2FO4B

Enhanced mhc class i binding and immune responses through anchor modification of the non-canonical tumor associated muc1-8 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Enhanced major histocompatibility complex class I binding and immune responses through anchor modification of the non-canonical tumour-associated mucin 1-8 peptide
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fo4B00
4J4PA 5D1ZC 4U4BA 1LQSR 3NTCH 2FO1A 3JWNC 3EYFA 4UU9B 2UYLB 5KSAD 2B5IB 3TC9A 4TRPL 4U1LB 2EDXA 3QA3B 4G6KL 4MJIB 2EKSB 5JMOC 4PJFA 5FYJH 4RMUA 3G6JA 5GGTL 3CIQA 1FZKA 4S2SA 2ITCB 4WW2C 5F72S 3BEWA 4NSKA 3IDXL 5ID0B 5D7LD 5DUPL 1D9KD 5ENWA 3QEGL 4X9BA 1JZ2A 5LCVL 3IVKB 2APXA 1C7SA 5JZ7D 4WV1A 4PJGF 1Q94B 4M02A 3QUYA 1KIRB 2FEDD 1XGRA 3VMPA 2G75B 3GO1H 2O5YH 2A6DB 5DRZB 1UWEH 2VR4A 2VXTH 1OGAE 3WLWC 2HMID 4R7DA 1CZ8H 1FCGA 1I1FA 4LCIH 4LVEA 4TVSa 3S98A 4HIIA 1JNJA 1AY1H 3TFKD 1UC6A 1CTOA 3HAEA 3EO0B 3ULUL 3WNLA 2MQ0A 2FLRT 3L9RB 4UMGA 4NRZB 5L8LB 3K7UA 3P4OA 3DMMC 5JXEC 2Z4QB 1NSNH 3SQOL 3H6JA 1JVKA 1RJLA 5KSBF 1UA6L 4G9FD 1BQLL 2H9GA 1HDMA 2EXWC 4P5MA 2CK2A 4F7PA 3QCUH 2Z35B 4M62L 3QRGH 4U1IB 3N1PC 2A1WH 4NO3B 1U91B 5E6YA 4EXPX 3VFRB 3WD5H 3QDHA 4UDTB 2EDOA 1U8LA 5DJDA 3ZYOA 1I7RB 1J86A 2JLLA 1WWCA 3MGOA 1X4XA 4FQQA 4LCYB 5GRJL 3VXSE 3EO9H 3LS5H 3HR5A 3UJTL 1SEQH 5DEFA 4RFOH 5E24E 3SCMB 1ZSDA 3VG9B 3VCLB 3QUZA 5AYUH 4QRRD 5ISZB 4LPUA 5GJTL 2Q8BL 5C0NC 1EGJA 4HULB 1I1YA 3GB7B 2IPUK 3RL1A 1MCRA 5KVDL 1SJHB 3VRIA 5J6GA 4U0RC 3MRQB 5LBSL 5TDNA 3MBEB 1H5BB 1QRND 4OZ4B 4P3WA 3SDCC 2VR9A 1UWGL 4ZXBB 1S9WA 3O4LB 5E1AA 2NQCA 4C4KO 1MREL 1W72L 4DEPC 4XVJL 4LPXA 5JW4R 1ZEAH 2ZOKA 4FQIH 3SDDB 1DN0A 2NY1B 3B5TA 3VFVB 2YD2A 4HSQA 3RJDA 1ZGLB 3HI1B 4FQXA 2HJLB 3QHZH 3CFEA 2BY0A 4R3SA 1WBXA 1UB6A 1PBYA 3ULVH 4LF3A 3ARFB 2HLAB 2PYEE 4Z8FH 1B6UA 3VXMD 5DSCA 4HFUH 1U0QA 4LIQE 4LSPL 4KZDL 3MODH 3UJIL 4G9DB 4H0GA 3F58H 2MCPH 2QJDA 4YHIA 4Z0XB 2WQ8A 1Q9KB 1W2KT 1CD0A 4PJBE 5FGCB 3JVGC 2AEQH 1H9VA 3UBXB 1PJ9A 1UEYA 3VFOA 3PHOB 3V8CA 1D5MB 3O2VH 3U82B 4Q6IC 1XF4B 4ZFOB 3DX8B 2DTMH 5DRXB 3SE4A 1CDBA 1N0LA 3AU1A 3EOTH 5F6HJ 3O0RL 5EUKA 1ORQA 3QUXA 4P2OB 4PGEB 4Y8DC 1RUKL 1AXIB 1YJDC 5IBLC 2QTEA 4KMTH 4KROD 1N26A 2HWZH 3ZTJG 2E7MA 2GW5A 5EC1A 2OK0H 3CC5A 2DQEH 4Y19A 5EUOE 2ESVA 1U2HA 3D2UA 1NFDE 4FQPA 5GGVH 4NNYA 3KYKL 4LRIA 3MCLH 4H20H 4NWUH 3SEPA 3EO1B 3MV7B 3T77A 3ZE1E 