2FNCA

Thermotoga maritima maltotriose binding protein bound with maltotriose.
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
379
structure length
379
Chain Sequence
KLTIWCSEKQVDILQKLGEEFKAKYGIPVEVQYVDFGSIKSKFLTAAPQGQGADIIVGAHDWVGELAVNGLIEPIPNFSDLKNFYDTALKAFSYGGKLYGVPYAMEAVALIYNKDYVDSVPKTMDELIEKAKQIDEEYGGEVRGFIYDVANFYFSAPFILGYGGYVFKETPQGLDVTDIGLANEGAVKGAKLIKRMIDEGVLTPGDNYGTMDSMFKEGLAAMIINGLWAIKSYKDAGINYGVAPIPELEPGVPAKPFVGVQGFMINAKSPNKVIAMEFLTNFIARKETMYKIYLADPRLPARKDVLELVKDNPDVVAFTQSASMGTPMPNVPEMAPVWSAMGDALSIIINGQASVEDALKEAVEKIKAQIEKGSHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords maltose ABC transporter, periplasmic maltose-binding protein
publication title The crystal structure of redundant maltotriose binding proteins from the thermophile Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Sugar binding protein
total genus 124
structure length 379
sequence length 379
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2fncA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2fncA01
4H0WA 2Y7RA 1LB9A 4OHNA 1B1XA 1AL3A 4ZECA 1P1NA 3ILTB 1N76A 1Y3PA 5EHMA 2VD3A 1D3KA 4YU0A 5ITPA 2PYYA 3H03A 2ABHA 4N13A 4LZ5A 1B05A 4IY6A 3QSLA 1LFHA 4QFOA 4F29A 5CC2A 1D4NA 5I59A 3FATA 3PGFA 1PB7A 4P0GA 2XXRA 2O1LA 2XD2A 4Z0IA 1PC3A 2UXAA 4FECA 4O3AA 3PPNA 3VE1B 1LBCA 1O64A 3EF7A 5I57B 2Q8JA 1A8FA 4IGRA 2GHAA 3KN3A 2OZZA 2V3UA 4OYVA 1CE2A 1MQIA 3KFMA 3N26A 1OQGA 1XOCA 3KJ7A 2OJTA 4GD5A 3G3HA 2F6GA 4ELQA 3K6XA 1FQDA 5CI5A 5I2KA 4JSDA 1AH5A 2CMOA 2F78A 3VDFA 3DELB 4YKPA 3SDFA 1O63A 2V25A 2R9JA 2PVUA 1MM7A 4QHQA 4O3CA 2V84A 3LSLA 1DTZA 3OSRA 3W9WA 3SEXA 4LP2B 1XT8A 4RK9A 1Y3QA 4NF8A 4ELOA 3GBAA 3VLWA 4NF4B 4NWDA 3KJTA 4U1OA 2O51A 1HSJA 2Y7PA 4RYAA 1A54A 4NWCA 3PU5A 5I84A 2F7AA 1B4ZA 4BDOA 1B51A 1OLAA 4EXKA 3EHSA 3ONMA 4F31B 5LOMA 5J1DA 2QS2A 3B6QA 4XKQA 4IB2A 3ECRA 3K1MA 2UVIA 4OVJA 2UYEA 3M3LA 2Q9TA 3IJXB 2ALUA 1MXUA 2THIA 4YZZA 1IXHA 2XXYA 2ONKE 4Q30B 4H5FA 3RQTA 4ELRA 1IUDA 1B3FA 1O7TA 1BLFA 3LSWA 4OFLA 1Z7ME 1IQ7A 1ANFA 1IIWA 3CIJA 4R2BA 5A5XA 1Y1MA 3D4CA 1BTJA 1ATGA 1QULA 4KI0E 2PMSA 4OXVA 3G3KA 1WVJA 5F7VA 4POWA 2XXHA 1B0HA 3MZBA 4ECFA 3GBBA 3ODBA 4DXBA 5KZTA 1US5A 1LGBC 3B6TA 3A09A 3C33A 3E4RA 3VVEA 3HCQA 3O6HA 1SW1A 2BJJX 2G29A 2RC9A 3E9XA 3OEMA 4IO3A 1NNPA 1ZBMA 2XXVA 5K2YA 3MUQA 4ZZEA 5ELVA 3E3KA 3SESA 1PB8A 4HW8A 2I58A 3FASA 4YMAA 3PUVE 1R9LA 1N84A 1UTBB 5ISUA 3PUXE 4XKPA 3PD8A 4EDPA 4IY5A 3RN8A 1LAFE 5HM4B 2I0BA 2ZNUA 4AB5A 1MY4A 2AYSA 3JV9A 3CI8A 1S9TA 4RNSA 4AB6A 3TPAA 3FJGA 4F3SA 1LCTA 4XIGQ 1ZU0A 1JVXA 3K00A 4PQJA 1SI1A 1MDP1 3FVGA 2DOJA 3U72A 3C35A 2ZYKA 3MBPA 5H8HB 3OENA 2ANJA 1EH3A 4K3FA 4M1VA 5L9OA 1M5CA 4TLLB 3KN7A 1PEBA 3PMWA 1A8EA 1FTMA 1Y1ZA 4GQOA 3FIRA 4QFKA 2F8DA 3FVNA 3IB2A 3OSQA 1FTKA 1BP5A 2P2AA 5H8NA 4QFLA 1XHYA 4FEDA 2UVJA 3O6GA 4I9DA 3IORA 5TP9A 2XXQA 4FJPA 1A7LA 1JEVA 3GLBA 3N6UA 4GIZA 3MPKA 4XXUA 2O7UA 5AA4A 1USYE 3DP8A 5EYFA 3N5LA 4QSEA 4F3GA 1M5BA 1N7XA 4KYDA 4THIA 2HQ0A 4DIGA 2FYIA 4EF1A 3K6WA 1I6AA 4I8CA 3T93B 4MF3A 2RINA 4G8HA 4OQOA 1D9YA 1FQAA 3TEPA 2H99A 2Z8EA 3H4ZA 1SI0A 2XX7A 4LVQA 5I58A 3THIA 4TOZA 4G4PA 4LQ2A 5DVFA 3TYHA 1FQCA 2AL5A 3FVKA 2HEUA 4ISUA 4OESA 5DEXB 4P0IA 4H1XA 4ZZAA 1A99A 3UA8A 3C36A 3MZ9A 4PFYA 3K01A 1B52A 4G8MA 1MY1A 4LUBA 5BWJA 4N6PA 4LQ5A 4KD5A 4R72A 1ZIUA 4QFPA 2DS9A 2GHBA 1P1OA 1RKMA 3GZGA 2A5SA 3CVGA 2DQVA 2IEEA 1LB8A 3TTKA 3HV1A 1ZKBA 4PFWA 4R73A 5DT6A 3PPOA 1JNFA 2P1SA 3FV1A 3IL1B 1UIVA 2ZMBA 3C32A 1FQBA 3MVXA 3O66A 1A40A 1F9BA 1DMBA 4NF5A 4G68A 1MPCA 2O1MA 2LAOA 1RYOA 4U4SA 1UIUA 3RPWA 5CMBA 2F36A 4F18A 4RA1A 4R6YA 3L6HA 4JWOA 1MH3A 2DYXA 5HBCA 3TUSA 2QJEA 1MDQA 2PT2A 5ICQA 5H8QA 2O84X 5H8SA 3A3UA 5CBSA 1Z7NE 2DE3A 3O9PA 3CG3A 2GH9A 3WAEA 2XX8A 2ONSA 4LONB 2HCAA 2Z23A 4YICA 1QUIA 1Q1KA 3R6UA 2E0SA 4F39A 1SD3A 2Q2AA 4KYSA 4R2FA 1UTHA 2I4CA 1JQFA 2NOOA 1IEJA 4NTLA 3QXMA 1QJMA 1FQFA 4ELPA 4JWYA 3FV2A 2I48A 3MZ1A 1H43A 5L9MA 3IOWA 2CZLA 3B7DA 1IXCA 4U21A 1URSA 3TCGA 3Q25A 4E0XA 4WEPA 1MH4A 1N0TA 1NMUA 4H5GA 3K4UA 2XHDA 4IO7A 1M5EA 3K1NA 2F97A 3FD3A 4U23A 2XXTA 2I3VA 2Q88A 3S2VA 2REJA 1OVBA 2Y7IA 2IA4A 1TT1A 3V83A 2F7CA 4IO2A 1Q35A 1IZ1A 3IK6B 3OELA 3USDA 4GWOA 3CFXA 4EXLA 1P99A 5KDTB 4KPTA 3V89B 5I57A 5I2KB 5FTHA 1GV8A 2B3BA 5AA2B 1DOTA 3PMVA 2UVGA 4OMBA 3TQWA 3T9VA 4KCCA 2ZXTA 1R1NA 3EHUA 4KFQA 3DM0A 5TPAB 3MVWA 3VLUA 3FXQA 3FGSA 2PBWA 2I49A 4P11A 1AMFA 1HSEA 3PD9A 1YAEA 3HO7A 5FHMA 1XS5A 1N7WA 4GLIA 3U92A 4F3PA 1QKAA 4F1VA 1B40A 2NUVA 3HN0A 1I69A 3KOTA 4QSDA 4BLAA 1MQDA 4NF4A 4OENA 5AA3A 4ZDMA 4OEVA 3LSXA 3K0VA 2ZNSA 2RCAA 4PETA 1PB9A 2OK2A 3TELA 1J1NA 3UIFA 4FEBA 1POTA 4ZEIA 4Q8RA 1M5FA 2XXWA 2QSXA 3MP1A 3IOVA 1SYHA 1AIVA 3DP4A 3I5OA 4HTGA 3RTFB 3DP6A 1OIBA 4M4GA 4H67A 4ESWA 4X9TA 1NH8A 1VFEA 4ZS9A 1P1QA 3H6WA 2DWHA 1B3GA 3CG1A 1CB6A 2XXUA 1LBBA 4G8NA 3QIMA 1YPNA 3PPRA 3ZS6A 1LSTA 4QF9A 3HHFA 4OWDA 3PV0E 5F1QA 2X7PA 2B65A 2OBGA 1GR2A 3RTWB 3TODA 4MFIA 4N07A 4G68C 4IO6A 1MQGA 1B5JA 1PBPA 4POXA 3KGCA 4RXLA 3IOUA 1MXZA 3RUMA 1YTVA 2V3TA 2VD2A 3N6TA 1QUKA 5TU0A 1L5TA 4I1DA 1B46A 4DDDA 4EQBA 5AE4A 1UTBA 1M5DA 3S9LC 3HHGA 1LAHE 1D9VA 1MM6A 1NNTA 3UP9A 1SBPA 3B6WA 5ICTA 3TTLA 1B5HA 4X1DA 4JWXA 1Y4TA 3G3FA 1Y9UA 3JZJA 4I62A 3VLVA 3U1OA 3MJNA 1WDNA 4RY1A 3SERA 3T66A 5AA2D 2FNCA 4R9GA 3LC8A 5JTYB 5H8HA 2YLNA 3HPIA 3SEUA 1OQHA 3E13X 4C1UA 1GVCA 1B7ZA 2HAVA 4U1ZA 1NH7A 3K02A 1Y20A 4NMYA 3BKIB 5AA1A 3C9HA 3EN3A 4Q5TA 2O69A 5FTIA 2Q89A 2XX9A 4GVOA 3T22A 1H45A 3OEKA 3KEIA 2O7IA 4G77A 4LZ8A 1LAXA 3MPLA 4YMBA 3K6VA 3KN8A 2R71A 3TFLA 2A5TB 1MXYA 1SW5A 2HZLA 2F34A 3M3KA 4NF6B 4QSCA 5FHNA 4PE5B 5I2NA 1MQJA 2DP8A 2M8CA 1B7HA 2V3QA 3R26A 3O6IA 3MVZA 5I58B 2F6PA 3KG2A 3SEVA 2RF1A 2XXXA 5IKBA 3RLFE 4OETA 1H44A 5FHOA 3KZGA 5DYHA 3TCHA 3PPQA 4EUOA 5H8FB 3KSXA 3U93A 4R9FA 3IO4A 3VFJA 2AIXA 1Y3NA 1SYIA 2GRVA 1JVYA 1II5A 1MY3A 4ZEBA 1MG1A 3UN6A 2RKMA 4H8IA 3KBRA 5I56B 3W15C 1JETA 5DEXA 3TKDA 1B58A 1H3DA 3Q29A 3LSFB 4MLVA 4DLDA 3N94A 1EZ9A 1FCKA 1SQYA 3VVFA 1UQWA 4DE8A 3I6VA 4BDLA 5DVJA 2I4BA 4KQPA 3M8UA 3OXNA 4DCYA 1TFDA 5B70A 4PFTA 4RPOA 2XXIA 4G2ZA 3Q26A 5KCJB 1MPDA 2DWJA 1USYH 3K1PA 3CR9A 2O6AA 3C4MA 4F1YA 2KLFA 3MP8A 3PPPA 4XKNA 4UA8A 4YKIA 4PP0A 1B32A 5CM6A 1MRPA 1ZJLA 3BFUA 3Q27A 3TZAA 1PBQA 1TFAA 3QYTA 4XKRA 3D4GA 3Q28A 4E0WA 1BIYA 4LATA 4DXUA 2YJPA 3EHTA 4L17A 3RT8A 3RY3A 3MAMA 5DTBA 4ZEDA 4GXAA 3U94A 1LFIA 3P7IA 4JBZA 4YB7A 1DPEA 3IB1A 1NNKA 3O28A 4DZ1A 2QPQA 4F1UA 4IO4A 1VR5A 4FIMA 3CSBA 2H9BA 1B3HA 3CFZA 3T96B 2R6GE 4LZ7A 1QKBA 2REGA 3KOSA 4Z7EA 4FE8A 2P0SA 3IX1A 3G7WA 1B3LA 4H6DA 1FTOA 5CMKA 5I59B 4ZE8A 1POY1 1ELJA 2Z8FA 1VE4A 3FJMA 3I3VA 3CRBA 3V5AA 4R74A 4DCXA 3S4UA 3K6UA 4U4XA 1N04A 3OOAA 1MXVA 5CBRA 4MH5A 2DXYA 4GFRA 5EHSA 3OD7A 1B9JA 4AQ4A 5K2XA 1KWHA 2D5WA 3QAXA 3FVOA 3TQLA 3PUZE 2OCUA 3MQ9A 4O3BA 2GFEA 1S7YA 4ZE9A 1LLSA 3H6UA 3OMBA 2H25A 3UK4A 4JSOA 3W9VA 2Z8DA 1B1HA 4WEDA 2VHAA 4GOTA 1QUJA 1BKAA 1IXIA 4BDQA 4YKKA 1ZMGA 5KDTA 2HFBA 2F7BA 1NL5A 3L6GA 1B0LA 4NE4A 5AA2A 3H06B 3O29A 1B3EA 3CSGA 4YB6A 5JK4A 2B3FA 1MXWA 4NF8B 1GTKA 5CMCA 4PFUA 3SEYA 5TPAA 2I0CA 1A55A 1JW5A 1URDA 1TXFA 3C34A 1FW0A 4BDRA 3M3FA 3RT6B 2F5XA 3SETA 3T9HB 1TWYA 4GRKA 3TMGA 4JDFA 2NXOA 3EPEA 3DLNA 3ZKKA 4UACA 3CFLA 1FTLA 4YKJA 2XXPA 3PMXA 3H6TA 3MVYA 2AL4A 2NWJA 2QS4A 2VGQA 1SW2A 4GL8A 1B2HA 1B7UA 1NKXA 3U8QA 1P1UA 3OO6A 4RPNA 3WAFA 3VVDA 1JEUA 4WKMA 2HXWA 1NFTA 4GL0A 5A5XB 3HSTA 5IAIA 4FAJA 3TTNA 2VOZA 2QMWA 3RNNA 3G3GA 1FQEA 3F11A 1N3WA 4BDNA 1DSNA 3MC2A 3VXBA 2UVHA 4OFJA 4NEDA 4HS7A 4F2QA 1VSOA 1IXGA 1QW0A 4EQ9A 3MWBA 3TAJA 2QL3A 3SEWA 4YAHX 2X26A 4YB5A 3LBSA 3H6VA 3C31A 1NNFA 3T9UA 4JB7A 5ITOA 1SW4A 4EF2A 3PUWE 2O68A 3MW0A 1GGGA 3S9NC 4HCWA 1SVXB 3H7MA 3ZKLA 3K2DA 1R9QA 1LAGE 2VP1A 2PX1A 2RCBA 2DSFA 2I6EA 3S9MC 3OO8A 5B7DA 3ZSFA 4MLQA 1MQHA 1RYXA 1VFDA 2E1SA 3FXRA 1XVYA 1B5IA 4H8JA 2QRYA 5JEIA 4KR5A 2UYFA 3FUZA 4DXCA 1JW4A 1OVTA 3PUYE 3O2AA 3G3IA 5CMMA 4ZEFA 2V93A 1MY2A 1R6ZA 4GXSB 2H4IA 4RK2A 2QS3A 4XTCQ 1MXXA 2Y7WA 2DE2A 1OLCA 4JXIA 5H8NB 2W7YA 4ESXA 2FA7A 3IJOB 1AOVA 3H3GA 5L8DA 5JTYA 2ZYOA 5TP9B 2HAUA 1IITA 1US4A 2ZYMA 1SDXA 5BUUA 2X7QA 2DWAA 4GF8A 5AA4B 2HZKA 5HPQA 4F3BA 3BBRA 3IO6A 3O97A 2NVUB 3TCFA 4EQ7A 1DTGA 5I2NB 3R7XA 4ZEKA 4IGTA 3S9EA 2PT1A 4C0RA 1EZPA 2DWIA 2I3WA 5M2VA 1DPPA 2ONRA 3FXUA 2A5TA 4KYEA 4ONYA 2RC8A 4NF6A 1B4HA 2OWSA 4IO5A 3QK6A 3KSJA 4OFOA 2RC7A 1H76A 3LR1A 4ND9A 5L9SA 2QS1A 1EZOA 4QFNA 1T0KA 2H5YA 3A3CA 1MPBA 4KHZE 2DVZA 4KCDA 4LA9A 1FTJA 1I6BA 3IOTA 1XVXA 3UORA 1ZLQA 3LUYA 3V8XB 3VV5A 4X1BA 2YPNA 4TQUQ 4OEUA 3JYRA 4HCYA 4H65A 3QUFA 5H8FA 2D3IA 1XC1A 3OO7A 1EU8A 4BDMA 3GXAA 4C1TA 4Q0CA 3QUJA 2ESNA 4FATA 2WKYA 1LFGA 1MY0A 3FZVA 3TTMA 5I56A 4U2RA 4TLMB 4X48A 2Y84A 2DE4A 4OZ9A 4F22A 4R75A 1QVSA 1URGA 2Z22A 4MBPA 4NF5B 4OERA 2F35A 4G68B 3TTRA 4R6HA 2D21A 1YCJA 2DVCA 1ZTYA 3MP6A 3VXCA 5DVIA 3RGYA 3BFTA 1OMPA 4OTEA 5CRYA 3AXFA 4U22A 1P1WA 1B6HA 3ILUB 5KCJA 4F19A 1S50A 2ZNTA 3OO9A 1Y4CA 3UGWA 2XD3A 4R6KA 4WXJA 2Q2CA 4FORA 2OWTA 1JW1A 5H8QB 4F2OA 1PDAA 1WODA 3TDJA 2G93A 2Y7KA 3IAZA 2H98A 2DXRA 1MS7A 1LCFA 2OLBA 1I6QA 4RJZA 4QRZA 3T9XB 3IR1A 1N3XA 2QMXA 1UTHB 3SKPA 1HSLA 3EQ1A 3IB0A 3FJ7A 2ZYNA 3G3JA
