L A;  1QKA A;  1SD3 A;  5ET5 A;  4OAN A;  3T1B A;  4K3F A;  3EHS A;  3Q28 A;  4WXJ A;  1FSA A;  2O1M A;  4UAC A;  4GFR A;  2OX3 A;  3IJO B;  3TMG A;  1OVB A;  3PPN A;  3PD9 A;  4ESX A;  1KA1 A;  2FNC A;  1B7Z A;  1Z7N E;  2DVC A;  1OQH A;  1ATG A;  3CG3 A;  5H8S A;  2RC9 A;  5I56 A;  2HCA A;  1Y4T A;  4KYE A;  3PUY E;  3T9H B;  3H6V A;  2MKZ A;  1DK4 A;  2NOO A;  5ELV A;  1AMF A;  1LBW A;  5AA1 A;  5I59 B;  3BIG A;  4QFL A;  1MXZ A;  4JVD A;  5KDT B;  1M5D A;  4YMB A;  3TTR A;  1EU8 A;  1NV3 A;  2QS1 A;  2WEF A;  1NUX A;  3GBA A;  3T93 B;  2UYF A;  5F24 A;  1B52 A;  4NQ8 A;  3RY3 A;  4UA8 A;  2XXT A;  3H4Z A;  2RCB A;  4ZEC A;  4H45 A;  2OLB A;  3MW0 A;  1ZLQ A;  4U2R A;  3IB1 A;  4DDD A;  1USY H;  1BLF A;  1ELJ A;  2YLN A;  5ITO A;  5HBC A;  1I6Q A;  3OMB A;  4OFL A;  1LEV A;  4G8H A;  2RKM A;  3VVD A;  4QFO A;  2ALU A;  3Q25 A;  5DYH A;  5ET6 A;  3VVF A;  1EZO A;  5IZ3 B;  2H5Y A;  2O84 X;  4NMY A;  3OEK A;  5JTY B;  1RYX A;  1LBZ A;  1XVX A;  4OEU A;  3NOH A;  5L9M A;  4NED A;  4P0G A;  5L8D A;  2DYX A;  4YB6 A;  1SVX B;  4LZ8 A;  4H6D A;  3H6U A;  1YZ0 A;  1QKB A;  2YPN A;  1G0I A;  4F22 A;  2G93 A;  5KCJ A;  1ZU0 A;  3RUM A;  1IXG A;  3MUQ A;  1DTZ A;  1UTH A;  3UGW A;  4JXI A;  1N3X A;  2BJI A;  1NV1 A;  4G61 A;  3ZKL A;  2B65 A;  3BKI B;  4U21 A;  3D4G A;  4ELO A;  1FJ6 A;  3IL1 B;  3B6W A;  3E13 X;  4IO4 A;  1FBC A;  4MFI A;  2Z23 A;  5HM4 B;  2Z8F A;  4N81 A;  1DSN A;  2DQV A;  2XWI A;  5I2N B;  1DTG A;  4RYA A;  5M2V A;  2Q88 A;  4G8M A;  3FJ7 A;  3G3H A;  1B1X A;  4Z0I A;  1VFD A;  4I3Y A;  2RC8 A;  1B1H A;  4RNS A;  2X7Q A;  4BDL A;  2FHY A;  1B46 A;  1D9Q A;  1UIU A;  1T0K A;  4NGU A;  2F97 A;  4FED A;  4EXL A;  1LAH E;  4ZS9 A;  1K9Z A;  1IXI A;  5I59 A;  3ECR A;  3H7M A;  1AWB A;  3B7D A;  1WVJ A;  3FVN A;  1QW0 A;  4H67 A;  4X8R A;  2VGQ A;  3H6T A;  1PB8 A;  1B4Z A;  4PE3 A;  1DMB A;  3BFU A;  5TP9 A;  2UVH A;  1B0H A;  4MIJ A;  4GLI A;  4R6H A;  4MCO A;  4F3P A;  5I56 B;  4GRK A;  5FTH A;  4PBH A;  1YPN A;  3TEP A;  2QS4 A;  1B5I A;  5FHM A;  2F3D A;  4OFO A;  1TWY A;  3W9W A;  4AS5 A;  1MM7 A;  1FBF A;  4MMP A;  2QRY A;  4TLL B;  5TPA B;  3MPL A;  3KZG A;  4EF1 A;  4DI4 B;  4PAK A;  4NWD A;  4OWD A;  4C0R A;  4I9D A;  3PU5 A;  2F6P A;  4DI3 D;  1MQD A;  1DCU A;  4G2Z A;  1FTM A;  3KG2 A;  1Y3P A;  4U23 A;  1EH3 A;  1FRP A;  3LBS A;  1WOD A;  1XT8 A;  4C1U A;  5T3J A;  3FGS A;  5AA4 B;  4IR8 A;  1NH7 A;  4EUO A;  1FBD A;  4ISU A;  4NHB A;  2ZNS A;  3EHT A;  1FW0 A;  2XWV A;  1FTA A;  4F29 A;  1SW1 A;  3KC0 A;  4ZE9 A;  3MVY A;  3L6G A;  3S9N C;  4H1X A;  4QHQ A;  4DIG A;  3S9L C;  3HHG A;  3KJ7 A;  1N7W