2FNCA

Thermotoga maritima maltotriose binding protein bound with maltotriose.
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
379
structure length
379
Chain Sequence
KLTIWCSEKQVDILQKLGEEFKAKYGIPVEVQYVDFGSIKSKFLTAAPQGQGADIIVGAHDWVGELAVNGLIEPIPNFSDLKNFYDTALKAFSYGGKLYGVPYAMEAVALIYNKDYVDSVPKTMDELIEKAKQIDEEYGGEVRGFIYDVANFYFSAPFILGYGGYVFKETPQGLDVTDIGLANEGAVKGAKLIKRMIDEGVLTPGDNYGTMDSMFKEGLAAMIINGLWAIKSYKDAGINYGVAPIPELEPGVPAKPFVGVQGFMINAKSPNKVIAMEFLTNFIARKETMYKIYLADPRLPARKDVLELVKDNPDVVAFTQSASMGTPMPNVPEMAPVWSAMGDALSIIINGQASVEDALKEAVEKIKAQIEKGSHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of redundant maltotriose binding proteins from the thermophile Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Sugar binding protein
molecule keywords maltose ABC transporter, periplasmic maltose-binding protein
total genus 124
structure length 379
sequence length 379
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2fncA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2fncA01
1M5CA 1UIVA 2PVUA 3CSBA 1MQDA 1B3EA 3CG1A 3KSJA 5FHMA 4AQ4A 5CM6A 3TQWA 4L17A 3TELA 2Y7RA 3LUYA 1DPPA 2OWSA 2VGQA 3TCHA 2ZNUA 2DP8A 2X7QA 3G3IA 3T93B 2PT1A 3N6TA 1BIYA 3THIA 4ELRA 4M4GA 5B70A 3KG2A 5H8SA 1MM7A 1TT1A 3OO9A 3TTKA 5ICQA 1P1WA 1TWYA 4OFLA 4EQ7A 3FZVA 2V25A 3U93A 3MVWA 2UYEA 4U22A 3PUZE 3G3HA 3TTNA 5FTIA 2DE3A 3A3UA 4FIMA 3FIRA 4R6HA 1SW5A 3RUMA 4YU0A 3Q29A 5CRYA 2ESNA 2HAUA 2XXYA 3IJOB 3KEIA 3VE1B 4EQ9A 1Y1ZA 3OSQA 2AL5A 1SYHA 4LONB 4Z7EA 1FTLA 2B65A 3IOVA 5CMMA 3SETA 1SBPA 5I2NB 1XVXA 2XXWA 2FA7A 2H9BA 4R74A 1LAXA 2Q8JA 4KFQA 3KJTA 2ZNSA 4WEDA 5H8QA 3TODA 1O63A 1PB9A 1R9LA 2RKMA 4LZ5A 3UGWA 2ONSA 3H7MA 2GHAA 1TFAA 2XXIA 2HXWA 1FTMA 1IIWA 4U2RA 1MXZA 2Q2CA 1PDAA 2RC9A 1SW2A 5I2KA 5CMCA 4YB7A 3QAXA 3S4UA 2F7AA 4YICA 4EXKA 3CFLA 3MWBA 1ANFA 4P11A 3HSTA 3QYTA 4YB6A 1XHYA 1XS5A 1B4HA 2XXPA 1GV8A 4YMAA 1FW0A 1OQHA 5L8DA 1IXHA 3ZKKA 1MY1A 3SDFA 1CE2A 1URDA 4C1UA 2DE2A 3IR1A 3S2VA 3UK4A 3Q26A 4JWOA 4RY1A 2OZZA 1N7WA 5TP9B 5I57A 1B0LA 3R26A 4XTCQ 5HM4B 1WVJA 4NF6A 4NF6B 4R6KA 2DVCA 3AXFA 3GLBA 1MY3A 1B2HA 1ZU0A 2F36A 4IGTA 3KN7A 4FATA 2ANJA 3OOAA 4RYAA 3VVEA 4F18A 5KDTA 1O7TA 1B7HA 1YAEA 3FVKA 1JEUA 1LAGE 1OVTA 4ZDMA 3V89B 4QF9A 3VLVA 4XKQA 3V5AA 2HQ0A 4LQ5A 1PEBA 1P1OA 2XD2A 3KN8A 4KQPA 4X9TA 4I62A 4LZ7A 4EXLA 4RK2A 3U1OA 5I2KB 3HCQA 1YCJA 1VFEA 4O3AA 3OO8A 4PFTA 1Y3PA 3I5OA 1NNKA 3SEXA 1OLCA 3O66A 3MQ9A 3IB2A 3VLUA 2ONRA 4Q8RA 3EPEA 1FCKA 4OESA 2DXYA 5H8QB 1OQGA 4ZE8A 3CFZA 1MY0A 2P1SA 4Q0CA 3DP8A 1EH3A 4XXUA 1WODA 3U92A 4XIGQ 1OIBA 2DWJA 3RLFE 2DXRA 2B3BA 4OHNA 4GIZA 4JB7A 3FATA 5B7DA 1MQIA 1DSNA 2O69A 3M3FA 4DXUA 1UTBB 2D5WA 4PFUA 3RTFB 3CRBA 5AA1A 4ECFA 5EYFA 4KR5A 5HBCA 1USYE 3LR1A 4U21A 4GXSB 3I6VA 3OD7A 4GOTA 1A40A 1FTKA 1QUIA 2Y7PA 2Y7WA 1IXIA 4R9FA 1POY1 2I6EA 3CFXA 3PUYE 1OMPA 2O6AA 4GF8A 5DVIA 2H25A 3CVGA 2E0SA 3CR9A 1JW4A 2GH9A 4H5GA 2ZYMA 1Y1MA 1B6HA 2R71A 4F1VA 4ESWA 4KCDA 4HTGA 3PPNA 1IZ1A 2H99A 2DOJA 1JW1A 3OO6A 4DLDA 4DCYA 2R6GE 4EF1A 4YZZA 5KCJA 1QVSA 4GWOA 3HN0A 2XXHA 4U1ZA 3JV9A 1NH8A 4ZEIA 5CBSA 1LBCA 3QIMA 3SEYA 1AMFA 2P0SA 5KZTA 5FTHA 3TKDA 1Y3QA 1P1QA 3EHUA 3O6IA 3TMGA 4KPTA 2F5XA 2YLNA 4PQJA 1R9QA 4IO5A 4PFWA 4EDPA 2QL3A 1D9VA 1NH7A 3IO4A 4NF8A 2XXRA 5JEIA 1ZKBA 1B3LA 3L6HA 2I0CA 1MPDA 5H8HB 1A55A 1FQCA 4JXIA 5BUUA 3TCGA 1JEVA 4NWDA 3PGFA 4ELQA 5CI5A 3LSXA 3PV0E 3G3FA 4YB5A 3RPWA 1B7UA 5HPQA 4N6PA 3TEPA 1LAHE 2O7IA 4QFNA 4RNSA 1MG1A 3FD3A 3FVNA 4H1XA 4ZZAA 3RQTA 1USYH 3FJ7A 1SW4A 3K1MA 3ILUB 4RPOA 2F8DA 2D21A 5F7VA 4DE8A 4DXBA 3K6XA 2M8CA 4UACA 4X1DA 2ZYNA 4NF5A 3Q28A 2PT2A 4JDFA 2F97A 3QXMA 1JVYA 3TTLA 1FQAA 1MDQA 2QMXA 4F3GA 3T96B 3C31A 2Q88A 2LAOA 2XXVA 2XXQA 2VP1A 2XX7A 2Z8FA 3C9HA 3SEUA 1TXFA 2A5TB 2F7BA 1AIVA 5I58A 4WKMA 5I59B 2RCAA 4XKRA 2I48A 2Z8EA 5DVFA 4ZECA 1MXVA 5DEXA 4JWXA 3KFMA 3D4CA 1PBPA 1Q1KA 3MZ9A 3SESA 2DVZA 1DPEA 3E9XA 1T0KA 1B3GA 3H6TA 2DWAA 1MH3A 2QS2A 2UVJA 3C4MA 3G3GA 1MQGA 3OEKA 4FE8A 4DDDA 4QSEA 4G77A 1A54A 1N3XA 1POTA 4FORA 4GLIA 1B05A 2NUVA 3MBPA 1D4NA 3K1PA 4FJPA 4O3BA 1L5TA 4IY5A 2B3FA 2GFEA 2I3WA 3H3GA 3ILTB 3OO7A 4PE5B 3T9XB 5I84A 4HCYA 3FUZA 1HSEA 4G8MA 3OEMA 4HS7A 3O6HA 3RN8A 3FXRA 2VD3A 3MJNA 4GQOA 1UTHB 3HHGA 5ICTA 5KCJB 2PX1A 3H06B 3A3CA 3OELA 2AL4A 3E3KA 4EUOA 3MAMA 1OLAA 5L9OA 2F6GA 3GBAA 3S9EA 1BP5A 1BKAA 1MPCA 2XD3A 1VSOA 3PPRA 3PUVE 1QW0A 1GGGA 4H0WA 3BFTA 4OENA 2I49A 1QKAA 3O2AA 4KHZE 1LGBC 3FGSA 4RJZA 3UA8A 3UP9A 1MRPA 1XC1A 4O3CA 1LFHA 3RT8A 3MW0A 3IAZA 1B5HA 3FVOA 3LBSA 3O97A 3RGYA 1LAFE 1Y4CA 3KOSA 3R6UA 4F29A 5A5XB 4BDMA 3FXUA 5K2XA 4F3BA 4PP0A 4PFYA 3N94A 3ZKLA 4GXAA 2QMWA 2A5SA 2OK2A 3BBRA 4R6YA 2Q89A 3H03A 2VD2A 4EQBA 3MPKA 4G68B 1I69A 1M5BA 2I58A 2CZLA 4ISUA 4R75A 4RK9A 2QS3A 3EHTA 1MS7A 3KN3A 4OERA 3CG3A 5JTYB 1MM6A 2I0BA 4E0WA 1UQWA 2XHDA 2O1LA 3MZBA 3TZAA 4YKPA 3FJMA 1LBBA 5DVJA 2O1MA 1VR5A 3T9UA 4PETA 3DP4A 1A8EA 4MFIA 4OFOA 3B6TA 1I6BA 2F34A 1US5A 3K4UA 3M3LA 2AYSA 1B5IA 1VE4A 2OLBA 3H6WA 3O9PA 3PD8A 1P1UA 4IY6A 3K0VA 4LUBA 4QSCA 3I3VA 4WEPA 5FHNA 2REGA 4F1YA 5AA4B 3O28A 2DS9A 2Z23A 4N13A 4BDOA 4U23A 3MZ1A 5CMBA 2G93A 4ZE9A 4UA8A 3QUFA 3ODBA 4POWA 3S9MC 1EU8A 2HAVA 1S7YA 5H8FA 1H3DA 1MDP1 2G29A 4H5FA 3H4ZA 4QFKA 4YAHX 2X26A 3EF7A 3K00A 3MVXA 4H8JA 4KD5A 3IOWA 4OWDA 1B51A 3T66A 3D4GA 2PYYA 2H98A 3TDJA 2QS4A 3PUXE 4HW8A 4F39A 1GR2A 1FQEA 3RY3A 1B32A 3SERA 4OVJA 3BKIB 1N76A 1A7LA 5J1DA 4F22A 2F35A 1KWHA 2DSFA 1IITA 4IO4A 4U4XA 1FQDA 1MXYA 2V84A 2R9JA 4N07A 5ITPA 1S9TA 1CB6A 3PMXA 3U94A 3C33A 5TPAA 4BDNA 4OFJA 3VDFA 4TQUQ 1GTKA 4OTEA 1HSLA 3H6VA 1H76A 1NNTA 4I8CA 1IXGA 3W15C 1OVBA 4GL8A 1B9JA 1IXCA 1M5FA 2HZLA 3VVDA 1DTGA 4MLVA 1EZ9A 4KCCA 4H65A 4ESXA 5I56A 4WXJA 3H6UA 3IX1A 3SEVA 2OJTA 1DTZA 1SW1A 3V8XB 5JTYA 3T9VA 1Y4TA 1Q35A 3U72A 3VXCA 1LB9A 3WAFA 2VHAA 1B40A 1PB8A 4G68A 1EZPA 5EHSA 4G2ZA 1MY2A 1DOTA 3V83A 1A99A 1FTOA 2Z22A 2Z8DA 1B3FA 5K2YA 5CBRA 3K1NA 4KI0E 5A5XA 5AA2A 1N7XA 3F11A 3O6GA 4NF4B 1IEJA 3DLNA 4NMYA 4QFLA 4R2FA 1RYXA 3TFLA 4DXCA 1LCFA 3G3JA 4OEUA 4IO6A 4KYSA 3S9NC 5H8NB 1FQBA 3M3KA 3R7XA 3LSLA 1NNPA 3DM0A 2CMOA 3GXAA 1R6ZA 2XX8A 3HHFA 3L6GA 4QFOA 3TUSA 3OXNA 1D3KA 3K6WA 1IUDA 1Y20A 4NE4A 1B3HA 1ZLQA 2KLFA 2DE4A 3KZGA 4ZEBA 1FQFA 1II5A 1SVXB 1XT8A 5H8NA 1MXUA 4OQOA 2QSXA 4I1DA 2XXUA 4U1OA 2PMSA 1H44A 3PUWE 4LA9A 2DQVA 4NF4A 4R72A 4ZEKA 5AA2B 1UIUA 5I2NA 2ZNTA 4ZS9A 3ZS6A 3RTWB 3IB0A 4IGRA 4OETA 4DCXA 3Q27A 1Y3NA 3USDA 4I9DA 1JNFA 1B46A 2Y84A 1URGA 4MBPA 2Q9TA 2XXXA 3RT6B 5AA2D 2H4IA 3K6VA 3SEWA 1WDNA 3SKPA 2V93A 4IB2A 2UYFA 1J1NA 4AB5A 1S50A 1YPNA 1NFTA 3N5LA 1N3WA 3DELB 5I56B 5I59A 1JW5A 5I58B 3KJ7A 2A5TA 3T22A 1D9YA 2UXAA 1BTJA 3CIJA 1SQYA 3E13X 5ELVA 4R9GA 4Z0IA 4DZ1A 1AL3A 1MPBA 3OMBA 4F19A 2HZKA 1US4A 4OXVA 3QSLA 2Y7IA 1VFDA 3P7IA 3LSWA 3PPQA 3B6QA 2I4BA 2V3QA 5TPAB 4BDLA 2AIXA 4BLAA 4H6DA 1SD3A 1Z7NE 3N6UA 1LFGA 2V3TA 1HSJA 2NOOA 3DP6A 4HCWA 5DTBA 5AE4A 2Q2AA 1LB8A 3M8UA 3EN3A 1GVCA 2GRVA 1LSTA 4M1VA 3T9HB 4C0RA 1N04A 1N84A 2ZMBA 3FXQA 3K6UA 1ZJLA 1PB7A 4LZ8A 3WAEA 1NNFA 1NL5A 4ELOA 4OZ9A 1MY4A 4OMBA 4LATA 1AH5A 4X48A 2ZYOA 1P1NA 5IKBA 2RC8A 3KSXA 4G68C 1I6AA 1M5DA 1Y9UA 1IQ7A 2BJJX 2F6PA 4FEDA 3VV5A 4F31B 4FEBA 3O29A 4XKPA 5H8FB 4LVQA 2QJEA 1NKXA 4NF8B 2YJPA 4ND9A 1YTVA 4GFRA 1B4ZA 2PBWA 4R73A 2ALUA 5TU0A 2RC7A 5JK4A 4NEDA 4BDQA 2HCAA 2F78A 3OSRA 5AA4A 5L9SA 3C36A 4RXLA 3TCFA 3EQ1A 2OWTA 3C34A 3K02A 1ZTYA 5L9MA 5BWJA 4GD5A 1RYOA 3PPPA 3BFUA 4KYEA 3PD9A 4MLQA 1H45A 1B1XA 1ZMGA 2HEUA 3G7WA 3MC2A 4H67A 3TTMA 1TFDA 4P0GA 3ZSFA 1ZBMA 4E0XA 4ELPA 3W9WA 3UORA 1EZOA 4MH5A 3VLWA 3KOTA 2IEEA 2RCBA 3C35A 3FV2A 4RA1A 4THIA 5IAIA 4H8IA 1URSA 4F2OA 3S9LC 4OYVA 1QJMA 2NXOA 3IOUA 3PMVA 1QUKA 4JWYA 5DYHA 3HV1A 2FNCA 2OCUA 1BLFA 3VFJA 3VXBA 3CI8A 2H5YA 2ONKE 3JZJA 3GZGA 4RPNA 3MP1A 4NTLA 2IA4A 1XOCA 5AA3A 4FECA 1LFIA 1UTBA 3IO6A 1A8FA 3W9VA 3B6WA 4Q5TA 5ISUA 3MVZA 3IORA 3EHSA 4LP2B 2QS1A 1LLSA 3N26A 4C1TA 4TLLB 3G3KA 3GBBA 4F3SA 2FYIA 3KGCA 4IO7A 3K01A 3FV1A 3HO7A 1MXWA 3Q25A 4GRKA 4KYDA 4YKJA 1MQJA 4F2QA 1JQFA 3MUQA 4TLMB 3A09A 5DT6A 2ABHA 1SYIA 2UVHA 4TOZA 3IOTA 3IB1A 1R1NA 2O7UA 4MF3A 5EHMA 4BDRA 4QHQA 5F1QA 3TYHA 4P0IA 4R2BA 4QRZA 3PMWA 2DYXA 3TQLA 1SI0A 1UTHA 1MH4A 4G4PA 4YKIA 5CMKA 3TAJA 2RF1A 2XXTA 3B7DA 2XX9A 4LQ2A 2E1SA 4DIGA 3LSFB 3ECRA 3UN6A 4QSDA 3VVFA 4ZEDA 3OENA 3CSGA 4AB6A 2OBGA 4K3FA 1JETA 2REJA 4Q30B 1MQHA 4EF2A 3TPAA 5KDTB 1SI1A 1NMUA 3LC8A 3IL1B 3MPLA 1PC3A 3PU5A 1AOVA 4FAJA 4GVOA 1QUJA 4G8NA 4F3PA 2O51A 1PBQA 2GHBA 3ONMA 5DEXB 5TP9A 5I57B 1N0TA 4POXA 4YKKA 1QULA 4IO3A 1QKBA 2W7YA 1B5JA 2ZYKA 4XKNA 1O64A 2QPQA 1JVXA 4NWCA 4JSDA 2DWIA 2NWJA 3IJXB 2O68A 4JSOA 2UVGA 4OEVA 5FHOA 2YPNA 3KBRA 4U4SA 2P2AA 2VOZA 4YMBA 1LCTA 3UIFA 3MVYA 2X7PA 4NF5B 1RKMA 1B0HA 2HFBA 2THIA 3IK6B 2V3UA 3JYRA 2F7CA 2I3VA 2O84X 4GL0A 1F9BA 1Z7ME 2Y7KA 1ATGA 2D3IA 3C32A 1H43A 1DMBA 4F1UA 1ZIUA 3FJGA 1ELJA 4JBZA 5LOMA 2ZXTA 1B52A 3QK6A 4X1BA 1B58A 3U8QA 2UVIA 3FASA 1B1HA 4G8HA 4ZEFA 2DWHA 3HPIA 2WKYA 3K2DA 1FTJA 5ITOA 5CC2A 4QFPA 1XVYA 5M2VA 1B7ZA 3E4RA 3FVGA 3MP8A 2QRYA 5H8HA 3TTRA 1SDXA 3MP6A 1P99A 2NVUB 1I6QA 3PPOA 3QUJA 1M5EA 2RINA 2I4CA 4ONYA 4ZZEA 4IO2A 1MXXA 3RNNA