5AWNL 5BMFH 3AMLA 3MRPB 4KDVA 4WHTA 2ZG1A 3PQYA 4S1SH 4DCQB 1WC7B 1GZQA 1JP5A 4OGAC 5J13C 3GBML 3TT1H 4YDKL 4RIRB 5JMRA 1JGUL 1RUPH 2IPKB 2X4TB 4NQCD 1T6VN 1EAPA 1L0XA 3BFOA 4HUKB 4PJ8B 2P5ED 2ED7A 5LG1A 2DBJA 4ZPVA 3VXQB 5D93B 4PJXB 7FABH 3RGVD 4QXGL 4O4YL 2O61B 4O2FA 4KJWD 4YXLH 5L9DH 2OCFD 3IFOA 4S11A 3KDMB 1AGEA 1RZ8A 2WBWB 5SX4H 4WGWB 4HUWA 2BSRA 4MNHA 3TYFA 5MHSD 1T2JA 4K3EL 2P43B 2X4NB 2VXQL 5IW3A 2KDGA 3NFPA 3C5ZA 4MXWL 5MI0C 3N0PB 3ZHKA 5A3ID 1ED3A 1DL7L 5K9KB 1WWBX 1ZHLA 2AAVA 5JUEL 2VDML 4JGJA 2OZ4H 5CCKH 1I3RA 1KUMA 4JZNB 1MFBL 3DUSB 5CBAB 1FYTB 3D9AL 2JKXA 4TUKL 3C8DA 2JCCA 5FB8A 3IF1A 3IT8D 4HEPG 3O4OC 4P46D 4V1DB 3ARED 2J4WH 4JPKL 4W4OA 1QBBA 1IM3B 1A6UL 1IL1A 3O3EB 2P5WB 1FVEA 1BIIA 1MWAH 3GI9L 2W0KA 1MLCA 1U8NB 5IBUB 5CJ8A 1U93B 2E6QA 2P4AB 1I8KA 2LAGB 3TZVC 4U2ZA 2OXHA 4GRWE 2XPGA 1FLRL 1UJ3C 4FXKA 5E08H 2H6PB 1DBML 2HFGH 5HHQA 5E2UL 2HVJA 4X80H 1U3HA 1T03L 3JV5A 3CDGA 4WO4A 3I6GB 1XMWA 3X3FL 5C0CA 4XCFL 2AJXL 2QR0B 5FO9A 1FP5A 3MRBA 4L3CB 3DWTA 5D1QD 4NN7C 4YHML 3S9DB 5HHOB 4U1SA 5GS2D 1GZPB 2FLBT 1MHEB 3PHQB 1U92B 3FT3B 4MD5A 5C07B 4H1LA 4PRID 5D6DC 5D7IF 2GTWB 3NH7H 3S8WA 4XVUD 2GUOA 5KTEH 3RFZC 4PB9L 1CXEA 5FYJE 2BVPB 4G6FD 2Y06L 4JO1L 2EDQA 2QSCL 3AB0B 1KB5H 4PLJC 1WTGT 2OQJB 4JFHE 5TH2A 4F7MA 3QNYA 5F96H 5I74B 3ETBF 5KW9L 1DZBA 3RBGA 1KC5H 5JLZB 4L8BA 1G7HA 4R7NA 4WTZG 4TUJB 5ITBL 4Y2DA 4LLYA 3JWDH 1NC4D 5D7JB 1JPST 3UJJL 1OW0A 2GY7B 1TPXC 2V6HA 4EVNA 3FTGB 4Z76A 2YD5A 1D6VL 3VFUB 1TTUA 3HLAB 3FO9A 2OSLB 2HFEB 3MRFA 3ARDA 5I1CL 12E8H 2J88H 1FO0B 3MV9B 4G7VL 3NACL 3KYNA 5I1GL 1ODAA 4JPIB 1B90A 4URTB 4UUJA 1TLKA 1CFNA 5GSRB 3EDFA 2VL4A 3U1SH 5ADOH 4JFEA 1NAMA 2PXYA 3CH1A 5CINH 1T1XA 1T7VA 4FTVA 3U6RB 5KZCB 1AKJA 3MA9L 4NHCH 4TPRL 5HDBE 4MNQA 4RX4D 2BVOB 3DV6A 5I8OL 4UV4H 2EO9A 4HWZB 1ZHNB 5HI5D 3VRLE 1PAMA 5IQ7H 1Q9OB 5CMAA 5EBWB 2GHWB 2WINB 3ZKMD 3VWKA 5J9PA 3ARBC 5EU3A 4RFEB 4PJ7A 4PJGA 3LHPH 1A4JA 1WBYB 4OGZA 2B5IC 3INUL 4WU7B 5FECB 1BX2A 4C83B 1IEHA 4I1NB 1MI5E 2BSSA 5T1DH 1FNEB 1N5AA 1GHFH 2FR4B 2E7CA 3TV3L 3RI5F 5SWSB 4NHUB 4B53A 1ZLWH 3VD7A 4OF3A 2APWA 2B1HL 25C8H 2CRYA 5KVGH 5IW1A 2FX7H 2DWEB 1YUHB 4JG1H 1MHHA 1TENA 3RWFB 4NQXA 4Q74A 3M17A 4EI5B 3O6LH 4IRJA 1CD8A 4DGVL 4RNRA 3U0PA 4ZO9A 3QR2A 1AO7D 3VFGL 5TJWK 3NCMA 3ULVE 4EUPA 1LK3L 1OCWH 2XZCH 5CJOL 5BVPL 4M5YH 4M6ML 1NMAH 5F7EL 2PKDA 3HC0A 1ZT1A 4KC3B 5C0RH 