A;  2HZK A;  4N6P A;  2G29 A;  1SW5 A;  1QJM A;  3C4M A;  3KN8 A;  4NX1 A;  3LUY A;  4PQJ A;  2VHA A;  3IOR A;  2I4C A;  3C32 A;  5FHO A;  2R71 A;  1MM6 A;  1TFD A;  3RTW B;  1VSO A;  4O3B A;  2WBB A;  3MZ1 A;  1XS5 A;  2PCR A;  3LSL A;  3A09 A;  1XI6 A;  1INP A;  1A99 A;  1POT A;  2F35 A;  5LDZ A;  3VLU A;  3Q26 A;  3Q27 A;  3SET A;  4PFT A;  5ISU A;  1FPI A;  4R75 A;  2XXP A;  4N8Y A;  4N07 A;  2F7A A;  4WED A;  2DWJ A;  2R9J A;  4NN3 A;  1SW4 A;  4RPN A;  3D4C A;  3MC2 A;  1AL3 A;  1SW2 A;  1PEB A;  3IOT A;  3GXA A;  1JP4 A;  4JWY A;  4N91 A;  3DP6 A;  3FBP A;  1MXV A;  3W9V A;  1US5 A;  1EYK A;  1OLC A;  2HFB A;  4GWX A;  2X26 A;  4OVP A;  4JWO A;  5IZ1 A;  4OFJ A;  2REG A;  3B50 A;  4Q0C A;  1O63 A;  5IZZ A;  4R2F A;  5EYH A;  2DE3 A;  4F1U A;  4JVI A;  4F2O A;  3K01 A;  3K1M A;  1N84 A;  3QUF A;  3C34 A;  3R7X A;  2GFE A;  1B3H A;  2ZZW A;  2HEU A;  1NI9 A;  2PFY A;  2PT2 A;  2Q2C A;  2XXW A;  5I58 A;  1MS7 A;  1PDA A;  2I6E A;  4ND9 A;  3KGC A;  2Q8J A;  3FXU A;  1EZ9 A;  1R9Q A;  5A5X A;  4GIZ A;  1B32 A;  4GX6 A;  3MBP A;  3RPL B;  4F18 A;  5AA4 A;  5I57 B;  4HXV A;  1MH4 A;  4OES A;  5I84 A;  2KR0 A;  5J1D A;  1QUL A;  1PBQ A;  4F3B A;  3HN0 A;  2XXU A;  2DP8 A;  2VD2 A;  3N6T A;  1SPI A;  3O29 A;  1FTK A;  3PGF A;  1HSJ A;  4O3C A;  4C1T A;  3BIH A;  1OVT A;  4PTK A;  4TLM B;  3G3K A;  2VOZ A;  3RT8 A;  3HV1 A;  1UTH B;  1PC3 A;  1XOC A;  3FVO A;  2CEY A;  2XHD A;  4MHF A;  3H03 A;  5EHS A;  4HCW A;  3I3V A;  3UIF A;  3MST A;  3H06 B;  4QSC A;  1OMP A;  2Y7P A;  1LFI A;  2XXV A;  2RF1 A;  2DWA A;  2XX9 A;  2XXQ A;  3KEI A;  2V3U A;  4GXS B;  3CRB A;  2VPN A;  1MQH A;  1ZBM A;  2UYE A;  5IM2 A;  3PTY A;  4LQ2 A;  4MNP A;  2DS9 A;  3N6U A;  2OCU A;  2Z8E A;  5H8N A;  1P1Q A;  1P1U A;  1Y1M A;  2VD3 A;  3LR1 A;  1EYJ A;  5AA2 D;  1O64 A;  2NVU B;  3IFC A;  5FHN A;  1QVS A;  1JW4 A;  3OOA A;  4O94 A;  3MZ9 A;  4FJP A;  2Z8D A;  3FXB A;  3C35 A;  4P3L A;  2UXA A;  3SDF A;  3QXM A;  4F31 B;  5CMB A;  4OVJ A;  1US4 A;  4ZEK A;  5ITP A;  4FOR A;  1D4N A;  3U72 A;  1CE2 A;  2ZYN A;  1GGG A;  3U65 A;  4F39 A;  4NF5 B;  4HE1 A;  5JK4 A;  3VXC A;  4DXU A;  2M8C A;  1SQY A;  3TOD A;  4GWY A;  3G3I A;  1NUY A;  1IMC A;  4JBZ A;  1Y20 A;  3TTL A;  4MLQ A;  1TFA A;  3RT6 B;  5IGA A;  3TDJ A;  1N0T A;  4ONY A;  1NNK A;  3RNN A;  4I1D A;  1IUD A;  4MEV A;  4RK2 A;  2XXI A;  2AL4 A;  4G8N A;  4P56 A;  4FAJ A;  2DDK A;  5IKB A;  4ZZE A;  5DT6 A;  4GX3 A;  3K02 A;  1FCK A;  3QSL A;  3MAM A;  4QF9 A;  3FXQ A;  1IMA A;  3IO6 A;  4DXC A;  4HW8 A;  2NXO A;  2B3F A;  4EDP A;  2UVI A;  1YXI A;  1BP5 A;  2PVU A;  4TQU Q;  4I8C A;  4Q5T