chains in the Genus database with same CATH superfamily
4AQ4A 5CM6A 1DPPA 3TCHA 2PT1A 1BIYA 5B70A 3KG2A 5H8SA 3TTKA 2HXRA 4GWSA 4EQ7A 3FZVA 3MVWA 2UYEA 3TTNA 2DE3A 1SW5A 2ESNA 2HAUA 4EQ9A 1FTLA 4OA4A 5IZ3B 2FA7A 2Q8JA 4KFQA 4WEDA 5H8QA 4PDHA 5ET5A 1PB9A 2RKMA 4P3LA 4U2RA 4NHBA 2WBBA 1FW0A 1MY1A 3SDFA 1CE2A 2DE2A 5TP9B 2OZZA 4XTCQ 4R6KA 2DVCA 4FATA 3OOAA 5KDTA 3V89B 4XKQA 2JJKA 4PFTA 3MQ9A 4OESA 3CFZA 2P1SA 3RLFE 2DXRA 4OHNA 4GIZA 4DXUA 2D5WA 1FBPA 3I6VA 3OD7A 1QUIA 2Y7PA 1IXIA 2CZHA 1OMPA 3CVGA 2E0SA 2ZYMA 3QMFA 2DOJA 3KBZA 4DCYA 2XXHA 1NH8A 5CBSA 4NG7A 5KZTA 3EHUA 1EYKA 5DW8A 4NF8A 2I0CA 1MPDA 4JXIA 1NV2A 3LSXA 2B4LA 4QFNA 3FD3A 1USYH 4PTKA 1SW4A 3ILUB 4DE8A 4PGNA 4PF6A 2FIEA 3Q28A 1JVYA 2QMXA 1FPIA 2Q88A 2A5TB 1Q9DA 5ET7A 4I40A 2I48A 2Z8EA 3KFMA 1MQGA 4G77A 4FORA 1B05A 3MBPA 3K1PA 3MSTA 2I3WA 3ILTB 4HCYA 3FUZA 3O6HA 3H06B 3GBAA 1FTAA 1BP5A 1BKAA 1MPCA 4KHZE 1K9ZA 3UP9A 1LGBC 4RJZA 4GWYA 1MRPA 4O3CA 3MW0A 3IAZA 3FVOA 3O97A 3R6UA 4O7MA 4BDMA 4PP0A 2QMWA 2A5SA 4GX3A 2Q89A 2VD2A 4EQBA 1I69A 2I58A 3VLUA 1MS7A 4OERA 1D9QA 1UQWA 2O1LA 3T9UA 4GBVA 2WBDA 1US5A 1VE4A 3TTLA 3H6WA 3O9PA 4E0WA 5FHNA 5A5LA 4WEPA 4F1YA 4QSCA 2WEFA 2REGA 3O28A 2DS9A 4BDOA 1XI6A 4U23A 5CMBA 4ZE9A 4UA8A 3ODBA 3H4ZA 3RYDA 4YAHX 3K00A 3MVXA 3T66A 4P1EA 2QS4A 1FQEA 3RY3A 2F35A 4OVRA 1CB6A 3C33A 2ZZXA 1B9JA 2HZLA 3H6UA 2OJTA 1Q35A 1LB9A 3WAFA 2VHAA 1EZPA 2Z22A 2Z8DA 5K2YA 3F11A 4NMYA 4OEUA 4KYSA 3BIGA 3S9NC 1FQBA 3DM0A 3HHFA 2XX8A 1IUDA 4NE4A 2DE4A 1FQFA 1SVXB 1G0IA 4OQOA 2QSXA 1H44A 4LA9A 4ZEKA 5AA2B 4R72A 5I2NA 3IB0A 4N6DA 4X04A 1B46A 1FBEA 3K6VA 2V93A 1J1NA 1YPNA 3KJ7A 2WYKA 1EYIA 1AL3A 4OXVA 4H6DA 3N6UA 2NOOA 2Q2AA 1LB8A 3T9HB 4C0RA 1PB7A 4ELOA 1MY4A 2Q8MA 1NUYA 1IQ7A 2QJEA 4ND9A 1YTVA 4GFRA 5JK4A 4NEDA 4BDQA 1FPKA 3OSRA 3PTYA 1FPBA 1RYOA 4MLQA 4KYEA 4H67A 1TFDA 4P0GA 4E0XA 4ELPA 4N91A 2IEEA 4RA1A 4THIA 3IOUA 3PMVA 5DYHA 1BLFA 3JZJA 3GZGA 1LBYA 4NTLA 4FECA 1FJ9A 3IORA 4LP2B 4GX4A 4C1TA 4F3SA 4IO7A 3FV1A 3Q25A 4OVQA 3MUQA 4TLMB 5DT6A 3BIHA 4TOZA 2DDKA 1KZ8A 4QHQA 5F1QA 4P0IA 2DYXA 2Y5KA 1SI0A 1UTHA 5CMKA 4YKIA 4LQ2A 3LSFB 3UN6A 3VVFA 4K3FA 3TPAA 3E78A 3IL1B 3MPLA 1PC3A 1AOVA 2HHMA 1QUJA 4G8NA 2O51A 3ONMA 2ZYKA 4NWCA 2QPQA 4G61A 4JSOA 4OEVA 2P2AA 4P1LA 2X7PA 2HFBA 3IK6B 5I5PA 2O84X 1F9BA 2VPOA 2ZXTA 3QK6A 4X1BA 3U8QA 2UVIA 5IZ3A 3HPIA 2WKYA 5H8HA 3TTRA 2HPGA 4MHFA 1M5EA 2I4CA 1M5CA 2PVUA 1MQDA 2KR0A 3TQWA 4L17A 3TELA 2Y7RA 3LUYA 2VGQA 2ZNUA 2DP8A 2X7QA 4ELRA 1LBVA 1TWYA 4OANA 2V25A 3PUZE 3G3HA 5FTIA 3RUMA 2XXYA 5EQ9A 2AL5A 2B65A 3IOVA 3SETA 2XXWA 1LAXA 3KJTA 2ZNSA 1NV5A 1R9LA 4LZ5A 3H7MA 2XXIA 5I2KA 1XHYA 1B4HA 1GV8A 1EYJA 1OQHA 4AS4A 5EYGA 3UK4A 4JWOA 1B0LA 5HM4B 4NF6A 1B2HA 1ZU0A 2F36A 2QVVA 1O7TA 2QFLA 1OVTA 4ZDMA 3V5AA 2HQ0A 2XD2A 4I62A 3HCQA 3OO8A 1Y3PA 3I5OA 1OLCA 3O66A 3IB2A 3EPEA 1OQGA 4ZE8A 1MY0A 4Q0CA 3DP8A 1EH3A 3U92A 1WODA 2DWJA 2B3BA 4JB7A 2O69A 3M3FA 1UTBB 4GWWA 3LR1A 4GXSB 1A40A 1FTKA 3CFXA 3CR9A 2GH9A 1B6HA 4F1VA 2H99A 4EF1A 3RPLB 3JV9A 4PFBA 3TKDA 3O6IA 2YLNA 4IO5A 2QL3A 1D9VA 1ZKBA 3TCGA 2XXKA 3PGFA 4ELQA 2Q74A 3G3FA 4ZZAA 4H1XA 3RQTA 4RPOA 4F2OA 2Y5LA 4X1DA 3T1BA 2ZYNA 4NF5A 2PT2A 2XWKA 3QXMA 3T96B 3C31A 1IMAA 2XXQA 2VP1A 2XX7A 2Z8FA 1TXFA 1AIVA 2RCAA 4ZECA 4MNCA 4JWXA 1PBPA 1Q1KA 5IM2A 2DWAA 3G3GA 4FE8A 4QSEA 3UORA 4GLIA 4O3BA 4FJPA 4IY5A 3OO7A 4HE0A 5I84A 4G8MA 3OEMA 4HS7A 3FXRA 2VD3A 3OELA 3E3KA 3MAMA 1OLAA 5L9OA 2F6GA 3S9EA 2XD3A 3PUVE 1QW0A 3BFTA 3FGSA 3RGYA 3KOSA 1Y4CA 4HE2A 4P56A 2XWIA 3ROJA 4PFIA 3H03A 4F1UA 4G68B 4RK9A 4F3GA 4R75A 5JTYB 1RDYA 4PETA 4MFIA 3U65A 1B5IA 3I3VA 4GWZA 2Z23A 2G93A 3QUFA 2HAVA 5H8FA 1MDP1 2X26A 3IOWA 3D4GA 2PYYA 4HW8A 3PUXE 2CEXA 4F39A 2FHYA 1B32A 3BKIB 1A7LA 4IO4A 4U4XA 1IITA 2V84A 2R9JA 1S9TA 4BDNA 5TPAA 4TQUQ 1GTKA 1HSLA 1H76A 1NNTA 1OVBA 4ESXA 4WXJA 4NF0A 5JTYA 3T0JA 1PB8A 2GQ1A 1DOTA 3V83A 1B3FA 1AWBA 5CBRA 4KI0E 4R2FA 1LCFA 3G3JA 2CMOA 3GXAA 3TUSA 3L6GA 1YZ0A 3K6WA 1Y20A 4HE1A 1ZLQA 1II5A 4I1DA 2PMSA 2OWZA 3PUWE 4NF4A 2DQVA 1UIUA 1FBFA 2ZNTA 4ZS9A 3RTWB 4IGRA 1Y3NA 1JNFA 4MBPA 1URGA 3SEWA 4AB5A 1S50A 5I58B 1D9YA 1BTJA 3E13X 4DZ1A 5ELVA 4Z0IA 3OMBA 4JVDA 1IMFA 2Y7IA 1VFDA 4BDLA 3B6QA 2AIXA 1NV4A 1Z7NE 1LFGA 4X8RA 1GVCA 1LSTA 1N04A 3K6UA 4O94A 1DK4A 4JVIA 4OZ9A 2ZYOA 4G68C 1Y9UA 2F6PA 4FEDA 2P3VA 4MNPA 2PBWA 2HCAA 5L9SA 4RXLA 5BWJA 4GD5A 4PE5B 3PD9A 5KCJB 1B1XA 1ZMGA 2HEUA 3TTMA 1ZBMA 3VLWA 3KOTA 5IAIA 3S9LC 4OYVA 2NXOA 4P9KA 1QUKA 2OCUA 5EQ7A 3VXBA 2ONKE 4RPNA 2IA4A 2WX9A 4Q5TA 3EHSA 4TLLB 2FYIA 1MXWA 4GRKA 1MQJA 4MAGA 2UVHA 3NOHA 3IOTA 5EQ8A 3TYHA 4QRZA 3PMWA 5EYHA 4G4PA 2XX9A 4DIGA 2E1SA 2REJA 4EF2A 2OX3A 3LC8A 3PU5A 2ZZWA 4F3PA 1PBQA 1LEVA 2GHBA 5I57B 1N0TA 4YKKA 4PDDA 1QULA 4IO3A 1B5JA 4XKNA 1FBHA 4YMBA 1B0HA 2V3UA 3JYRA 4GL0A 1Z7ME 2D3IA 3A29A 1H43A 1INPA 1DMBA 1ELJA 5LOMA 2PFYA 3FASA 1FPDA 2DWHA 5ITOA 3K2DA 1FTJA 5M2VA 1B7ZA 3E4RA 2QRYA 1SDXA 3MP6A 4ONYA 4O3AA 4IO2A 3CSBA 1UIVA 5FHMA 3CG1A 3KSJA 4N17A 3G3IA 3N6TA 1NV1A 3OO9A 4OFLA 5J16A 1CNQA 4UABA 4U22A 2KQZA 4FIMA 4YU0A 3Q29A 5CRYA 3VE1B 3IJOB 4H45A 4OVPA 4Z7EA 1FBDA 4PE3A 1XVXA 3TODA 1O63A 4GX6A 2ONSA 2B4MA 1FTMA 1DCUA 2HXWA 1SW2A 5CMCA 4YB7A 2F7AA 4MMPA 4YICA 3CFLA 3HSTA 4YB6A 1XS5A 1IXHA 3ZKKA 4C1UA 1URDA 3IR1A 2L5VA 3Q26A 4RY1A 3R26A 3AXFA 4IGTA 3KN7A 4RYAA 3VVEA 4F18A 1YAEA 2MKZA 4X9TA 1PEBA 1P1OA 2PFZA 3KN8A 4DI3D 4EXLA 4RK2A 3FBPA 3SEXA 3MYUA 1FCKA 2DXYA 5H8QB 4DI4B 4XXUA 1OIBA 1MQIA 1DSNA 4PFUA 3CRBA 4ECFA 3D1RA 5HBCA 1USYE 4U21A 5FBPA 4GWUA 2Y7WA 1POY1 3PUYE 2O6AA 5DVIA 4GF8A 1Y1MA 4ESWA 4KCDA 4HTGA 3PPNA 2R6GE 3KC0A 1QVSA 4I3EA 3HN0A 4U1ZA 4ZEIA 1AMFA 2P0SA 3TMGA 4KPTA 4PFWA 5LTCA 1NH7A 2XXRA 5JEIA 1FQCA 5LDZA 5BUUA 5CI5A 2BJIA 4IR8A 3RPWA 1B7UA 3TEPA 1LAHE 2O7IA 4RNSA 4DXBA 2F8DA 4PGPA 1KA0A 4JDFA 1MDQA 2XXVA 5T3JA 2F7BA 4WKMA 5I59B 4XKRA 1RDZA 5DEXA 3SESA 3MZ9A 3E9XA 3H6TA 2QS2A 3C4MA 3OEKA 1FPEA 2UVJA 4DDDA 1A54A 1POTA 1L5TA 2NUVA 1D4NA 2GFEA 3H3GA 1HSEA 3RN8A 4GQOA 4EUOA 2AL4A 2FBPA 1VSOA 1GGGA 4H0WA 1QKAA 3O2AA 3UA8A 4LN5A 1NV3A 4PFYA 3ZKLA 3BBRA 4R6YA 4PAIA 3KC1A 3MPKA 4ISUA 2CZLA 3KN3A 3EHTA 1QGXA 1MM6A 2I0BA 3MZBA 1LBZA 4YKPA 3FJMA 2O1MA 3DP4A 1A8EA 4OFOA 3B6TA 1LBWA 2F34A 4PAKA 3M3LA 3K4UA 2AYSA 1P1UA 4LUBA 3LUZA 4N13A 4POWA 1EU8A 1H3DA 2G29A 1FBGA 4H8JA 4KD5A 2H98A 3TDJA 1GR2A 3SERA 1N76A 4F22A 1KWHA 1FQDA 1MXYA 3PMXA 2FIXA 4OFJA 3VDFA 4OTEA 1IXGA 3W15C 4GL8A 1IXCA 1DTGA 4MLVA 4KCCA 4H65A 4AS5A 5I56A 3SEVA 3IX1A 4P47A 1Y4TA 1B40A 5EHSA 4G2ZA 1N7XA 4NF4B 3O6GA 1IEJA 3DLNA 4QFLA 5I7IA 3TFLA 4DXCA 4IO6A 5H8NB 3M3KA 3R7XA 3OXNA 1D3KA 5F24A 1B3HA 3KZGA 2KLFA 1XT8A 1MXUA 2VT5A 2XXUA 4U1OA 1NUZA 3CHGA 3ZS6A 4DCXA 4OETA 4I9DA 3RT6B 2H4IA 1NFTA 5I59A 1JW5A 2A5TA 3T22A 2UXAA 5ET6A 1SQYA 4I3YA 1MPBA 3QSLA 2QVUA 2R8TA 3P7IA 4MX6A 3PPQA 5TPAB 2I4BA 4PBQA 2V3TA 1FPGA 1FSAA 3EN3A 2GRVA 4M1VA 2CZIA 3FXQA 1NNFA 4OMBA 4X48A 1AH5A 2P3NA 3KSXA 1M5DA 3VV5A 4FEBA 4XKPA 5H8FB 4NF8B 4PAFA 1B4ZA 4R73A 1NUWA 2F78A 5AA4A 3C36A 3TCFA 3EQ1A 2OWTA 3C34A 3K02A 1ZTYA 3PPPA 3ZSFA 4MEVA 3W9WA 1FRPA 3FV2A 2RCBA 4H8IA 1URSA 4JWYA 2PCRA 3VFJA 3CI8A 1LFIA 3IO6A 5ISUA 3MVZA 4MIJA 3G3KA 3KGCA 3K01A 4YKJA 2ABHA 1FPLA 3IB1A 1R1NA 4BDRA 3E79A 1KA1A 3TQLA 1NV7A 3S9MC 2XWVA 3TAJA 2RF1A 2XXTA 3B7DA 3ECRA 4Q30B 1MQHA 5KDTB 1SI1A 4N15A 1NMUA 1BK4A 1YXIA 5TP9A 1FPJA 4JSDA 3IJXB 5FHOA 1NV0A 1NV6A 2O68A 2UVGA 2YPNA 3KBRA 2VOZA 4NF5B 1RKMA 2THIA 2F7CA 2I3VA 1ATGA 1ZIUA 3FJGA 4O7IA 5IZ1A 1B1HA 4G8HA 2V4CA 3ISPA 5IZZA 4QFPA 1P99A 2NVUB 3PPOA 3QUJA 4ZZEA 1MXXA 1B3EA 2OWSA 2XA5A 4N4UA 3T93B 3RPLA 3THIA 4M4GA 1MM7A 1TT1A 