5IV2B 1UGNA 4O02H 5E99L 1H8OA 5JIHA 3NN8B 4NNXB 2VLKB 1CFSA 3C6SA 1U8PA 3PE9A 5FF6A 3TVMC 3RQ3A 1T3FA 3QQ9C 1UVQB 1FV1A 3VXRA 1U8HB 2P8LA 4OV6F 3H8NA 1HXYB 4FQHB 4FHBD 1EEUA 1FVDB 1ADQH 1KPRA 2IQAA 5FUCC 2PTTA 4Y16C 1EJ6A 3HFMH 5C6TL 2XWBA 4OZHF 1CL7L 2AJVH 2OR9L 1G7IB 2VR5A 4Z7OE 1P4BH 3B3IA 4NPYA 1VESA 2H3NB 3IDYC 4X5WB 1J1PH 3S34H 3DO7B 4P3DB 1WJ3A 1KCRL 1OAKL 3VMOA 2YEZB 4LP5A 4YLQT 4HQQL 1A4KB 1AHWA 4U6XB 1VEPA 3QEQB 5H94A 3MLVH 5DK3A 5AUMA 5JQ6L 3G6AA 4DUWA 3QPXH 1MQKL 1I8IA 3GGWB 4XTRD 2I5YL 1IEBB 1ZLWK 3AY4A 4LSUL 4Z7VE 5DWUL 5CAYB 1ZLSL 5HGAB 3CMGA 4RFNC 2A0LC 2FB4H 4ZXBC 1TQCC 4LLDA 3H0TB 4OT1L 5DA4A 5ALCH 3MRLB 3PP3H 1F42A 4I8DA 2EC8A 2YD3A 1OQXA 4PS4L 1SYVB 5I76A 2YD9A 2AJUL 5C09A 4L1HA 1UM4L 3BZDA 1A2YA 3IDNA 3QO0A 3PWLB 3CSYB 4F7CB 1L4IA 2GK2A 3PWVA 5JW4M 2ZG2A 3OR6B 2D4DA 4R26L 3MRJB 1OF2A 3MR9B 4IOFC 4FQLL 4YIQA 1OGTA 1JRHH 2DQDL 2EICA 4JQVC 1C5BH 5DD3H 4K23L 4BQCA 4MLIA 4QOKD 1PLGL 1YEHL 4CU8A 1X5YA 4TUOA 4DN3H 2FJGB 3N06B 3QNXA 4Y5YA 2C3WA 4P57B 3ARYA 3VFPA 1YZZA 3T3ME 1G0XA 2IBZX 1AXSB 3OR7B 4DKFL 1JYXA 4UOW0 1FL6B 5GQBA 4EI6A 3L3JA 3EFFB 5JW5A 5DURD 4YPJA 1I3GL 1KB9K 3UAJC 1A7PH 5JOPD 4L5FL 1MSPA 4DGYH 2XA8L 4UILH 4QHNB 2IPTL 4X6CE 1NEZG 3OKLB 1OLLA 5HXMA 4Y7MA 5DHVA 3SE8L 2GTZB 3IFLH 3VGGA 1S7RA 2EEBA 1MY7A 2O5ZH 2DTSA 1E28B 3HCVB 3PWPB 5D7LE 2EDYA 2SEBA 3GMNB 2X70A 4NC0B 3RDTB 5GGUA 4PJEF 3GBNL 3VGHA 1YNLL 3QUML 1CBVL 1LP9A 1AR1C 2DD8H 4QLRA 5CEZH 4N8CH 5EU6A 2CSPA 3EFDH 1MCBA 3WFHA 3L7EA 4MQ7A 5EIVA 2ZPKL 5EOQH 4JM4L 1QLFB 4YR6A 3AMKA 4JPVL 3G04B 5CD5D 3L5WA 5EZLA 4MQSB 5KSVA 2EDNA 1KNOB 3N9GL 2VERN 1OM3L 3KAAA 1D6EA 4A6YA 2ZJSH 3MJ7B 4NKDB 2VQ1A 1KJVB 3BUYB 4G9FE 4POZD 4ERSL 3IU4L 1CE6A 3K1DA 4ZFFB 4P4RB 1C12B 1I1RA 8FABA 3KG5A 4OTXL 3CAFA 1MFCH 4BZ2L 1A1MA 2GJ6B 4LGPB 1L7IH 5TE4H 5C9JA 4M4RA 4FNLH 1JF1A 1TVBB 5ELIA 1MH5A 3VMNA 4DJMA 2P7TB 4YEEA 2FBJL 2YHGA 4M03A 3DGGB 4LNRB 4YGAB 2ZCLL 1CDHA 2J6EH 3VFNB 3VWJB 1K8IB 2PO6C 1IAOA 1IFHH 5FYKH 1JHLH 1J7VR 3OXSA 1C8PA 2APVA 4F58L 3ARTA 4LLVB 5L7XH 1U8JA 3MRHB 4GKOA 5IB4B 2QADC 2F15A 1M05B 4QRRE 2X89A 5J3HD 1C16B 2LTQB 2YSSB 3WDHA 4YUEL 2R0ZH 4L4VA 3PGFL 4XPBH 1KV3A 3NFSH 4IJ3C 1J8HA 5IP4A 3DBXB 2XTJE 2EDWA 2YWYA 4D0CB 1JPTL 4JEGB 4LVOC 4PV9B 3TO4A 1QRNE 2D0GA 4WDIA 3VGAB 1T1WA 3O6FA 3L3KA 2R2BA 1BQHG 5DT1H 5EZOL 5CFHA 3X13B 4KAQL 2BJMH 1MCPH 3C6LC 1J05B 1U6AL 3MRKA 4LLQA 4OCXH 