chains in the Genus database with same CATH superfamily
4H0WA 2Y7RA 1LB9A 4OHNA 1B1XA 4OA4A 1RDZA 1AL3A 4ZECA 1P1NA 3ILTB 1N76A 1Y3PA 5EHMA 2VD3A 1D3KA 4YU0A 5ITPA 2PYYA 3H03A 2ABHA 4N13A 4LZ5A 1B05A 4IY6A 3QSLA 1LFHA 4QFOA 4F29A 5CC2A 1D4NA 5I59A 3FATA 3PGFA 1PB7A 4P0GA 1FBHA 4O8MA 2XXRA 4NHBA 2O1LA 2XD2A 2WX9A 4Z0IA 1PC3A 1FJ9A 2UXAA 1FPJA 4FECA 4O3AA 3PPNA 3VE1B 2XA5A 1LBCA 1O64A 3EF7A 3A29A 5I57B 2Q8JA 1A8FA 4IGRA 2GHAA 3KN3A 2OZZA 2V3UA 4OYVA 1CE2A 1MQIA 3KFMA 3N26A 1OQGA 1XOCA 1KA1A 3KJ7A 2OJTA 4GD5A 3G3HA 2F6GA 4ELQA 3K6XA 1FQDA 5CI5A 5I2KA 4JSDA 1AH5A 2CMOA 2F78A 5I5PA 3VDFA 3DELB 4YKPA 2PFYA 3SDFA 1O63A 2PCRA 2V25A 2R9JA 2PVUA 4HE1A 1LBYA 1MM7A 4QHQA 4O3CA 2V84A 2Y5LA 3LSLA 1BK4A 1DTZA 3OSRA 3W9WA 3SEXA 4LP2B 1XT8A 4RK9A 1Y3QA 1EYIA 4NF8A 4ELOA 3GBAA 3VLWA 4NF4B 4NWDA 3KJTA 4U1OA 2O51A 1HSJA 2Y7PA 4RYAA 1A54A 4MEVA 4NWCA 3PTYA 3PU5A 1EYJA 5I84A 2F7AA 4N8GA 1B4ZA 4BDOA 1B51A 3FBPA 1OLAA 4EXKA 1NV2A 3EHSA 3ONMA 4F31B 5LOMA 5J1DA 4O7MA 2QS2A 3B6QA 4PAFA 4XKQA 4IB2A 3ECRA 3K1MA 2UVIA 2CZHA 4OVJA 2UYEA 3M3LA 1IMBA 2Q9TA 3IJXB 2ALUA 1MXUA 1DBZA 2THIA 2VPOA 4YZZA 1IXHA 3IFAA 2XXYA 2ONKE 4Q30B 4H5FA 3RQTA 4ELRA 1IUDA 1B3FA 1O7TA 1BLFA 1Q9DA 3LSWA 4OFLA 1Z7ME 1IQ7A 1ANFA 1IIWA 3CIJA 4R2BA 5A5XA 1Y1MA 1KZ8A 4QBAA 2FVZA 1BTJA 3D4CA 1ATGA 1QULA 4KI0E 2PMSA 4OXVA 3G3KA 1WVJA 5F7VA 4POWA 2XXHA 1B0HA 3MSTA 3MZBA 4ECFA 3GBBA 3ODBA 4DXBA 5KZTA 1US5A 4UABA 1LGBC 3B6TA 3A09A 3C33A 3E4RA 3VVEA 3HCQA 3O6HA 1SW1A 2BJJX 3RPLA 1FSAA 2G29A 2RC9A 3E9XA 3OEMA 4IO3A 1NNPA 1NV5A 1ZBMA 2XXVA 5K2YA 3MUQA 4ZZEA 5ELVA 3E3KA 3SESA 1PB8A 4HW8A 2I58A 4NAPA 3FASA 4YMAA 3PUVE 1R9LA 3IFCA 1N84A 1UTBB 5ISUA 3PUXE 4XKPA 3PD8A 4EDPA 4IY5A 4PF6A 3RN8A 1LAFE 4XEQA 5HM4B 4O7IA 2I0BA 2ZNUA 4AB5A 1MY4A 2AYSA 3JV9A 3CI8A 1S9TA 4RNSA 4AB6A 3TPAA 4GWSA 2XWKA 3FJGA 4F3SA 1LCTA 4XIGQ 1JVXA 1ZU0A 3K00A 5T3JA 1IMCA 4PQJA 1SI1A 1MDP1 3FVGA 2DOJA 3C35A 3U72A 2ZYKA 3MBPA 5H8HB 3OENA 2ANJA 1EH3A 4K3FA 4M1VA 5L9OA 1M5CA 2FIEA 4TLLB 3KN7A 1NV6A 1PEBA 3PMWA 1A8EA 4MNPA 1FTMA 1Y1ZA 4GQOA 3FIRA 4QFKA 2F8DA 3FVNA 3IB2A 3OSQA 1FTKA 1BP5A 2P2AA 5H8NA 4QFLA 4PFIA 1XHYA 4FEDA 2UVJA 3O6GA 2JJKA 4I9DA 3IORA 5TP9A 2XXQA 4FJPA 1A7LA 1JEVA 3GLBA 3N6UA 4GIZA 1NUWA 3MPKA 4XXUA 2O7UA 3RYDA 5AA4A 2QFLA 1USYE 3DP8A 5EYFA 4OVRA 3N5LA 4QSEA 4F3GA 4MX6A 1M5BA 1N7XA 4KYDA 5LDZA 1SPIA 4THIA 2HQ0A 4DIGA 1NV0A 2FYIA 4EF1A 3K6WA 5EQ8A 1FBFA 1I6AA 4I8CA 3T93B 2WBBA 4MF3A 2RINA 4G8HA 4OQOA 1D9YA 1FQAA 3TEPA 2CEYA 2H99A 2Z8EA 3H4ZA 1SI0A 2XX7A 4LVQA 5I58A 3THIA 4TOZA 4G4PA 1FBDA 4LQ2A 5DVFA 3TYHA 1FQCA 2AL5A 2OWZA 4N4UA 2GQ1A 3FVKA 2HEUA 4ISUA 4OESA 5DEXB 4P0IA 4NGUA 4H1XA 5EQAA 4ZZAA 5IZ1A 1A99A 3UA8A 3C36A 4MHFA 3MZ9A 4GWWA 4PFYA 3K01A 1B52A 4G8MA 1MY1A 4LUBA 5BWJA 4N6PA 4LQ5A 4P1EA 3BIHA 4KD5A 4R72A 1ZIUA 4QFPA 2DS9A 2GHBA 1P1OA 1RKMA 3GZGA 2A5SA 3CVGA 2DQVA 2IEEA 4GX4A 1LB8A 3TTKA 3HV1A 1ZKBA 4PFWA 4R73A 5DT6A 3PPOA 1JNFA 2P1SA 3FV1A 3IL1B 1UIVA 1AWBA 2ZMBA 3C32A 1FQBA 3MVXA 3O66A 1A40A 1F9BA 1DMBA 4NF5A 2MKZA 4G68A 1MPCA 2O1MA 2LAOA 5A5LA 1RYOA 4U4SA 1UIUA 3RPWA 5CMBA 2F36A 4F18A 3GYYA 4RA1A 4R6YA 3L6HA 4JWOA 1MH3A 5FBPA 2DYXA 5HBCA 5F24A 2B4LA 3TUSA 2QJEA 4AS5A 1MDQA 2PT2A 5ICQA 5H8QA 2O84X 5H8SA 3A3UA 5CBSA 1Z7NE 2DE3A 3O9PA 3CG3A 2GH9A 3WAEA 1NUXA 3QMFA 2XX8A 4OVPA 2ONSA 4LONB 2HCAA 2Z23A 4YICA 1FBPA 1QUIA 1Q1KA 3R6UA 2E0SA 4F39A 3T1BA 1SD3A 2Q2AA 4KYSA 4R2FA 1UTHA 2I4CA 1JQFA 2NOOA 4PCDA 1IEJA 4NTLA 1INPA 3QXMA 1QJMA 1FQFA 4ELPA 2CZIA 4JWYA 3FV2A 2I48A 3MZ1A 1H43A 5L9MA 5EQ7A 3IOWA 2CZLA 3B7DA 2WEFA 1IXCA 4U21A 1URSA 3TCGA 4OVQA 3Q25A 4E0XA 4WEPA 1LBVA 1MH4A 1N0TA 1NMUA 4H5GA 3K4UA 2CZKA 2XHDA 4IO7A 1M5EA 3K1NA 4PE3A 2F97A 3FD3A 4U23A 2XXTA 4X8RA 2I3VA 2XWIA 2Q88A 3S2VA 2REJA 1OVBA 2Y7IA 4I3EA 2Y5KA 2IA4A 1TT1A 3V83A 2F7CA 4IO2A 1Q35A 1IZ1A 3IK6B 3NOHA 3OELA 3USDA 4GWOA 4P1LA 3CFXA 4PDHA 1FBCA 4EXLA 1P99A 5KDTB 4KPTA 3V89B 5I57A 4N17A 5I2KB 4QXDA 5FTHA 1FPBA 5I3SA 1GV8A 2B3BA 5AA2B 1DOTA 3PMVA 2UVGA 4OMBA 3TQWA 3T9VA 4KCCA 2ZXTA 1R1NA 3EHUA 4KFQA 3DM0A 5TPAB 3MVWA 3VLUA 3FXQA 3FGSA 2PBWA 2I49A 4P11A 5J16A 1AMFA 1HSEA 3PD9A 1YAEA 4GWYA 3HO7A 5FHMA 1XS5A 2VT5A 4GBVA 1N7WA 4GLIA 3U92A 4F3PA 1QKAA 1KA0A 4F1VA 1B40A 2NUVA 3HN0A 1I69A 3KOTA 4QSDA 4BLAA 1MQDA 4NF4A 4OENA 5AA3A 2FIXA 4ZDMA 4OEVA 3LSXA 1IMAA 3K0VA 2ZNSA 2RCAA 4PETA 1PB9A 2OK2A 3TELA 1J1NA 1FBGA 3UIFA 4FEBA 4P56A 1POTA 4ZEIA 4Q8RA 1M5FA 2XXWA 2QSXA 3MP1A 3IOVA 3LUZA 1SYHA 1AIVA 3DP4A 1K9ZA 3I5OA 4HTGA 3RTFB 3DP6A 3B8BA 2PFZA 1OIBA 4M4GA 4H67A 4XFEA 4ESWA 4X9TA 1NH8A 1VFEA 4ZS9A 1P1QA 3H6WA 2DWHA 1B3GA 2ZZXA 5ESYA 3CG1A 1CB6A 2HPGA 3D1RA 2XXUA 1LBBA 4G8NA 3QIMA 1YPNA 3PPRA 3ZS6A 1LSTA 4QF9A 3HHFA 4OWDA 4GWXA 4N91A 3SZPA 4MIJA 3PV0E 5F1QA 1CNQA 1FTAA 2X7PA 2B65A 2OBGA 1GR2A 3RTWB 3TODA 4MFIA 4N07A 4G68C 4IO6A 1MQGA 1B5JA 1PBPA 4POXA 3U65A 4GX6A 3KGCA 4RXLA 5EYGA 3IOUA 1MXZA 3RUMA 1YTVA 2V3TA 2VD2A 3N6TA 1QUKA 5TU0A 1L5TA 4I1DA 1B46A 4DDDA 4EQBA 5AE4A 1UTBA 1M5DA 3S9LC 1FBEA 3HHGA 1LAHE 1D9VA 4PAIA 2HHMA 1MM6A 1NNTA 3UP9A 1SBPA 3B6WA 5ICTA 3TTLA 1FPFA 1B5HA 4X1DA 3E78A 4JWXA 1Y4TA 5ET7A 3G3FA 1Y9UA 3JZJA 4I62A 3VLVA 3U1OA 3MJNA 1WDNA 4RY1A 3SERA 2XWVA 3T66A 5AA2D 2FNCA 4R9GA 3LC8A 5JTYB 5H8HA 2YLNA 3HPIA 3SEUA 1OQHA 3E13X 1NV3A 4C1UA 1GVCA 5ET8A 1B7ZA 2HAVA 4U1ZA 1NH7A 3K02A 1Y20A 4NMYA 3BKIB 5AA1A 5EQ9A 3C9HA 4N6DA 3EN3A 4Q5TA 3CHGA 2O69A 5FTIA 2Q89A 2XX9A 4GVOA 3T22A 1H45A 3OEKA 3KEIA 2O7IA 4MJOA 4G77A 4GBWA 4LZ8A 1LAXA 3MPLA 4YMBA 4MMPA 4P9KA 1DK4A 3K6VA 4KXPA 3KN8A 1XI6A 2R71A 2QVUA 3TFLA 2A5TB 1MXYA 1SW5A 2HZLA 2F34A 3M3KA 4NF6B 4QSCA 2KR0A 4AS4A 5FHNA 4PE5B 5I2NA 1MQJA 1QGXA 2DP8A 2M8CA 1B7HA 2V3QA 3R26A 3O6IA 3MVZA 5I58B 2F6PA 3KG2A 4PFRA 3SEVA 2RF1A 2XXXA 5IKBA 3RLFE 4PBHA 4OETA 1H44A 5FHOA 2L5VA 3KZGA 5DYHA 3TCHA 3PPQA 4EUOA 5H8FB 3KSXA 3U93A 1NUYA 4R9FA 3IO4A 3VFJA 2AIXA 1LBXA 1Y3NA 1SYIA 2GRVA 1JVYA 5IZ3B 1II5A 1VDWA 1MY3A 4PC9A 4ZEBA 1MG1A 3UN6A 2RKMA 4H8IA 3KBRA 5I56B 3W15C 1JETA 5DEXA 3TKDA 1B58A 4H46A 1H3DA 3Q29A 4NN3A 3LSFB 4MLVA 4I3YA 4HE2A 4DLDA 3N94A 1EZ9A 1FCKA 4N6KA 1SQYA 1FPKA 3VVFA 1UQWA 4DE8A 3I6VA 4BDLA 5DVJA 2I4BA 4KQPA 3M8UA 3OXNA 4DCYA 2XWOA 1TFDA 5B70A 4PFTA 4RPOA 2XXIA 4G2ZA 3Q26A 5KCJB 1MPDA 2F3DA 4OVSA 2DWJA 1USYH 3K1PA 2XXKA 4DI3D 3CR9A 3MYUA 2O6AA 3C4MA 1FPGA 4F1YA 2KLFA 2VPNA 3MP8A 3PPPA 4XKNA 4UA8A 4YKIA 4PP0A 1B32A 5CM6A 1MRPA 1ZJLA 3BFUA 3Q27A 3TZAA 2Q8MA 1PBQA 1TFAA 3QYTA 4XKRA 1IMEA 3D4GA 3Q28A 4E0WA 1BIYA 4LATA 4DXUA 2YJPA 3EHTA 1YYZA 4L17A 3RT8A 3RY3A 3MAMA 5DTBA 4ZEDA 4GXAA 3U94A 1LFIA 3P7IA 4JBZA 4YB7A 4PFBA 1NUZA 1DPEA 3IB1A 1NNKA 3O28A 4DZ1A 2F3BA 2ZZVA 4NG7A 2QPQA 4F1UA 4IO4A 1VR5A 1LBZA 4FIMA 3CSBA 2H9BA 1B3HA 1JP4A 3CFZA 3T96B 2R6GE 4LZ7A 1QKBA 2REGA 3KOSA 4Z7EA 4FE8A 2P0SA 3IX1A 3EKIA 4PTKA 3G7WA 1G0IA 1B3LA 4H6DA 5ET6A 1FTOA 5CMKA 5I59B 4ZE8A 1POY1 4JVCA 1ELJA 2Z8FA 1VE4A 3FJMA 3I3VA 3CRBA 3V5AA 4JVIA 4R74A 4DCXA 3S4UA 2OX3A 3K6UA 4U4XA 1N04A 3OOAA 1MXVA 5CBRA 2QVVA 4MH5A 2DXYA 4GFRA 5EHSA 3OD7A 1B9JA 4AQ4A 5K2XA 1KWHA 2D5WA 3QAXA 5EYHA 1FRPA 3FVOA 4OANA 3TQLA 3PUZE 2OCUA 3MQ9A 4NF0A 4O3BA 4N81A 2GFEA 1S7YA 4ZE9A 1LLSA 3H6UA 3OMBA 2H25A 3UK4A 1FPLA 1LEVA 4JSOA 1RDYA 3W9VA 2Z8DA 1B1HA 4WEDA 2VHAA 4LN5A 4GOTA 1QUJA 1BKAA 2FBPA 1IXIA 4BDQA 5I7IA 4O94A 4YKKA 1ZMGA 5KDTA 2HFBA 2F7BA 1NL5A 4P47A 3L6GA 1B0LA 4NE4A 5AA2A 3H06B 3O29A 1B3EA 3CSGA 4YB6A 4PF8A 5JK4A 2B3FA 1MXWA 4NF8B 1GTKA 5CMCA 4PFUA 3SEYA 5TPAA 2I0CA 1A55A 1JW5A 1URDA 1TXFA 3C34A 1FW0A 4BDRA 3M3FA 3RT6B 2F5XA 3SETA 3T9HB 1TWYA 2Q74A 4GRKA 3TMGA 3T0JA 