5ICQA 4NGUA 1P1WA 3U93A 1IMEA 1NUXA 3A3UA 3FIRA 4R6HA 2F3DA 4OVSA 3KEIA 1Y1ZA 3OSQA 1SYHA 4LONB 5CMMA 1SBPA 2H9BA 4R74A 3UGWA 2GHAA 1TFAA 1IIWA 1RDXA 1MXZA 2Q2CA 1PDAA 2RC9A 4PC9A 3S4UA 3QAXA 4EXKA 3MWBA 1ANFA 4P11A 3QYTA 2XXPA 4YMAA 5L8DA 4QXDA 3S2VA 5I57A 1N7WA 3IFAA 1WVJA 4NF6B 3GLBA 1MY3A 1NI9A 1DBZA 4P8BA 2ANJA 1B7HA 3FVKA 1JEUA 1LAGE 3IFCA 4QF9A 3VLVA 4LQ5A 5I3SA 4KQPA 4LZ7A 3U1OA 5I2KB 1YCJA 1VFEA 1NNKA 1YYZA 4Q8RA 2ONRA 4N8YA 4XIGQ 1FPFA 4NQ8A 4NX1A 3FATA 5B7DA 3RTFB 5AA1A 5EYFA 4KR5A 4KXPA 4GOTA 4R9FA 2I6EA 2H25A 1JW4A 4GBWA 4H5GA 2R71A 2CEYA 1IZ1A 1JW1A 3OO6A 4DLDA 4YZZA 5KCJA 1VDWA 4GWOA 4N6KA 1LBCA 3QIMA 3SEYA 5FTHA 1Y3QA 1P1QA 2F5XA 4PQJA 1R9QA 4EDPA 4N81A 3IO4A 1B3LA 3L6HA 5H8HB 1A55A 4PBHA 5ESYA 1JEVA 4NWDA 1IMCA 3PV0E 1K9YA 4YB5A 5HPQA 4N6PA 3GYYA 1MG1A 3FVNA 3SZPA 3FJ7A 3K1MA 5ET8A 5F7VA 2D21A 3K6XA 2M8CA 4UACA 2WYPA 2F97A 1FQAA 2ZZVA 2LAOA 3C9HA 5I58A 5DVFA 1MXVA 3D4CA 4OVTA 2DVZA 1DPEA 1T0KA 1B3GA 1MH3A 1N3XA 2F3BA 2B3FA 1IMBA 3T9XB 3MJNA 1UTHB 3HHGA 2PX1A 3A3CA 3PPRA 4JVCA 1G0HA 4OENA 2I49A 1XC1A 1LFHA 4XF5A 3RT8A 1B5HA 3LBSA 1LAFE 4F29A 5A5XB 3FXUA 5K2XA 4F3BA 3N94A 4GXAA 2OK2A 1M5BA 2QS3A 3CG3A 2XHDA 3TZAA 5DVJA 1LBBA 1VR5A 1I6BA 2OLBA 2XWOA 4IY6A 3PD8A 3K0VA 4N8GA 5AA4B 4O8MA 3MZ1A 4NAPA 3LV0A 1S7YA 1SPIA 4H5FA 4QFKA 3EF7A 4OWDA 1B51A 1IMDA 4PFRA 4OVJA 5J1DA 4FBPA 2DSFA 5ITPA 4N07A 4MNIA 3U94A 4QBAA 3H6VA 4I8CA 1M5FA 3VVDA 1EZ9A 1DTZA 1SW1A 3V8XB 3T9VA 3U72A 3VXCA 4G68A 1MY2A 2CZKA 1A99A 1FTOA 3K1NA 5A5XA 5AA2A 5I2NB 4HXVA 1RYXA 3LSLA 4XEQA 1NNPA 1R6ZA 4QFOA 3SEUA 5H8NA 4NN3A 2QVRA 4XFEA 3Q27A 1JP4A 3USDA 2Y84A 5AA2D 2Q9TA 2XXXA 1WDNA 3SKPA 4IB2A 2UYFA 3N5LA 1N3WA 3DELB 5I56B 3CIJA 4R9GA 4F19A 2HZKA 1US4A 3LSWA 2V3QA 4BLAA 1SD3A 5AE4A 1HSJA 3DP6A 4HCWA 4MJOA 5DTBA 5ICTA 3M8UA 1N84A 2ZMBA 1ZJLA 4LZ8A 3WAEA 1NL5A 3FXBA 5IKBA 3HFUA 4LATA 1P1NA 2RC8A 4F31B 1I6AA 2BJJX 3O29A 4LVQA 1NKXA 2YJPA 2ALUA 5TU0A 2RC7A 5L9MA 3BFUA 1H45A 3G7WA 4H46A 3MC2A 1EZOA 4MH5A 3C35A 1QJMA 1LBXA 3HV1A 2FNCA 2VPNA 5IGAA 2H5YA 3MP1A 1XOCA 5AA3A 1FJ6A 3W9VA 1UTBA 1A8FA 4GWXA 3B6WA 1FBCA 2QS1A 1LLSA 3N26A 3GBBA 4ZEBA 3HO7A 4KYDA 5EQAA 4F2QA 1JQFA 3A09A 4MCOA 1SYIA 2O7UA 4MF3A 5EHMA 4R2BA 1MH4A 4QSDA 4ZEDA 3OENA 3CSGA 4AB6A 2OBGA 1JETA 4FAJA 4GVOA 5DEXB 2FVZA 4POXA 1QKBA 2W7YA 1O64A 1JVXA 2DWIA 2NWJA 4U4SA 3B50A 1LCTA 3UIFA 3MVYA 4PCDA 3C32A 2Y7KA 4JBZA 1B52A 1B58A 4ZEFA 5CC2A 3B8BA 4PF8A 1XVYA 3FVGA 3MP8A 1I6QA 3EKIA 2RINA 3RNNA
chains in the Genus database with same CATH topology
1M5CA 1UIVA 2PVUA 3CSBA 1MQDA 1B3EA 3CG1A 3KSJA 5FHMA 4AQ4A 5CM6A 3TQWA 4L17A 3TELA 2Y7RA 3LUYA 1DPPA 2OWSA 2VGQA 3TCHA 2ZNUA 2DP8A 2X7QA 3G3IA 3T93B 2PT1A 3N6TA 1BIYA 3THIA 4ELRA 4M4GA 5B70A 3KG2A 5H8SA 1MM7A 1TT1A 3OO9A 3TTKA 5ICQA 1P1WA 1TWYA 4OFLA 4EQ7A 3FZVA 2V25A 3U93A 3MVWA 2UYEA 4U22A 3PUZE 3G3HA 3TTNA 5FTIA 2DE3A 3A3UA 4FIMA 3FIRA 4R6HA 1SW5A 3RUMA 4YU0A 3Q29A 5CRYA 2ESNA 2HAUA 2XXYA 3IJOB 3KEIA 3VE1B 4EQ9A 1Y1ZA 3OSQA 2AL5A 1SYHA 4LONB 4Z7EA 1FTLA 2B65A 3IOVA 5CMMA 3SETA 1SBPA 5I2NB 1XVXA 2XXWA 2FA7A 2H9BA 4R74A 1LAXA 2Q8JA 4KFQA 3KJTA 2ZNSA 4WEDA 5H8QA 3TODA 1O63A 1PB9A 1R9LA 2RKMA 4LZ5A 3UGWA 2ONSA 3H7MA 2GHAA 1TFAA 2XXIA 2HXWA 1FTMA 1IIWA 4U2RA 1MXZA 2Q2CA 1PDAA 2RC9A 1SW2A 5I2KA 5CMCA 4YB7A 3QAXA 3S4UA 2F7AA 4YICA 4EXKA 3CFLA 3MWBA 1ANFA 4P11A 3HSTA 3QYTA 4YB6A 1XHYA 1XS5A 1B4HA 2XXPA 1GV8A 4YMAA 1FW0A 1OQHA 5L8DA 1IXHA 3ZKKA 1MY1A 3SDFA 1CE2A 1URDA 4C1UA 2DE2A 3IR1A 3S2VA 3UK4A 3Q26A 4JWOA 4RY1A 2OZZA 1N7WA 5TP9B 5I57A 1B0LA 3R26A 4XTCQ 5HM4B 1WVJA 4NF6A 4NF6B 4R6KA 2DVCA 3AXFA 3GLBA 1MY3A 1B2HA 1ZU0A 2F36A 4IGTA 3KN7A 4FATA 2ANJA 3OOAA 4RYAA 3VVEA 4F18A 5KDTA 1O7TA 1B7HA 1YAEA 3FVKA 1JEUA 1LAGE 1OVTA 4ZDMA 3V89B 4QF9A 3VLVA 4XKQA 3V5AA 2HQ0A 4LQ5A 1PEBA 1P1OA 2XD2A 3KN8A 4KQPA 4X9TA 4I62A 4LZ7A 4EXLA 4RK2A 3U1OA 5I2KB 3HCQA 1YCJA 1VFEA 4O3AA 3OO8A 4PFTA 1Y3PA 3I5OA 1NNKA 3SEXA 1OLCA 3O66A 3MQ9A 3IB2A 3VLUA 2ONRA 4Q8RA 3EPEA 1FCKA 4OESA 2DXYA 5H8QB 1OQGA 4ZE8A 3CFZA 1MY0A 2P1SA 4Q0CA 3DP8A 1EH3A 4XXUA 1WODA 3U92A 4XIGQ 1OIBA 2DWJA 3RLFE 2DXRA 2B3BA 4OHNA 4GIZA 4JB7A 3FATA 5B7DA 1MQIA 1DSNA 2O69A 3M3FA 4DXUA 1UTBB 2D5WA 4PFUA 3RTFB 3CRBA 5AA1A 4ECFA 5EYFA 4KR5A 5HBCA 1USYE 3LR1A 4U21A 4GXSB 3I6VA 3OD7A 4GOTA 1A40A 1FTKA 1QUIA 2Y7PA 2Y7WA 1IXIA 4R9FA 1POY1 2I6EA 3CFXA 3PUYE 1OMPA 2O6AA 4GF8A 5DVIA 2H25A 3CVGA 2E0SA 3CR9A 1JW4A 2GH9A 4H5GA 2ZYMA 1Y1MA 1B6HA 2R71A 4F1VA 4ESWA 4KCDA 4HTGA 3PPNA 1IZ1A 2H99A 2DOJA 1JW1A 3OO6A 4DLDA 4DCYA 2R6GE 4EF1A 4YZZA 5KCJA 1QVSA 4GWOA 3HN0A 2XXHA 4U1ZA 3JV9A 1NH8A 4ZEIA 5CBSA 1LBCA 3QIMA 3SEYA 1AMFA 2P0SA 5KZTA 5FTHA 3TKDA 1Y3QA 1P1QA 3EHUA 3O6IA 3TMGA 4KPTA 2F5XA 2YLNA 4PQJA 1R9QA 4IO5A 4PFWA 4EDPA 2QL3A 1D9VA 1NH7A 3IO4A 4NF8A 2XXRA 5JEIA 1ZKBA 1B3LA 3L6HA 2I0CA 1MPDA 5H8HB 1A55A 1FQCA 4JXIA 5BUUA 3TCGA 1JEVA 4NWDA 3PGFA 4ELQA 5CI5A 3LSXA 3PV0E 3G3FA 4YB5A 3RPWA 1B7UA 5HPQA 4N6PA 3TEPA 1LAHE 2O7IA 4QFNA 4RNSA 1MG1A 3FD3A 3FVNA 4H1XA 4ZZAA 3RQTA 1USYH 3FJ7A 1SW4A 3K1MA 3ILUB 4RPOA 2F8DA 2D21A 5F7VA 4DE8A 4DXBA 3K6XA 2M8CA 4UACA 4X1DA 2ZYNA 4NF5A 3Q28A 2PT2A 4JDFA 2F97A 3QXMA 1JVYA 3TTLA 1FQAA 1MDQA 2QMXA 4F3GA 3T96B 3C31A 2Q88A 2LAOA 2XXVA 2XXQA 2VP1A 2XX7A 2Z8FA 3C9HA 3SEUA 1TXFA 2A5TB 2F7BA 1AIVA 5I58A 4WKMA 5I59B 2RCAA 4XKRA 2I48A 2Z8EA 5DVFA 4ZECA 1MXVA 5DEXA 4JWXA 3KFMA 3D4CA 1PBPA 1Q1KA 3MZ9A 3SESA 2DVZA 1DPEA 3E9XA 1T0KA 1B3GA 3H6TA 2DWAA 1MH3A 2QS2A 2UVJA 3C4MA 3G3GA 1MQGA 3OEKA 4FE8A 4DDDA 4QSEA 4G77A 1A54A 1N3XA 1POTA 4FORA 4GLIA 1B05A 2NUVA 3MBPA 1D4NA 3K1PA 4FJPA 4O3BA 1L5TA 4IY5A 2B3FA 2GFEA 2I3WA 3H3GA 3ILTB 3OO7A 4PE5B 3T9XB 5I84A 4HCYA 3FUZA 1HSEA 4G8MA 3OEMA 4HS7A 3O6HA 3RN8A 3FXRA 2VD3A 3MJNA 4GQOA 1UTHB 3HHGA 5ICTA 5KCJB 2PX1A 3H06B 3A3CA 3OELA 2AL4A 3E3KA 4EUOA 3MAMA 1OLAA 5L9OA 2F6GA 3GBAA 3S9EA 1BP5A 1BKAA 1MPCA 2XD3A 1VSOA 3PPRA 3PUVE 1QW0A 1GGGA 4H0WA 3BFTA 4OENA 2I49A 1QKAA 3O2AA 4KHZE 1LGBC 3FGSA 4RJZA 3UA8A 3UP9A 1MRPA 1XC1A 4O3CA 1LFHA 3RT8A 3MW0A 3IAZA 1B5HA 3FVOA 3LBSA 3O97A 3RGYA 1LAFE 1Y4CA 3KOSA 3R6UA 4F29A 5A5XB 4BDMA 3FXUA 5K2XA 4F3BA 4PP0A 4PFYA 3N94A 3ZKLA 4GXAA 2QMWA 2A5SA 2OK2A 3BBRA 4R6YA 2Q89A 3H03A 2VD2A 4EQBA 3MPKA 4G68B 1I69A 1M5BA 2I58A 2CZLA 4ISUA 4R75A 4RK9A 2QS3A 3EHTA 1MS7A 3KN3A 4OERA 3CG3A 5JTYB 1MM6A 2I0BA 4E0WA 1UQWA 2XHDA 2O1LA 3MZBA 3TZAA 4YKPA 3FJMA 1LBBA 5DVJA 2O1MA 1VR5A 3T9UA 4PETA 3DP4A 1A8EA 4MFIA 4OFOA 3B6TA 1I6BA 2F34A 1US5A 3K4UA 3M3LA 2AYSA 1B5IA 1VE4A 2OLBA 3H6WA 3O9PA 3PD8A 1P1UA 4IY6A 3K0VA 4LUBA 4QSCA 3I3VA 4WEPA 5FHNA 2REGA 4F1YA 5AA4B 3O28A 2DS9A 2Z23A 4N13A 4BDOA 4U23A 3MZ1A 5CMBA 2G93A 4ZE9A 4UA8A 3QUFA 3ODBA 4POWA 3S9MC 1EU8A 2HAVA 1S7YA 5H8FA 1H3DA 1MDP1 2G29A 4H5FA 3H4ZA 4QFKA 4YAHX 2X26A 3EF7A 3K00A 3MVXA 4H8JA 4KD5A 3IOWA 4OWDA 1B51A 3T66A 3D4GA 2PYYA 2H98A 3TDJA 2QS4A 3PUXE 4HW8A 4F39A 1GR2A 1FQEA 3RY3A 1B32A 3SERA 4OVJA 3BKIB 1N76A 1A7LA 5J1DA 4F22A 2F35A 1KWHA 2DSFA 1IITA 4IO4A 4U4XA 1FQDA 1MXYA 2V84A 2R9JA 4N07A 5ITPA 1S9TA 1CB6A 3PMXA 3U94A 3C33A 5TPAA 4BDNA 4OFJA 3VDFA 4TQUQ 1GTKA 4OTEA 1HSLA 3H6VA 1H76A 1NNTA 4I8CA 1IXGA 3W15C 1OVBA 4GL8A 1B9JA 1IXCA 1M5FA 2HZLA 3VVDA 1DTGA 4MLVA 1EZ9A 4KCCA 4H65A 4ESXA 5I56A 4WXJA 3H6UA 3IX1A 3SEVA 2OJTA 1DTZA 1SW1A 3V8XB 5JTYA 3T9VA 1Y4TA 1Q35A 3U72A 3VXCA 1LB9A 3WAFA 2VHAA 1B40A 1PB8A 4G68A 1EZPA 5EHSA 4G2ZA 1MY2A 1DOTA 3V83A 1A99A 1FTOA 2Z22A 2Z8DA 1B3FA 5K2YA 5CBRA 3K1NA 4KI0E 5A5XA 5AA2A 1N7XA 3F11A 3O6GA 4NF4B 1IEJA 3DLNA 4NMYA 4QFLA 4R2FA 1RYXA 3TFLA 4DXCA 1LCFA 3G3JA 4OEUA 4IO6A 4KYSA 3S9NC 5H8NB 1FQBA 3M3KA 3R7XA 3LSLA 1NNPA 3DM0A 2CMOA 3GXAA 1R6ZA 2XX8A 3HHFA 3L6GA 4QFOA 3TUSA 3OXNA 1D3KA 3K6WA 1IUDA 1Y20A 4NE4A 1B3HA 1ZLQA 2KLFA 2DE4A 3KZGA 4ZEBA 1FQFA 1II5A 1SVXB 1XT8A 5H8NA 1MXUA 4OQOA 2QSXA 4I1DA 2XXUA 4U1OA 2PMSA 1H44A 3PUWE 4LA9A 2DQVA 4NF4A 4R72A 4ZEKA 5AA2B 1UIUA 5I2NA 2ZNTA 4ZS9A 3ZS6A 3RTWB 3IB0A 4IGRA 4OETA 4DCXA 3Q27A 1Y3NA 3USDA 4I9DA 1JNFA 1B46A 2Y84A 1URGA 4MBPA 2Q9TA 2XXXA 3RT6B 5AA2D 2H4IA 3K6VA 3SEWA 1WDNA 3SKPA 2V93A 4IB2A 2UYFA 1J1NA 4AB5A 1S50A 1YPNA 1NFTA 3N5LA 1N3WA 3DELB 5I56B 5I59A 1JW5A 5I58B 3KJ7A 2A5TA 3T22A 1D9YA 2UXAA 1BTJA 3CIJA 1SQYA 3E13X 5ELVA 4R9GA 4Z0IA 4DZ1A 1AL3A 1MPBA 3OMBA 4F19A 2HZKA 1US4A 4OXVA 3QSLA 2Y7IA 1VFDA 3P7IA 3LSWA 3PPQA 3B6QA 2I4BA 2V3QA 5TPAB 4BDLA 2AIXA 4BLAA 4H6DA 1SD3A 1Z7NE 3N6UA 1LFGA 2V3TA 