A;  1VFE A;  2I58 A;  4MNI A;  5HPQ A;  2H4I A;  3MVZ A;  3MP8 A;  1GTK A;  3TCH A;  2P0S A;  3O6H A;  3O6G A;  1LFG A;  3V89 B;  1Q9D A;  1H3D A;  4X48 A;  3VLW A;  4ZEI A;  4GX4 A;  4OYV A;  2OWS A;  4KXP A;  1UTB B;  4OVR A;  4LON B;  4I3E A;  1JW5 A;  2E0S A;  4RXL A;  4QFK A;  4MH5 A;  2QJE A;  1AIV A;  4NE4 A;  1JNF A;  3PUZ E;  3IJX B;  2OBG A;  5CM6 A;  2I0B A;  4R2B A;  3U92 A;  3SES A;  4NTL A;  1LB8 A;  4EQB A;  2F8D A;  3UN6 A;  3TTK A;  4R6K A;  2ONR A;  1LAF E;  4M1V A;  3G3F A;  4LN5 A;  4BDR A;  5DEX A;  2O7I A;  3TTM A;  4POW A;  3K1P A;  4JWX A;  3QUJ A;  3SEV A;  3EF7 A;  1NMU A;  2PYY A;  4GBW A;  4UAB A;  5TPA A;  1LAG E;  2V4C A;  1FTO A;  4N8G A;  2I3V A;  2X7P A;  3B8B A;  4H5G A;  3FZV A;  4LZ5 A;  5F7V A;  4N15 A;  2CZK A;  4LA9 A;  1BKA A;  4NF8 A;  3A29 A;  3O2A A;  1NKX A;  3M3L A;  1Y1Z A;  4PGP A;  3KN3 A;  1D9Y A;  4AS4 A;  3ODB A;  4GWU A;  1JEV A;  1M5F A;  2F7B A;  4HS7 A;  4YAH X;  5K2X A;  3PMX A;  4HTG A;  1VR5 A;  2CMO A;  4BDM A;  3O66 A;  3V83 A;  4PAF A;  2I48 A;  4OMB A;  2Z22 A;  1LAX A;  1POY 1;  3DM0 A;  2P2A A;  3HPI A;  4ZZA A;  1DBZ A;  3RQT A;  3N94 A;  3KJT A;  2ONS A;  3U1O A;  4LZ7 A;  4H5F A;  1JVY A;  5H8Q B;  1Y3N A;  1QUJ A;  1MPD A;  1B0L A;  1Y3Q A;  3V8X B;  1R9L A;  5KZT A;  5ESY A;  3CG1 A;  4GOT A;  3EN3 A;  4PFW A;  4FBP A;  1N7X A;  3VFJ A;  1IQ7 A;  2Y7R A;  3LSW A;  4WKM A;  2QL3 A;  3MP1 A;  2PX1 A;  3FJM A;  4X9T A;  4NF4 B;  2IEE A;  4XFE A;  3HST A;  2F5X A;  1GR2 A;  1B3G A;  3USD A;  3T9X B;  3RTF B;  2I0C A;  1IIT A;  1ZKB A;  2REJ A;  5F1Q A;  3OO9 A;  3ZS6 A;  4U1O A;  1JQF A;  4O7M A;  1FQB A;  3E9X A;  5AA3 A;  3K1N A;  1IXH A;  3K6W A;  4H65 A;  2UVJ A;  3TQW A;  3B6Q A;  4R73 A;  3SKP A;  4KPT A;  1Q35 A;  5I58 B;  1LB9 A;  3PUX E;  4NF6 B;  4F3S A;  3VVE A;  4Q30 B;  1P1O A;  2AIX A;  3CSG A;  2F3B A;  5EQA A;  1MQI A;  3MYU A;  3QYT A;  2CZH A;  2CZL A;  3PPR A;  3KSJ A;  4KFQ A;  1FPG A;  2R6G E;  1YCJ A;  2XXR A;  3RPW A;  1VDW A;  3LSF B;  4AB5 A;  4GQO A;  4EF2 A;  2E1S A;  4ECF A;  2Q9T A;  4PF6 A;  2Q74 A;  2XXH A;  2DXY A;  5CC2 A;  2HHM A;  3K0V A;  1URS A;  4PC9 A;  3LC8 A;  4AB6 A;  1LFH A;  3BBR A;  3KC1 A;  5L9S A;  3I6V A;  3MVX A;  3ONM A;  1BK4 A;  1P1N A;  3OSQ A;  5CI5 A;  4I62 A;  5DEX B;  3E3K A;  3FVK A;  1B9J A;  3IO4 A;  5K2Y A;  1MDP 1;  5I2K B;  2DE2 A;  1BTJ A;  2O69 A;  3CFL A;  4NG7 A;  3T66 A;  3L6H A;  5ET8 A;  1MY2 A;  3IB0 A;  3SEX A;  5AA2 A;  3SER A;  2WBD A;  5EYF A;  1HSE A;  4NWC A;  2ESN A;  3I5O A;  4KI0 E;  5EQ8 A;  3K4U A;  4IGT A;  1CNQ A;  1N04 A;  2Y7I A;  1MXX A;  5CMK A;  4KCC A;  4OEN A;  4RJZ A;  