4JDFA 3KC0A 2NXOA 4PBQA 3EPEA 3DLNA 3ZKKA 4UACA 3CFLA 1YXIA 1FTLA 4YKJA 2XXPA 3PMXA 3H6TA 3MVYA 2AL4A 2NWJA 2QS4A 2VGQA 1SW2A 4H45A 4GL8A 3ROJA 1B2HA 1B7UA 1NKXA 3U8QA 1P1UA 3OO6A 4G61A 3HFUA 4RPNA 3WAFA 3VVDA 1JEUA 2P3VA 2HXWA 4WKMA 1NFTA 4GL0A 5A5XB 2FHYA 1FPIA 3HSTA 5IAIA 5LTCA 2QVRA 4FAJA 3TTNA 2VOZA 2QMWA 3RNNA 1K9YA 3G3GA 1FQEA 3F11A 1N3WA 4BDNA 1DSNA 3MC2A 3VXBA 2UVHA 4OFJA 3B50A 4NEDA 4HS7A 3E79A 4F2QA 4PGPA 1VSOA 1IXGA 1QW0A 5ET5A 3RPLB 4EQ9A 4P3LA 2P3NA 3MWBA 3TAJA 2QL3A 3SEWA 4YAHX 2X26A 4YB5A 1YZ0A 3LBSA 3H6VA 3C31A 1NNFA 3T9UA 4JB7A 5ITOA 1SW4A 4EF2A 3PUWE 2O68A 1D9QA 3MW0A 1GGGA 3S9NC 4HCWA 1SVXB 3H7MA 1NV4A 3ZKLA 3K2DA 1R9QA 1LAGE 2VP1A 2PX1A 2RCBA 3KC1A 2DSFA 2I6EA 3S9MC 4P8BA 3FXBA 1G0HA 3OO8A 5B7DA 2BJIA 3ZSFA 4MLQA 1MQHA 1RYXA 1VFDA 2E1SA 2CEXA 3FXRA 1XVYA 1B5IA 2KQZA 4H8JA 2QRYA 5JEIA 4MCOA 4KR5A 2UYFA 3FUZA 4DXCA 1JW4A 1OVTA 3PUYE 3O2AA 3G3IA 5CMMA 2WYKA 4ZEFA 2V93A 1MY2A 1R6ZA 4GXSB 2H4IA 4RK2A 2QS3A 4XTCQ 1MXXA 2Y7WA 2DE2A 1OLCA 4MNIA 4JXIA 5H8NB 2W7YA 4IR8A 4ESXA 2FA7A 3IJOB 1AOVA 3H3GA 5L8DA 5JTYA 2ZYOA 5TP9B 2HAUA 1IITA 1US4A 2ZYMA 4PAKA 1SDXA 5BUUA 2X7QA 2DWAA 4GF8A 5AA4B 2HZKA 5HPQA 4F3BA 3BBRA 3ISPA 3IO6A 3O97A 2NVUB 2WBDA 3TCFA 4EQ7A 1RDXA 1DTGA 2B4MA 5I2NB 3R7XA 1FJ6A 4ZEKA 1FPEA 4IGTA 3S9EA 2PT1A 4C0RA 1EZPA 2DWIA 2I3WA 4PDDA 5M2VA 1DPPA 2ONRA 3FXUA 4GX3A 1IMFA 2A5TA 4KYEA 3LV0A 4ONYA 2RC8A 4NF6A 1B4HA 2OWSA 4IO5A 3QK6A 3KSJA 4OFOA 2RC7A 1H76A 4JVDA 3LR1A 4ND9A 5L9SA 2QS1A 1EZOA 2V4CA 4QFNA 1NI9A 1T0KA 2DDKA 2H5YA 3A3CA 4GWUA 5IM2A 1MPBA 4KHZE 1FPDA 2DVZA 4KCDA 4LA9A 1FTJA 1I6BA 3IOTA 1XVXA 3UORA 1ZLQA 3LUYA 4I40A 3V8XB 3VV5A 4X1BA 2YPNA 4TQUQ 4OEUA 4NX1A 3JYRA 4HCYA 4H65A 3QUFA 5H8FA 2D3IA 1XC1A 3OO7A 5DW8A 1EU8A 4BDMA 3GXAA 5IZ3A 4C1TA 4Q0CA 3QUJA 2ESNA 4FATA 2WKYA 1LFGA 4OVTA 1MY0A 3FZVA 3TTMA 5I56A 4U2RA 4TLMB 4X48A 4N8YA 1NV1A 2Y84A 2DE4A 4OZ9A 4F22A 4R75A 1QVSA 1URGA 5IZZA 5IGAA 2Z22A 4MBPA 4NF5B 2R8TA 4OERA 1NV7A 2F35A 4G68B 3TTRA 4NQ8A 4R6HA 2D21A 1YCJA 1IMDA 2DVCA 1ZTYA 4MNCA 3MP6A 3VXCA 5DVIA 4PGNA 3BIGA 3RGYA 3BFTA 1OMPA 1DCUA 4OTEA 5CRYA 3AXFA 4U22A 1P1WA 1B6HA 3ILUB 5KCJA 4FBPA 4F19A 1S50A 2ZNTA 3OO9A 1Y4CA 4MAGA 4X04A 1EYKA 4GWZA 3UGWA 2XD3A 4R6KA 4WXJA 2Q2CA 4FORA 2OWTA 1JW1A 5H8QB 4F2OA 3KBZA 1PDAA 1WODA 3TDJA 2G93A 4N15A 2Y7KA 2HXRA 2ZZWA 1LBWA 3IAZA 4HXVA 2H98A 2DXRA 1MS7A 1LCFA 2OLBA 1I6QA 4RJZA 4QRZA 3IR1A 3T9XB 1N3XA 2QMXA 4DI4B 1UTHB 3SKPA 2WYPA 1HSLA 3EQ1A 3IB0A 3FJ7A 2ZYNA 4HE0A 4XF5A 3G3JA
chains in the Genus database with same CATH topology
4H0WA 2Y7RA 1LB9A 4OHNA 1B1XA 1AL3A 4ZECA 1P1NA 3ILTB 1N76A 1Y3PA 5EHMA 2VD3A 1D3KA 4YU0A 5ITPA 2PYYA 3H03A 2ABHA 4N13A 4LZ5A 1B05A 4IY6A 3QSLA 1LFHA 4QFOA 4F29A 5CC2A 1D4NA 5I59A 3FATA 3PGFA 1PB7A 4P0GA 2XXRA 2O1LA 2XD2A 4Z0IA 1PC3A 2UXAA 4FECA 4O3AA 3PPNA 3VE1B 1LBCA 1O64A 3EF7A 5I57B 2Q8JA 1A8FA 4IGRA 2GHAA 3KN3A 2OZZA 2V3UA 4OYVA 1CE2A 1MQIA 3KFMA 3N26A 1OQGA 1XOCA 3KJ7A 2OJTA 4GD5A 3G3HA 2F6GA 4ELQA 3K6XA 1FQDA 5CI5A 5I2KA 4JSDA 1AH5A 2CMOA 2F78A 3VDFA 3DELB 4YKPA 3SDFA 1O63A 2V25A 2R9JA 2PVUA 1MM7A 4QHQA 4O3CA 2V84A 3LSLA 1DTZA 3OSRA 3W9WA 3SEXA 4LP2B 1XT8A 4RK9A 1Y3QA 4NF8A 4ELOA 3GBAA 3VLWA 4NF4B 4NWDA 3KJTA 4U1OA 2O51A 1HSJA 2Y7PA 4RYAA 1A54A 4NWCA 3PU5A 5I84A 2F7AA 1B4ZA 4BDOA 1B51A 1OLAA 4EXKA 3EHSA 3ONMA 4F31B 5LOMA 5J1DA 2QS2A 3B6QA 4XKQA 4IB2A 3ECRA 3K1MA 2UVIA 4OVJA 2UYEA 3M3LA 2Q9TA 3IJXB 2ALUA 1MXUA 2THIA 4YZZA 1IXHA 2XXYA 2ONKE 4Q30B 4H5FA 3RQTA 4ELRA 1IUDA 1B3FA 1O7TA 1BLFA 3LSWA 4OFLA 1Z7ME 1IQ7A 1ANFA 1IIWA 3CIJA 4R2BA 5A5XA 1Y1MA 3D4CA 1BTJA 1ATGA 1QULA 4KI0E 2PMSA 4OXVA 3G3KA 1WVJA 5F7VA 4POWA 2XXHA 1B0HA 3MZBA 4ECFA 3GBBA 3ODBA 4DXBA 5KZTA 1US5A 1LGBC 3B6TA 3A09A 3C33A 3E4RA 3VVEA 3HCQA 3O6HA 1SW1A 2BJJX 2G29A 2RC9A 3E9XA 3OEMA 4IO3A 1NNPA 1ZBMA 2XXVA 5K2YA 3MUQA 4ZZEA 5ELVA 3E3KA 3SESA 1PB8A 4HW8A 2I58A 3FASA 4YMAA 3PUVE 1R9LA 1N84A 1UTBB 5ISUA 3PUXE 4XKPA 3PD8A 4EDPA 4IY5A 3RN8A 1LAFE 5HM4B 2I0BA 2ZNUA 4AB5A 1MY4A 2AYSA 3JV9A 3CI8A 1S9TA 4RNSA 4AB6A 3TPAA 3FJGA 4F3SA 1LCTA 4XIGQ 1ZU0A 1JVXA 3K00A 4PQJA 1SI1A 1MDP1 3FVGA 2DOJA 3U72A 3C35A 2ZYKA 3MBPA 5H8HB 3OENA 2ANJA 1EH3A 4K3FA 4M1VA 5L9OA 1M5CA 4TLLB 3KN7A 1PEBA 3PMWA 1A8EA 1FTMA 1Y1ZA 4GQOA 3FIRA 4QFKA 2F8DA 3FVNA 3IB2A 3OSQA 1FTKA 1BP5A 2P2AA 5H8NA 4QFLA 1XHYA 4FEDA 2UVJA 3O6GA 4I9DA 3IORA 5TP9A 2XXQA 4FJPA 1A7LA 1JEVA 3GLBA 3N6UA 4GIZA 3MPKA 4XXUA 2O7UA 5AA4A 1USYE 3DP8A 5EYFA 3N5LA 4QSEA 4F3GA 1M5BA 1N7XA 4KYDA 4THIA 2HQ0A 4DIGA 2FYIA 4EF1A 3K6WA 1I6AA 4I8CA 3T93B 4MF3A 2RINA 4G8HA 4OQOA 1D9YA 1FQAA 3TEPA 2H99A 2Z8EA 3H4ZA 1SI0A 2XX7A 4LVQA 5I58A 3THIA 4TOZA 4G4PA 4LQ2A 5DVFA 3TYHA 1FQCA 2AL5A 3FVKA 2HEUA 4ISUA 4OESA 5DEXB 4P0IA 4H1XA 4ZZAA 1A99A 3UA8A 3C36A 3MZ9A 4PFYA 3K01A 1B52A 4G8MA 1MY1A 4LUBA 5BWJA 4N6PA 4LQ5A 4KD5A 4R72A 1ZIUA 4QFPA 2DS9A 2GHBA 1P1OA 1RKMA 3GZGA 2A5SA 3CVGA 2DQVA 2IEEA 1LB8A 3TTKA 3HV1A 1ZKBA 4PFWA 4R73A 5DT6A 3PPOA 1JNFA 2P1SA 3FV1A 3IL1B 1UIVA 2ZMBA 3C32A 1FQBA 3MVXA 3O66A 1A40A 1F9BA 1DMBA 4NF5A 4G68A 1MPCA 2O1MA 2LAOA 1RYOA 4U4SA 1UIUA 3RPWA 5CMBA 2F36A 4F18A 4RA1A 4R6YA 3L6HA 4JWOA 1MH3A 2DYXA 5HBCA 3TUSA 2QJEA 1MDQA 2PT2A 5ICQA 5H8QA 2O84X 5H8SA 3A3UA 5CBSA 1Z7NE 2DE3A 3O9PA 3CG3A 2GH9A 3WAEA 2XX8A 2ONSA 4LONB 2HCAA 2Z23A 4YICA 1QUIA 1Q1KA 3R6UA 2E0SA 4F39A 1SD3A 2Q2AA 4KYSA 4R2FA 1UTHA 2I4CA 1JQFA 2NOOA 1IEJA 4NTLA 3QXMA 1QJMA 1FQFA 4ELPA 4JWYA 3FV2A 2I48A 3MZ1A 1H43A 5L9MA 3IOWA 2CZLA 3B7DA 1IXCA 4U21A 1URSA 3TCGA 3Q25A 4E0XA 4WEPA 1MH4A 1N0TA 1NMUA 4H5GA 3K4UA 2XHDA 4IO7A 1M5EA 3K1NA 2F97A 3FD3A 4U23A 2XXTA 2I3VA 2Q88A 3S2VA 2REJA 1OVBA 2Y7IA 2IA4A 1TT1A 3V83A 2F7CA 4IO2A 1Q35A 1IZ1A 3IK6B 3OELA 3USDA 4GWOA 3CFXA 4EXLA 1P99A 5KDTB 4KPTA 3V89B 5I57A 5I2KB 5FTHA 1GV8A 2B3BA 5AA2B 1DOTA 3PMVA 2UVGA 4OMBA 3TQWA 3T9VA 4KCCA 2ZXTA 1R1NA 3EHUA 4KFQA 3DM0A 5TPAB 3MVWA 3VLUA 3FXQA 3FGSA 2PBWA 2I49A 4P11A 1AMFA 1HSEA 3PD9A 1YAEA 3HO7A 5FHMA 1XS5A 1N7WA 4GLIA 3U92A 4F3PA 1QKAA 4F1VA 1B40A 2NUVA 3HN0A 1I69A 3KOTA 4QSDA 4BLAA 1MQDA 4NF4A 4OENA 5AA3A 4ZDMA 4OEVA 3LSXA 3K0VA 2ZNSA 2RCAA 4PETA 1PB9A 2OK2A 3TELA 1J1NA 3UIFA 4FEBA 1POTA 4ZEIA 4Q8RA 1M5FA 2XXWA 2QSXA 3MP1A 3IOVA 1SYHA 1AIVA 3DP4A 3I5OA 4HTGA 3RTFB 3DP6A 1OIBA 4M4GA 4H67A 4ESWA 4X9TA 1NH8A 1VFEA 4ZS9A 1P1QA 3H6WA 2DWHA 1B3GA 3CG1A 1CB6A 2XXUA 1LBBA 4G8NA 3QIMA 1YPNA 3PPRA 3ZS6A 1LSTA 4QF9A 3HHFA 4OWDA 3PV0E 5F1QA 2X7PA 2B65A 2OBGA 1GR2A 3RTWB 3TODA 4MFIA 4N07A 4G68C 4IO6A 1MQGA 1B5JA 1PBPA 4POXA 3KGCA 4RXLA 3IOUA 1MXZA 3RUMA 1YTVA 2V3TA 2VD2A 3N6TA 1QUKA 5TU0A 1L5TA 4I1DA 1B46A 4DDDA 4EQBA 5AE4A 1UTBA 1M5DA 3S9LC 3HHGA 1LAHE 1D9VA 1MM6A 1NNTA 3UP9A 1SBPA 3B6WA 5ICTA 3TTLA 1B5HA 4X1DA 4JWXA 1Y4TA 3G3FA 1Y9UA 3JZJA 4I62A 3VLVA 3U1OA 3MJNA 1WDNA 4RY1A 3SERA 3T66A 5AA2D 2FNCA 4R9GA 3LC8A 5JTYB 5H8HA 2YLNA 3HPIA 3SEUA 1OQHA 3E13X 4C1UA 1GVCA 1B7ZA 2HAVA 4U1ZA 1NH7A 3K02A 1Y20A 4NMYA 3BKIB 5AA1A 3C9HA 3EN3A 4Q5TA 2O69A 5FTIA 2Q89A 2XX9A 4GVOA 3T22A 1H45A 3OEKA 3KEIA 2O7IA 4G77A 4LZ8A 1LAXA 3MPLA 4YMBA 3K6VA 3KN8A 2R71A 3TFLA 2A5TB 1MXYA 1SW5A 2HZLA 2F34A 3M3KA 4NF6B 4QSCA 5FHNA 4PE5B 5I2NA 1MQJA 2DP8A 2M8CA 1B7HA 2V3QA 3R26A 3O6IA 3MVZA 5I58B 2F6PA 3KG2A 3SEVA 2RF1A 2XXXA 5IKBA 3RLFE 4OETA 1H44A 5FHOA 3KZGA 5DYHA 3TCHA 3PPQA 4EUOA 5H8FB 3KSXA 3U93A 4R9FA 3IO4A 3VFJA 2AIXA 1Y3NA 1SYIA 2GRVA 1JVYA 1II5A 1MY3A 4ZEBA 1MG1A 3UN6A 2RKMA 4H8IA 3KBRA 5I56B 3W15C 1JETA 5DEXA 3TKDA 1B58A 1H3DA 3Q29A 3LSFB 4MLVA 4DLDA 3N94A 1EZ9A 1FCKA 1SQYA 3VVFA 1UQWA 4DE8A 3I6VA 4BDLA 5DVJA 2I4BA 4KQPA 3M8UA 3OXNA 4DCYA 1TFDA 5B70A 4PFTA 4RPOA 2XXIA 4G2ZA 3Q26A 5KCJB 1MPDA 2DWJA 1USYH 3K1PA 3CR9A 2O6AA 3C4MA 4F1YA 2KLFA 3MP8A 3PPPA 4XKNA 4UA8A 4YKIA 4PP0A 1B32A 5CM6A 1MRPA 1ZJLA 3BFUA 3Q27A 3TZAA 1PBQA 1TFAA 3QYTA 4XKRA 3D4GA 3Q28A 4E0WA 1BIYA 4LATA 4DXUA 2YJPA 3EHTA 4L17A 3RT8A 3RY3A 3MAMA 5DTBA 4ZEDA 4GXAA 3U94A 1LFIA 3P7IA 4JBZA 4YB7A 1DPEA 3IB1A 1NNKA 3O28A 4DZ1A 2QPQA 4F1UA 4IO4A 1VR5A 4FIMA 3CSBA 2H9BA 1B3HA 3CFZA 3T96B 2R6GE 4LZ7A 1QKBA 2REGA 3KOSA 4Z7EA 4FE8A 2P0SA 3IX1A 3G7WA 1B3LA 4H6DA 1FTOA 5CMKA 5I59B 4ZE8A 1POY1 1ELJA 2Z8FA 1VE4A 3FJMA 3I3VA 3CRBA 3V5AA 4R74A 4DCXA 3S4UA 3K6UA 4U4XA 1N04A 3OOAA 1MXVA 5CBRA 4MH5A 2DXYA 4GFRA 5EHSA 3OD7A 1B9JA 4AQ4A 5K2XA 1KWHA 2D5WA 3QAXA 3FVOA 3TQLA 3PUZE 2OCUA 3MQ9A 4O3BA 2GFEA 1S7YA 4ZE9A 1LLSA 3H6UA 3OMBA 2H25A 3UK4A 4JSOA 