4JDTL 1DN2A 2IH3B 2I9TA 1P84K 2MHAA 2YXMA 3LDBB 5DD6A 2X4RA 3E2HB 3MRIA 4I2XE 4AT6B 3PDGA 4KKCD 5I1IL 4GAJH 3S37L 3IJHA 1JZ3A 1W0WB 4YHOH 5HY9A 4BH8B 1IM9B 1KTLA 4LGSB 3V52H 5GGQH 4I18A 2V2XA 43CAA 3BP6B 3AB0C 4I3SH 3SJVE 5I18H 1CLYH 1UM6L 4JFPB 4M8QA 2CLVA 2EO1A 4NKIH 2LU7A 4R96A 5D2NE 3MXVH 4M6OL 4EN3C 3HUJF 4FZ8H 2HTLD 4X4MA 5FV1L 1FIEA 1L6XA 1QSFB 1T04A 1N6VA 4PP1C 2WZPD 4R90L 5KG9A 4LP4A 1UKQA 1MRCH 2K7PA 1CT8A 4Q0XL 1G6RH 5I1LA 4HPOL 2F54B 2Q86A 4NGHL 4YXKL 2Y9RT 5DJXB 2W92A 2WBJC 3WFBH 1KJ3L 1IT9H 1OPGH 3WFEL 5GRVK 3MLSH 3SGDI 1K5NB 1JFQH 1YEEL 5IB2A 1QFWM 5GGVY 1RZKC 2QHRH 3WN5A 3EYFB 4D8PA 2J7LA 4U1HA 2E8ZA 1N6QL 1MCHA 1X7QA 4P5TA 4Q6YA 15C8H 4ONHA 4HIJA 3G6JB 1WICA 3QCVL 1FZKB 3RA7H 3BEWB 4NSKB 3BISA 4RGNC 5C0BA 1R5IA 2NY4C 1IKFL 4NQCE 1RIHH 2IAND 2P5EE 5F7UA 2R2HB 5JIKA 5GZNC 4ENEC 5CJ5A 3DUHA 4AEFA 2RFXA 3LQAH 1FNGB 3MRDA 2OS7A 1SJXA 4OB5H 3DETD 4HIIB 3Q2CA 2YPVH 5K33A 3GJEA 1JGLL 4NUGL 4NQED 4M48H 3P4OB 4ETQB 3E6HA 1KEGH 1UWEL 3RU8L 4MVBC 4OF6A 4PJIA 3AXLA 3QXDA 2FL5A 3UPRA 1IZKA 1CZ8L 3OKEA 5GGTA 2P48B 4GAYA 1H0DA 1KN2L 5AD0A 1QSVA 4OZFG 5T5NF 1S7VA 5B3NA 1X9QA 3O2DH 2H9GB 1HDMB 4P5MB 3UO1H 3ES6B 4F7PB 3RWJA 1IGMH 4R4NC 4R2GC 1MUJA 1QHOA 1NSNL 3VXPA 1V3MA 1KBGL 4NQTA 4MS8D 3QIBC 4FFVC 1RMFH 5DJDB 1U8LB 4H25B 4KDTA 5F97E 2H2PD 4P9HC 2DLEA 3QCUL 4N1CA 3MGOB 1IAIM 3QRGL 5TPWL 4FQQB 1V3JA 1XIWA 4X5LA 1IKNA 5HVWA 3L95A 3HR5B 2YMXH 1J87A 1T0MA 2I27N 5DEFB 1H3GA 3ECBA 4JG0H 2X9WA 4G6MH 1RJCA 4M7ZB 1IC7H 3W0WD 3VDAA 1IGJB 2ATPA 3HNSL 1Q0YH 4Z0BH 4X8JB 4OZHA 2PCPA 4XCYB 1A6WH 1I1YB 3C5JA 2VE6A 2BVEA 4RMSA 4CVWA 4WUUA 1SEQL 3UTSA 3VRIB 1S7UB 4W68A 5J6GB 4RFOL 3SKMA 3HRZA 5TDNB 3S36H 5AYUL 3WJJC 5B3JF 4JY6A 2CD0A 2MQCA 5INCA 2NY5C 4DZBA 1S9WB 5E1AB 3SO3B 4PRIE 5CIPB 1YMMA 4MXVF 4P23A 4OCRH 4YBHA 1VKXA 2ZOKB 3I50L 4NO5A 3CFEB 4R3SB 3KPRD 1WBXB 3RTQC 1KLGA 1SM3H 5IVNA 1WBZA 4XMLH 2MTPA 3PIQA 2QBWA 2NXYB 4KTYA 3UBXI 1H3UA 4FQIL 1E4XL 5DSCB 2P46B 2UUDH 5CJQH 3BGAA 2NX5B 5CGTA 1BFOA 2APTA 3BPLC 3S36X 4J3XA 4O2CA 3O41A 3VXMA 2IEPA 1UENA 4Z8FL 4ZNCD 1W72A 3BIBX 4MMZC 3MOQA 3DHMA 4HFUL 3IKCA 2XV6B 3VFOB 1URLA 2FX8H 4ETYA 2NY3C 2Z91B 3OG6B 5H35A 5JHDA 3MODL 4XPGH 4OLXH 4RMVA 3UC0H 5D2LF 3AU1B 1I9RH 4PGDB 3WLBA 3H42H 4HWEH 2NY2D 4GRLC 2OL3H 3BD4A 4EEEA 3L6FA 3HTLX 4TOYH 2PTVA 3O2VL 3CC5B 3K80A 1CLZL 4Y19B 1UZ8B 1WZ1H 3FO0H 3D2UB 3EOTL 3GZKA 4JZJC 