1G0H A;  5BWJ A;  2ANJ A;  1JVX A;  3IX1 A;  5I57 A;  2DVZ A;  1QUK A;  4MJO A;  4EQ7 A;  2QVV A;  3T0J A;  1S7Y A;  1NV6 A;  4KYD A;  3TQL A;  2FIE A;  1FPK A;  4U4S A;  3A3C A;  1TXF A;  3PMV A;  1QGX A;  3FVG A;  3EPE A;  2Q2A A;  2QVR A;  2FIX A;  4IY5 A;  2DWH A;  4IO7 A;  1FPF A;  1M5E A;  3C31 A;  1OIB A;  4GVO A;  1MXY A;  4RY1 A;  2KLF A;  2B3B A;  2XX7 A;  3N5L A;  4P9K A;  3UOR A;  1EZP A;  1D9V A;  1LCF A;  3VDF A;  2HXW A;  2WKY A;  1ZIU A;  3FXR A;  4JSD A;  3OO6 A;  2CZI A;  1LST A;  3HHF A;  3HO7 A;  4QBA A;  1F9B A;  3GZG A;  4X04 A;  4QRZ A;  4XKN A;  4GXA A;  2OWT A;  3K2D A;  4BLA A;  2XWK A;  4JSO A;  1CB6 A;  2OWZ A;  5EQ7 A;  5FTI A;  4POX A;  4H0W A;  2V93 A;  4KQP A;  2P1S A;  4KCD A;  4OVT A;  4H8J A;  3V5A A;  2F6G A;  4IB2 A;  4QXD A;  1LBV A;  2ZYO A;  5DW8 A;  3MJN A;  5EYG A;  4QSE A;  3IOV A;  4H46 A;  1JW1 A;  4P0I A;  1VE4 A;  4YB5 A;  2GQ1 A;  2CEX A;  4NF4 A;  1FBP A;  4PFI A;  2ZMB A;  4ZEF A;  1UIV A;  1LGB C;  3CFZ A;  4GWO A;  2P3N A;  2FA7 A;  2NUV A;  2F78 A;  1IIW A;  1L5T A;  3G3G A;  4G4P A;  4E0X A;  3ILT B;  3RLF E;  2D5W A;  1NFT A;  3IK6 B;  4JDF A;  2ONK E;  1NNF A;  3MQ9 A;  1B3E A;  3DP4 A;  1O7T A;  2GHB A;  4R74 A; 
#chains in the Genus database with same CATH homology
 3BFU A;  3PUZ E;  5TP9 A;  1IXC A;  3TYH A;  1S9T A;  3IJX B;  3R26 A;  3SEW A;  2OBG A;  2UVH A;  1B0H A;  1FQE A;  2I0B A;  4R2B A;  4GLI A;  4R6H A;  3TEL A;  5CM6 A;  3U92 A;  4YIC A;  3T22 A;  3SES A;  1JEU A;  2PBW A;  1LB8 A;  2O68 A;  2F8D A;  3OEN A;  4G68 A;  4KD5 A;  4NTL A;  4EQB A;  3PUW E;  2V3Q A;  4F3P A;  5I56 B;  4GRK A;  5FTH A;  2XXY A;  3UN6 A;  2RCA A;  3G3J A;  3G7W A;  1JET A;  1YPN A;  4GL8 A;  3TEP A;  4PFY A;  4F1V A;  3TTK A;  1WDN A;  2QS4 A;  4FAT A;  1B5I A;  4R6K A;  5FHM A;  4ZED A;  2ONR A;  1LAF E;  4M1V A;  2DOJ A;  4Q8R A;  4OFO A;  3N26 A;  3G3F A;  1TWY A;  4BDR A;  3W9W A;  5IAI A;  1MM7 A;  2GRV A;  2NWJ A;  5DEX A;  1I6A A;  2O7I A;  3TTM A;  2QRY A;  4POW A;  1GVC A;  1OQG A;  3K1P A;  4JWX A;  3K6V A;  3QUJ A;  4TLL B;  5TPA B;  3EF7 A;  3MPL A;  4TOZ A;  3KZG A;  3SEV A;  4EF1 A;  5A5X A;  4H8I A;  1NMU A;  3HCQ A;  4RK9 A;  2PYY A;  4YKJ A;  4NWD A;  1MY4 A;  4OWD A;  1SYH A;  4I9D A;  2DWI A;  3PU5 A;  4C0R A;  2F6P A;  2H9B A;  1MQD A;  4IO6 A;  5TPA A;  1LAG E;  1FTO A;  4G2Z A;  2I3V A;  1H76 A;  1USY E;  1FTM A;  4QSD A;  4M4G A;  4DXB A;  1FQF A;  1SI0 A;  2Q89 A;  2OJT A;  2X7P A;  2ZYK A;  2BJJ X;  4FEC A;  3FZV A;  3KG2 A;  4H5G A;  4LZ5 A;  3KN7 A;  3OXN A;  5F7V A;  3TAJ A;  1Y3P A;  4ELR A;  3FUZ A;  1LBB A;  3PPP A;  4U1Z A;  4U23 A;  1MY1 A;  