3W9VA 2Z8DA 1B1HA 4WEDA 2VHAA 4GOTA 1QUJA 1BKAA 1IXIA 4BDQA 4YKKA 1ZMGA 5KDTA 2HFBA 2F7BA 1NL5A 3L6GA 1B0LA 4NE4A 5AA2A 3H06B 3O29A 1B3EA 3CSGA 4YB6A 5JK4A 2B3FA 1MXWA 4NF8B 1GTKA 5CMCA 4PFUA 3SEYA 5TPAA 2I0CA 1A55A 1JW5A 1URDA 1TXFA 3C34A 1FW0A 4BDRA 3M3FA 3RT6B 2F5XA 3SETA 3T9HB 1TWYA 4GRKA 3TMGA 4JDFA 2NXOA 3EPEA 3DLNA 3ZKKA 4UACA 3CFLA 1FTLA 4YKJA 2XXPA 3PMXA 3H6TA 3MVYA 2AL4A 2NWJA 2QS4A 2VGQA 1SW2A 4GL8A 1B2HA 1B7UA 1NKXA 3U8QA 1P1UA 3OO6A 4RPNA 3WAFA 3VVDA 1JEUA 4WKMA 2HXWA 1NFTA 4GL0A 5A5XB 3HSTA 5IAIA 4FAJA 3TTNA 2VOZA 2QMWA 3RNNA 3G3GA 1FQEA 3F11A 1N3WA 4BDNA 1DSNA 3MC2A 3VXBA 2UVHA 4OFJA 4NEDA 4HS7A 4F2QA 1VSOA 1IXGA 1QW0A 4EQ9A 3MWBA 3TAJA 2QL3A 3SEWA 4YAHX 2X26A 4YB5A 3LBSA 3H6VA 3C31A 1NNFA 3T9UA 4JB7A 5ITOA 1SW4A 4EF2A 3PUWE 2O68A 3MW0A 1GGGA 3S9NC 4HCWA 1SVXB 3H7MA 3ZKLA 3K2DA 1R9QA 1LAGE 2VP1A 2PX1A 2RCBA 2DSFA 2I6EA 3S9MC 3OO8A 5B7DA 3ZSFA 4MLQA 1MQHA 1RYXA 1VFDA 2E1SA 3FXRA 1XVYA 1B5IA 4H8JA 2QRYA 5JEIA 4KR5A 2UYFA 3FUZA 4DXCA 1JW4A 1OVTA 3PUYE 3O2AA 3G3IA 5CMMA 4ZEFA 2V93A 1MY2A 1R6ZA 4GXSB 2H4IA 4RK2A 2QS3A 4XTCQ 1MXXA 2Y7WA 2DE2A 1OLCA 4JXIA 5H8NB 2W7YA 4ESXA 2FA7A 3IJOB 1AOVA 3H3GA 5L8DA 5JTYA 2ZYOA 5TP9B 2HAUA 1IITA 1US4A 2ZYMA 1SDXA 5BUUA 2X7QA 2DWAA 4GF8A 5AA4B 2HZKA 5HPQA 4F3BA 3BBRA 3IO6A 3O97A 2NVUB 3TCFA 4EQ7A 1DTGA 5I2NB 3R7XA 4ZEKA 4IGTA 3S9EA 2PT1A 4C0RA 1EZPA 2DWIA 2I3WA 5M2VA 1DPPA 2ONRA 3FXUA 2A5TA 4KYEA 4ONYA 2RC8A 4NF6A 1B4HA 2OWSA 4IO5A 3QK6A 3KSJA 4OFOA 2RC7A 1H76A 3LR1A 4ND9A 5L9SA 2QS1A 1EZOA 4QFNA 1T0KA 2H5YA 3A3CA 1MPBA 4KHZE 2DVZA 4KCDA 4LA9A 1FTJA 1I6BA 3IOTA 1XVXA 3UORA 1ZLQA 3LUYA 3V8XB 3VV5A 4X1BA 2YPNA 4TQUQ 4OEUA 3JYRA 4HCYA 4H65A 3QUFA 5H8FA 2D3IA 1XC1A 3OO7A 1EU8A 4BDMA 3GXAA 4C1TA 4Q0CA 3QUJA 2ESNA 4FATA 2WKYA 1LFGA 1MY0A 3FZVA 3TTMA 5I56A 4U2RA 4TLMB 4X48A 2Y84A 2DE4A 4OZ9A 4F22A 4R75A 1QVSA 1URGA 2Z22A 4MBPA 4NF5B 4OERA 2F35A 4G68B 3TTRA 4R6HA 2D21A 1YCJA 2DVCA 1ZTYA 3MP6A 3VXCA 5DVIA 3RGYA 3BFTA 1OMPA 4OTEA 5CRYA 3AXFA 4U22A 1P1WA 1B6HA 3ILUB 5KCJA 4F19A 1S50A 2ZNTA 3OO9A 1Y4CA 3UGWA 2XD3A 4R6KA 4WXJA 2Q2CA 4FORA 2OWTA 1JW1A 5H8QB 4F2OA 1PDAA 1WODA 3TDJA 2G93A 2Y7KA 3IAZA 2H98A 2DXRA 1MS7A 1LCFA 2OLBA 1I6QA 4RJZA 4QRZA 3T9XB 3IR1A 1N3XA 2QMXA 1UTHB 3SKPA 1HSLA 3EQ1A 3IB0A 3FJ7A 2ZYNA 3G3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0W A;  2Y7R A;  1LB9 A;  4OHN A;  1B1X A;  1AL3 A;  4ZEC A;  1P1N A;  3ILT B;  1N76 A;  1Y3P A;  5EHM A;  2VD3 A;  1D3K A;  4YU0 A;  5ITP A;  2PYY A;  3H03 A;  2ABH A;  4N13 A;  4LZ5 A;  1B05 A;  4IY6 A;  3QSL A;  1LFH A;  4QFO A;  4F29 A;  5CC2 A;  1D4N A;  5I59 A;  3FAT A;  3PGF A;  1PB7 A;  4P0G A;  2XXR A;  2O1L A;  2XD2 A;  4Z0I A;  1PC3 A;  2UXA A;  4FEC A;  4O3A A;  3PPN A;  3VE1 B;  1LBC A;  1O64 A;  3EF7 A;  5I57 B;  2Q8J A;  1A8F A;  4IGR A;  2GHA A;  3KN3 A;  2OZZ A;  2V3U A;  4OYV A;  1CE2 A;  1MQI A;  3KFM A;  3N26 A;  1OQG A;  1XOC A;  3KJ7 A;  2OJT A;  4GD5 A;  3G3H A;  2F6G A;  4ELQ A;  3K6X A;  1FQD A;  5CI5 A;  5I2K A;  4JSD A;  1AH5 A;  2CMO A;  2F78 A;  3VDF A;  3DEL B;  4YKP A;  3SDF A;  1O63 A;  2V25 A;  2R9J A;  2PVU A;  1MM7 A;  4QHQ A;  4O3C A;  2V84 A;  3LSL A;  1DTZ A;  3OSR A;  3W9W A;  3SEX A;  4LP2 B;  1XT8 A;  4RK9 A;  1Y3Q A;  4NF8 A;  4ELO A;  3GBA A;  3VLW A;  4NF4 B;  4NWD A;  3KJT A;  4U1O A;  2O51 A;  1HSJ A;  2Y7P A;  4RYA A;  1A54 A;  4NWC A;  3PU5 A;  5I84 A;  2F7A A;  1B4Z A;  4BDO A;  1B51 A;  1OLA A;  4EXK A;  3EHS A;  3ONM A;  4F31 B;  5LOM A;  5J1D A;  2QS2 A;  3B6Q A;  4XKQ A;  4IB2 A;  3ECR A;  3K1M A;  2UVI A;  4OVJ A;  2UYE A;  3M3L A;  2Q9T A;  3IJX B;  2ALU A;  1MXU A;  2THI A;  4YZZ A;  1IXH A;  2XXY A;  2ONK E;  4Q30 B;  4H5F A;  3RQT A;  4ELR A;  1IUD A;  1B3F A;  1O7T A;  1BLF A;  3LSW A;  4OFL A;  1Z7M E;  1IQ7 A;  1ANF A;  1IIW A;  3CIJ A;  4R2B A;  5A5X A;  1Y1M A;  3D4C A;  1BTJ A;  1ATG A;  1QUL A;  4KI0 E;  2PMS A;  4OXV A;  3G3K A;  1WVJ A;  5F7V A;  4POW A;  2XXH A;  1B0H A;  3MZB A;  4ECF A;  3GBB A;  3ODB A;  4DXB A;  5KZT A;  1US5 A;  1LGB C;  3B6T A;  3A09 A;  3C33 A;  3E4R A;  3VVE A;  3HCQ A;  3O6H A;  1SW1 A;  2BJJ X;  2G29 A;  2RC9 A;  3E9X A;  3OEM A;  4IO3 A;  1NNP A;  1ZBM A;  2XXV A;  5K2Y A;  3MUQ A;  4ZZE A;  5ELV A;  3E3K A;  3SES A;  1PB8 A;  4HW8 A;  2I58 A;  3FAS A;  4YMA A;  3PUV E;  1R9L A;  1N84 A;  1UTB B;  5ISU A;  3PUX E;  4XKP A;  3PD8 A;  4EDP A;  4IY5 A;  3RN8 A;  1LAF E;  5HM4 B;  2I0B A;  2ZNU A;  4AB5 A;  1MY4 A;  2AYS A;  3JV9 A;  3CI8 A;  1S9T A;  4RNS A;  4AB6 A;  3TPA A;  3FJG A;  4F3S A;  1LCT A;  4XIG Q;  1ZU0 A;  1JVX A;  3K00 A;  4PQJ A;  1SI1 A;  1MDP 1;  3FVG A;  2DOJ A;  3U72 A;  3C35 A;  2ZYK A;  3MBP A;  5H8H B;  3OEN A;  2ANJ A;  1EH3 A;  4K3F A;  4M1V A;  5L9O A;  1M5C A;  4TLL B;  3KN7 A;  1PEB A;  3PMW A;  1A8E A;  1FTM A;  1Y1Z A;  4GQO A;  3FIR A;  4QFK A;  2F8D A;  3FVN A;  3IB2 A;  3OSQ A;  1FTK A;  1BP5 A;  2P2A A;  5H8N A;  4QFL A;  1XHY A;  4FED A;  2UVJ A;  3O6G A;  4I9D A;  3IOR A;  5TP9 A;  2XXQ A;  4FJP A;  1A7L A;  1JEV A;  3GLB A;  3N6U A;  4GIZ A;  3MPK A;  4XXU A;  2O7U A;  5AA4 A;  1USY E;  3DP8 A;  5EYF A;  3N5L A;  4QSE A;  4F3G A;  1M5B A;  1N7X A;  4KYD A;  4THI A;  2HQ0 A;  4DIG A;  2FYI A;  4EF1 A;  3K6W A;  1I6A A;  4I8C A;  3T93 B;  4MF3 A;  2RIN A;  4G8H A;  4OQO A;  1D9Y A;  1FQA A;  3TEP A;  2H99 A;  2Z8E A;  3H4Z A;  1SI0 A;  2XX7 A;  4LVQ A;  5I58 A;  3THI A;  4TOZ A;  4G4P A;  4LQ2 A;  5DVF A;  3TYH A;  1FQC A;  2AL5 A;  3FVK A;  2HEU A;  4ISU A;  4OES A;  5DEX B;  4P0I A;  4H1X A;  4ZZA A;  1A99 A;  3UA8 A;  3C36 A;  3MZ9 A;  4PFY A;  3K01 A;  1B52 A;  4G8M A;  1MY1 A;  4LUB A;  5BWJ A;  4N6P A;  4LQ5 A;  4KD5 A;  4R72 A;  1ZIU A;  4QFP A;  2DS9 A;  2GHB A;  1P1O A;  1RKM A;  3GZG A;  2A5S A;  3CVG A;  2DQV A;  2IEE A;  1LB8 A;  3TTK A;  3HV1 A;  1ZKB A;  4PFW A;  4R73 A;  5DT6 A;  3PPO A;  1JNF A;  2P1S A;  3FV1 A;  3IL1 B;  1UIV A;  2ZMB A;  3C32 A;  1FQB A;  3MVX A;  3O66 A;  1A40 A;  1F9B A;  1DMB A;  4NF5 A;  4G68 A;  1MPC A;  2O1M A;  2LAO A;  1RYO A;  4U4S A;  1UIU A;  3RPW A;  5CMB A;  2F36 A;  4F18 A;  4RA1 A;  4R6Y A;  3L6H A;  4JWO A;  1MH3 A;  2DYX A;  5HBC A;  3TUS A;  2QJE A;  1MDQ A;  2PT2 A;  5ICQ A;  5H8Q A;  2O84 X;  5H8S A;  3A3U A;  5CBS A;  1Z7N E;  2DE3 A;  3O9P A;  3CG3 A;  2GH9 A;  3WAE A;  2XX8 A;  2ONS A;  4LON B;  2HCA A;  2Z23 A;  4YIC A;  1QUI A;  1Q1K A;  3R6U A;  2E0S A;  4F39 A;  1SD3 A;  2Q2A A;  4KYS A;  4R2F A;  1UTH A;  2I4C A;  1JQF A;  2NOO A;  1IEJ A;  4NTL A;  3QXM A;  1QJM A;  1FQF A;  4ELP A;  4JWY A;  3FV2 A;  2I48 A;  3MZ1 A;  1H43 A;  5L9M A;  3IOW A;  2CZL A;  3B7D A;  1IXC A;  4U21 A;  1URS A;  3TCG A;  3Q25 A;  4E0X A;  4WEP A;  1MH4 A;  1N0T A;  1NMU A;  4H5G A;  3K4U A;  2XHD A;  4IO7 A;  1M5E A;  3K1N A;  2F97 A;  3FD3 A;  4U23 A;  2XXT A;  2I3V A;  2Q88 A;  3S2V A;  2REJ A;  1OVB A;  2Y7I A;  2IA4 A;  1TT1 A;  3V83 A;  2F7C A;  4IO2 A;  1Q35 A;  1IZ1 A;  3IK6 B;  3OEL A;  3USD A;  4GWO A;  3CFX A;  4EXL A;  1P99 A;  5KDT B;  4KPT A;  3V89 B;  5I57 A;  5I2K B;  5FTH A;  1GV8 A;  2B3B A;  5AA2 B;  1DOT A;  3PMV A;  2UVG A;  4OMB A;  3TQW A;  3T9V A;  4KCC A;  2ZXT A;  1R1N A;  3EHU A;  4KFQ A;  3DM0 A;  5TPA B;  3MVW A;  3VLU A;  3FXQ A;  3FGS A;  2PBW A;  2I49 A;  4P11 A;  1AMF A;  1HSE A;  3PD9 A;  1YAE A;  3HO7 A;  5FHM A;  1XS5 A;  1N7W A;  4GLI A;  3U92 A;  4F3P A;  1QKA A;  4F1V A;  1B40 A;  2NUV A;  3HN0 A;  1I69 A;  3KOT A;  4QSD A;  4BLA A;  1MQD A;  4NF4 A;  4OEN A;  5AA3 A;  4ZDM A;  4OEV A;  3LSX A;  3K0V A;  2ZNS A;  2RCA A;  4PET A;  1PB9 A;  2OK2 A;  3TEL A;  1J1N A;  3UIF A;  4FEB A;  1POT A;  4ZEI A;  4Q8R A;  1M5F A;  2XXW A;  2QSX A;  3MP1 A;  3IOV A;  1SYH A;  1AIV A;  3DP4 A;  3I5O A;  4HTG A;  3RTF B;  3DP6 A;  1OIB A;  4M4G A;  4H67 A;  4ESW A;  4X9T A;  1NH8 A;  1VFE A;  4ZS9 A;  1P1Q A;  3H6W A;  2DWH A;  1B3G A;  3CG1 A;  1CB6 A;  2XXU A;  1LBB A;  4G8N A;  3QIM A;  1YPN A;  3PPR A;  3ZS6 A;  1LST A;  4QF9 A;  3HHF A;  4OWD A;  3PV0 E;  5F1Q A;  2X7P A;  2B65 A;  2OBG A;  1GR2 A;  3RTW B;  3TOD A;  4MFI A;  4N07 A;  4G68 C;  4IO6 A;  1MQG A;  1B5J A;  1PBP A;  4POX A;  3KGC A;  4RXL A;  3IOU A;  1MXZ A;  3RUM A;  1YTV A;  2V3T A;  2VD2 A;  3N6T A;  1QUK A;  5TU0 A;  1L5T A;  4I1D A;  1B46 A;  