4NNYB 1GOFA 4KMTL 3T77B 4S1RH 4NC2B 4WHTB 2HWZL 2ZOLA 3PQYB 3VW3L 2OK0L 2D0FA 1GZQB 2P24A 1MEXL 4PJEA 3UTQA 3RVTD 3MCLL 4H20L 4UI2A 1DBBH 1EAPB 4NWUL 4P2RD 5A2LH 3TEUA 2NYYC 5BMFL 1VFOA 2R0KH 4ZPVB 1HZHL 2Y6SD 3BE1H 1FZOA 3RWIA 2D7TL 1JUFA 3TT1L 3I02B 4OGAD 4KZEH 3T1WA 1FL5A 3IFOB 4RDQG 2B39A 3ARSA 1AGEB 3QIWC 5FFLA 1I1CA 1MCFA 4HUWB 2BSRB 3RGVA 4HF5H 4M1GL 3DURB 1V05A 4KJQC 4WY7H 3VFMB 4HK0A 4GLRI 1XCTA 1CDIA 3QT2A 3NFPB 5DVMA 7FABL 4UAOC 3QQ3A 1X5KA 4HAGA 3VI4E 1ED3B 3VGEA 4S10A 1R3IH 3QFDB 3CSGA 4RISH 4XNQA 4E0RB 1ZHLB 4LFHG 4LPVA 3O6MH 3ABZA 1AO7E 3J7HA 4G5ZH 1RU9L 4JRXA 1MFDH 2AXGA 3T04D 3X11B 5I1EH 2QHLA 5MEND 3LY6A 4Y5XC 4JFQA 1ZT7B 2JCCB 2C9AA 4ONGH 5FB8B 3IF1B 1RPQA 4XI5C 1ULVA 3QWRA 5BOPA 5C0AD 5CCKL 4EXKA 2OZ4L 4YZFE 3EJYC 3T0AA 5A2JH 3L3IA 5DJZA 2ITDB 4B0MM 1P7HL 3R0NA 1SVCP 2DI8A 3AREA 1MLCB 5EWIL 3B9KD 1EUUA 2UZIL 5IR1A 3RZCA 3CPLB 2B1AL 1T83C 1I8KB 3UYOD 4IIQC 2XPGB 5IHUH 4FXKB 1NAKH 4XBEH 3L3GA 4X4XA 2HVJB 1MWAL 1NCWL 3K8KA 3IFPA 2AEPH 2CR6A 3CDGB 4YHNA 5FO9B 3MRBB 2HJKA 5IFJA 3C60B 2CRZA 3B9AA 2ZSWA 4DK6A 3NA9H 2RCSH 2HFGL 3LEVL 2WWKT 4H1LB 4OQ1A 2Q8AH 3VFTA 4E41B 4OIAA 3IJYA 1B3JA 1FPTH 1MIEH 3MRNA 4C56A 4LVHC 1SYSA 5EUOF 1YPZE 2JIXA 4PJAE 4OF0A 1NFDF 4AQ1B 3RVVD 5TH2B 5I2IA 1PZUB 1B88A 3WKNA 1RZJH 4OIBA 2IBZY 2FO4A 3ZE1F 5EOTA 5KTEL 4L8BB 5T33H 4EDWH 4Y2OA 4HZLA 5FYJU 3RIFF 4R6UA 2HKHH 4JFYA 3L5HA 3PDOB 1KB5L 4LLYB 5GRZA 5IK3A 3K74B 2Y5EA 1TJGH 1T1YA 5FGRA 4GAGL 4HLJA 4EVNB 5K59E 1KC5L 4OCSH 3FO9B 3F7VB 4PY7A 3HUJA 4N68A 1DBJH 1HYSC 4G43A 4QOKE 3JWDL 1P7QB 2R2EA 4TYUA 3D39A 5IMLB 3V5KA 4RAUA 1TZIB 1A1OA 3IDJB 3O81A 1CFNB 5GJSH 5I30H 1P1ZB 3QI9A 4Y4FB 4NQSA 1EO7A 2PXYB 4YXHH 5A40E 4PPTA 4FTVB 2J88L 3RY6C 5J57B 1BD2D 1W0VB 3EYSH 1AKJB 3B2VL 4ZDHA 5IVOA 3DV6B 5ADOL 3U1SL 4U7MA 2NZ9C 3MLZL 1BJ1H 2DDQH 4QTHA 4P3CH 5CINL 5CMAB 4XNMA 4IDJH 1GH7A 4L3EE 3U0TB 1C5CL 1TNNA 3HRPA 32C2A 3VWKB 5E6IA 4J4PC 3ZYIA 5EU3B 4UV4L 2VDLH 3U9PH 4PJ7B 4KRPC 4PJGB 4F15C 1VB9A 1BX2B 3ZTJH 1BF2A 2B20A 1CD9B 1HXMB 3CFCH 2BSSB 2XA3A 1QR1B 1N5AB 1GIGH 4NQDD 2XACC 1JTPA 4GRWF 2VN7A 1YN7A 1KEMH 4HLZG 2VQUA 4KMLB 3LHPL 4LQFL 1QG3A 4G6JL 1QA9B 2DRUA 3Q3GA 3ARQA 4P9ML 3CUPA 4WV1C 4MJID 3QUYC 1T4KA 3UTTB 5LJYH 1KCVL 4MDIA 4NQXB 3F7RA 4WI6A 2IAMC 4IRSA 4K8RC 4IRJB 1FDLH 1UJTA 4PTUA 4YK4B 5IT2H 5KSBB 2WP3T 5FEBA 3U0PB 3UYRH 3WHE1 3O11B 2YKLH 4EUPB 25C8L 5JPNA 4PY8J 