4LA9 A;  1BKA A;  4NF8 A;  3OO7 A;  1EH3 A;  4PE5 B;  3TKD A;  3CR9 A;  3O2A A;  1NKX A;  1WOD A;  1XT8 A;  3LBS A;  1I6B A;  2HAU A;  2THI A;  1P1W A;  3JZJ A;  3M3L A;  1Y1Z A;  3O6I A;  4X1D A;  2ZYM A;  5DTB A;  3TPA A;  2YJP A;  3FGS A;  3FV1 A;  3KN3 A;  5AA4 B;  1D9Y A;  3K6X A;  4OHN A;  3SEU A;  2QPQ A;  3MP6 A;  1SBP A;  2H99 A;  1NH7 A;  3ODB A;  4NF8 B;  4HCY A;  4EUO A;  3ZKK A;  1JEV A;  2O1L A;  3PPQ A;  4QFP A;  1M5F A;  4ISU A;  3M3K A;  2W7Y A;  4YKP A;  2F7B A;  2ZNS A;  3EHT A;  1FW0 A;  4HS7 A;  3A3U A;  4YAH X;  3VLV A;  5K2X A;  4NF5 A;  2GH9 A;  3PMX A;  4HTG A;  1A8E A;  4LVQ A;  1YAE A;  4L17 A;  5CMM A;  3FAT A;  3E4R A;  4DE8 A;  3TFL A;  1VR5 A;  2CMO A;  4BDM A;  3S9M C;  1IEJ A;  3ILU B;  4F29 A;  1SW1 A;  3O66 A;  3V83 A;  1M5C A;  2I48 A;  4OMB A;  4C1U A;  2Z22 A;  1LAX A;  1A55 A;  1POY 1;  3MVY A;  4JB7 A;  3SEY A;  4ZE9 A;  5AA2 B;  3DM0 A;  3L6G A;  2P2A A;  3S9N C;  3HPI A;  1KWH A;  4H1X A;  1RYO A;  4QHQ A;  2Y7K A;  4ZZA A;  3VV5 A;  1URG A;  3HHG A;  3KJ7 A;  3N94 A;  1N7W A;  2HZK A;  3KJT A;  4N6P A;  3RQT A;  2G29 A;  2ONS A;  2QS3 A;  3UP9 A;  4ELP A;  2A5T A;  3DEL B;  4XXU A;  1SW5 A;  4FE8 A;  1QJM A;  4LZ7 A;  1BIY A;  3U1O A;  3C4M A;  3KFM A;  1B7U A;  3KN8 A;  4H5F A;  3LUY A;  1JVY A;  4ZDM A;  4G68 C;  5H8Q B;  5KDT A;  1Y3N A;  2V84 A;  4PQJ A;  4YKK A;  1QUJ A;  5I2N A;  2VHA A;  3UK4 A;  1MPD A;  1B0L A;  1Y3Q A;  3IOR A;  4G68 B;  4O3A A;  3V8X B;  2I4C A;  1R9L A;  3FAS A;  4XKP A;  3CG1 A;  3C32 A;  3EN3 A;  4GOT A;  1FTJ A;  1FQD A;  4PFW A;  1N7X A;  4MLV A;  5FHO A;  1IQ7 A;  3VFJ A;  2Y7R A;  4IY6 A;  3LSW A;  3IAZ A;  4P11 A;  2QL3 A;  3MP1 A;  2PX1 A;  2R71 A;  1MM6 A;  3FJM A;  1MRP A;  2F7C A;  4X9T A;  3OEL A;  4NF4 B;  4ZE8 A;  1GV8 A;  2IEE A;  3QK6 A;  2LAO A;  1TFD A;  3HST A;  2F5X A;  1GR2 A;  3RTW B;  1VSO A;  4O3B A;  4BDN A;  5I59 A;  4EXK A;  1B3G A;  3USD A;  3MZ1 A;  1XS5 A;  3T9X B;  1MH3 A;  2DXR A;  3RTF B;  1ZTY A;  3LSL A;  2I0C A;  1AOV A;  3EQ1 A;  3A09 A;  1B3F A;  3BFT A;  3Q29 A;  1IIT A;  1LCT A;  3GLB A;  3S2V A;  1ZKB A;  2REJ A;  1A40 A;  1H44 A;  5F1Q A;  1B58 A;  3RN8 A;  4F2Q A;  3OO9 A;  2XXX A;  3CIJ A;  4DCY A;  1IZ1 A;  2DE4 A;  3PD8 A;  3T9V A;  3ZS6 A;  4U1O A;  1JQF A;  2H25 A;  1A99 A;  1POT A;  2F35 A;  1S50 A;  1FQB A;  4OEV A;  3CFX A;  1NH8 A;  3VXB A;  3M3F A;  4U22 A;  3E9X A;  3Q26 A;  3VLU A;  2QMW A;  3Q27 A;  5AA3 A;  1MXW A;  2F34 A;  4E0X A;  1R6Z A;  3ZSF A;  3KOT A;  4PFT A;  2ZNU A;  3SET A;  4AQ4 A;  3K1N A;  1IXH A;  3K6W A;  4H65 A;  2UVJ A;  5EHM A;  3TQW A;  2D21 A;  3B6Q A;  1II5 A;  4R73 A;  