1HSJA 2NOOA 3DP6A 4HCWA 5DTBA 5AE4A 2Q2AA 1LB8A 3M8UA 3EN3A 1GVCA 2GRVA 1LSTA 4M1VA 3T9HB 4C0RA 1N04A 1N84A 2ZMBA 3FXQA 3K6UA 1ZJLA 1PB7A 4LZ8A 3WAEA 1NNFA 1NL5A 4ELOA 4OZ9A 1MY4A 4OMBA 4LATA 1AH5A 4X48A 2ZYOA 1P1NA 5IKBA 2RC8A 3KSXA 4G68C 1I6AA 1M5DA 1Y9UA 1IQ7A 2BJJX 2F6PA 4FEDA 3VV5A 4F31B 4FEBA 3O29A 4XKPA 5H8FB 4LVQA 2QJEA 1NKXA 4NF8B 2YJPA 4ND9A 1YTVA 4GFRA 1B4ZA 2PBWA 4R73A 2ALUA 5TU0A 2RC7A 5JK4A 4NEDA 4BDQA 2HCAA 2F78A 3OSRA 5AA4A 5L9SA 3C36A 4RXLA 3TCFA 3EQ1A 2OWTA 3C34A 3K02A 1ZTYA 5L9MA 5BWJA 4GD5A 1RYOA 3PPPA 3BFUA 4KYEA 3PD9A 4MLQA 1H45A 1B1XA 1ZMGA 2HEUA 3G7WA 3MC2A 4H67A 3TTMA 1TFDA 4P0GA 3ZSFA 1ZBMA 4E0XA 4ELPA 3W9WA 3UORA 1EZOA 4MH5A 3VLWA 3KOTA 2IEEA 2RCBA 3C35A 3FV2A 4RA1A 4THIA 5IAIA 4H8IA 1URSA 4F2OA 3S9LC 4OYVA 1QJMA 2NXOA 3IOUA 3PMVA 1QUKA 4JWYA 5DYHA 3HV1A 2FNCA 2OCUA 1BLFA 3VFJA 3VXBA 3CI8A 2H5YA 2ONKE 3JZJA 3GZGA 4RPNA 3MP1A 4NTLA 2IA4A 1XOCA 5AA3A 4FECA 1LFIA 1UTBA 3IO6A 1A8FA 3W9VA 3B6WA 4Q5TA 5ISUA 3MVZA 3IORA 3EHSA 4LP2B 2QS1A 1LLSA 3N26A 4C1TA 4TLLB 3G3KA 3GBBA 4F3SA 2FYIA 3KGCA 4IO7A 3K01A 3FV1A 3HO7A 1MXWA 3Q25A 4GRKA 4KYDA 4YKJA 1MQJA 4F2QA 1JQFA 3MUQA 4TLMB 3A09A 5DT6A 2ABHA 1SYIA 2UVHA 4TOZA 3IOTA 3IB1A 1R1NA 2O7UA 4MF3A 5EHMA 4BDRA 4QHQA 5F1QA 3TYHA 4P0IA 4R2BA 4QRZA 3PMWA 2DYXA 3TQLA 1SI0A 1UTHA 1MH4A 4G4PA 4YKIA 5CMKA 3TAJA 2RF1A 2XXTA 3B7DA 2XX9A 4LQ2A 2E1SA 4DIGA 3LSFB 3ECRA 3UN6A 4QSDA 3VVFA 4ZEDA 3OENA 3CSGA 4AB6A 2OBGA 4K3FA 1JETA 2REJA 4Q30B 1MQHA 4EF2A 3TPAA 5KDTB 1SI1A 1NMUA 3LC8A 3IL1B 3MPLA 1PC3A 3PU5A 1AOVA 4FAJA 4GVOA 1QUJA 4G8NA 4F3PA 2O51A 1PBQA 2GHBA 3ONMA 5DEXB 5TP9A 5I57B 1N0TA 4POXA 4YKKA 1QULA 4IO3A 1QKBA 2W7YA 1B5JA 2ZYKA 4XKNA 1O64A 2QPQA 1JVXA 4NWCA 4JSDA 2DWIA 2NWJA 3IJXB 2O68A 4JSOA 2UVGA 4OEVA 5FHOA 2YPNA 3KBRA 4U4SA 2P2AA 2VOZA 4YMBA 1LCTA 3UIFA 3MVYA 2X7PA 4NF5B 1RKMA 1B0HA 2HFBA 2THIA 3IK6B 2V3UA 3JYRA 2F7CA 2I3VA 2O84X 4GL0A 1F9BA 1Z7ME 2Y7KA 1ATGA 2D3IA 3C32A 1H43A 1DMBA 4F1UA 1ZIUA 3FJGA 1ELJA 4JBZA 5LOMA 2ZXTA 1B52A 3QK6A 4X1BA 1B58A 3U8QA 2UVIA 3FASA 1B1HA 4G8HA 4ZEFA 2DWHA 3HPIA 2WKYA 3K2DA 1FTJA 5ITOA 5CC2A 4QFPA 1XVYA 5M2VA 1B7ZA 3E4RA 3FVGA 3MP8A 2QRYA 5H8HA 3TTRA 1SDXA 3MP6A 1P99A 2NVUB 1I6QA 3PPOA 3QUJA 1M5EA 2RINA 2I4CA 4ONYA 4ZZEA 4IO2A 1MXXA 3RNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5C A;  1UIV A;  2PVU A;  3CSB A;  1MQD A;  1B3E A;  3CG1 A;  3KSJ A;  5FHM A;  4AQ4 A;  5CM6 A;  3TQW A;  4L17 A;  3TEL A;  2Y7R A;  3LUY A;  1DPP A;  2OWS A;  2VGQ A;  3TCH A;  2ZNU A;  2DP8 A;  2X7Q A;  3G3I A;  3T93 B;  2PT1 A;  3N6T A;  1BIY A;  3THI A;  4ELR A;  4M4G A;  5B70 A;  3KG2 A;  5H8S A;  1MM7 A;  1TT1 A;  3OO9 A;  3TTK A;  5ICQ A;  1P1W A;  1TWY A;  4OFL A;  4EQ7 A;  3FZV A;  2V25 A;  3U93 A;  3MVW A;  2UYE A;  4U22 A;  3PUZ E;  3G3H A;  3TTN A;  5FTI A;  2DE3 A;  3A3U A;  4FIM A;  3FIR A;  4R6H A;  1SW5 A;  3RUM A;  4YU0 A;  3Q29 A;  5CRY A;  2ESN A;  2HAU A;  2XXY A;  3IJO B;  3KEI A;  3VE1 B;  4EQ9 A;  1Y1Z A;  3OSQ A;  2AL5 A;  1SYH A;  4LON B;  4Z7E A;  1FTL A;  2B65 A;  3IOV A;  5CMM A;  3SET A;  1SBP A;  5I2N B;  1XVX A;  2XXW A;  2FA7 A;  2H9B A;  4R74 A;  1LAX A;  2Q8J A;  4KFQ A;  3KJT A;  2ZNS A;  4WED A;  5H8Q A;  3TOD A;  1O63 A;  1PB9 A;  1R9L A;  2RKM A;  4LZ5 A;  3UGW A;  2ONS A;  3H7M A;  2GHA A;  1TFA A;  2XXI A;  2HXW A;  1FTM A;  1IIW A;  4U2R A;  1MXZ A;  2Q2C A;  1PDA A;  2RC9 A;  1SW2 A;  5I2K A;  5CMC A;  4YB7 A;  3QAX A;  3S4U A;  2F7A A;  4YIC A;  4EXK A;  3CFL A;  3MWB A;  1ANF A;  4P11 A;  3HST A;  3QYT A;  4YB6 A;  1XHY A;  1XS5 A;  1B4H A;  2XXP A;  1GV8 A;  4YMA A;  1FW0 A;  1OQH A;  5L8D A;  1IXH A;  3ZKK A;  1MY1 A;  3SDF A;  1CE2 A;  1URD A;  4C1U A;  2DE2 A;  3IR1 A;  3S2V A;  3UK4 A;  3Q26 A;  4JWO A;  4RY1 A;  2OZZ A;  1N7W A;  5TP9 B;  5I57 A;  1B0L A;  3R26 A;  4XTC Q;  5HM4 B;  1WVJ A;  4NF6 A;  4NF6 B;  4R6K A;  2DVC A;  3AXF A;  3GLB A;  1MY3 A;  1B2H A;  1ZU0 A;  2F36 A;  4IGT A;  3KN7 A;  4FAT A;  2ANJ A;  3OOA A;  4RYA A;  3VVE A;  4F18 A;  5KDT A;  1O7T A;  1B7H A;  1YAE A;  3FVK A;  1JEU A;  1LAG E;  1OVT A;  4ZDM A;  3V89 B;  4QF9 A;  3VLV A;  4XKQ A;  3V5A A;  2HQ0 A;  4LQ5 A;  1PEB A;  1P1O A;  2XD2 A;  3KN8 A;  4KQP A;  4X9T A;  4I62 A;  4LZ7 A;  4EXL A;  4RK2 A;  3U1O A;  5I2K B;  3HCQ A;  1YCJ A;  1VFE A;  4O3A A;  3OO8 A;  4PFT A;  1Y3P A;  3I5O A;  1NNK A;  3SEX A;  1OLC A;  3O66 A;  3MQ9 A;  3IB2 A;  3VLU A;  2ONR A;  4Q8R A;  3EPE A;  1FCK A;  4OES A;  2DXY A;  5H8Q B;  1OQG A;  4ZE8 A;  3CFZ A;  1MY0 A;  2P1S A;  4Q0C A;  3DP8 A;  1EH3 A;  4XXU A;  1WOD A;  3U92 A;  4XIG Q;  1OIB A;  2DWJ A;  3RLF E;  2DXR A;  2B3B A;  4OHN A;  4GIZ A;  4JB7 A;  3FAT A;  5B7D A;  1MQI A;  1DSN A;  2O69 A;  3M3F A;  4DXU A;  1UTB B;  2D5W A;  4PFU A;  3RTF B;  3CRB A;  5AA1 A;  4ECF A;  5EYF A;  4KR5 A;  5HBC A;  1USY E;  3LR1 A;  4U21 A;  4GXS B;  3I6V A;  3OD7 A;  4GOT A;  1A40 A;  1FTK A;  1QUI A;  2Y7P A;  2Y7W A;  1IXI A;  4R9F A;  1POY 1;  2I6E A;  3CFX A;  3PUY E;  1OMP A;  2O6A A;  4GF8 A;  5DVI A;  2H25 A;  3CVG A;  2E0S A;  3CR9 A;  1JW4 A;  2GH9 A;  4H5G A;  2ZYM A;  1Y1M A;  1B6H A;  2R71 A;  4F1V A;  4ESW A;  4KCD A;  4HTG A;  3PPN A;  1IZ1 A;  2H99 A;  2DOJ A;  1JW1 A;  3OO6 A;  4DLD A;  4DCY A;  2R6G E;  4EF1 A;  4YZZ A;  5KCJ A;  1QVS A;  4GWO A;  3HN0 A;  2XXH A;  4U1Z A;  3JV9 A;  1NH8 A;  4ZEI A;  5CBS A;  1LBC A;  3QIM A;  3SEY A;  1AMF A;  2P0S A;  5KZT A;  5FTH A;  3TKD A;  1Y3Q A;  1P1Q A;  3EHU A;  3O6I A;  3TMG A;  4KPT A;  2F5X A;  2YLN A;  4PQJ A;  1R9Q A;  4IO5 A;  4PFW A;  4EDP A;  2QL3 A;  1D9V A;  1NH7 A;  3IO4 A;  4NF8 A;  2XXR A;  5JEI A;  1ZKB A;  1B3L A;  3L6H A;  2I0C A;  1MPD A;  5H8H B;  1A55 A;  1FQC A;  4JXI A;  5BUU A;  3TCG A;  1JEV A;  4NWD A;  3PGF A;  4ELQ A;  5CI5 A;  3LSX A;  3PV0 E;  3G3F A;  4YB5 A;  3RPW A;  1B7U A;  5HPQ A;  4N6P A;  3TEP A;  1LAH E;  2O7I A;  4QFN A;  4RNS A;  1MG1 A;  3FD3 A;  3FVN A;  4H1X A;  4ZZA A;  3RQT A;  1USY H;  3FJ7 A;  1SW4 A;  3K1M A;  3ILU B;  4RPO A;  2F8D A;  2D21 A;  5F7V A;  4DE8 A;  4DXB A;  3K6X A;  2M8C A;  4UAC A;  4X1D A;  2ZYN A;  4NF5 A;  3Q28 A;  2PT2 A;  4JDF A;  2F97 A;  3QXM A;  1JVY A;  3TTL A;  1FQA A;  1MDQ A;  2QMX A;  4F3G A;  3T96 B;  3C31 A;  2Q88 A;  2LAO A;  2XXV A;  2XXQ A;  2VP1 A;  2XX7 A;  2Z8F A;  3C9H A;  3SEU A;  1TXF A;  2A5T B;  2F7B A;  1AIV A;  5I58 A;  4WKM A;  5I59 B;  2RCA A;  4XKR A;  2I48 A;  2Z8E A;  5DVF A;  4ZEC A;  1MXV A;  5DEX A;  4JWX A;  3KFM A;  3D4C A;  1PBP A;  1Q1K A;  3MZ9 A;  3SES A;  2DVZ A;  1DPE A;  3E9X A;  1T0K A;  1B3G A;  3H6T A;  2DWA A;  1MH3 A;  2QS2 A;  2UVJ A;  3C4M A;  3G3G A;  1MQG A;  3OEK A;  4FE8 A;  4DDD A;  4QSE A;  4G77 A;  1A54 A;  1N3X A;  1POT A;  4FOR A;  4GLI A;  1B05 A;  2NUV A;  3MBP A;  1D4N A;  3K1P A;  4FJP A;  4O3B A;  1L5T A;  4IY5 A;  2B3F A;  2GFE A;  2I3W A;  3H3G A;  3ILT B;  3OO7 A;  4PE5 B;  3T9X B;  5I84 A;  4HCY A;  3FUZ A;  1HSE A;  4G8M A;  3OEM A;  4HS7 A;  3O6H A;  3RN8 A;  3FXR A;  2VD3 A;  3MJN A;  4GQO A;  1UTH B;  3HHG A;  5ICT A;  5KCJ B;  2PX1 A;  3H06 B;  3A3C A;  3OEL A;  2AL4 A;  3E3K A;  4EUO A;  3MAM A;  1OLA A;  5L9O A;  2F6G A;  3GBA A;  3S9E A;  1BP5 A;  1BKA A;  1MPC A;  2XD3 A;  1VSO A;  3PPR A;  3PUV E;  1QW0 A;  1GGG A;  4H0W A;  3BFT A;  4OEN A;  2I49 A;  1QKA A;  3O2A A;  4KHZ E;  1LGB C;  3FGS A;  4RJZ A;  3UA8 A;  3UP9 A;  1MRP A;  1XC1 A;  4O3C A;  1LFH A;  3RT8 A;  3MW0 A;  3IAZ A;  1B5H A;  3FVO A;  3LBS A;  3O97 A;  3RGY A;  1LAF E;  1Y4C A;  3KOS A;  3R6U A;  4F29 A;  5A5X B;  4BDM A;  3FXU A;  5K2X A;  4F3B A;  4PP0 A;  4PFY A;  3N94 A;  3ZKL A;  4GXA A;  2QMW A;  2A5S A;  2OK2 A;  3BBR A;  4R6Y A;  2Q89 A;  3H03 A;  2VD2 A;  4EQB A;  3MPK A;  4G68 B;  1I69 A;  1M5B A;  2I58 A;  2CZL A;  4ISU A;  4R75 A;  4RK9 A;  2QS3 A;  3EHT A;  1MS7 A;  3KN3 A;  4OER A;  3CG3 A;  5JTY B;  1MM6 A;  2I0B A;  4E0W A;  1UQW A;  2XHD A;  2O1L A;  3MZB A;  3TZA A;  4YKP A;  3FJM A;  1LBB A;  5DVJ A;  2O1M A;  1VR5 A;  3T9U A;  4PET A;  3DP4 A;  1A8E A;  4MFI A;  4OFO A;  3B6T A;  1I6B A;  2F34 A;  1US5 A;  3K4U A;  3M3L A;  2AYS A;  1B5I A;  1VE4 A;  2OLB A;  3H6W A;  3O9P A;  3PD8 A;  1P1U A;  4IY6 A;  3K0V A;  4LUB A;  4QSC A;  3I3V A;  4WEP A;  5FHN A;  2REG A;  4F1Y A;  5AA4 