4DDD A;  4EQB A;  5AE4 A;  1UTB A;  1M5D A;  3S9L C;  3HHG A;  1LAH E;  1D9V A;  1MM6 A;  1NNT A;  3UP9 A;  1SBP A;  3B6W A;  5ICT A;  3TTL A;  1B5H A;  4X1D A;  4JWX A;  1Y4T A;  3G3F A;  1Y9U A;  3JZJ A;  4I62 A;  3VLV A;  3U1O A;  3MJN A;  1WDN A;  4RY1 A;  3SER A;  3T66 A;  5AA2 D;  2FNC A;  4R9G A;  3LC8 A;  5JTY B;  5H8H A;  2YLN A;  3HPI A;  3SEU A;  1OQH A;  3E13 X;  4C1U A;  1GVC A;  1B7Z A;  2HAV A;  4U1Z A;  1NH7 A;  3K02 A;  1Y20 A;  4NMY A;  3BKI B;  5AA1 A;  3C9H A;  3EN3 A;  4Q5T A;  2O69 A;  5FTI A;  2Q89 A;  2XX9 A;  4GVO A;  3T22 A;  1H45 A;  3OEK A;  3KEI A;  2O7I A;  4G77 A;  4LZ8 A;  1LAX A;  3MPL A;  4YMB A;  3K6V A;  3KN8 A;  2R71 A;  3TFL A;  2A5T B;  1MXY A;  1SW5 A;  2HZL A;  2F34 A;  3M3K A;  4NF6 B;  4QSC A;  5FHN A;  4PE5 B;  5I2N A;  1MQJ A;  2DP8 A;  2M8C A;  1B7H A;  2V3Q A;  3R26 A;  3O6I A;  3MVZ A;  5I58 B;  2F6P A;  3KG2 A;  3SEV A;  2RF1 A;  2XXX A;  5IKB A;  3RLF E;  4OET A;  1H44 A;  5FHO A;  3KZG A;  5DYH A;  3TCH A;  3PPQ A;  4EUO A;  5H8F B;  3KSX A;  3U93 A;  4R9F A;  3IO4 A;  3VFJ A;  2AIX A;  1Y3N A;  1SYI A;  2GRV A;  1JVY A;  1II5 A;  1MY3 A;  4ZEB A;  1MG1 A;  3UN6 A;  2RKM A;  4H8I A;  3KBR A;  5I56 B;  3W15 C;  1JET A;  5DEX A;  3TKD A;  1B58 A;  1H3D A;  3Q29 A;  3LSF B;  4MLV A;  4DLD A;  3N94 A;  1EZ9 A;  1FCK A;  1SQY A;  3VVF A;  1UQW A;  4DE8 A;  3I6V A;  4BDL A;  5DVJ A;  2I4B A;  4KQP A;  3M8U A;  3OXN A;  4DCY A;  1TFD A;  5B70 A;  4PFT A;  4RPO A;  2XXI A;  4G2Z A;  3Q26 A;  5KCJ B;  1MPD A;  2DWJ A;  1USY H;  3K1P A;  3CR9 A;  2O6A A;  3C4M A;  4F1Y A;  2KLF A;  3MP8 A;  3PPP A;  4XKN A;  4UA8 A;  4YKI A;  4PP0 A;  1B32 A;  5CM6 A;  1MRP A;  1ZJL A;  3BFU A;  3Q27 A;  3TZA A;  1PBQ A;  1TFA A;  3QYT A;  4XKR A;  3D4G A;  3Q28 A;  4E0W A;  1BIY A;  4LAT A;  4DXU A;  2YJP A;  3EHT A;  4L17 A;  3RT8 A;  3RY3 A;  3MAM A;  5DTB A;  4ZED A;  4GXA A;  3U94 A;  1LFI A;  3P7I A;  4JBZ A;  4YB7 A;  1DPE A;  3IB1 A;  1NNK A;  3O28 A;  4DZ1 A;  2QPQ A;  4F1U A;  4IO4 A;  1VR5 A;  4FIM A;  3CSB A;  2H9B A;  1B3H A;  3CFZ A;  3T96 B;  2R6G E;  4LZ7 A;  1QKB A;  2REG A;  3KOS A;  4Z7E A;  4FE8 A;  2P0S A;  3IX1 A;  3G7W A;  1B3L A;  4H6D A;  1FTO A;  5CMK A;  5I59 B;  4ZE8 A;  1POY 1;  1ELJ A;  2Z8F A;  1VE4 A;  3FJM A;  3I3V A;  3CRB A;  3V5A A;  4R74 A;  4DCX A;  3S4U A;  3K6U A;  4U4X A;  1N04 A;  3OOA A;  1MXV A;  5CBR A;  4MH5 A;  2DXY A;  4GFR A;  5EHS A;  3OD7 A;  1B9J A;  4AQ4 A;  5K2X A;  1KWH A;  2D5W A;  3QAX A;  3FVO A;  3TQL A;  3PUZ E;  2OCU A;  3MQ9 A;  4O3B A;  2GFE A;  1S7Y A;  4ZE9 A;  1LLS A;  3H6U A;  3OMB A;  2H25 A;  3UK4 A;  4JSO A;  3W9V A;  2Z8D A;  1B1H A;  4WED A;  2VHA A;  4GOT A;  1QUJ A;  1BKA A;  1IXI A;  4BDQ A;  4YKK A;  1ZMG A;  5KDT A;  2HFB A;  2F7B A;  1NL5 A;  3L6G A;  1B0L A;  4NE4 A;  5AA2 A;  3H06 B;  3O29 A;  1B3E A;  3CSG A;  4YB6 A;  5JK4 A;  2B3F A;  1MXW A;  4NF8 B;  1GTK A;  5CMC A;  4PFU A;  3SEY A;  5TPA A;  2I0C A;  1A55 A;  1JW5 A;  1URD A;  1TXF A;  3C34 A;  1FW0 A;  4BDR A;  3M3F A;  3RT6 B;  2F5X A;  3SET A;  3T9H B;  1TWY A;  4GRK A;  3TMG A;  4JDF A;  2NXO A;  3EPE A;  3DLN A;  3ZKK A;  4UAC A;  3CFL A;  1FTL A;  4YKJ A;  2XXP A;  3PMX A;  3H6T A;  3MVY A;  2AL4 A;  2NWJ A;  2QS4 A;  2VGQ A;  1SW2 A;  4GL8 A;  1B2H A;  1B7U A;  1NKX A;  3U8Q A;  1P1U A;  3OO6 A;  4RPN A;  3WAF A;  3VVD A;  1JEU A;  4WKM A;  2HXW A;  1NFT A;  4GL0 A;  5A5X B;  3HST A;  5IAI A;  4FAJ A;  3TTN A;  2VOZ A;  2QMW A;  3RNN A;  3G3G A;  1FQE A;  3F11 A;  1N3W A;  4BDN A;  1DSN A;  3MC2 A;  3VXB A;  2UVH A;  4OFJ A;  4NED A;  4HS7 A;  4F2Q A;  1VSO A;  1IXG A;  1QW0 A;  4EQ9 A;  3MWB A;  3TAJ A;  2QL3 A;  3SEW A;  4YAH X;  2X26 A;  4YB5 A;  3LBS A;  3H6V A;  3C31 A;  1NNF A;  3T9U A;  4JB7 A;  5ITO A;  1SW4 A;  4EF2 A;  3PUW E;  2O68 A;  3MW0 A;  1GGG A;  3S9N C;  4HCW A;  1SVX B;  3H7M A;  3ZKL A;  3K2D A;  1R9Q A;  1LAG E;  2VP1 A;  2PX1 A;  2RCB A;  2DSF A;  2I6E A;  3S9M C;  3OO8 A;  5B7D A;  3ZSF A;  4MLQ A;  1MQH A;  1RYX A;  1VFD A;  2E1S A;  3FXR A;  1XVY A;  1B5I A;  4H8J A;  2QRY A;  5JEI A;  4KR5 A;  2UYF A;  3FUZ A;  4DXC A;  1JW4 A;  1OVT A;  3PUY E;  3O2A A;  3G3I A;  5CMM A;  4ZEF A;  2V93 A;  1MY2 A;  1R6Z A;  4GXS B;  2H4I A;  4RK2 A;  2QS3 A;  4XTC Q;  1MXX A;  2Y7W A;  2DE2 A;  1OLC A;  4JXI A;  5H8N B;  2W7Y A;  4ESX A;  2FA7 A;  3IJO B;  1AOV A;  3H3G A;  5L8D A;  5JTY A;  2ZYO A;  5TP9 B;  2HAU A;  1IIT A;  1US4 A;  2ZYM A;  1SDX A;  5BUU A;  2X7Q A;  2DWA A;  4GF8 A;  5AA4 B;  2HZK A;  5HPQ A;  4F3B A;  3BBR A;  3IO6 A;  3O97 A;  2NVU B;  3TCF A;  4EQ7 A;  1DTG A;  5I2N B;  3R7X A;  4ZEK A;  4IGT A;  3S9E A;  2PT1 A;  4C0R A;  1EZP A;  2DWI A;  2I3W A;  5M2V A;  1DPP A;  2ONR A;  3FXU A;  2A5T A;  4KYE A;  4ONY A;  2RC8 A;  4NF6 A;  1B4H A;  2OWS A;  4IO5 A;  3QK6 A;  3KSJ A;  4OFO A;  2RC7 A;  1H76 A;  3LR1 A;  4ND9 A;  5L9S A;  2QS1 A;  1EZO A;  4QFN A;  1T0K A;  2H5Y A;  3A3C A;  1MPB A;  4KHZ E;  2DVZ A;  4KCD A;  4LA9 A;  1FTJ A;  1I6B A;  3IOT A;  1XVX A;  3UOR A;  1ZLQ A;  3LUY A;  3V8X B;  3VV5 A;  4X1B A;  2YPN A;  4TQU Q;  4OEU A;  3JYR A;  4HCY A;  4H65 A;  3QUF A;  5H8F A;  2D3I A;  1XC1 A;  3OO7 A;  1EU8 A;  4BDM A;  3GXA A;  4C1T A;  4Q0C A;  3QUJ A;  2ESN A;  4FAT A;  2WKY A;  1LFG A;  1MY0 A;  3FZV A;  3TTM A;  5I56 A;  4U2R A;  4TLM B;  4X48 A;  2Y84 A;  2DE4 A;  4OZ9 A;  4F22 A;  4R75 A;  1QVS A;  1URG A;  2Z22 A;  4MBP A;  4NF5 B;  4OER A;  2F35 A;  4G68 B;  3TTR A;  4R6H A;  2D21 A;  1YCJ A;  2DVC A;  1ZTY A;  3MP6 A;  3VXC A;  5DVI A;  3RGY A;  3BFT A;  1OMP A;  4OTE A;  5CRY A;  3AXF A;  4U22 A;  1P1W A;  1B6H A;  3ILU B;  5KCJ A;  4F19 A;  1S50 A;  2ZNT A;  3OO9 A;  1Y4C A;  3UGW A;  2XD3 A;  4R6K A;  4WXJ A;  2Q2C A;  4FOR A;  2OWT A;  1JW1 A;  5H8Q B;  4F2O A;  1PDA A;  1WOD A;  3TDJ A;  2G93 A;  2Y7K A;  3IAZ A;  2H98 A;  2DXR A;  1MS7 A;  1LCF A;  2OLB A;  1I6Q A;  4RJZ A;  4QRZ A;  3T9X B;  3IR1 A;  1N3X A;  2QMX A;  1UTH B;  3SKP A;  1HSL A;  3EQ1 A;  3IB0 A;  3FJ7 A;  2ZYN A;  3G3J A; 
#chains in the Genus database with same CATH topology
 4H0W A;  2Y7R A;  1LB9 A;  4OHN A;  1B1X A;  4OA4 A;  1RDZ A;  1AL3 A;  4ZEC A;  1P1N A;  3ILT B;  1N76 A;  1Y3P A;  5EHM A;  2VD3 A;  1D3K A;  4YU0 A;  5ITP A;  2PYY A;  3H03 A;  2ABH A;  4N13 A;  4LZ5 A;  1B05 A;  4IY6 A;  3QSL A;  1LFH A;  4QFO A;  4F29 A;  5CC2 A;  1D4N A;  5I59 A;  3FAT A;  3PGF A;  1PB7 A;  4P0G A;  1FBH A;  4O8M A;  2XXR A;  4NHB A;  2O1L A;  2XD2 A;  2WX9 A;  4Z0I A;  1PC3 A;  1FJ9 A;  2UXA A;  1FPJ A;  4FEC A;  4O3A A;  3PPN A;  3VE1 B;  2XA5 A;  1LBC A;  1O64 A;  3EF7 A;  3A29 A;  5I57 B;  2Q8J A;  1A8F A;  4IGR A;  2GHA A;  3KN3 A;  2OZZ A;  2V3U A;  4OYV A;  1CE2 A;  1MQI A;  3KFM A;  3N26 A;  1OQG A;  1XOC A;  1KA1 A;  3KJ7 A;  2OJT A;  4GD5 A;  3G3H A;  2F6G A;  4ELQ A;  3K6X A;  1FQD A;  5CI5 A;  5I2K A;  4JSD A;  1AH5 A;  2CMO A;  2F78 A;  5I5P A;  3VDF A;  3DEL B;  4YKP A;  2PFY A;  3SDF A;  1O63 A;  2PCR A;  2V25 A;  2R9J A;  2PVU A;  4HE1 A;  1LBY A;  1MM7 A;  4QHQ A;  4O3C A;  2V84 A;  2Y5L A;  3LSL A;  1BK4 A;  1DTZ A;  3OSR A;  3W9W A;  3SEX A;  4LP2 B;  1XT8 A;  4RK9 A;  1Y3Q A;  1EYI A;  4NF8 A;  4ELO A;  3GBA A;  3VLW A;  4NF4 B;  4NWD A;  3KJT A;  4U1O A;  2O51 A;  1HSJ A;  2Y7P A;  4RYA A;  1A54 A;  4MEV A;  4NWC A;  3PTY A;  3PU5 A;  1EYJ A;  5I84 A;  2F7A A;  4N8G A;  1B4Z A;  4BDO A;  1B51 A;  3FBP A;  1OLA A;  4EXK A;  1NV2 A;  3EHS A;  3ONM A;  4F31 B;  5LOM A;  5J1D A;  4O7M A;  2QS2 A;  3B6Q A;  4PAF A;  4XKQ A;  4IB2 A;  3ECR A;  3K1M A;  2UVI A;  2CZH A;  4OVJ A;  2UYE A;  3M3L A;  1IMB A;  2Q9T A;  3IJX B;  2ALU A;  1MXU A;  1DBZ A;  2THI A;  2VPO A;  4YZZ A;  1IXH A;  3IFA A;  2XXY A;  2ONK E;  4Q30 B;  4H5F A;  3RQT A;  4ELR A;  1IUD A;  1B3F A;  1O7T A;  1BLF A;  1Q9D A;  3LSW A;  4OFL A;  1Z7M E;  1IQ7 A;  1ANF A;  1IIW A;  3CIJ A;  4R2B A;  5A5X A;  1Y1M A;  1KZ8 A;  4QBA A;  2FVZ A;  1BTJ A;  3D4C A;  1ATG A;  1QUL A;  4KI0 E;  2PMS A;  4OXV A;  3G3K A;  1WVJ A;  5F7V A;  4POW A;  2XXH A;  1B0H A;  3MST A;  3MZB A;  4ECF A;  3GBB A;  3ODB A;  4DXB A;  5KZT A;  1US5 A;  4UAB A;  1LGB C;  3B6T A;  3A09 A;  3C33 A;  3E4R A;  3VVE A;  3HCQ A;  3O6H A;  1SW1 A;  2BJJ X;  3RPL A;  