2H98 A;  3SKP A;  2A5S A;  5ISU A;  4KR5 A;  4KPT A;  4OXV A;  1Q35 A;  4R9F A;  5I58 B;  1LB9 A;  3PUX E;  4NF6 B;  4R75 A;  4ZEB A;  4F3S A;  2XXP A;  3O97 A;  5DVJ A;  4F3G A;  4N07 A;  3VVE A;  2F7A A;  3MVW A;  4OTE A;  4IO2 A;  4Q30 B;  2DWJ A;  1Y9U A;  4PFU A;  4WED A;  4XKQ A;  2R9J A;  3T9U A;  1SW4 A;  1P1O A;  2AIX A;  1MQG A;  3CSG A;  1MY3 A;  1NNT A;  4RPN A;  3D4C A;  3MC2 A;  1AL3 A;  1SW2 A;  1UTB A;  2QSX A;  5DVI A;  5H8F A;  1PEB A;  3CVG A;  3IOT A;  4KHZ E;  1MQI A;  2Y84 A;  1N76 A;  3MZB A;  3GXA A;  3QYT A;  2CZL A;  5H8H B;  1HSL A;  1NNP A;  4JWY A;  3PPR A;  4U4X A;  4LUB A;  3S9L C;  3FIR A;  3QIM A;  1MXU A;  3DP6 A;  4YB7 A;  3KSJ A;  1J1N A;  2XD3 A;  1DPE A;  1MXV A;  3W9V A;  4Z7E A;  1OLA A;  2HAV A;  4YMA A;  4KFQ A;  1US5 A;  4F1Y A;  2QS2 A;  1MY0 A;  3MPK A;  3OEM A;  2R6G E;  4DZ1 A;  1OLC A;  4GD5 A;  1A7L A;  1TT1 A;  1YCJ A;  2AYS A;  2FYI A;  2HFB A;  2V25 A;  2XXR A;  4QFN A;  3RPW A;  1B40 A;  2X26 A;  3PMW A;  4OQO A;  1MDQ A;  4BDO A;  3O28 A;  4JWO A;  3LSF B;  2REG A;  4GQO A;  4OFJ A;  4AB5 A;  4Q0C A;  1O63 A;  3U8Q A;  4KYS A;  4R2F A;  4EF2 A;  2E1S A;  4ECF A;  2Q9T A;  2DE3 A;  3H6W A;  3TCG A;  4F19 A;  2PT1 A;  4F1U A;  4XTC Q;  1MQJ A;  2F36 A;  4F2O A;  2O51 A;  5CBR A;  2XXH A;  3K01 A;  2Y7W A;  1LLS A;  3K1M A;  4N13 A;  2DXY A;  2ZXT A;  5CMC A;  1N84 A;  3QUF A;  5CC2 A;  1DOT A;  1QUI A;  3M8U A;  1PB7 A;  2XD2 A;  4NF6 A;  3C34 A;  2GFE A;  3F11 A;  3K0V A;  4MBP A;  4R72 A;  1B3H A;  4XKR A;  1YTV A;  3R7X A;  3THI A;  4LP2 B;  1URS A;  1URD A;  2HEU A;  3UA8 A;  4XIG Q;  1FQA A;  5DVF A;  2PT2 A;  3LC8 A;  1ZJL A;  4WEP A;  1H43 A;  4AB6 A;  1LFH A;  1QKA A;  2Q2C A;  3BBR A;  1SD3 A;  2XXW A;  1B7H A;  5L9S A;  5I58 A;  1MS7 A;  1PDA A;  3I6V A;  3MVX A;  4ESW A;  2I6E A;  3ONM A;  4K3F A;  4ND9 A;  1P1N A;  4ELQ A;  3KGC A;  3EHS A;  1B2H A;  3OSQ A;  5CI5 A;  5A5X B;  4I62 A;  3Q28 A;  4WXJ A;  2O1M A;  2V3T A;  4UAC A;  4GFR A;  3E3K A;  1UQW A;  5DEX B;  2Q8J A;  3FXU A;  3IJO B;  3TMG A;  1OVB A;  1EZ9 A;  3DP8 A;  5H8Q A;  1B5H A;  3FVK A;  1B9J A;  3PPN A;  4DDD A;  1R9Q A;  3IO4 A;  3MWB A;  3PD9 A;  5K2Y A;  3U93 A;  4GIZ A;  4BDQ A;  2FNC A;  1MDP 1;  1B32 A;  3S4U A;  4ESX A;  1B7Z A;  5I2K B;  1SDX A;  3FJG A;  1Z7N E;  2DE2 A;  3MBP A;  4F18 A;  1BTJ A;  2O69 A;  3CFL A;  3CI8 A;  4GF8 A;  1SI1 A;  2DVC A;  5AA4 A;  3T66 A;  5I57 B;  1OQH A;  1ATG A;  3L6H A;  4GL0 A;  1MY2 A;  3C36 A;  5KCJ B;  2QMX A;  3CG3 A;  3IB0 A;  3KOS A;  1MH4 A;  5H8S A;  3SEX A;  3SER A;  4OES A;  5AA2 A;  5I84 A;  4G77 A;  5EYF A;  5J1D A;  1HSE A;  1QUL A;  1PBQ A;  4F3B A;  1Y4C A;  1XVY A;  3HN0 A;  1MPB A;  2RC9 A;  2XXU A;  4NWC A;  2DP8 A;  2VD2 A;  2HCA A;  3IOW A;  3N6T A;  4FIM A;  1Y4T A;  1SYI A;  4KYE A;  5I56 A;  2D3I A;  3PUY E;  3O29 A;  3T9H B;  1FTK A;  2ESN A;  3I5O A;  3H6V A;  3PGF A;  5EHS A;  4KI0 E;  3K4U A;  4IGT A;  1N04 A;  1A54 A;  2Y7I A;  2ZNT A;  1HSJ A;  2NOO A;  1MXX A;  5CMK A;  4KCC A;  1AMF A;  4O3C A;  5ELV A;  5H8F B;  3U94 A;  4FEB A;  4NE4 A;  4OEN A;  4RJZ A;  4C1T A;  1OVT A;  5BWJ A;  5I2K A;  4TLM B;  2ANJ A;  5AA1 A;  3G3K A;  1JVX A;  2VOZ A;  3RT8 A;  4QFL A;  3T96 B;  3IX1 A;  3WAF A;  5I59 B;  1MXZ A;  3HV1 A;  3PPO A;  5I57 A;  1UTH B;  4OZ9 A;  5KDT B;  4DCX A;  2DVZ A;  1M5D A;  2VP1 A;  3TUS A;  5ICT A;  1QUK A;  4YMB A;  3TTR A;  4EQ7 A;  1EU8 A;  1PC3 A;  1S7Y A;  3EHU A;  4MF3 A;  2QS1 A;  3K00 A;  1XOC A;  3FVO A;  3GBA A;  4KYD A;  2UYF A;  3T93 B;  3TQL A;  5B7D A;  2HQ0 A;  2XHD A;  2XX8 A;  1B52 A;  3RY3 A;  3H03 A;  4U4S A;  4UA8 A;  2UVG A;  2XXT A;  3A3C A;  1B3L A;  1TXF A;  2RCB A;  3H4Z A;  4IO5 A;  3OSR A;  4IO3 A;  4HCW A;  4ZEC A;  2HZL A;  3I3V A;  3PMV A;  2OLB A;  3UIF A;  3MW0 A;  1ZLQ A;  4U2R A;  3H06 B;  4YU0 A;  1XC1 A;  2RC7 A;  4QSC A;  3FVG A;  1OMP A;  2Y7P A;  1LFI A;  3IB1 A;  3IB2 A;  3DLN A;  2XXV A;  3EPE A;  4LQ5 A;  1BLF A;  1ELJ A;  1H45 A;  1USY H;  2DWA A;  2RF1 A;  2YLN A;  5B70 A;  2XX9 A;  2XXQ A;  3KEI A;  5CBS A;  2V3U A;  4GXS B;  2I3W A;  5ITO A;  3TCF A;  5HBC A;  3CRB A;  5H8N B;  1I6Q A;  5JEI A;  3IR1 A;  3FV2 A;  4RPO A;  3OMB A;  2GHA A;  1MQH A;  1ZBM A;  2I4B A;  2Q2A A;  1A8F A;  4OFL A;  3KSX A;  2UYE A;  4G8H A;  4YZZ A;  2RKM A;  4LQ2 A;  2DS9 A;  4QFO A;  2ALU A;  3VVD A;  4E0W A;  1B51 A;  3WAE A;  4IY5 A;  2OK2 A;  3N6U A;  2OCU A;  2Z8E A;  3Q25 A;  4RA1 A;  2DWH A;  5DYH A;  5H8N A;  4R6Y A;  4IO7 A;  4OET A;  3VVF A;  1P1Q A;  4PP0 A;  1P1U A;  1Y1M A;  2VD3 A;  1M5E A;  1MG1 A;  1EZO A;  4LAT A;  3LR1 A;  1DPP A;  3C31 A;  5TU0 A;  5AA2 D;  1OIB A;  1O64 A;  2NVU B;  5FHN A;  2H5Y A;  2O84 X;  1QVS A;  1JW4 A;  4GVO A;  4NMY A;  3KBR A;  3OOA A;  1MXY A;  3JV9 A;  4DLD A;  2DSF A;  3P7I A;  1RKM A;  3GBB A;  3MZ9 A;  4RY1 A;  5TP9 B;  3OEK A;  2KLF A;  2B3B A;  4FJP A;  4IGR A;  5JTY B;  1RYX A;  1XVX A;  2XX7 A;  4OEU A;  2Z8D A;  1NL5 A;  1P99 A;  5L9M A;  4PET A;  3C35 A;  4WKM A;  1MPC A;  3FD3 A;  5LOM A;  1Z7M E;  2UXA A;  4NED A;  4P0G A;  5L8D A;  3SDF A;  3N5L A;  3QXM A;  3UOR A;  1EZP A;  1D9V A;  2DYX A;  4YB6 A;  4F31 B;  1LCF A;  1SVX B;  4LZ8 A;  5ICQ A;  3VDF A;  4H6D A;  4OVJ A;  1US4 A;  1LBC A;  5CMB A;  2O6A A;  5CRY A;  2HXW A;  3H6U A;  4ZEK