B;  3O28 A;  2DS9 A;  2Z23 A;  4N13 A;  4BDO A;  4U23 A;  3MZ1 A;  5CMB A;  2G93 A;  4ZE9 A;  4UA8 A;  3QUF A;  3ODB A;  4POW A;  3S9M C;  1EU8 A;  2HAV A;  1S7Y A;  5H8F A;  1H3D A;  1MDP 1;  2G29 A;  4H5F A;  3H4Z A;  4QFK A;  4YAH X;  2X26 A;  3EF7 A;  3K00 A;  3MVX A;  4H8J A;  4KD5 A;  3IOW A;  4OWD A;  1B51 A;  3T66 A;  3D4G A;  2PYY A;  2H98 A;  3TDJ A;  2QS4 A;  3PUX E;  4HW8 A;  4F39 A;  1GR2 A;  1FQE A;  3RY3 A;  1B32 A;  3SER A;  4OVJ A;  3BKI B;  1N76 A;  1A7L A;  5J1D A;  4F22 A;  2F35 A;  1KWH A;  2DSF A;  1IIT A;  4IO4 A;  4U4X A;  1FQD A;  1MXY A;  2V84 A;  2R9J A;  4N07 A;  5ITP A;  1S9T A;  1CB6 A;  3PMX A;  3U94 A;  3C33 A;  5TPA A;  4BDN A;  4OFJ A;  3VDF A;  4TQU Q;  1GTK A;  4OTE A;  1HSL A;  3H6V A;  1H76 A;  1NNT A;  4I8C A;  1IXG A;  3W15 C;  1OVB A;  4GL8 A;  1B9J A;  1IXC A;  1M5F A;  2HZL A;  3VVD A;  1DTG A;  4MLV A;  1EZ9 A;  4KCC A;  4H65 A;  4ESX A;  5I56 A;  4WXJ A;  3H6U A;  3IX1 A;  3SEV A;  2OJT A;  1DTZ A;  1SW1 A;  3V8X B;  5JTY A;  3T9V A;  1Y4T A;  1Q35 A;  3U72 A;  3VXC A;  1LB9 A;  3WAF A;  2VHA A;  1B40 A;  1PB8 A;  4G68 A;  1EZP A;  5EHS A;  4G2Z A;  1MY2 A;  1DOT A;  3V83 A;  1A99 A;  1FTO A;  2Z22 A;  2Z8D A;  1B3F A;  5K2Y A;  5CBR A;  3K1N A;  4KI0 E;  5A5X A;  5AA2 A;  1N7X A;  3F11 A;  3O6G A;  4NF4 B;  1IEJ A;  3DLN A;  4NMY A;  4QFL A;  4R2F A;  1RYX A;  3TFL A;  4DXC A;  1LCF A;  3G3J A;  4OEU A;  4IO6 A;  4KYS A;  3S9N C;  5H8N B;  1FQB A;  3M3K A;  3R7X A;  3LSL A;  1NNP A;  3DM0 A;  2CMO A;  3GXA A;  1R6Z A;  2XX8 A;  3HHF A;  3L6G A;  4QFO A;  3TUS A;  3OXN A;  1D3K A;  3K6W A;  1IUD A;  1Y20 A;  4NE4 A;  1B3H A;  1ZLQ A;  2KLF A;  2DE4 A;  3KZG A;  4ZEB A;  1FQF A;  1II5 A;  1SVX B;  1XT8 A;  5H8N A;  1MXU A;  4OQO A;  2QSX A;  4I1D A;  2XXU A;  4U1O A;  2PMS A;  1H44 A;  3PUW E;  4LA9 A;  2DQV A;  4NF4 A;  4R72 A;  4ZEK A;  5AA2 B;  1UIU A;  5I2N A;  2ZNT A;  4ZS9 A;  3ZS6 A;  3RTW B;  3IB0 A;  4IGR A;  4OET A;  4DCX A;  3Q27 A;  1Y3N A;  3USD A;  4I9D A;  1JNF A;  1B46 A;  2Y84 A;  1URG A;  4MBP A;  2Q9T A;  2XXX A;  3RT6 B;  5AA2 D;  2H4I A;  3K6V A;  3SEW A;  1WDN A;  3SKP A;  2V93 A;  4IB2 A;  2UYF A;  1J1N A;  4AB5 A;  1S50 A;  1YPN A;  1NFT A;  3N5L A;  1N3W A;  3DEL B;  5I56 B;  5I59 A;  1JW5 A;  5I58 B;  3KJ7 A;  2A5T A;  3T22 A;  1D9Y A;  2UXA A;  1BTJ A;  3CIJ A;  1SQY A;  3E13 X;  5ELV A;  4R9G A;  4Z0I A;  4DZ1 A;  1AL3 A;  1MPB A;  3OMB A;  4F19 A;  2HZK A;  1US4 A;  4OXV A;  3QSL A;  2Y7I A;  1VFD A;  3P7I A;  3LSW A;  3PPQ A;  3B6Q A;  2I4B A;  2V3Q A;  5TPA B;  4BDL A;  2AIX A;  4BLA A;  4H6D A;  1SD3 A;  1Z7N E;  3N6U A;  1LFG A;  2V3T A;  1HSJ A;  2NOO A;  3DP6 A;  4HCW A;  5DTB A;  5AE4 A;  2Q2A A;  1LB8 A;  3M8U A;  3EN3 A;  1GVC A;  2GRV A;  1LST A;  4M1V A;  3T9H B;  4C0R A;  1N04 A;  1N84 A;  2ZMB A;  3FXQ A;  3K6U A;  1ZJL A;  1PB7 A;  4LZ8 A;  3WAE A;  1NNF A;  1NL5 A;  4ELO A;  4OZ9 A;  1MY4 A;  4OMB A;  4LAT A;  1AH5 A;  4X48 A;  2ZYO A;  1P1N A;  5IKB A;  2RC8 A;  3KSX A;  4G68 C;  1I6A A;  1M5D A;  1Y9U A;  1IQ7 A;  2BJJ X;  2F6P A;  4FED A;  3VV5 A;  4F31 B;  4FEB A;  3O29 A;  4XKP A;  5H8F B;  4LVQ A;  2QJE A;  1NKX A;  4NF8 B;  2YJP A;  4ND9 A;  1YTV A;  4GFR A;  1B4Z A;  2PBW A;  4R73 A;  2ALU A;  5TU0 A;  2RC7 A;  5JK4 A;  4NED A;  4BDQ A;  2HCA A;  2F78 A;  3OSR A;  5AA4 A;  5L9S A;  3C36 A;  4RXL A;  3TCF A;  3EQ1 A;  2OWT A;  3C34 A;  3K02 A;  1ZTY A;  5L9M A;  5BWJ A;  4GD5 A;  1RYO A;  3PPP A;  3BFU A;  4KYE A;  3PD9 A;  4MLQ A;  1H45 A;  1B1X A;  1ZMG A;  2HEU A;  3G7W A;  3MC2 A;  4H67 A;  3TTM A;  1TFD A;  4P0G A;  3ZSF A;  1ZBM A;  4E0X A;  4ELP A;  3W9W A;  3UOR A;  1EZO A;  4MH5 A;  3VLW A;  3KOT A;  2IEE A;  2RCB A;  3C35 A;  3FV2 A;  4RA1 A;  4THI A;  5IAI A;  4H8I A;  1URS A;  4F2O A;  3S9L C;  4OYV A;  1QJM A;  2NXO A;  3IOU A;  3PMV A;  1QUK A;  4JWY A;  5DYH A;  3HV1 A;  2FNC A;  2OCU A;  1BLF A;  3VFJ A;  3VXB A;  3CI8 A;  2H5Y A;  2ONK E;  3JZJ A;  3GZG A;  4RPN A;  3MP1 A;  4NTL A;  2IA4 A;  1XOC A;  5AA3 A;  4FEC A;  1LFI A;  1UTB A;  3IO6 A;  1A8F A;  3W9V A;  3B6W A;  4Q5T A;  5ISU A;  3MVZ A;  3IOR A;  3EHS A;  4LP2 B;  2QS1 A;  1LLS A;  3N26 A;  4C1T A;  4TLL B;  3G3K A;  3GBB A;  4F3S A;  2FYI A;  3KGC A;  4IO7 A;  3K01 A;  3FV1 A;  3HO7 A;  1MXW A;  3Q25 A;  4GRK A;  4KYD A;  4YKJ A;  1MQJ A;  4F2Q A;  1JQF A;  3MUQ A;  4TLM B;  3A09 A;  5DT6 A;  2ABH A;  1SYI A;  2UVH A;  4TOZ A;  3IOT A;  3IB1 A;  1R1N A;  2O7U A;  4MF3 A;  5EHM A;  4BDR A;  4QHQ A;  5F1Q A;  3TYH A;  4P0I A;  4R2B A;  4QRZ A;  3PMW A;  2DYX A;  3TQL A;  1SI0 A;  1UTH A;  1MH4 A;  4G4P A;  4YKI A;  5CMK A;  3TAJ A;  2RF1 A;  2XXT A;  3B7D A;  2XX9 A;  4LQ2 A;  2E1S A;  4DIG A;  3LSF B;  3ECR A;  3UN6 A;  4QSD A;  3VVF A;  4ZED A;  3OEN A;  3CSG A;  4AB6 A;  2OBG A;  4K3F A;  1JET A;  2REJ A;  4Q30 B;  1MQH A;  4EF2 A;  3TPA A;  5KDT B;  1SI1 A;  1NMU A;  3LC8 A;  3IL1 B;  3MPL A;  1PC3 A;  3PU5 A;  1AOV A;  4FAJ A;  4GVO A;  1QUJ A;  4G8N A;  4F3P A;  2O51 A;  1PBQ A;  2GHB A;  3ONM A;  5DEX B;  5TP9 A;  5I57 B;  1N0T A;  4POX A;  4YKK A;  1QUL A;  4IO3 A;  1QKB A;  2W7Y A;  1B5J A;  2ZYK A;  4XKN A;  1O64 A;  2QPQ A;  1JVX A;  4NWC A;  4JSD A;  2DWI A;  2NWJ A;  3IJX B;  2O68 A;  4JSO A;  2UVG A;  4OEV A;  5FHO A;  2YPN A;  3KBR A;  4U4S A;  2P2A A;  2VOZ A;  4YMB A;  1LCT A;  3UIF A;  3MVY A;  2X7P A;  4NF5 B;  1RKM A;  1B0H A;  2HFB A;  2THI A;  3IK6 B;  2V3U A;  3JYR A;  2F7C A;  2I3V A;  2O84 X;  4GL0 A;  1F9B A;  1Z7M E;  2Y7K A;  1ATG A;  2D3I A;  3C32 A;  1H43 A;  1DMB A;  4F1U A;  1ZIU A;  3FJG A;  1ELJ A;  4JBZ A;  5LOM A;  2ZXT A;  1B52 A;  3QK6 A;  4X1B A;  1B58 A;  3U8Q A;  2UVI A;  3FAS A;  1B1H A;  4G8H A;  4ZEF A;  2DWH A;  3HPI A;  2WKY A;  3K2D A;  1FTJ A;  5ITO A;  5CC2 A;  4QFP A;  1XVY A;  5M2V A;  1B7Z A;  3E4R A;  3FVG A;  3MP8 A;  2QRY A;  5H8H A;  3TTR A;  1SDX A;  3MP6 A;  1P99 A;  2NVU B;  1I6Q A;  3PPO A;  3QUJ A;  1M5E A;  2RIN A;  2I4C A;  4ONY A;  4ZZE A;  4IO2 A;  1MXX A;  3RNN A; 
#chains in the Genus database with same CATH topology
 4AQ4 A;  5CM6 A;  1DPP A;  3TCH A;  2PT1 A;  1BIY A;  5B70 A;  3KG2 A;  5H8S A;  3TTK A;  2HXR A;  4GWS A;  4EQ7 A;  3FZV A;  3MVW A;  2UYE A;  3TTN A;  2DE3 A;  1SW5 A;  2ESN A;  2HAU A;  4EQ9 A;  1FTL A;  4OA4 A;  5IZ3 B;  2FA7 A;  2Q8J A;  4KFQ A;  4WED A;  5H8Q A;  4PDH A;  5ET5 A;  1PB9 A;  2RKM A;  4P3L A;  4U2R A;  4NHB A;  2WBB A;  1FW0 A;  1MY1 A;  3SDF A;  1CE2 A;  2DE2 A;  5TP9 B;  2OZZ A;  4XTC Q;  4R6K A;  2DVC A;  4FAT A;  3OOA A;  5KDT A;  3V89 B;  4XKQ A;  2JJK A;  4PFT A;  3MQ9 A;  4OES A;  3CFZ A;  2P1S A;  3RLF E;  2DXR A;  4OHN A;  4GIZ A;  4DXU A;  2D5W A;  1FBP A;  3I6V A;  3OD7 A;  1QUI A;  2Y7P A;  1IXI A;  2CZH A;  1OMP A;  3CVG A;  2E0S A;  2ZYM A;  3QMF A;  2DOJ A;  3KBZ A;  4DCY A;  2XXH A;  1NH8 A;  5CBS A;  4NG7 A;  5KZT A;  3EHU A;  1EYK A;  5DW8 A;  4NF8 A;  2I0C A;  1MPD A;  4JXI A;  1NV2 A;  3LSX A;  2B4L A;  4QFN A;  3FD3 A;  1USY H;  4PTK A;  1SW4 A;  3ILU B;  4DE8 A;  4PGN A;  4PF6 A;  2FIE A;  3Q28 A;  1JVY A;  2QMX A;  1FPI A;  2Q88 A;  2A5T B;  1Q9D A;  5ET7 A;  4I40 A;  2I48 A;  2Z8E A;  3KFM A;  1MQG A;  4G77 A;  4FOR A;  1B05 A;  3MBP A;  3K1P A;  3MST A;  2I3W A;  3ILT B;  4HCY A;  3FUZ A;  3O6H A;  3H06 B;  3GBA A;  1FTA A;  1BP5 A;  1BKA A;  1MPC A;  4KHZ E;  1K9Z A;  3UP9 A;  1LGB C;  4RJZ A;  4GWY A;  1MRP A;  4O3C A;  3MW0 A;  3IAZ A;  3FVO A;  3O97 A;  3R6U A;  4O7M A;  4BDM A;  4PP0 A;  2QMW A;  2A5S A;  4GX3 A;  2Q89 A;  2VD2 A;  4EQB A;  1I69 A;  2I58 A;  3VLU A;  1MS7 A;  4OER A;  1D9Q A;  1UQW A;  2O1L A;  3T9U A;  4GBV A;  2WBD A;  1US5 A;  1VE4 A;  3TTL A;  3H6W A;  3O9P A;  4E0W A;  5FHN A;  5A5L A;  4WEP A;  4F1Y A;  4QSC A;  2WEF A;  2REG A;  3O28 A;  2DS9 A;  4BDO A;  1XI6 A;  4U23 A;  5CMB A;  4ZE9 A;  4UA8 A;  3ODB A;  3H4Z A;  3RYD A;  4YAH X;  3K00 A;  3MVX A;  3T66 A;  4P1E A;  2QS4 A;  1FQE A;  3RY3 A;  2F35 A;  4OVR A;  1CB6 A;  3C33 A;  2ZZX A;  1B9J A;  2HZL A;  3H6U A;  2OJT A;  1Q35 A;  1LB9 A;  3WAF A;  2VHA A;  1EZP A;  2Z22 A;  2Z8D A;  5K2Y A;  3F11 A;  4NMY A;  4OEU A;  4KYS A;  3BIG A;  3S9N C;  1FQB A;  3DM0 A;  3HHF A;  2XX8 A;  1IUD A;  4NE4 A;  2DE4 A;  1FQF A;  