1FSA A;  2G29 A;  2RC9 A;  3E9X A;  3OEM A;  4IO3 A;  1NNP A;  1NV5 A;  1ZBM A;  2XXV A;  5K2Y A;  3MUQ A;  4ZZE A;  5ELV A;  3E3K A;  3SES A;  1PB8 A;  4HW8 A;  2I58 A;  4NAP A;  3FAS A;  4YMA A;  3PUV E;  1R9L A;  3IFC A;  1N84 A;  1UTB B;  5ISU A;  3PUX E;  4XKP A;  3PD8 A;  4EDP A;  4IY5 A;  4PF6 A;  3RN8 A;  1LAF E;  4XEQ A;  5HM4 B;  4O7I A;  2I0B A;  2ZNU A;  4AB5 A;  1MY4 A;  2AYS A;  3JV9 A;  3CI8 A;  1S9T A;  4RNS A;  4AB6 A;  3TPA A;  4GWS A;  2XWK A;  3FJG A;  4F3S A;  1LCT A;  4XIG Q;  1JVX A;  1ZU0 A;  3K00 A;  5T3J A;  1IMC A;  4PQJ A;  1SI1 A;  1MDP 1;  3FVG A;  2DOJ A;  3C35 A;  3U72 A;  2ZYK A;  3MBP A;  5H8H B;  3OEN A;  2ANJ A;  1EH3 A;  4K3F A;  4M1V A;  5L9O A;  1M5C A;  2FIE A;  4TLL B;  3KN7 A;  1NV6 A;  1PEB A;  3PMW A;  1A8E A;  4MNP A;  1FTM A;  1Y1Z A;  4GQO A;  3FIR A;  4QFK A;  2F8D A;  3FVN A;  3IB2 A;  3OSQ A;  1FTK A;  1BP5 A;  2P2A A;  5H8N A;  4QFL A;  4PFI A;  1XHY A;  4FED A;  2UVJ A;  3O6G A;  2JJK A;  4I9D A;  3IOR A;  5TP9 A;  2XXQ A;  4FJP A;  1A7L A;  1JEV A;  3GLB A;  3N6U A;  4GIZ A;  1NUW A;  3MPK A;  4XXU A;  2O7U A;  3RYD A;  5AA4 A;  2QFL A;  1USY E;  3DP8 A;  5EYF A;  4OVR A;  3N5L A;  4QSE A;  4F3G A;  4MX6 A;  1M5B A;  1N7X A;  4KYD A;  5LDZ A;  1SPI A;  4THI A;  2HQ0 A;  4DIG A;  1NV0 A;  2FYI A;  4EF1 A;  3K6W A;  5EQ8 A;  1FBF A;  1I6A A;  4I8C A;  3T93 B;  2WBB A;  4MF3 A;  2RIN A;  4G8H A;  4OQO A;  1D9Y A;  1FQA A;  3TEP A;  2CEY A;  2H99 A;  2Z8E A;  3H4Z A;  1SI0 A;  2XX7 A;  4LVQ A;  5I58 A;  3THI A;  4TOZ A;  4G4P A;  1FBD A;  4LQ2 A;  5DVF A;  3TYH A;  1FQC A;  2AL5 A;  2OWZ A;  4N4U A;  2GQ1 A;  3FVK A;  2HEU A;  4ISU A;  4OES A;  5DEX B;  4P0I A;  4NGU A;  4H1X A;  5EQA A;  4ZZA A;  5IZ1 A;  1A99 A;  3UA8 A;  3C36 A;  4MHF A;  3MZ9 A;  4GWW A;  4PFY A;  3K01 A;  1B52 A;  4G8M A;  1MY1 A;  4LUB A;  5BWJ A;  4N6P A;  4LQ5 A;  4P1E A;  3BIH A;  4KD5 A;  4R72 A;  1ZIU A;  4QFP A;  2DS9 A;  2GHB A;  1P1O A;  1RKM A;  3GZG A;  2A5S A;  3CVG A;  2DQV A;  2IEE A;  4GX4 A;  1LB8 A;  3TTK A;  3HV1 A;  1ZKB A;  4PFW A;  4R73 A;  5DT6 A;  3PPO A;  1JNF A;  2P1S A;  3FV1 A;  3IL1 B;  1UIV A;  1AWB A;  2ZMB A;  3C32 A;  1FQB A;  3MVX A;  3O66 A;  1A40 A;  1F9B A;  1DMB A;  4NF5 A;  2MKZ A;  4G68 A;  1MPC A;  2O1M A;  2LAO A;  5A5L A;  1RYO A;  4U4S A;  1UIU A;  3RPW A;  5CMB A;  2F36 A;  4F18 A;  3GYY A;  4RA1 A;  4R6Y A;  3L6H A;  4JWO A;  1MH3 A;  5FBP A;  2DYX A;  5HBC A;  5F24 A;  2B4L A;  3TUS A;  2QJE A;  4AS5 A;  1MDQ A;  2PT2 A;  5ICQ A;  5H8Q A;  2O84 X;  5H8S A;  3A3U A;  5CBS A;  1Z7N E;  2DE3 A;  3O9P A;  3CG3 A;  2GH9 A;  3WAE A;  1NUX A;  3QMF A;  2XX8 A;  4OVP A;  2ONS A;  4LON B;  2HCA A;  2Z23 A;  4YIC A;  1FBP A;  1QUI A;  1Q1K A;  3R6U A;  2E0S A;  4F39 A;  3T1B A;  1SD3 A;  2Q2A A;  4KYS A;  4R2F A;  1UTH A;  2I4C A;  1JQF A;  2NOO A;  4PCD A;  1IEJ A;  4NTL A;  1INP A;  3QXM A;  1QJM A;  1FQF A;  4ELP A;  2CZI A;  4JWY A;  3FV2 A;  2I48 A;  3MZ1 A;  1H43 A;  5L9M A;  5EQ7 A;  3IOW A;  2CZL A;  3B7D A;  2WEF A;  1IXC A;  4U21 A;  1URS A;  3TCG A;  4OVQ A;  3Q25 A;  4E0X A;  4WEP A;  1LBV A;  1MH4 A;  1N0T A;  1NMU A;  4H5G A;  3K4U A;  2CZK A;  2XHD A;  4IO7 A;  1M5E A;  3K1N A;  4PE3 A;  2F97 A;  3FD3 A;  4U23 A;  2XXT A;  4X8R A;  2I3V A;  2XWI A;  2Q88 A;  3S2V A;  2REJ A;  1OVB A;  2Y7I A;  4I3E A;  2Y5K A;  2IA4 A;  1TT1 A;  3V83 A;  2F7C A;  4IO2 A;  1Q35 A;  1IZ1 A;  3IK6 B;  3NOH A;  3OEL A;  3USD A;  4GWO A;  4P1L A;  3CFX A;  4PDH A;  1FBC A;  4EXL A;  1P99 A;  5KDT B;  4KPT A;  3V89 B;  5I57 A;  4N17 A;  5I2K B;  4QXD A;  5FTH A;  1FPB A;  5I3S A;  1GV8 A;  2B3B A;  5AA2 B;  1DOT A;  3PMV A;  2UVG A;  4OMB A;  3TQW A;  3T9V A;  4KCC A;  2ZXT A;  1R1N A;  3EHU A;  4KFQ A;  3DM0 A;  5TPA B;  3MVW A;  3VLU A;  3FXQ A;  3FGS A;  2PBW A;  2I49 A;  4P11 A;  5J16 A;  1AMF A;  1HSE A;  3PD9 A;  1YAE A;  4GWY A;  3HO7 A;  5FHM A;  1XS5 A;  2VT5 A;  4GBV A;  1N7W A;  4GLI A;  3U92 A;  4F3P A;  1QKA A;  1KA0 A;  4F1V A;  1B40 A;  2NUV A;  3HN0 A;  1I69 A;  3KOT A;  4QSD A;  4BLA A;  1MQD A;  4NF4 A;  4OEN A;  5AA3 A;  2FIX A;  4ZDM A;  4OEV A;  3LSX A;  1IMA A;  3K0V A;  2ZNS A;  2RCA A;  4PET A;  1PB9 A;  2OK2 A;  3TEL A;  1J1N A;  1FBG A;  3UIF A;  4FEB A;  4P56 A;  1POT A;  4ZEI A;  4Q8R A;  1M5F A;  2XXW A;  2QSX A;  3MP1 A;  3IOV A;  3LUZ A;  1SYH A;  1AIV A;  3DP4 A;  1K9Z A;  3I5O A;  4HTG A;  3RTF B;  3DP6 A;  3B8B A;  2PFZ A;  1OIB A;  4M4G A;  4H67 A;  4XFE A;  4ESW A;  4X9T A;  1NH8 A;  1VFE A;  4ZS9 A;  1P1Q A;  3H6W A;  2DWH A;  1B3G A;  2ZZX A;  5ESY A;  3CG1 A;  1CB6 A;  2HPG A;  3D1R A;  2XXU A;  1LBB A;  4G8N A;  3QIM A;  1YPN A;  3PPR A;  3ZS6 A;  1LST A;  4QF9 A;  3HHF A;  4OWD A;  4GWX A;  4N91 A;  3SZP A;  4MIJ A;  3PV0 E;  5F1Q A;  1CNQ A;  1FTA A;  2X7P A;  2B65 A;  2OBG A;  1GR2 A;  3RTW B;  3TOD A;  4MFI A;  4N07 A;  4G68 C;  4IO6 A;  1MQG A;  1B5J A;  1PBP A;  4POX A;  3U65 A;  4GX6 A;  3KGC A;  4RXL A;  5EYG A;  3IOU A;  1MXZ A;  3RUM A;  1YTV A;  2V3T A;  2VD2 A;  3N6T A;  1QUK A;  5TU0 A;  1L5T A;  4I1D A;  1B46 A;  4DDD A;  4EQB A;  5AE4 A;  1UTB A;  1M5D A;  3S9L C;  1FBE A;  3HHG A;  1LAH E;  1D9V A;  4PAI A;  2HHM A;  1MM6 A;  1NNT A;  3UP9 A;  1SBP A;  3B6W A;  5ICT A;  3TTL A;  1FPF A;  1B5H A;  4X1D A;  3E78 A;  4JWX A;  1Y4T A;  5ET7 A;  3G3F A;  1Y9U A;  3JZJ A;  4I62 A;  3VLV A;  3U1O A;  3MJN A;  1WDN A;  4RY1 A;  3SER A;  2XWV A;  3T66 A;  5AA2 D;  2FNC A;  4R9G A;  3LC8 A;  5JTY B;  5H8H A;  2YLN A;  3HPI A;  3SEU A;  1OQH A;  3E13 X;  1NV3 A;  4C1U A;  1GVC A;  5ET8 A;  1B7Z A;  2HAV A;  4U1Z A;  1NH7 A;  3K02 A;  1Y20 A;  4NMY A;  3BKI B;  5AA1 A;  5EQ9 A;  3C9H A;  4N6D A;  3EN3 A;  4Q5T A;  3CHG A;  2O69 A;  5FTI A;  2Q89 A;  2XX9 A;  4GVO A;  3T22 A;  1H45 A;  3OEK A;  3KEI A;  2O7I A;  4MJO A;  4G77 A;  4GBW A;  4LZ8 A;  1LAX A;  3MPL A;  4YMB A;  4MMP A;  4P9K A;  1DK4 A;  3K6V A;  4KXP A;  3KN8 A;  1XI6 A;  2R71 A;  2QVU A;  3TFL A;  2A5T B;  1MXY A;  1SW5 A;  2HZL A;  2F34 A;  3M3K A;  4NF6 B;  4QSC A;  2KR0 A;  4AS4 A;  5FHN A;  4PE5 B;  5I2N A;  1MQJ A;  1QGX A;  2DP8 A;  2M8C A;  1B7H A;  2V3Q A;  3R26 A;  3O6I A;  3MVZ A;  5I58 B;  2F6P A;  3KG2 A;  4PFR A;  3SEV A;  2RF1 A;  2XXX A;  5IKB A;  3RLF E;  4PBH A;  4OET A;  1H44 A;  5FHO A;  2L5V A;  3KZG A;  5DYH A;  3TCH A;  3PPQ A;  4EUO A;  5H8F B;  3KSX A;  3U93 A;  1NUY A;  4R9F A;  3IO4 A;  3VFJ A;  2AIX A;  1LBX A;  1Y3N A;  1SYI A;  2GRV A;  1JVY A;  5IZ3 B;  1II5 A;  1VDW A;  1MY3 A;  4PC9 A;  4ZEB A;  1MG1 A;  3UN6 A;  2RKM A;  4H8I A;  3KBR A;  5I56 B;  3W15 C;  1JET A;  5DEX A;  3TKD A;  1B58 A;  4H46 A;  1H3D A;  3Q29 A;  4NN3 A;  3LSF B;  4MLV A;  4I3Y A;  4HE2 A;  4DLD A;  3N94 A;  1EZ9 A;  1FCK A;  4N6K A;  1SQY A;  1FPK A;  3VVF A;  1UQW A;  4DE8 A;  3I6V A;  4BDL A;  5DVJ A;  2I4B A;  4KQP A;  3M8U A;  3OXN A;  4DCY A;  2XWO A;  1TFD A;  5B70 A;  4PFT A;  4RPO A;  2XXI A;  4G2Z A;  3Q26 A;  5KCJ B;  1MPD A;  2F3D A;  4OVS A;  2DWJ A;  1USY H;  3K1P A;  2XXK A;  4DI3 D;  3CR9 A;  3MYU A;  2O6A A;  3C4M A;  1FPG A;  4F1Y A;  2KLF A;  2VPN A;  3MP8 A;  3PPP A;  4XKN A;  4UA8 A;  4YKI A;  4PP0 A;  1B32 A;  5CM6 A;  1MRP A;  1ZJL A;  3BFU A;  3Q27 A;  3TZA A;  2Q8M A;  1PBQ A;  1TFA A;  3QYT A;  4XKR A;  1IME A;  3D4G A;  3Q28 A;  4E0W A;  1BIY A;  4LAT A;  4DXU A;  2YJP A;  3EHT A;  1YYZ A;  4L17 A;  3RT8 A;  3RY3 A;  3MAM A;  5DTB A;  4ZED A;  4GXA A;  3U94 A;  1LFI A;  3P7I A;  4JBZ A;  4YB7 A;  4PFB A;  1NUZ A;  1DPE A;  3IB1 A;  1NNK A;  3O28 A;  4DZ1 A;  2F3B A;  2ZZV A;  4NG7 A;  2QPQ A;  4F1U A;  4IO4 A;  1VR5 A;  1LBZ A;  4FIM A;  3CSB A;  2H9B A;  1B3H A;  1JP4 A;  3CFZ A;  3T96 B;  2R6G E;  4LZ7 A;  1QKB A;  2REG A;  3KOS A;  4Z7E A;  4FE8 A;  2P0S A;  3IX1 A;  3EKI A;  4PTK A;  3G7W A;  1G0I A;  1B3L A;  4H6D A;  5ET6 A;  1FTO A;  5CMK A;  5I59 B;  4ZE8 A;  1POY 1;  4JVC A;  1ELJ A;  2Z8F A;  1VE4 A;  3FJM A;  3I3V A;  3CRB A;  3V5A A;  4JVI A;  4R74 A;  4DCX A;  3S4U A;  2OX3 A;  3K6U A;  4U4X A;  1N04 A;  3OOA A;  1MXV A;  5CBR A;  2QVV A;  4MH5 A;  2DXY A;  4GFR A;  5EHS A;  3OD7 A;  1B9J A;  4AQ4 A;  5K2X A;  1KWH A;  2D5W A;  3QAX A;  5EYH A;  1FRP A;  3FVO A;  4OAN A;  3TQL A;  3PUZ E;  2OCU