A;  5ITP A;  1FQC A;  1QKB A;  2WKY A;  4FOR A;  2YPN A;  1ZIU A;  1D4N A;  3U72 A;  1CE2 A;  2ZYN A;  3FXR A;  1GGG A;  4F22 A;  3OD7 A;  2G93 A;  4F39 A;  4NF5 B;  4JSD A;  5KCJ A;  5JK4 A;  3OO6 A;  1ZU0 A;  3C9H A;  3TTN A;  3VXC A;  1ANF A;  1R1N A;  1LST A;  3RUM A;  1B05 A;  4DXU A;  5AE4 A;  2M8C A;  1SQY A;  3TOD A;  4R9G A;  1IXG A;  3G3I A;  3HHF A;  3JYR A;  1DTZ A;  3MUQ A;  4JBZ A;  3QAX A;  1UTH A;  3HO7 A;  1Y20 A;  3TTL A;  3UGW A;  4MLQ A;  1TFA A;  2RIN A;  3RT6 B;  1F9B A;  3LSX A;  3GZG A;  1ZMG A;  3H3G A;  4QRZ A;  2A5T B;  3AXF A;  4EQ9 A;  4JXI A;  1N3X A;  3TDJ A;  1N0T A;  3ZKL A;  4ONY A;  1NNK A;  2B65 A;  3C33 A;  4XKN A;  4I1D A;  1IUD A;  4GXA A;  4RK2 A;  3RNN A;  2XXI A;  1XHY A;  2AL4 A;  2OWT A;  3K2D A;  4BLA A;  3VE1 B;  3BKI B;  4U21 A;  3O9P A;  4G8N A;  3D4G A;  4ELO A;  4JSO A;  4FAJ A;  3IL1 B;  1CB6 A;  5IKB A;  1PB9 A;  3B6W A;  3E13 X;  4IO4 A;  4ZZE A;  5DT6 A;  4MFI A;  2Z23 A;  3PV0 E;  5HM4 B;  3K02 A;  3CSB A;  3TZA A;  2Z8F A;  5FTI A;  4POX A;  4H0W A;  1DSN A;  2DQV A;  3RGY A;  1FCK A;  4DIG A;  5I2N B;  2V93 A;  3K6U A;  2ABH A;  3R6U A;  1DTG A;  4KQP A;  3QSL A;  2P1S A;  2O7U A;  4KCD A;  4RYA A;  2Q88 A;  4H8J A;  5M2V A;  3V5A A;  1Q1K A;  3MAM A;  2F6G A;  4G8M A;  1FTL A;  3FJ7 A;  4IB2 A;  4QF9 A;  3FXQ A;  5H8H A;  3G3H A;  1B1X A;  3IO6 A;  4OER A;  4DXC A;  4HW8 A;  2NXO A;  2B3F A;  2ZYO A;  4X1B A;  4Z0I A;  4EDP A;  2UVI A;  3MJN A;  4QSE A;  1BP5 A;  2PVU A;  3IOV A;  1VFD A;  1D3K A;  1JW1 A;  3B6T A;  5L9O A;  4P0I A;  1VE4 A;  2OZZ A;  4TQU Q;  4YB5 A;  2IA4 A;  2RC8 A;  1B1H A;  4I8C A;  4Q5T A;  1VFE A;  2I58 A;  4RNS A;  3OO8 A;  2X7Q A;  3W15 C;  5HPQ A;  2H4I A;  3MVZ A;  3MP8 A;  5BUU A;  4NF4 A;  4BDL A;  1B46 A;  1GTK A;  2AL5 A;  2ZMB A;  3TCH A;  1UIU A;  4ZEF A;  2P0S A;  1T0K A;  1M5B A;  1UIV A;  1LGB C;  3CFZ A;  3IOU A;  3O6H A;  4GWO A;  5KZT A;  4THI A;  3O6G A;  1LFG A;  2F97 A;  2I49 A;  3PUV E;  4FED A;  4EXL A;  3V89 B;  2FA7 A;  2NUV A;  1LAH E;  1H3D A;  2F78 A;  1IIW A;  4X48 A;  4ZS9 A;  1B6H A;  4YKI A;  4ZEI A;  1L5T A;  3VLW A;  1IXI A;  3G3G A;  4G4P A;  3ECR A;  3H7M A;  3ILT B;  1B4H A;  2D5W A;  4OYV A;  3RLF E;  2PMS A;  1NFT A;  3IK6 B;  1PBP A;  3B7D A;  1I69 A;  2OWS A;  3S9E A;  1WVJ A;  2ONK E;  1AH5 A;  1UTB B;  3FVN A;  4JDF A;  5JTY A;  1QW0 A;  1B5J A;  1NNF A;  3MQ9 A;  1JW5 A;  2E0S A;  1B3E A;  4H67 A;  4LON B;  4RXL A;  4QFK A;  3DP4 A;  1O7T A;  2VGQ A;  3H6T A;  1PB8 A;  4MH5 A;  1B4Z A;  1N3W A;  2QJE A;  1AIV A;  1DMB A;  2GHB A;  1JNF A;  4R74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...