4NQVB 1BVLB 4X6BB 4X83A 1CDYA 4JG1L 4Z7NE 2VH5L 2X2YA 1ZT1B 4U6HB 3O6LL 4CGTA 1M7IA 5C9KA 3IDUA 4KQ3L 1AJ7L 1YJDH 3VG0L 2EH7H 1OCWL 2XZCL 5FM8A 1T3FB 2HT2C 5EN2A 1FV1B 1MVUA 1NMAL 1UKTA 3VXRB 2P8LB 5F9JB 3C08L 3KPTA 3D87B 5IESH 5C0RL 2EYTA 4GQ9H 1CGSL 5D71L 4O02L 1I1AA 1FORL 3RVWD 1EXUB 4K9EC 3JUYA 2IQAB 2PTTB 1A9EA 5HDQH 4PJDE 4YDLB 2MKLC 4YAQA 3FQRB 2DQTH 2C1OA 4F37F 4DZ8A 2AQ1A 4NPYB 4K7PX 3LQZA 2GJZA 1ADQL 3TPUA 3HFML 3F7PC 3HAEG 3QUZC 2AJVL 4IOIA 2ICWJ 2NXZB 4KV5E 4YFLF 1A6AA 5I71C 2Q76A 2R8SH 5H94B 2G9HA 4RWYL 1P4BL 1RD6A 5AUMB 1I8IB 1RJYA 5BS0D 3SCMD 1MPAH 3H9SA 5D7KE 4HS8L 3VFWB 5ISZD 1CTNA 3C9NB 2XN9E 4LLDB 5DD1L 3MLVL 2FWOA 2VC2H 1JPSH 2CGRH 4YWGL 3HKFA 4QXWA 4ELMA 1L7TH 3MO1A 1E4KC 3QPXL 5ERWA 5E2TH 5C09B 2APFA 2CPCA 3RNKA 4FQXC 1VADA 3QO0B 1BF8A 4NDMA 3MBED 3BKCH 4P2QE 4ZXBD 2BNUB 3O4LD 1BQHB 5CS7A 3T0EA 4WFHD 1OF2B 5SWZD 4YIQB 5DUBA 4J3WA 5ALCL 1F6LL 1RURH 2COQA 2NXYC 3B8SA 5FGBA 5L2JA 1WIUA 5DEZA 3IAQA 5FM5M 2NY1D 3SDDD 3I75A 3QDGD 2CR3A 4MYWB 1DUZA 3MREB 4PR5A 4TUOB 4XH2B 5D2LA 2XWTA 4LSVL 2VDQH 5DFVC 1OB1B 5H8DA 3QNXB 5GS0L 4NWTL 3FMGH 2VZ3A 2BY1A 3VFPB 4IOFD 1AGCA 3ARFD 1JRHL 5DD3L 3L3JB 4V2CB 1AGDB 1NGPH 3BP4B 1GC1L 4U6VH 1A0QH 3X14A 1I7ZA 5LXGL 4G6AD 1MFNA 5DHVB 3GK8H 3SE4C 3ULVF 1NLBL 4G3YL 2CMRH 3QUXC 4Z7UE 3WIIH 1FFPA 1S7RB 1BFVH 4RQQA 5ESQA 3UAJD 4FA8A 1A7PL 5GS0D 5T3XL 3QQ4B 2MOVA 2B8OT 2X70B 2YPLA 2AABH 2IANE 5DFTA 3ILPB 5C0JB 3BRDA 1LP9B 4P2OD 4LRIC 3GSXA 3E3QC 1QSZA 2O5ZL 4EIGB 1A5FH 4QRPA 2E9WA 1V8HA 2CDEA 4XCNA 4F9LA 1J10A 4XNXH 3WFHB 5HGBA 2V9TA 4M3JA 1K8DA 3L7EB 4MQ7B 1CXKA 4NQEE 2IG2L 5CEZL 4N8CL 1JYVA 3L5WB 5ITFA 5KSVB 3MV7D 1N8ZA 2Y23A 4HIHA 3MJ9L 4HXBL 5CJBA 4Z7OF 5EU4A 1D6EB 4LCWA 3EFDL 4A6YB 2N1KA 2YR3A 4HHAA 1B4JL 1QD0A 3I6LE 5EOQL 4ORGA 3DX7B 3BDYL 1CE6B 4QXUL 2H41A 3QUMA 4H5SA 5TF1L 3W9EA 1GRWA 4PJ8D 5DF0A 4WNQA 4OFPA 3VXOA 5EPMB 1S7SA 8FABB 3C5ZC 1A1MB 1E6JL 1FIGL 4K2UH 3TBWA 3OJ2C 1CWVA 2B0SH 2ICCA 3D3VB 5C9JB 1F00I 2A73A 1MH5B 1D5IL 1LMKA 2DM3A 2FD6H 2K1MA 5EO9A 1MFAL 3PGDA 1IAOB 4XBPA 5ESAB 3UDWA 4I4WA 1MFCL 2IC2A 3RVUC 1L7IL 1U8JB 2UV3A 4GG6A 1DQDH 1ZAGA 3DECA 3W0WE 1JNLL 3GM8A 3IS0X 4GBXA 2J6EL 3MV8A 4KVNL 4L4VB 3GSUA 1JHLL 1PKQA 3IYLW 2ZCKL 5L7XL 4N8PA 4C57C 1X44A 4YHPA 1H8SA 2QADD 3VE0A 5GRVL 5DVOA 4WDIB 3T0XA 4V1DD 5D7IB 3O6FB 2LVEA 2R2BB 3L3KB 4XPBL 4D0DA 1CU4H 4KGJA 2P5WD 3FFCA 2MJWA 1VDGA 1U3HC 2PNDA 2VNCA 4LLQB 4WO4C 1K2DA 3SGDH 2I9TB 3KPRE 5I1JH 2VB5A 4X6CF 3W5MA 5DD6B 5FHBH 3MRIB 1CFBA 1N2RB 3V7AE 2BJML 1MCPL 3IJHB 5D8JH 1XGTB 5HY9B 5HI3C 4N8VG 1KTLB 4OCXL 1CS6A 3GJFH 4I18B 1V5JA 4PGZA 1AH1A 1S78C 2V2XB 2NNAA 4FQJH 1DQJA 4YFEA 3PWUA 5HHOD 3T4YB 1JNHA 2XG5A 2HG5A 3L3DA 3SOBH 4JFZH 5B39A 1AIFB 3HE7C 4MA7L 5C07D 4M8QB 4YHOL 2BZDA 4O51B 5ALBL 4AEIL 3ESVF 4R96B 5C08B 2UY7A 1PYWA 4XNZC 3V52L 1OAZH 2ZKHH 1DVFC 2KQMA 4PJHE 1AGFB 4QRUA 3BGMB 2ZUWA 1A7QH 1MCWM 4X7SH 1DBKL 1T04B 4Y2DC 2R9HD 1MCNA 5KG9B 5D5ME 3AAZA 5J89A 5JIPA 1T7XA 4I3SL 1QSEA 5I18L 1CT8B 4BUHA 1OW0C 5I1LB 4Y88A 3TWCH 2BHZA 3MLWL 4NKIL 1AE6H 5F7MC 1C1EL 5FO7A 3MXVL 2Q86B 3TBVA 4CVXA 4EN3D 1OARH 4FZ8L 1HE7A 3PL6C 2XQYK 2V7NA 2Z8RA 3ARDC 5IB2B 1NUDA 1GJIA 3OB0H 3UEZA 2IFGA 5D7JD 4NZRH 1X7QB 4P5TB 2YA0A 4ONHB 4HIJB 3WS6A 1OPGL 3GSWA 5SV4A 5DK2A 3MLSL 1JFQL 2QQKL 3ARVA 5GRWA 3KJ4B 4GFTB 2QHRL 4NT6A 4AQOA 3W81A 2ZNXA 4WFED 1R5IB 5I1AA 3RP1A 1KXQE 3GKWL 1R3JA 2EKJA 3U4BH 4M7JH 5IJKA 5DGQA 2WANA 5TE6H 3RA7L 4K71B 1UT9A 3MRDB 5KZCD 2R4SL 3EJZD 2NMSA 2Z31C 4U1KA 3VWKC 1RIHL 4R0LB 3S35H 1F4YH 3GJEB 4PP2A 3PABB 2VLMD 2VQTA 3E6HB 3QZWA 1N0XH 3QXDB 3LQAL 1CICA 2FCBA 3DVIA 3OKEB 4LCCA 5D6CB 4GAYB 1H0DB 5DQDH 2KQNA 4F7EA 5AD0B 1R0AH 3CVHH 1DQMH 1NUNB 1S7VB 4M48L 2HT3C 5EB9A 1IQDA 1KEGL 3RWJB 5MENE 4N0UA 1GGIL 1QLRB 1MUJB 4KGLA 5CSZA 3SDAC 3VXPB 2YD1A 1T0PB 3OAYK 1BHGA 4JFOA 3P73B 4IRJC 4HWBH 3UO1L 4DFIA 3TJEH 2ZG3A 1FFRA 1IGML 2P49B 5SWSD 5HGDA 4D9LL 5IMKB 1XIWB 3WXWH 4R2GD 3L95B 1T0MB 3ECBB 2GCYA 4OLWH 3JTSB 1RMFL 1LGVA 4EI5D 5F7DA 2IWGA 2DBLH 4OZHB 1EBPA 4UIKH 3VI3F 2VE6B 1WVZA 2YMXL 4WUUB 3UTSB 4JG0L 4UDUA 4LARH 3SKMB 1I3UA 3HRZB 3REWA 1IC7L 1YN6A 2IFFH 4CW1A 2DN7A 1CGYA 4ZAKA 5INCB 4Z0BL 5ACZB 1A6WL 2VLKD 1Z9SA 2VUYA 5IROA 5A2IH 1YMMB 2EYSA 5D1XC 4P23B 3DO3A 1RI8A 4NC1C 5KVMC 1IQWL 4B7LA 5GHWH 5FUOH 4YQXL 3CK0H 4NO5B 4PRBA 5DVLA 2ID5A 4NN5B 2V2WA 4U3XA 1KLGB 4H8WC 4HFWB 1H8NA 1TZGH 1WBZB 3G5YB 3PIQB 1TXKA 1X5JA 5DJYB 1F2XK 1MRDH 1YYLH 4MNGA 3MUGA 1PEWA 4CDHA 1AHWC 1GGUA 5B8CC 4JKMA 3ZE0E 3I85A 4OUOA 3ZE2F 3RTQD 1RIUH 4O2CB 4XMLL 3CLFH 3I6KB 3U30B 3L3OA 4JM2A 3SE3A 4U3CA 2W07A 4KH2A 3U36B 4AENA 2JB5H 1W72B 2CUHA 1AI1L 2HJFA 4CJ0A 4NO0B 1QTYT 3HN3A 3IKCB 3OXRA 3QEQD 1UCBH 5JHDB 4GW1B 3WIFB 5JHLH 1TJIH 1Y6MR 1X6NA 4CL7A 2AK4A 1HILA 5BZDB 3WLBB 5DJ0B 5L2KE 4ZPTA 5FDWA 3L6FB 1BD2E 2NY3D 