1SVX B;  1G0I A;  4OQO A;  2QSX A;  1H44 A;  4LA9 A;  4ZEK A;  5AA2 B;  4R72 A;  5I2N A;  3IB0 A;  4N6D A;  4X04 A;  1B46 A;  1FBE A;  3K6V A;  2V93 A;  1J1N A;  1YPN A;  3KJ7 A;  2WYK A;  1EYI A;  1AL3 A;  4OXV A;  4H6D A;  3N6U A;  2NOO A;  2Q2A A;  1LB8 A;  3T9H B;  4C0R A;  1PB7 A;  4ELO A;  1MY4 A;  2Q8M A;  1NUY A;  1IQ7 A;  2QJE A;  4ND9 A;  1YTV A;  4GFR A;  5JK4 A;  4NED A;  4BDQ A;  1FPK A;  3OSR A;  3PTY A;  1FPB A;  1RYO A;  4MLQ A;  4KYE A;  4H67 A;  1TFD A;  4P0G A;  4E0X A;  4ELP A;  4N91 A;  2IEE A;  4RA1 A;  4THI A;  3IOU A;  3PMV A;  5DYH A;  1BLF A;  3JZJ A;  3GZG A;  1LBY A;  4NTL A;  4FEC A;  1FJ9 A;  3IOR A;  4LP2 B;  4GX4 A;  4C1T A;  4F3S A;  4IO7 A;  3FV1 A;  3Q25 A;  4OVQ A;  3MUQ A;  4TLM B;  5DT6 A;  3BIH A;  4TOZ A;  2DDK A;  1KZ8 A;  4QHQ A;  5F1Q A;  4P0I A;  2DYX A;  2Y5K A;  1SI0 A;  1UTH A;  5CMK A;  4YKI A;  4LQ2 A;  3LSF B;  3UN6 A;  3VVF A;  4K3F A;  3TPA A;  3E78 A;  3IL1 B;  3MPL A;  1PC3 A;  1AOV A;  2HHM A;  1QUJ A;  4G8N A;  2O51 A;  3ONM A;  2ZYK A;  4NWC A;  2QPQ A;  4G61 A;  4JSO A;  4OEV A;  2P2A A;  4P1L A;  2X7P A;  2HFB A;  3IK6 B;  5I5P A;  2O84 X;  1F9B A;  2VPO A;  2ZXT A;  3QK6 A;  4X1B A;  3U8Q A;  2UVI A;  5IZ3 A;  3HPI A;  2WKY A;  5H8H A;  3TTR A;  2HPG A;  4MHF A;  1M5E A;  2I4C A;  1M5C A;  2PVU A;  1MQD A;  2KR0 A;  3TQW A;  4L17 A;  3TEL A;  2Y7R A;  3LUY A;  2VGQ A;  2ZNU A;  2DP8 A;  2X7Q A;  4ELR A;  1LBV A;  1TWY A;  4OAN A;  2V25 A;  3PUZ E;  3G3H A;  5FTI A;  3RUM A;  2XXY A;  5EQ9 A;  2AL5 A;  2B65 A;  3IOV A;  3SET A;  2XXW A;  1LAX A;  3KJT A;  2ZNS A;  1NV5 A;  1R9L A;  4LZ5 A;  3H7M A;  2XXI A;  5I2K A;  1XHY A;  1B4H A;  1GV8 A;  1EYJ A;  1OQH A;  4AS4 A;  5EYG A;  3UK4 A;  4JWO A;  1B0L A;  5HM4 B;  4NF6 A;  1B2H A;  1ZU0 A;  2F36 A;  2QVV A;  1O7T A;  2QFL A;  1OVT A;  4ZDM A;  3V5A A;  2HQ0 A;  2XD2 A;  4I62 A;  3HCQ A;  3OO8 A;  1Y3P A;  3I5O A;  1OLC A;  3O66 A;  3IB2 A;  3EPE A;  1OQG A;  4ZE8 A;  1MY0 A;  4Q0C A;  3DP8 A;  1EH3 A;  3U92 A;  1WOD A;  2DWJ A;  2B3B A;  4JB7 A;  2O69 A;  3M3F A;  1UTB B;  4GWW A;  3LR1 A;  4GXS B;  1A40 A;  1FTK A;  3CFX A;  3CR9 A;  2GH9 A;  1B6H A;  4F1V A;  2H99 A;  4EF1 A;  3RPL B;  3JV9 A;  4PFB A;  3TKD A;  3O6I A;  2YLN A;  4IO5 A;  2QL3 A;  1D9V A;  1ZKB A;  3TCG A;  2XXK A;  3PGF A;  4ELQ A;  2Q74 A;  3G3F A;  4ZZA A;  4H1X A;  3RQT A;  4RPO A;  4F2O A;  2Y5L A;  4X1D A;  3T1B A;  2ZYN A;  4NF5 A;  2PT2 A;  2XWK A;  3QXM A;  3T96 B;  3C31 A;  1IMA A;  2XXQ A;  2VP1 A;  2XX7 A;  2Z8F A;  1TXF A;  1AIV A;  2RCA A;  4ZEC A;  4MNC A;  4JWX A;  1PBP A;  1Q1K A;  5IM2 A;  2DWA A;  3G3G A;  4FE8 A;  4QSE A;  3UOR A;  4GLI A;  4O3B A;  4FJP A;  4IY5 A;  3OO7 A;  4HE0 A;  5I84 A;  4G8M A;  3OEM A;  4HS7 A;  3FXR A;  2VD3 A;  3OEL A;  3E3K A;  3MAM A;  1OLA A;  5L9O A;  2F6G A;  3S9E A;  2XD3 A;  3PUV E;  1QW0 A;  3BFT A;  3FGS A;  3RGY A;  3KOS A;  1Y4C A;  4HE2 A;  4P56 A;  2XWI A;  3ROJ A;  4PFI A;  3H03 A;  4F1U A;  4G68 B;  4RK9 A;  4F3G A;  4R75 A;  5JTY B;  1RDY A;  4PET A;  4MFI A;  3U65 A;  1B5I A;  3I3V A;  4GWZ A;  2Z23 A;  2G93 A;  3QUF A;  2HAV A;  5H8F A;  1MDP 1;  2X26 A;  3IOW A;  3D4G A;  2PYY A;  4HW8 A;  3PUX E;  2CEX A;  4F39 A;  2FHY A;  1B32 A;  3BKI B;  1A7L A;  4IO4 A;  4U4X A;  1IIT A;  2V84 A;  2R9J A;  1S9T A;  4BDN A;  5TPA A;  4TQU Q;  1GTK A;  1HSL A;  1H76 A;  1NNT A;  1OVB A;  4ESX A;  4WXJ A;  4NF0 A;  5JTY A;  3T0J A;  1PB8 A;  2GQ1 A;  1DOT A;  3V83 A;  1B3F A;  1AWB A;  5CBR A;  4KI0 E;  4R2F A;  1LCF A;  3G3J A;  2CMO A;  3GXA A;  3TUS A;  3L6G A;  1YZ0 A;  3K6W A;  1Y20 A;  4HE1 A;  1ZLQ A;  1II5 A;  4I1D A;  2PMS A;  2OWZ A;  3PUW E;  4NF4 A;  2DQV A;  1UIU A;  1FBF A;  2ZNT A;  4ZS9 A;  3RTW B;  4IGR A;  1Y3N A;  1JNF A;  4MBP A;  1URG A;  3SEW A;  4AB5 A;  1S50 A;  5I58 B;  1D9Y A;  1BTJ A;  3E13 X;  4DZ1 A;  5ELV A;  4Z0I A;  3OMB A;  4JVD A;  1IMF A;  2Y7I A;  1VFD A;  4BDL A;  3B6Q A;  2AIX A;  1NV4 A;  1Z7N E;  1LFG A;  4X8R A;  1GVC A;  1LST A;  1N04 A;  3K6U A;  4O94 A;  1DK4 A;  4JVI A;  4OZ9 A;  2ZYO A;  4G68 C;  1Y9U A;  2F6P A;  4FED A;  2P3V A;  4MNP A;  2PBW A;  2HCA A;  5L9S A;  4RXL A;  5BWJ A;  4GD5 A;  4PE5 B;  3PD9 A;  5KCJ B;  1B1X A;  1ZMG A;  2HEU A;  3TTM A;  1ZBM A;  3VLW A;  3KOT A;  5IAI A;  3S9L C;  4OYV A;  2NXO A;  4P9K A;  1QUK A;  2OCU A;  5EQ7 A;  3VXB A;  2ONK E;  4RPN A;  2IA4 A;  2WX9 A;  4Q5T A;  3EHS A;  4TLL B;  2FYI A;  1MXW A;  4GRK A;  1MQJ A;  4MAG A;  2UVH A;  3NOH A;  3IOT A;  5EQ8 A;  3TYH A;  4QRZ A;  3PMW A;  5EYH A;  4G4P A;  2XX9 A;  4DIG A;  2E1S A;  2REJ A;  4EF2 A;  2OX3 A;  3LC8 A;  3PU5 A;  2ZZW A;  4F3P A;  1PBQ A;  1LEV A;  2GHB A;  5I57 B;  1N0T A;  4YKK A;  4PDD A;  1QUL A;  4IO3 A;  1B5J A;  4XKN A;  1FBH A;  4YMB A;  1B0H A;  2V3U A;  3JYR A;  4GL0 A;  1Z7M E;  2D3I A;  3A29 A;  1H43 A;  1INP A;  1DMB A;  1ELJ A;  5LOM A;  2PFY A;  3FAS A;  1FPD A;  2DWH A;  5ITO A;  3K2D A;  1FTJ A;  5M2V A;  1B7Z A;  3E4R A;  2QRY A;  1SDX A;  3MP6 A;  4ONY A;  4O3A A;  4IO2 A;  3CSB A;  1UIV A;  5FHM A;  3CG1 A;  3KSJ A;  4N17 A;  3G3I A;  3N6T A;  1NV1 A;  3OO9 A;  4OFL A;  5J16 A;  1CNQ A;  4UAB A;  4U22 A;  2KQZ A;  4FIM A;  4YU0 A;  3Q29 A;  5CRY A;  3VE1 B;  3IJO B;  4H45 A;  4OVP A;  4Z7E A;  1FBD A;  4PE3 A;  1XVX A;  3TOD A;  1O63 A;  4GX6 A;  2ONS A;  2B4M A;  1FTM A;  1DCU A;  2HXW A;  1SW2 A;  5CMC A;  4YB7 A;  2F7A A;  4MMP A;  4YIC A;  3CFL A;  3HST A;  4YB6 A;  1XS5 A;  1IXH A;  3ZKK A;  4C1U A;  1URD A;  3IR1 A;  2L5V A;  3Q26 A;  4RY1 A;  3R26 A;  3AXF A;  4IGT A;  3KN7 A;  4RYA A;  3VVE A;  4F18 A;  1YAE A;  2MKZ A;  4X9T A;  1PEB A;  1P1O A;  2PFZ A;  3KN8 A;  4DI3 D;  4EXL A;  4RK2 A;  3FBP A;  3SEX A;  3MYU A;  1FCK A;  2DXY A;  5H8Q B;  4DI4 B;  4XXU A;  1OIB A;  1MQI A;  1DSN A;  4PFU A;  3CRB A;  4ECF A;  3D1R A;  5HBC A;  1USY E;  4U21 A;  5FBP A;  4GWU A;  2Y7W A;  1POY 1;  3PUY E;  2O6A A;  5DVI A;  4GF8 A;  1Y1M A;  4ESW A;  4KCD A;  4HTG A;  3PPN A;  2R6G E;  3KC0 A;  1QVS A;  4I3E A;  3HN0 A;  4U1Z A;  4ZEI A;  1AMF A;  2P0S A;  3TMG A;  4KPT A;  4PFW A;  5LTC A;  1NH7 A;  2XXR A;  5JEI A;  1FQC A;  5LDZ A;  5BUU A;  5CI5 A;  2BJI A;  4IR8 A;  3RPW A;  1B7U A;  3TEP A;  1LAH E;  2O7I A;  4RNS A;  4DXB A;  2F8D A;  4PGP A;  1KA0 A;  4JDF A;  1MDQ A;  2XXV A;  5T3J A;  2F7B A;  4WKM A;  5I59 B;  4XKR A;  1RDZ A;  5DEX A;  3SES A;  3MZ9 A;  3E9X A;  3H6T A;  2QS2 A;  3C4M A;  3OEK A;  1FPE A;  2UVJ A;  4DDD A;  1A54 A;  1POT A;  1L5T A;  2NUV A;  1D4N A;  2GFE A;  3H3G A;  1HSE A;  3RN8 A;  4GQO A;  4EUO A;  2AL4 A;  2FBP A;  1VSO A;  1GGG A;  4H0W A;  1QKA A;  3O2A A;  3UA8 A;  4LN5 A;  1NV3 A;  4PFY A;  3ZKL A;  3BBR A;  4R6Y A;  4PAI A;  3KC1 A;  3MPK A;  4ISU A;  2CZL A;  3KN3 A;  3EHT A;  1QGX A;  1MM6 A;  2I0B A;  3MZB A;  1LBZ A;  4YKP A;  3FJM A;  2O1M A;  3DP4 A;  1A8E A;  4OFO A;  3B6T A;  1LBW A;  2F34 A;  4PAK A;  3M3L A;  3K4U A;  2AYS A;  1P1U A;  4LUB A;  3LUZ A;  4N13 A;  4POW A;  1EU8 A;  1H3D A;  2G29 A;  1FBG A;  4H8J A;  4KD5 A;  2H98 A;  3TDJ A;  1GR2 A;  3SER A;  1N76 A;  4F22 A;  1KWH A;  1FQD A;  1MXY A;  3PMX A;  2FIX A;  4OFJ A;  3VDF A;  4OTE A;  1IXG A;  3W15 C;  4GL8 A;  1IXC A;  1DTG A;  4MLV A;  4KCC A;  4H65 A;  4AS5 A;  5I56 A;  3SEV A;  3IX1 A;  4P47 A;  1Y4T A;  1B40 A;  5EHS A;  4G2Z A;  1N7X A;  4NF4 B;  3O6G A;  1IEJ A;  3DLN A;  4QFL A;  5I7I A;  3TFL A;  4DXC A;  4IO6 A;  5H8N B;  3M3K A;  3R7X A;  3OXN A;  1D3K A;  5F24 A;  1B3H A;  3KZG A;  2KLF A;  1XT8 A;  1MXU A;  2VT5 A;  2XXU A;  4U1O A;  1NUZ A;  3CHG A;  3ZS6 A;  4DCX A;  4OET A;  4I9D A;  3RT6 B;  2H4I A;  1NFT A;  5I59 A;  1JW5 A;  2A5T A;  3T22 A;  2UXA A;  5ET6 A;  1SQY A;  4I3Y A;  1MPB A;  3QSL A;  2QVU A;  2R8T A;  3P7I A;  4MX6 A;  3PPQ A;  5TPA B;  2I4B A;  4PBQ A;  2V3T A;  1FPG A;  1FSA A;  3EN3 A;  2GRV A;  4M1V A;  2CZI A;  3FXQ A;  1NNF A;  4OMB A;  4X48 A;  1AH5 A;  2P3N A;  3KSX A;  1M5D A;  3VV5 A;  4FEB A;  4XKP A;  5H8F B;  4NF8 B;  4PAF A;  1B4Z A;  4R73 A;  1NUW A;  2F78 A;  5AA4 A;  3C36 A;  3TCF A;  3EQ1 A;  2OWT A;  3C34 A;  3K02 A;  1ZTY A;  3PPP A;  3ZSF A;  4MEV A;  3W9W A;  1FRP A;  3FV2 A;  2RCB A;  4H8I A;  1URS A;  4JWY A;  2PCR A;  3VFJ A;  3CI8 