A;  3MQ9 A;  4NF0 A;  4O3B A;  4N81 A;  2GFE A;  1S7Y A;  4ZE9 A;  1LLS A;  3H6U A;  3OMB A;  2H25 A;  3UK4 A;  1FPL A;  1LEV A;  4JSO A;  1RDY A;  3W9V A;  2Z8D A;  1B1H A;  4WED A;  2VHA A;  4LN5 A;  4GOT A;  1QUJ A;  1BKA A;  2FBP A;  1IXI A;  4BDQ A;  5I7I A;  4O94 A;  4YKK A;  1ZMG A;  5KDT A;  2HFB A;  2F7B A;  1NL5 A;  4P47 A;  3L6G A;  1B0L A;  4NE4 A;  5AA2 A;  3H06 B;  3O29 A;  1B3E A;  3CSG A;  4YB6 A;  4PF8 A;  5JK4 A;  2B3F A;  1MXW A;  4NF8 B;  1GTK A;  5CMC A;  4PFU A;  3SEY A;  5TPA A;  2I0C A;  1A55 A;  1JW5 A;  1URD A;  1TXF A;  3C34 A;  1FW0 A;  4BDR A;  3M3F A;  3RT6 B;  2F5X A;  3SET A;  3T9H B;  1TWY A;  2Q74 A;  4GRK A;  3TMG A;  3T0J A;  4JDF A;  3KC0 A;  2NXO A;  4PBQ A;  3EPE A;  3DLN A;  3ZKK A;  4UAC A;  3CFL A;  1YXI A;  1FTL A;  4YKJ A;  2XXP A;  3PMX A;  3H6T A;  3MVY A;  2AL4 A;  2NWJ A;  2QS4 A;  2VGQ A;  1SW2 A;  4H45 A;  4GL8 A;  3ROJ A;  1B2H A;  1B7U A;  1NKX A;  3U8Q A;  1P1U A;  3OO6 A;  4G61 A;  3HFU A;  4RPN A;  3WAF A;  3VVD A;  1JEU A;  2P3V A;  2HXW A;  4WKM A;  1NFT A;  4GL0 A;  5A5X B;  2FHY A;  1FPI A;  3HST A;  5IAI A;  5LTC A;  2QVR A;  4FAJ A;  3TTN A;  2VOZ A;  2QMW A;  3RNN A;  1K9Y A;  3G3G A;  1FQE A;  3F11 A;  1N3W A;  4BDN A;  1DSN A;  3MC2 A;  3VXB A;  2UVH A;  4OFJ A;  3B50 A;  4NED A;  4HS7 A;  3E79 A;  4F2Q A;  4PGP A;  1VSO A;  1IXG A;  1QW0 A;  5ET5 A;  3RPL B;  4EQ9 A;  4P3L A;  2P3N A;  3MWB A;  3TAJ A;  2QL3 A;  3SEW A;  4YAH X;  2X26 A;  4YB5 A;  1YZ0 A;  3LBS A;  3H6V A;  3C31 A;  1NNF A;  3T9U A;  4JB7 A;  5ITO A;  1SW4 A;  4EF2 A;  3PUW E;  2O68 A;  1D9Q A;  3MW0 A;  1GGG A;  3S9N C;  4HCW A;  1SVX B;  3H7M A;  1NV4 A;  3ZKL A;  3K2D A;  1R9Q A;  1LAG E;  2VP1 A;  2PX1 A;  2RCB A;  3KC1 A;  2DSF A;  2I6E A;  3S9M C;  4P8B A;  3FXB A;  1G0H A;  3OO8 A;  5B7D A;  2BJI A;  3ZSF A;  4MLQ A;  1MQH A;  1RYX A;  1VFD A;  2E1S A;  2CEX A;  3FXR A;  1XVY A;  1B5I A;  2KQZ A;  4H8J A;  2QRY A;  5JEI A;  4MCO A;  4KR5 A;  2UYF A;  3FUZ A;  4DXC A;  1JW4 A;  1OVT A;  3PUY E;  3O2A A;  3G3I A;  5CMM A;  2WYK A;  4ZEF A;  2V93 A;  1MY2 A;  1R6Z A;  4GXS B;  2H4I A;  4RK2 A;  2QS3 A;  4XTC Q;  1MXX A;  2Y7W A;  2DE2 A;  1OLC A;  4MNI A;  4JXI A;  5H8N B;  2W7Y A;  4IR8 A;  4ESX A;  2FA7 A;  3IJO B;  1AOV A;  3H3G A;  5L8D A;  5JTY A;  2ZYO A;  5TP9 B;  2HAU A;  1IIT A;  1US4 A;  2ZYM A;  4PAK A;  1SDX A;  5BUU A;  2X7Q A;  2DWA A;  4GF8 A;  5AA4 B;  2HZK A;  5HPQ A;  4F3B A;  3BBR A;  3ISP A;  3IO6 A;  3O97 A;  2NVU B;  2WBD A;  3TCF A;  4EQ7 A;  1RDX A;  1DTG A;  2B4M A;  5I2N B;  3R7X A;  1FJ6 A;  4ZEK A;  1FPE A;  4IGT A;  3S9E A;  2PT1 A;  4C0R A;  1EZP A;  2DWI A;  2I3W A;  4PDD A;  5M2V A;  1DPP A;  2ONR A;  3FXU A;  4GX3 A;  1IMF A;  2A5T A;  4KYE A;  3LV0 A;  4ONY A;  2RC8 A;  4NF6 A;  1B4H A;  2OWS A;  4IO5 A;  3QK6 A;  3KSJ A;  4OFO A;  2RC7 A;  1H76 A;  4JVD A;  3LR1 A;  4ND9 A;  5L9S A;  2QS1 A;  1EZO A;  2V4C A;  4QFN A;  1NI9 A;  1T0K A;  2DDK A;  2H5Y A;  3A3C A;  4GWU A;  5IM2 A;  1MPB A;  4KHZ E;  1FPD A;  2DVZ A;  4KCD A;  4LA9 A;  1FTJ A;  1I6B A;  3IOT A;  1XVX A;  3UOR A;  1ZLQ A;  3LUY A;  4I40 A;  3V8X B;  3VV5 A;  4X1B A;  2YPN A;  4TQU Q;  4OEU A;  4NX1 A;  3JYR A;  4HCY A;  4H65 A;  3QUF A;  5H8F A;  2D3I A;  1XC1 A;  3OO7 A;  5DW8 A;  1EU8 A;  4BDM A;  3GXA A;  5IZ3 A;  4C1T A;  4Q0C A;  3QUJ A;  2ESN A;  4FAT A;  2WKY A;  1LFG A;  4OVT A;  1MY0 A;  3FZV A;  3TTM A;  5I56 A;  4U2R A;  4TLM B;  4X48 A;  4N8Y A;  1NV1 A;  2Y84 A;  2DE4 A;  4OZ9 A;  4F22 A;  4R75 A;  1QVS A;  1URG A;  5IZZ A;  5IGA A;  2Z22 A;  4MBP A;  4NF5 B;  2R8T A;  4OER A;  1NV7 A;  2F35 A;  4G68 B;  3TTR A;  4NQ8 A;  4R6H A;  2D21 A;  1YCJ A;  1IMD A;  2DVC A;  1ZTY A;  4MNC A;  3MP6 A;  3VXC A;  5DVI A;  4PGN A;  3BIG A;  3RGY A;  3BFT A;  1OMP A;  1DCU A;  4OTE A;  5CRY A;  3AXF A;  4U22 A;  1P1W A;  1B6H A;  3ILU B;  5KCJ A;  4FBP A;  4F19 A;  1S50 A;  2ZNT A;  3OO9 A;  1Y4C A;  4MAG A;  4X04 A;  1EYK A;  4GWZ A;  3UGW A;  2XD3 A;  4R6K A;  4WXJ A;  2Q2C A;  4FOR A;  2OWT A;  1JW1 A;  5H8Q B;  4F2O A;  3KBZ A;  1PDA A;  1WOD A;  3TDJ A;  2G93 A;  4N15 A;  2Y7K A;  2HXR A;  2ZZW A;  1LBW A;  3IAZ A;  4HXV A;  2H98 A;  2DXR A;  1MS7 A;  1LCF A;  2OLB A;  1I6Q A;  4RJZ A;  4QRZ A;  3IR1 A;  3T9X B;  1N3X A;  2QMX A;  4DI4 B;  1UTH B;  3SKP A;  2WYP A;  1HSL A;  3EQ1 A;  3IB0 A;  3FJ7 A;  2ZYN A;  4HE0 A;  4XF5 A;  3G3J A; 
#chains in the Genus database with same CATH homology
 4H0W A;  2Y7R A;  1LB9 A;  4OHN A;  1B1X A;  1AL3 A;  4ZEC A;  1P1N A;  3ILT B;  1N76 A;  1Y3P A;  5EHM A;  2VD3 A;  1D3K A;  4YU0 A;  5ITP A;  2PYY A;  3H03 A;  2ABH A;  4N13 A;  4LZ5 A;  1B05 A;  4IY6 A;  3QSL A;  1LFH A;  4QFO A;  4F29 A;  5CC2 A;  1D4N A;  5I59 A;  3FAT A;  3PGF A;  1PB7 A;  4P0G A;  2XXR A;  2O1L A;  2XD2 A;  4Z0I A;  1PC3 A;  2UXA A;  4FEC A;  4O3A A;  3PPN A;  3VE1 B;  1LBC A;  1O64 A;  3EF7 A;  5I57 B;  2Q8J A;  1A8F A;  4IGR A;  2GHA A;  3KN3 A;  2OZZ A;  2V3U A;  4OYV A;  1CE2 A;  1MQI A;  3KFM A;  3N26 A;  1OQG A;  1XOC A;  3KJ7 A;  2OJT A;  4GD5 A;  3G3H A;  2F6G A;  4ELQ A;  3K6X A;  1FQD A;  5CI5 A;  5I2K A;  4JSD A;  1AH5 A;  2CMO A;  2F78 A;  3VDF A;  3DEL B;  4YKP A;  3SDF A;  1O63 A;  2V25 A;  2R9J A;  2PVU A;  1MM7 A;  4QHQ A;  4O3C A;  2V84 A;  3LSL A;  1DTZ A;  3OSR A;  3W9W A;  3SEX A;  4LP2 B;  1XT8 A;  4RK9 A;  1Y3Q A;  4NF8 A;  4ELO A;  3GBA A;  3VLW A;  4NF4 B;  4NWD A;  3KJT A;  4U1O A;  2O51 A;  1HSJ A;  2Y7P A;  4RYA A;  1A54 A;  4NWC A;  3PU5 A;  5I84 A;  2F7A A;  1B4Z A;  4BDO A;  1B51 A;  1OLA A;  4EXK A;  3EHS A;  3ONM A;  4F31 B;  5LOM A;  5J1D A;  2QS2 A;  3B6Q A;  4XKQ A;  4IB2 A;  3ECR A;  3K1M A;  2UVI A;  4OVJ A;  2UYE A;  3M3L A;  2Q9T A;  3IJX B;  2ALU A;  1MXU A;  2THI A;  4YZZ A;  1IXH A;  2XXY A;  2ONK E;  4Q30 B;  4H5F A;  3RQT A;  4ELR A;  1IUD A;  1B3F A;  1O7T A;  1BLF A;  3LSW A;  4OFL A;  1Z7M E;  1IQ7 A;  1ANF A;  1IIW A;  3CIJ A;  4R2B A;  5A5X A;  1Y1M A;  3D4C A;  1BTJ A;  1ATG A;  1QUL A;  4KI0 E;  2PMS A;  4OXV A;  3G3K A;  1WVJ A;  5F7V A;  4POW A;  2XXH A;  1B0H A;  3MZB A;  4ECF A;  3GBB A;  3ODB A;  4DXB A;  5KZT A;  1US5 A;  1LGB C;  3B6T A;  3A09 A;  3C33 A;  3E4R A;  3VVE A;  3HCQ A;  3O6H A;  1SW1 A;  2BJJ X;  2G29 A;  2RC9 A;  3E9X A;  3OEM A;  4IO3 A;  1NNP A;  1ZBM A;  2XXV A;  5K2Y A;  3MUQ A;  4ZZE A;  5ELV A;  3E3K A;  3SES A;  1PB8 A;  4HW8 A;  2I58 A;  3FAS A;  4YMA A;  3PUV E;  1R9L A;  1N84 A;  1UTB B;  5ISU A;  3PUX E;  4XKP A;  3PD8 A;  4EDP A;  4IY5 A;  3RN8 A;  1LAF E;  5HM4 B;  2I0B A;  2ZNU A;  4AB5 A;  1MY4 A;  2AYS A;  3JV9 A;  3CI8 A;  1S9T A;  4RNS A;  4AB6 A;  3TPA A;  3FJG A;  4F3S A;  1LCT A;  4XIG Q;  1ZU0 A;  1JVX A;  3K00 A;  4PQJ A;  1SI1 A;  1MDP 1;  3FVG A;  2DOJ A;  3U72 A;  3C35 A;  2ZYK A;  3MBP A;  5H8H B;  3OEN A;  2ANJ A;  1EH3 A;  4K3F A;  4M1V A;  5L9O A;  1M5C A;  4TLL B;  3KN7 A;  1PEB A;  3PMW A;  1A8E A;  1FTM A;  1Y1Z A;  4GQO A;  3FIR A;  4QFK A;  2F8D A;  3FVN A;  3IB2 A;  3OSQ A;  1FTK A;  1BP5 A;  2P2A A;  5H8N A;  4QFL A;  1XHY A;  4FED A;  2UVJ A;  3O6G A;  4I9D A;  3IOR A;  5TP9 A;  2XXQ A;  4FJP A;  1A7L A;  1JEV A;  3GLB A;  3N6U A;  4GIZ A;  3MPK A;  4XXU A;  2O7U A;  5AA4 A;  1USY E;  3DP8 A;  5EYF A;  3N5L A;  4QSE A;  4F3G A;  1M5B A;  1N7X A;  4KYD A;  4THI A;  2HQ0 A;  4DIG A;  2FYI A;  4EF1 A;  3K6W A;  1I6A A;  4I8C A;  3T93 B;  4MF3 A;  2RIN A;  4G8H A;  4OQO A;  1D9Y A;  1FQA A;  3TEP A;  2H99 A;  2Z8E A;  3H4Z A;  1SI0 A;  2XX7 A;  4LVQ A;  5I58 A;  3THI A;  4TOZ A;  4G4P A;  4LQ2 A;  5DVF A;  3TYH A;  1FQC A;  2AL5 A;  3FVK A;  2HEU A;  4ISU A;  4OES A;  5DEX B;  4P0I A;  4H1X A;  4ZZA A;  1A99 A;  3UA8 A;  3C36 A;  3MZ9 A;  4PFY A;  3K01 A;  1B52 A;  4G8M A;  1MY1 A;  4LUB A;  5BWJ A;  4N6P A;  4LQ5 A;  4KD5 A;  4R72 A;  1ZIU A;  4QFP A;  2DS9 A;  2GHB A;  1P1O A;  1RKM A;  3GZG A;  2A5S A;  3CVG A;  2DQV A;  2IEE A;  1LB8 A;  3TTK A;  3HV1 A;  1ZKB A;  4PFW A;  4R73 A;  5DT6 A;  3PPO A;  1JNF A;  2P1S A;  3FV1 A;  3IL1 B;  1UIV A;  2ZMB A;  3C32 A;  1FQB A;  3MVX A;  3O66 A;  1A40 A;  1F9B A;  1DMB A;  4NF5 A;  4G68 A;  1MPC A;  2O1M A;  2LAO A;  1RYO A;  4U4S A;  1UIU A;  3RPW A;  5CMB A;  2F36 A;  4F18 A;  4RA1 A;  4R6Y A;  3L6H