A;  1LFI A;  3IO6 A;  5ISU A;  3MVZ A;  4MIJ A;  3G3K A;  3KGC A;  3K01 A;  4YKJ A;  2ABH A;  1FPL A;  3IB1 A;  1R1N A;  4BDR A;  3E79 A;  1KA1 A;  3TQL A;  1NV7 A;  3S9M C;  2XWV A;  3TAJ A;  2RF1 A;  2XXT A;  3B7D A;  3ECR A;  4Q30 B;  1MQH A;  5KDT B;  1SI1 A;  4N15 A;  1NMU A;  1BK4 A;  1YXI A;  5TP9 A;  1FPJ A;  4JSD A;  3IJX B;  5FHO A;  1NV0 A;  1NV6 A;  2O68 A;  2UVG A;  2YPN A;  3KBR A;  2VOZ A;  4NF5 B;  1RKM A;  2THI A;  2F7C A;  2I3V A;  1ATG A;  1ZIU A;  3FJG A;  4O7I A;  5IZ1 A;  1B1H A;  4G8H A;  2V4C A;  3ISP A;  5IZZ A;  4QFP A;  1P99 A;  2NVU B;  3PPO A;  3QUJ A;  4ZZE A;  1MXX A;  1B3E A;  2OWS A;  2XA5 A;  4N4U A;  3T93 B;  3RPL A;  3THI A;  4M4G A;  1MM7 A;  1TT1 A;  5ICQ A;  4NGU A;  1P1W A;  3U93 A;  1IME A;  1NUX A;  3A3U A;  3FIR A;  4R6H A;  2F3D A;  4OVS A;  3KEI A;  1Y1Z A;  3OSQ A;  1SYH A;  4LON B;  5CMM A;  1SBP A;  2H9B A;  4R74 A;  3UGW A;  2GHA A;  1TFA A;  1IIW A;  1RDX A;  1MXZ A;  2Q2C A;  1PDA A;  2RC9 A;  4PC9 A;  3S4U A;  3QAX A;  4EXK A;  3MWB A;  1ANF A;  4P11 A;  3QYT A;  2XXP A;  4YMA A;  5L8D A;  4QXD A;  3S2V A;  5I57 A;  1N7W A;  3IFA A;  1WVJ A;  4NF6 B;  3GLB A;  1MY3 A;  1NI9 A;  1DBZ A;  4P8B A;  2ANJ A;  1B7H A;  3FVK A;  1JEU A;  1LAG E;  3IFC A;  4QF9 A;  3VLV A;  4LQ5 A;  5I3S A;  4KQP A;  4LZ7 A;  3U1O A;  5I2K B;  1YCJ A;  1VFE A;  1NNK A;  1YYZ A;  4Q8R A;  2ONR A;  4N8Y A;  4XIG Q;  1FPF A;  4NQ8 A;  4NX1 A;  3FAT A;  5B7D A;  3RTF B;  5AA1 A;  5EYF A;  4KR5 A;  4KXP A;  4GOT A;  4R9F A;  2I6E A;  2H25 A;  1JW4 A;  4GBW A;  4H5G A;  2R71 A;  2CEY A;  1IZ1 A;  1JW1 A;  3OO6 A;  4DLD A;  4YZZ A;  5KCJ A;  1VDW A;  4GWO A;  4N6K A;  1LBC A;  3QIM A;  3SEY A;  5FTH A;  1Y3Q A;  1P1Q A;  2F5X A;  4PQJ A;  1R9Q A;  4EDP A;  4N81 A;  3IO4 A;  1B3L A;  3L6H A;  5H8H B;  1A55 A;  4PBH A;  5ESY A;  1JEV A;  4NWD A;  1IMC A;  3PV0 E;  1K9Y A;  4YB5 A;  5HPQ A;  4N6P A;  3GYY A;  1MG1 A;  3FVN A;  3SZP A;  3FJ7 A;  3K1M A;  5ET8 A;  5F7V A;  2D21 A;  3K6X A;  2M8C A;  4UAC A;  2WYP A;  2F97 A;  1FQA A;  2ZZV A;  2LAO A;  3C9H A;  5I58 A;  5DVF A;  1MXV A;  3D4C A;  4OVT A;  2DVZ A;  1DPE A;  1T0K A;  1B3G A;  1MH3 A;  1N3X A;  2F3B A;  2B3F A;  1IMB A;  3T9X B;  3MJN A;  1UTH B;  3HHG A;  2PX1 A;  3A3C A;  3PPR A;  4JVC A;  1G0H A;  4OEN A;  2I49 A;  1XC1 A;  1LFH A;  4XF5 A;  3RT8 A;  1B5H A;  3LBS A;  1LAF E;  4F29 A;  5A5X B;  3FXU A;  5K2X A;  4F3B A;  3N94 A;  4GXA A;  2OK2 A;  1M5B A;  2QS3 A;  3CG3 A;  2XHD A;  3TZA A;  5DVJ A;  1LBB A;  1VR5 A;  1I6B A;  2OLB A;  2XWO A;  4IY6 A;  3PD8 A;  3K0V A;  4N8G A;  5AA4 B;  4O8M A;  3MZ1 A;  4NAP A;  3LV0 A;  1S7Y A;  1SPI A;  4H5F A;  4QFK A;  3EF7 A;  4OWD A;  1B51 A;  1IMD A;  4PFR A;  4OVJ A;  5J1D A;  4FBP A;  2DSF A;  5ITP A;  4N07 A;  4MNI A;  3U94 A;  4QBA A;  3H6V A;  4I8C A;  1M5F A;  3VVD A;  1EZ9 A;  1DTZ A;  1SW1 A;  3V8X B;  3T9V A;  3U72 A;  3VXC A;  4G68 A;  1MY2 A;  2CZK A;  1A99 A;  1FTO A;  3K1N A;  5A5X A;  5AA2 A;  5I2N B;  4HXV A;  1RYX A;  3LSL A;  4XEQ A;  1NNP A;  1R6Z A;  4QFO A;  3SEU A;  5H8N A;  4NN3 A;  2QVR A;  4XFE A;  3Q27 A;  1JP4 A;  3USD A;  2Y84 A;  5AA2 D;  2Q9T A;  2XXX A;  1WDN A;  3SKP A;  4IB2 A;  2UYF A;  3N5L A;  1N3W A;  3DEL B;  5I56 B;  3CIJ A;  4R9G A;  4F19 A;  2HZK A;  1US4 A;  3LSW A;  2V3Q A;  4BLA A;  1SD3 A;  5AE4 A;  1HSJ A;  3DP6 A;  4HCW A;  4MJO A;  5DTB A;  5ICT A;  3M8U A;  1N84 A;  2ZMB A;  1ZJL A;  4LZ8 A;  3WAE A;  1NL5 A;  3FXB A;  5IKB A;  3HFU A;  4LAT A;  1P1N A;  2RC8 A;  4F31 B;  1I6A A;  2BJJ X;  3O29 A;  4LVQ A;  1NKX A;  2YJP A;  2ALU A;  5TU0 A;  2RC7 A;  5L9M A;  3BFU A;  1H45 A;  3G7W A;  4H46 A;  3MC2 A;  1EZO A;  4MH5 A;  3C35 A;  1QJM A;  1LBX A;  3HV1 A;  2FNC A;  2VPN A;  5IGA A;  2H5Y A;  3MP1 A;  1XOC A;  5AA3 A;  1FJ6 A;  3W9V A;  1UTB A;  1A8F A;  4GWX A;  3B6W A;  1FBC A;  2QS1 A;  1LLS A;  3N26 A;  3GBB A;  4ZEB A;  3HO7 A;  4KYD A;  5EQA A;  4F2Q A;  1JQF A;  3A09 A;  4MCO A;  1SYI A;  2O7U A;  4MF3 A;  5EHM A;  4R2B A;  1MH4 A;  4QSD A;  4ZED A;  3OEN A;  3CSG A;  4AB6 A;  2OBG A;  1JET A;  4FAJ A;  4GVO A;  5DEX B;  2FVZ A;  4POX A;  1QKB A;  2W7Y A;  1O64 A;  1JVX A;  2DWI A;  2NWJ A;  4U4S A;  3B50 A;  1LCT A;  3UIF A;  3MVY A;  4PCD A;  3C32 A;  2Y7K A;  4JBZ A;  1B52 A;  1B58 A;  4ZEF A;  5CC2 A;  3B8B A;  4PF8 A;  1XVY A;  3FVG A;  3MP8 A;  1I6Q A;  3EKI A;  2RIN A;  3RNN A; 
#chains in the Genus database with same CATH homology
 1M5C A;  1UIV A;  2PVU A;  3CSB A;  1MQD A;  1B3E A;  3CG1 A;  3KSJ A;  5FHM A;  4AQ4 A;  5CM6 A;  3TQW A;  4L17 A;  3TEL A;  2Y7R A;  3LUY A;  1DPP A;  2OWS A;  2VGQ A;  3TCH A;  2ZNU A;  2DP8 A;  2X7Q A;  3G3I A;  3T93 B;  2PT1 A;  3N6T A;  1BIY A;  3THI A;  4ELR A;  4M4G A;  5B70 A;  3KG2 A;  5H8S A;  1MM7 A;  1TT1 A;  3OO9 A;  3TTK A;  5ICQ A;  1P1W A;  1TWY A;  4OFL A;  4EQ7 A;  3FZV A;  2V25 A;  3U93 A;  3MVW A;  2UYE A;  4U22 A;  3PUZ E;  3G3H A;  3TTN A;  5FTI A;  2DE3 A;  3A3U A;  4FIM A;  3FIR A;  4R6H A;  1SW5 A;  3RUM A;  4YU0 A;  3Q29 A;  5CRY A;  2ESN A;  2HAU A;  2XXY A;  3IJO B;  3KEI A;  3VE1 B;  4EQ9 A;  1Y1Z A;  3OSQ A;  2AL5 A;  1SYH A;  4LON B;  4Z7E A;  1FTL A;  2B65 A;  3IOV A;  5CMM A;  3SET A;  1SBP A;  5I2N B;  1XVX A;  2XXW A;  2FA7 A;  2H9B A;  4R74 A;  1LAX A;  2Q8J A;  4KFQ A;  3KJT A;  2ZNS A;  4WED A;  5H8Q A;  3TOD A;  1O63 A;  1PB9 A;  1R9L A;  2RKM A;  4LZ5 A;  3UGW A;  2ONS A;  3H7M A;  2GHA A;  1TFA A;  2XXI A;  2HXW A;  1FTM A;  1IIW A;  4U2R A;  1MXZ A;  2Q2C A;  1PDA A;  2RC9 A;  1SW2 A;  5I2K A;  5CMC A;  4YB7 A;  3QAX A;  3S4U A;  2F7A A;  4YIC A;  4EXK A;  3CFL A;  3MWB A;  1ANF A;  4P11 A;  3HST A;  3QYT A;  4YB6 A;  1XHY A;  1XS5 A;  1B4H A;  2XXP A;  1GV8 A;  4YMA A;  1FW0 A;  1OQH A;  5L8D A;  1IXH A;  3ZKK A;  1MY1 A;  3SDF A;  1CE2 A;  1URD A;  4C1U A;  2DE2 A;  3IR1 A;  3S2V A;  3UK4 A;  3Q26 A;  4JWO A;  4RY1 A;  2OZZ A;  1N7W A;  5TP9 B;  5I57 A;  1B0L A;  3R26 A;  4XTC Q;  5HM4 B;  1WVJ A;  4NF6 A;  4NF6 B;  4R6K A;  2DVC A;  3AXF A;  3GLB A;  1MY3 A;  1B2H A;  1ZU0 A;  2F36 A;  4IGT A;  3KN7 A;  4FAT A;  2ANJ A;  3OOA A;  4RYA A;  3VVE A;  4F18 A;  5KDT A;  1O7T A;  1B7H A;  1YAE A;  3FVK A;  1JEU A;  1LAG E;  1OVT A;  4ZDM A;  3V89 B;  4QF9 A;  3VLV A;  4XKQ A;  3V5A A;  2HQ0 A;  4LQ5 A;  1PEB A;  1P1O A;  2XD2 A;  3KN8 A;  4KQP A;  4X9T A;  4I62 A;  4LZ7 A;  4EXL A;  4RK2 A;  3U1O A;  5I2K B;  3HCQ A;  1YCJ A;  1VFE A;  4O3A A;  3OO8 A;  4PFT A;  1Y3P A;  3I5O A;  1NNK A;  3SEX A;  1OLC A;  3O66 A;  3MQ9 A;  3IB2 A;  3VLU A;  2ONR A;  4Q8R A;  3EPE A;  1FCK A;  4OES A;  2DXY A;  5H8Q B;  1OQG A;  4ZE8 A;  3CFZ A;  1MY0 A;  2P1S A;  4Q0C A;  3DP8 A;  1EH3 A;  4XXU A;  1WOD A;  3U92 A;  4XIG Q;  1OIB A;  2DWJ A;  3RLF E;  2DXR A;  2B3B A;  4OHN A;  4GIZ A;  4JB7 A;  3FAT A;  5B7D A;  1MQI A;  1DSN A;  2O69 A;  3M3F A;  4DXU A;  1UTB B;  2D5W A;  4PFU A;  3RTF B;  3CRB A;  5AA1 A;  4ECF A;  5EYF A;  4KR5 A;  5HBC A;  1USY E;  3LR1 A;  4U21 A;  4GXS B;  3I6V A;  3OD7 A;  4GOT A;  1A40 A;  1FTK A;  1QUI A;  2Y7P A;  2Y7W A;  1IXI A;  4R9F A;  1POY 1;  2I6E A;  3CFX A;  3PUY E;  1OMP A;  2O6A A;  4GF8 A;  5DVI A;  2H25 A;  3CVG A;  2E0S A;  3CR9 A;  1JW4 A;  2GH9 A;  4H5G A;  2ZYM A;  1Y1M A;  1B6H A;  2R71 A;  4F1V A;  4ESW A;  4KCD A;  4HTG A;  3PPN A;  1IZ1 A;  2H99 A;  2DOJ A;  1JW1 A;  3OO6 A;  4DLD A;  4DCY A;  2R6G E;  4EF1 A;  4YZZ A;  5KCJ A;  1QVS A;  4GWO A;  3HN0 A;  2XXH A;  4U1Z A;  3JV9 A;  1NH8 A;  4ZEI A;  5CBS A;  1LBC A;  3QIM A;  3SEY A;  1AMF A;  2P0S A;  5KZT A;  5FTH A;  3TKD A;  1Y3Q A;  1P1Q A;  3EHU A;  3O6I A;  3TMG A;  4KPT A;  2F5X A;  2YLN A;  4PQJ A;  1R9Q A;  4IO5 A;  4PFW A;  4EDP A;  2QL3 A;  1D9V A;  1NH7 A;  3IO4 A;  4NF8 A;  2XXR A;  5JEI A;  1ZKB A;  1B3L A;  3L6H A;  2I0C A;  1MPD A;  5H8H B;  1A55 A;  1FQC A;  4JXI A;  5BUU A;  3TCG A;  1JEV A;  4NWD A;  3PGF A;  4ELQ A;  5CI5 A;  3LSX A;  3PV0 E;  3G3F A;  4YB5 A;  3RPW A;  1B7U A;  5HPQ A;  4N6P A;  3TEP A;  1LAH E;  2O7I A;  4QFN A;  4RNS A;  1MG1 A;  3FD3 A;  3FVN A;  4H1X A;  4ZZA A;  3RQT A;  1USY H;  3FJ7 A;  1SW4 A;  3K1M A;  3ILU B;  4RPO A;  2F8D A;  2D21 A;  5F7V A;  4DE8 A;  4DXB A;  3K6X A;  2M8C A;  4UAC A;  4X1D A;  2ZYN A;  4NF5 A;  3Q28 A;  2PT2 A;  4JDF A;  2F97 A;  3QXM A;  1JVY A;  3TTL A;  1FQA A;  1MDQ A;  2QMX A;  4F3G A;  3T96 B;  3C31 A;  2Q88 A;  2LAO A;  2XXV A;  2XXQ A;  2VP1 A;  2XX7 A;  2Z8F A;  3C9H A;  3SEU A;  1TXF A;  2A5T B;  2F7B A;  1AIV A;  5I58 A;  4WKM A;  5I59 B;  2RCA A;  4XKR A;  2I48 A;  2Z8E A;  5DVF A;  4ZEC A;  1MXV A;  5DEX A;  4JWX A;  3KFM A;  3D4C A;  1PBP A;  1Q1K A;  3MZ9 A;  3SES A;  2DVZ A;  1DPE A;  3E9X A;  1T0K A;  1B3G A;  3H6T A;  2DWA A;  1MH3 A;  2QS2 A;  2UVJ A;  3C4M A;  3G3G A;  1MQG A;  3OEK A;  4FE8 A;  4DDD A;  4QSE A;  4G77 A;  1A54 A;  1N3X A;  1POT A;  4FOR A;  4GLI A;  1B05 A;  2NUV A;  3MBP A;  1D4N A;  3K1P A;  4FJP A;  4O3B A;  1L5T A;  4IY5 A;  2B3F A;  2GFE A;  2I3W A;  3H3G A;  3ILT B;  3OO7 A;  4PE5 B;  3T9X B;  5I84 A;  4HCY A;  3FUZ A;  1HSE A;  4G8M A;  3OEM A;  4HS7 A;  3O6H A;  3RN8 A;  3FXR A;  2VD3 A;  3MJN A;  4GQO A;  1UTH B;  3HHG A;  5ICT A;  5KCJ B;  2PX1 A;  3H06 B;  3A3C A;  3OEL A;  2AL4 A;  3E3K A;  4EUO A;  3MAM A;  1OLA A;  5L9O A;  2F6G A;  3GBA A;  3S9E A;  1BP5 A;  1BKA A;  1MPC A;  2XD3 A;  1VSO A;  3PPR A;  3PUV E;  1QW0 A;  1GGG A;  4H0W A;  3BFT A;  4OEN A;  2I49 A;  1QKA A;  3O2A A;  4KHZ E;  1LGB C;  3FGS A;  4RJZ A;  3UA8 A;  3UP9 A;  1MRP A;  1XC1 A;  4O3C A;  1LFH A;  3RT8 A;  3MW0 A;  3IAZ A;  1B5H A;  3FVO A;  3LBS A;  3O97 A;  3RGY A;  1LAF E;  1Y4C A;  3KOS A;  3R6U A;  4F29 A;  5A5X B;  4BDM A;  3FXU A;  5K2X A;  4F3B A;  4PP0 A;  4PFY A;  3N94 A;  3ZKL A;  4GXA A;  2QMW A;  2A5S A;  2OK2 A;  3BBR A;  4R6Y A;  2Q89 A;  3H03 A;  2VD2 A;  4EQB A;  3MPK A;  4G68 B;  1I69 A;  1M5B A;  2I58 A;  2CZL A;  4ISU A;  4R75 A;  4RK9 A;  2QS3 A;  3EHT A;  1MS7 A;  3KN3 A;  4OER A;  3CG3 A;  5JTY B;  1MM6 A;  2I0B A;  4E0W A;  1UQW A;  2XHD A;  2O1L A;  3MZB A;  3TZA A;  4YKP A;  3FJM A;  1LBB A;  5DVJ A;  2O1M A;  1VR5 A;  3T9U A;  4PET A;  3DP4 A;  1A8E A;  4MFI A;  4OFO A;  3B6T A;  1I6B A;  2F34 A;  1US5 A;  3K4U A;  3M3L A;  2AYS A;  1B5I A;  1VE4 A;  2OLB A;  3H6W A;  3O9P A;  3PD8 A;  1P1U A;  4IY6 A;  3K0V A;  4LUB A;  4QSC A;  3I3V A;  4WEP A;  5FHN A;  2REG A;  4F1Y A;  5AA4 B;  3O28 A;  2DS9 A;  2Z23 A;  4N13 A;  4BDO A;  4U23 A;  3MZ1 A;  5CMB A;  2G93 A;  4ZE9 A;  4UA8 A;  3QUF A;  3ODB A;  4POW A;  3S9M C;  1EU8 A;  2HAV A;  1S7Y A;  5H8F A;  1H3D A;  1MDP 1;  2G29 A;  4H5F A;  3H4Z A;  4QFK A;  4YAH X;  2X26 A;  3EF7 A;  3K00 A;  3MVX A;  4H8J A;  4KD5 A;  3IOW A;  4OWD A;  1B51 A;  3T66 A;  3D4G A;  2PYY A;  2H98 A;  3TDJ A;  2QS4 A;  3PUX E;  4HW8 A;  4F39 A;  1GR2 A;  1FQE A;  3RY3 A;  1B32 A;  3SER A;  4OVJ A;  3BKI B;  1N76 A;  1A7L A;  5J1D A;  4F22 A;  2F35 A;  1KWH A;  2DSF A;  1IIT A;  4IO4 A;  4U4X A;  1FQD A;  1MXY A;  2V84 A;  2R9J A;  4N07 A;  5ITP A;  1S9T A;  1CB6 A;  3PMX A;  3U94 A;  3C33 A;  5TPA A;  4BDN A;  4OFJ A;  3VDF A;  4TQU Q;  1GTK A;  4OTE A;  1HSL A;  3H6V A;  1H76 A;  1NNT A;  4I8C A;  1IXG A;  3W15 C;  1OVB A;  4GL8 A;  1B9J A;  1IXC A;  1M5F A;  2HZL A;  3VVD A;  1DTG A;  4MLV A;  1EZ9 A;  4KCC A;  4H65 A;  4ESX A;  5I56 A;  4WXJ A;  3H6U A;  3IX1 A;  3SEV A;  2OJT A;  1DTZ A;  1SW1 A;  3V8X B;  5JTY A;  3T9V A;  1Y4T A;  1Q35 A;  3U72 A;  3VXC A;  1LB9 A;  3WAF A;  2VHA A;  1B40 A;  1PB8 A;  4G68 A;  1EZP A;  5EHS A;  4G2Z A;  1MY2 A;  1DOT A;  3V83 A;  1A99 A;  1FTO A;  2Z22 A;  2Z8D A;  1B3F A;  5K2Y A;  5CBR A;  3K1N A;  4KI0 E;  5A5X A;  5AA2 A;  1N7X A;  3F11 A;  3O6G A;  4NF4 B;  1IEJ A;  3DLN A;  4NMY A;  4QFL A;  4R2F A;  1RYX A;  3TFL A;  4DXC A;  1LCF A;  3G3J A;  4OEU A;  4IO6 A;  4KYS A;  3S9N C;  5H8N B;  1FQB A;  3M3K A;  3R7X A;  3LSL A;  1NNP A;  3DM0 A;  2CMO A;  3GXA A;  1R6Z A;  2XX8 A;  3HHF A;  3L6G A;  4QFO A;  3TUS A;  3OXN A;  1D3K A;  3K6W A;  1IUD A;  1Y20 A;  4NE4 A;  1B3H A;  1ZLQ A;  2KLF A;  2DE4 A;  3KZG A;  4ZEB A;  1FQF A;  1II5 A;  1SVX B;  1XT8 A;  5H8N A;  1MXU A;  4OQO A;  2QSX A;  4I1D A;  2XXU A;  4U1O A;  2PMS A;  1H44 A;  3PUW E;  4LA9 A;  2DQV A;  4NF4 A;  4R72 A;  4ZEK A;  5AA2 B;  1UIU A;  5I2N A;  2ZNT A;  4ZS9 A;  3ZS6 A;  3RTW B;  3IB0 A;  4IGR A;  4OET A;  4DCX A;  3Q27 A;  1Y3N A;  3USD A;  4I9D A;  1JNF A;  1B46 A;  2Y84 A;  1URG A;  4MBP A;  2Q9T A;  2XXX A;  3RT6 B;  5AA2 D;  2H4I A;  3K6V A;  3SEW A;  1WDN A;  3SKP A;  2V93 A;  4IB2 A;  2UYF A;  1J1N A;  4AB5 A;  1S50 A;  1YPN A;  1NFT A;  3N5L A;  1N3W A;  3DEL B;  5I56 B;  5I59 A;  1JW5 A;  5I58 B;  3KJ7 A;  2A5T A;  3T22 A;  1D9Y A;  2UXA A;  1BTJ A;  3CIJ A;  1SQY A;  3E13 X;  5ELV A;  4R9G A;  4Z0I A;  4DZ1 A;  1AL3 A;  1MPB A;  3OMB A;  4F19 A;  2HZK A;  1US4 A;  4OXV A;  3QSL A;  2Y7I A;  1VFD A;  3P7I A;  3LSW A;  3PPQ A;  3B6Q A;  2I4B A;  2V3Q A;  5TPA B;  4BDL A;  2AIX A;  4BLA A;  4H6D A;  1SD3 A;  1Z7N E;  3N6U A;  1LFG A;  2V3T A;  1HSJ A;  2NOO A;  3DP6 A;  4HCW A;  5DTB A;  5AE4 A;  2Q2A A;  1LB8 A;  3M8U A;  3EN3 A;  1GVC A;  2GRV A;  1LST A;  4M1V A;  3T9H B;  4C0R A;  1N04 A;  1N84 A;  2ZMB A;  3FXQ A;  3K6U A;  1ZJL A;  1PB7 A;  4LZ8 A;  3WAE A;  1NNF A;  1NL5 A;  4ELO A;  4OZ9 A;  1MY4 A;  4OMB A;  4LAT A;  1AH5 A;  4X48 A;  2ZYO A;  1P1N A;  5IKB A;  2RC8 A;  3KSX A;  4G68 C;  1I6A A;  1M5D A;  1Y9U A;  1IQ7 A;  2BJJ X;  2F6P A;  4FED A;  3VV5 A;  4F31 B;  4FEB A;  3O29 A;  4XKP A;  5H8F B;  4LVQ A;  2QJE A;  1NKX A;  4NF8 B;  2YJP A;  4ND9 A;  1YTV A;  4GFR A;  1B4Z A;  2PBW A;  4R73 A;  2ALU A;  5TU0 A;  2RC7 A;  5JK4 A;  4NED A;  4BDQ A;  2HCA A;  2F78 A;  3OSR A;  5AA4 A;  5L9S A;  3C36 A;  4RXL A;  3TCF A;  3EQ1 A;  2OWT A;  3C34 A;  3K02 A;  1ZTY A;  5L9M A;  5BWJ A;  4GD5 A;  1RYO A;  3PPP A;  3BFU A;  4KYE A;  3PD9 A;  4MLQ A;  1H45 A;  1B1X A;  1ZMG A;  2HEU A;  3G7W A;  3MC2 A;  4H67 A;  3TTM A;  1TFD A;  4P0G A;  3ZSF A;  1ZBM A;  4E0X A;  4ELP A;  3W9W A;  3UOR A;  1EZO A;  4MH5 A;  3VLW A;  3KOT A;  2IEE A;  2RCB A;  3C35 A;  3FV2 A;  4RA1 A;  4THI A;  5IAI A;  4H8I A;  1URS A;  4F2O A;  3S9L C;  4OYV A;  1QJM A;  2NXO A;  3IOU A;  3PMV A;  1QUK A;  4JWY A;  5DYH A;  3HV1 A;  2FNC A;  2OCU A;  1BLF A;  3VFJ A;  3VXB A;  3CI8 A;  2H5Y A;  2ONK E;  3JZJ A;  3GZG A;  4RPN A;  3MP1 A;  4NTL A;  2IA4 A;  1XOC A;  5AA3 A;  4FEC A;  1LFI A;  1UTB A;  3IO6 A;  1A8F A;  3W9V A;  3B6W A;  4Q5T A;  5ISU A;  3MVZ A;  3IOR A;  3EHS A;  4LP2 B;  2QS1 A;  1LLS A;  3N26 A;  4C1T A;  4TLL B;  3G3K A;  3GBB A;  4F3S A;  2FYI A;  3KGC A;  4IO7 A;  3K01 A;  3FV1 A;  3HO7 A;  1MXW A;  3Q25 A;  4GRK A;  4KYD A;  4YKJ A;  1MQJ A;  4F2Q A;  1JQF A;  3MUQ A;  4TLM B;  3A09 A;  5DT6 A;  2ABH A;  1SYI A;  2UVH A;  4TOZ A;  3IOT A;  3IB1 A;  1R1N A;  2O7U A;  4MF3 A;  5EHM A;  4BDR A;  4QHQ A;  5F1Q A;  3TYH A;  4P0I A;  4R2B A;  4QRZ A;  3PMW A;  2DYX A;  3TQL A;  1SI0 A;  1UTH A;  1MH4 A;  4G4P A;  4YKI A;  5CMK A;  3TAJ A;  2RF1 A;  2XXT A;  3B7D A;  2XX9 A;  4LQ2 A;  2E1S A;  4DIG A;  3LSF B;  3ECR A;  3UN6 A;  4QSD A;  3VVF A;  4ZED A;  3OEN A;  3CSG A;  4AB6 A;  2OBG A;  4K3F A;  1JET A;  2REJ A;  4Q30 B;  1MQH A;  4EF2 A;  3TPA A;  5KDT B;  1SI1 A;  1NMU A;  3LC8 A;  3IL1 B;  3MPL A;  1PC3 A;  3PU5 A;  1AOV A;  4FAJ A;  4GVO A;  1QUJ A;  4G8N A;  4F3P A;  2O51 A;  1PBQ A;  2GHB A;  3ONM A;  5DEX B;  5TP9 A;  5I57 B;  1N0T A;  4POX A;  4YKK A;  1QUL A;  4IO3 A;  1QKB A;  2W7Y A;  1B5J A;  2ZYK A;  4XKN A;  1O64 A;  2QPQ A;  1JVX A;  4NWC A;  4JSD A;  2DWI A;  2NWJ A;  3IJX B;  2O68 A;  4JSO A;  2UVG A;  4OEV A;  5FHO A;  2YPN A;  3KBR A;  4U4S A;  2P2A A;  2VOZ A;  4YMB A;  1LCT A;  3UIF A;  3MVY A;  2X7P A;  4NF5 B;  1RKM A;  1B0H A;  2HFB A;  2THI A;  3IK6 B;  2V3U A;  3JYR A;  2F7C A;  2I3V A;  2O84 X;  4GL0 A;  1F9B A;  1Z7M E;  2Y7K A;  1ATG A;  2D3I A;  3C32 A;  1H43 A;  1DMB A;  4F1U A;  1ZIU A;  3FJG A;  1ELJ A;  4JBZ A;  5LOM A;  2ZXT A;  1B52 A;  3QK6 A;  4X1B A;  1B58 A;  3U8Q A;  2UVI A;  3FAS A;  1B1H A;  4G8H A;  4ZEF A;  2DWH A;  3HPI A;  2WKY A;  3K2D A;  1FTJ A;  5ITO A;  5CC2 A;  4QFP A;  1XVY A;  5M2V A;  1B7Z A;  3E4R A;  3FVG A;  3MP8 A;  2QRY A;  5H8H A;  3TTR A;  1SDX A;  3MP6 A;  1P99 A;  2NVU B;  1I6Q A;  3PPO A;  3QUJ A;  1M5E A;  2RIN A;  2I4C A;  4ONY A;  4ZZE A;  4IO2 A;  1MXX A;  3RNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...