A;  4JWO A;  1MH3 A;  2DYX A;  5HBC A;  3TUS A;  2QJE A;  1MDQ A;  2PT2 A;  5ICQ A;  5H8Q A;  2O84 X;  5H8S A;  3A3U A;  5CBS A;  1Z7N E;  2DE3 A;  3O9P A;  3CG3 A;  2GH9 A;  3WAE A;  2XX8 A;  2ONS A;  4LON B;  2HCA A;  2Z23 A;  4YIC A;  1QUI A;  1Q1K A;  3R6U A;  2E0S A;  4F39 A;  1SD3 A;  2Q2A A;  4KYS A;  4R2F A;  1UTH A;  2I4C A;  1JQF A;  2NOO A;  1IEJ A;  4NTL A;  3QXM A;  1QJM A;  1FQF A;  4ELP A;  4JWY A;  3FV2 A;  2I48 A;  3MZ1 A;  1H43 A;  5L9M A;  3IOW A;  2CZL A;  3B7D A;  1IXC A;  4U21 A;  1URS A;  3TCG A;  3Q25 A;  4E0X A;  4WEP A;  1MH4 A;  1N0T A;  1NMU A;  4H5G A;  3K4U A;  2XHD A;  4IO7 A;  1M5E A;  3K1N A;  2F97 A;  3FD3 A;  4U23 A;  2XXT A;  2I3V A;  2Q88 A;  3S2V A;  2REJ A;  1OVB A;  2Y7I A;  2IA4 A;  1TT1 A;  3V83 A;  2F7C A;  4IO2 A;  1Q35 A;  1IZ1 A;  3IK6 B;  3OEL A;  3USD A;  4GWO A;  3CFX A;  4EXL A;  1P99 A;  5KDT B;  4KPT A;  3V89 B;  5I57 A;  5I2K B;  5FTH A;  1GV8 A;  2B3B A;  5AA2 B;  1DOT A;  3PMV A;  2UVG A;  4OMB A;  3TQW A;  3T9V A;  4KCC A;  2ZXT A;  1R1N A;  3EHU A;  4KFQ A;  3DM0 A;  5TPA B;  3MVW A;  3VLU A;  3FXQ A;  3FGS A;  2PBW A;  2I49 A;  4P11 A;  1AMF A;  1HSE A;  3PD9 A;  1YAE A;  3HO7 A;  5FHM A;  1XS5 A;  1N7W A;  4GLI A;  3U92 A;  4F3P A;  1QKA A;  4F1V A;  1B40 A;  2NUV A;  3HN0 A;  1I69 A;  3KOT A;  4QSD A;  4BLA A;  1MQD A;  4NF4 A;  4OEN A;  5AA3 A;  4ZDM A;  4OEV A;  3LSX A;  3K0V A;  2ZNS A;  2RCA A;  4PET A;  1PB9 A;  2OK2 A;  3TEL A;  1J1N A;  3UIF A;  4FEB A;  1POT A;  4ZEI A;  4Q8R A;  1M5F A;  2XXW A;  2QSX A;  3MP1 A;  3IOV A;  1SYH A;  1AIV A;  3DP4 A;  3I5O A;  4HTG A;  3RTF B;  3DP6 A;  1OIB A;  4M4G A;  4H67 A;  4ESW A;  4X9T A;  1NH8 A;  1VFE A;  4ZS9 A;  1P1Q A;  3H6W A;  2DWH A;  1B3G A;  3CG1 A;  1CB6 A;  2XXU A;  1LBB A;  4G8N A;  3QIM A;  1YPN A;  3PPR A;  3ZS6 A;  1LST A;  4QF9 A;  3HHF A;  4OWD A;  3PV0 E;  5F1Q A;  2X7P A;  2B65 A;  2OBG A;  1GR2 A;  3RTW B;  3TOD A;  4MFI A;  4N07 A;  4G68 C;  4IO6 A;  1MQG A;  1B5J A;  1PBP A;  4POX A;  3KGC A;  4RXL A;  3IOU A;  1MXZ A;  3RUM A;  1YTV A;  2V3T A;  2VD2 A;  3N6T A;  1QUK A;  5TU0 A;  1L5T A;  4I1D A;  1B46 A;  4DDD A;  4EQB A;  5AE4 A;  1UTB A;  1M5D A;  3S9L C;  3HHG A;  1LAH E;  1D9V A;  1MM6 A;  1NNT A;  3UP9 A;  1SBP A;  3B6W A;  5ICT A;  3TTL A;  1B5H A;  4X1D A;  4JWX A;  1Y4T A;  3G3F A;  1Y9U A;  3JZJ A;  4I62 A;  3VLV A;  3U1O A;  3MJN A;  1WDN A;  4RY1 A;  3SER A;  3T66 A;  5AA2 D;  2FNC A;  4R9G A;  3LC8 A;  5JTY B;  5H8H A;  2YLN A;  3HPI A;  3SEU A;  1OQH A;  3E13 X;  4C1U A;  1GVC A;  1B7Z A;  2HAV A;  4U1Z A;  1NH7 A;  3K02 A;  1Y20 A;  4NMY A;  3BKI B;  5AA1 A;  3C9H A;  3EN3 A;  4Q5T A;  2O69 A;  5FTI A;  2Q89 A;  2XX9 A;  4GVO A;  3T22 A;  1H45 A;  3OEK A;  3KEI A;  2O7I A;  4G77 A;  4LZ8 A;  1LAX A;  3MPL A;  4YMB A;  3K6V A;  3KN8 A;  2R71 A;  3TFL A;  2A5T B;  1MXY A;  1SW5 A;  2HZL A;  2F34 A;  3M3K A;  4NF6 B;  4QSC A;  5FHN A;  4PE5 B;  5I2N A;  1MQJ A;  2DP8 A;  2M8C A;  1B7H A;  2V3Q A;  3R26 A;  3O6I A;  3MVZ A;  5I58 B;  2F6P A;  3KG2 A;  3SEV A;  2RF1 A;  2XXX A;  5IKB A;  3RLF E;  4OET A;  1H44 A;  5FHO A;  3KZG A;  5DYH A;  3TCH A;  3PPQ A;  4EUO A;  5H8F B;  3KSX A;  3U93 A;  4R9F A;  3IO4 A;  3VFJ A;  2AIX A;  1Y3N A;  1SYI A;  2GRV A;  1JVY A;  1II5 A;  1MY3 A;  4ZEB A;  1MG1 A;  3UN6 A;  2RKM A;  4H8I A;  3KBR A;  5I56 B;  3W15 C;  1JET A;  5DEX A;  3TKD A;  1B58 A;  1H3D A;  3Q29 A;  3LSF B;  4MLV A;  4DLD A;  3N94 A;  1EZ9 A;  1FCK A;  1SQY A;  3VVF A;  1UQW A;  4DE8 A;  3I6V A;  4BDL A;  5DVJ A;  2I4B A;  4KQP A;  3M8U A;  3OXN A;  4DCY A;  1TFD A;  5B70 A;  4PFT A;  4RPO A;  2XXI A;  4G2Z A;  3Q26 A;  5KCJ B;  1MPD A;  2DWJ A;  1USY H;  3K1P A;  3CR9 A;  2O6A A;  3C4M A;  4F1Y A;  2KLF A;  3MP8 A;  3PPP A;  4XKN A;  4UA8 A;  4YKI A;  4PP0 A;  1B32 A;  5CM6 A;  1MRP A;  1ZJL A;  3BFU A;  3Q27 A;  3TZA A;  1PBQ A;  1TFA A;  3QYT A;  4XKR A;  3D4G A;  3Q28 A;  4E0W A;  1BIY A;  4LAT A;  4DXU A;  2YJP A;  3EHT A;  4L17 A;  3RT8 A;  3RY3 A;  3MAM A;  5DTB A;  4ZED A;  4GXA A;  3U94 A;  1LFI A;  3P7I A;  4JBZ A;  4YB7 A;  1DPE A;  3IB1 A;  1NNK A;  3O28 A;  4DZ1 A;  2QPQ A;  4F1U A;  4IO4 A;  1VR5 A;  4FIM A;  3CSB A;  2H9B A;  1B3H A;  3CFZ A;  3T96 B;  2R6G E;  4LZ7 A;  1QKB A;  2REG A;  3KOS A;  4Z7E A;  4FE8 A;  2P0S A;  3IX1 A;  3G7W A;  1B3L A;  4H6D A;  1FTO A;  5CMK A;  5I59 B;  4ZE8 A;  1POY 1;  1ELJ A;  2Z8F A;  1VE4 A;  3FJM A;  3I3V A;  3CRB A;  3V5A A;  4R74 A;  4DCX A;  3S4U A;  3K6U A;  4U4X A;  1N04 A;  3OOA A;  1MXV A;  5CBR A;  4MH5 A;  2DXY A;  4GFR A;  5EHS A;  3OD7 A;  1B9J A;  4AQ4 A;  5K2X A;  1KWH A;  2D5W A;  3QAX A;  3FVO A;  3TQL A;  3PUZ E;  2OCU A;  3MQ9 A;  4O3B A;  2GFE A;  1S7Y A;  4ZE9 A;  1LLS A;  3H6U A;  3OMB A;  2H25 A;  3UK4 A;  4JSO A;  3W9V A;  2Z8D A;  1B1H A;  4WED A;  2VHA A;  4GOT A;  1QUJ A;  1BKA A;  1IXI A;  4BDQ A;  4YKK A;  1ZMG A;  5KDT A;  2HFB A;  2F7B A;  1NL5 A;  3L6G A;  1B0L A;  4NE4 A;  5AA2 A;  3H06 B;  3O29 A;  1B3E A;  3CSG A;  4YB6 A;  5JK4 A;  2B3F A;  1MXW A;  4NF8 B;  1GTK A;  5CMC A;  4PFU A;  3SEY A;  5TPA A;  2I0C A;  1A55 A;  1JW5 A;  1URD A;  1TXF A;  3C34 A;  1FW0 A;  4BDR A;  3M3F A;  3RT6 B;  2F5X A;  3SET A;  3T9H B;  1TWY A;  4GRK A;  3TMG A;  4JDF A;  2NXO A;  3EPE A;  3DLN A;  3ZKK A;  4UAC A;  3CFL A;  1FTL A;  4YKJ A;  2XXP A;  3PMX A;  3H6T A;  3MVY A;  2AL4 A;  2NWJ A;  2QS4 A;  2VGQ A;  1SW2 A;  4GL8 A;  1B2H A;  1B7U A;  1NKX A;  3U8Q A;  1P1U A;  3OO6 A;  4RPN A;  3WAF A;  3VVD A;  1JEU A;  4WKM A;  2HXW A;  1NFT A;  4GL0 A;  5A5X B;  3HST A;  5IAI A;  4FAJ A;  3TTN A;  2VOZ A;  2QMW A;  3RNN A;  3G3G A;  1FQE A;  3F11 A;  1N3W A;  4BDN A;  1DSN A;  3MC2 A;  3VXB A;  2UVH A;  4OFJ A;  4NED A;  4HS7 A;  4F2Q A;  1VSO A;  1IXG A;  1QW0 A;  4EQ9 A;  3MWB A;  3TAJ A;  2QL3 A;  3SEW A;  4YAH X;  2X26 A;  4YB5 A;  3LBS A;  3H6V A;  3C31 A;  1NNF A;  3T9U A;  4JB7 A;  5ITO A;  1SW4 A;  4EF2 A;  3PUW E;  2O68 A;  3MW0 A;  1GGG A;  3S9N C;  4HCW A;  1SVX B;  3H7M A;  3ZKL A;  3K2D A;  1R9Q A;  1LAG E;  2VP1 A;  2PX1 A;  2RCB A;  2DSF A;  2I6E A;  3S9M C;  3OO8 A;  5B7D A;  3ZSF A;  4MLQ A;  1MQH A;  1RYX A;  1VFD A;  2E1S A;  3FXR A;  1XVY A;  1B5I A;  4H8J A;  2QRY A;  5JEI A;  4KR5 A;  2UYF A;  3FUZ A;  4DXC A;  1JW4 A;  1OVT A;  3PUY E;  3O2A A;  3G3I A;  5CMM A;  4ZEF A;  2V93 A;  1MY2 A;  1R6Z A;  4GXS B;  2H4I A;  4RK2 A;  2QS3 A;  4XTC Q;  1MXX A;  2Y7W A;  2DE2 A;  1OLC A;  4JXI A;  5H8N B;  2W7Y A;  4ESX A;  2FA7 A;  3IJO B;  1AOV A;  3H3G A;  5L8D A;  5JTY A;  2ZYO A;  5TP9 B;  2HAU A;  1IIT A;  1US4 A;  2ZYM A;  1SDX A;  5BUU A;  2X7Q A;  2DWA A;  4GF8 A;  5AA4 B;  2HZK A;  5HPQ A;  4F3B A;  3BBR A;  3IO6 A;  3O97 A;  2NVU B;  3TCF A;  4EQ7 A;  1DTG A;  5I2N B;  3R7X A;  4ZEK A;  4IGT A;  3S9E A;  2PT1 A;  4C0R A;  1EZP A;  2DWI A;  2I3W A;  5M2V A;  1DPP A;  2ONR A;  3FXU A;  2A5T A;  4KYE A;  4ONY A;  2RC8 A;  4NF6 A;  1B4H A;  2OWS A;  4IO5 A;  3QK6 A;  3KSJ A;  4OFO A;  2RC7 A;  1H76 A;  3LR1 A;  4ND9 A;  5L9S A;  2QS1 A;  1EZO A;  4QFN A;  1T0K A;  2H5Y A;  3A3C A;  1MPB A;  4KHZ E;  2DVZ A;  4KCD A;  4LA9 A;  1FTJ A;  1I6B A;  3IOT A;  1XVX A;  3UOR A;  1ZLQ A;  3LUY A;  3V8X B;  3VV5 A;  4X1B A;  2YPN A;  4TQU Q;  4OEU A;  3JYR A;  4HCY A;  4H65 A;  3QUF A;  5H8F A;  2D3I A;  1XC1 A;  3OO7 A;  1EU8 A;  4BDM A;  3GXA A;  4C1T A;  4Q0C A;  3QUJ A;  2ESN A;  4FAT A;  2WKY A;  1LFG A;  1MY0 A;  3FZV A;  3TTM A;  5I56 A;  4U2R A;  4TLM B;  4X48 A;  2Y84 A;  2DE4 A;  4OZ9 A;  4F22 A;  4R75 A;  1QVS A;  1URG A;  2Z22 A;  4MBP A;  4NF5 B;  4OER A;  2F35 A;  4G68 B;  3TTR A;  4R6H A;  2D21 A;  1YCJ A;  2DVC A;  1ZTY A;  3MP6 A;  3VXC A;  5DVI A;  3RGY A;  3BFT A;  1OMP A;  4OTE A;  5CRY A;  3AXF A;  4U22 A;  1P1W A;  1B6H A;  3ILU B;  5KCJ A;  4F19 A;  1S50 A;  2ZNT A;  3OO9 A;  1Y4C A;  3UGW A;  2XD3 A;  4R6K A;  4WXJ A;  2Q2C A;  4FOR A;  2OWT A;  1JW1 A;  5H8Q B;  4F2O A;  1PDA A;  1WOD A;  3TDJ A;  2G93 A;  2Y7K A;  3IAZ A;  2H98 A;  2DXR A;  1MS7 A;  1LCF A;  2OLB A;  1I6Q A;  4RJZ A;  4QRZ A;  3T9X B;  3IR1 A;  1N3X A;  2QMX A;  1UTH B;  3SKP A;  1HSL A;  3EQ1 A;  3IB0 A;  3FJ7 A;  2ZYN A;  3G3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...