3LRHA 1RHHA 4OGXH 2V9RA 4UOJA 1YQ2A 2CIKB 3MA7A 2AGJL 4OZIF 1QKZH 3BQUC 1I9RL 4L8DA 4X6DA 1UB5A 2DKUA 4JFXA 1X4YA 4R97C 3N85H 4KK5C 2OL3L 3CH8A 4Y5YC 1J0JA 4PD4J 2GAZA 3QULA 4TOYL 1WITA 2Y36H 3BKMH 4M9OA 3VU2A 5ANMA 3HB3C 3FO0L 3P11H 4CNIA 1N4XH 1CD1A 3NGBC 4PJEB 3UTQB 4PIRF 3ROLA 3MRRA 1DE4A 3S4SA 1QR4A 1VENA 2XFXA 4LAQH 2VDPH 1LE5A 5GS1C 3SPVA 1FZOB 4BK4A 3RWIB 1JUFB 4HKJA 4NQDE 3LPWA 4P2RA 4ZNEE 5J12B 1AGBB 5DRNA 2QEJA 3TCLA 43C9A 1DBBL 1LO4H 3W2DH 4ONOA 3B5GA 4EQ2A 4XWGH 1J5OH 1XCTB 4MJIE 1T20B 1A7OL 1NKRA 1ONQA 2RIKA 5GRXG 5F44A 2JF1A 1F97A 2RGSA 4XNQB 4PGBA 1UH4A 2DQUH 1ZKAA 3PWPD 4O2EA 4HF5L 4OCWH 4NKMB 3BZ4A 3RDTD 5J11B 2GJJA 4WY7L 1CXLA 4WFGD 2X09A 3SGJC 2AXGB 3FKUS 3MV01 1FFOA 4JFQB 4K7PY 4RISL 1LEIB 4OLVH 3PGCB 2AI0L 3V0WL 2W0PA 1A9BB 3FAWA 5T1KA 4QF1B 4CN4A 2PUQT 3L3IB 4XXCA 4QRTA 1JHKH 1MFDL 3WBDA 5I1EL 1NMCB 3ZTNH 3NCJL 2WSKA 5C0AA 5C0DA 1O7SA 4I5BA 5CUSH 2ENYA 4KJPD 3BAEH 4ONGL 3V6ZA 1RZKH 4N0YL 3RKDC 1JCKA 4XI5D 5IR1B 4OZFH 3P0VH 3HZMB 2B4CC 3OKMA 3IXAA 2A9MH 1F8TH 1QP1A 4X4XB 3IFPB 4HT1H 5IF0B 2UZYB 3IJSA 3QIUA 4M93B 2YN5A 4YHNB 2LU3A 1YDPA 4MAYA 2JJWA 2BFVH 4PJCA 2WUCH 2GJ6D 2ZSWB 3DVNB 5IHUL 2OZ4A 3V79C 4XBEL 1AXTH 5JO5A 1T7ZA 3MRNB 4C56B 1R3KA 3BH8A 3VWJD 1SYSB 5CGYD 1TVHB 4PLKC 4HGKC 4LHUA 4UTBH 5BS0E 3P40A 5J1SC 3NA9L 1NMBH 2RCSL 3GBLA 4LSRH 3TO4C 1D5BB 2Q8AL 5I2IB 5ISZE 5DDHB 1QFWI 2FO4B 1FPTL 2E6PA 1MWAA 2X4SA 2JELH 2D4FA 4JFYB 1FYHB 4KK6C 2X4QB 5DMYA 4M7LT 5IK3B 4HJJH 4RA0C 1T1YB 3RL2A 3HI5H 5E56A 1RZJL 1YNTA 3O4LE 4KI1A 4JFFB 4WFHE 5SWZE 2C3HA 3FHAA 2DQCH 3T1FA 4PY7B 3HUJB 1CFTA 4LPCA 4ONFH 2ZUQB 5F3BA 3QDGE 1JMXA 1DDHA 4G43B 3OB8A 2R2EB 3IDGB 3CLEH 2A6KB 3D39B 4MA1C 3V5KB 1MCOH 4RAUB 1RJZA 3EUUA 5FCUH 3QI9B 2BERA 4NQSB 4OCSL 4JKLA 1G9NC 4EOWH 3VI4F 4PG9A 1DBJL 1N7MH 1IM9D 4XAKD 1G6VK 5T3ZD 1KB5A 5GJSL 4ZDHB 5I30L 1KJ2H 2IQ9H 2WK2A 4YO0A 4QTHB 1CLCA 4OUUB 5F3HA 3EYSL 2HTKC 3IDMA 4XNMB 4M6NL 3WCYA 3QDJB 2NY5H 1FHGA 1MF2H 4Z7WF 2VXSL 32C2B 5E6IB 1T1ZB 4X6FB 3B4NA 2VSDA 3WN5C 1LEGA 1G0DA 2NZ9D 1LDSA 3GUTB 1BQSA 2F54D 2VKWA 1SHMA 4X5XA 3DV4B 5I75B 4IDJL 1BM3H 1IAII 4LPTA 5DYOA 1FAIH 4OZGE 5KSAC 1IBGH 4J4PD 2VDLL 1YN7B 1EZVX 2EIZA 3U9PL 1T89A 4PREA 3MOBH 2NTFB 4MJ6A 3CUPB 3GMRB 4WGVB 3VH8G 1RULH 2R2CA 1T4KB 1E4WL 1GIGL 1BPVA 2FRGP 5E4EB 4MDIB 2UYLA 4U7KA 1RVFH 1KEML 4CAGA 5JZ7C 3QA3A 4PTUB 4K94H 2FEDC 1CVRA 4JVPA 5GS3A 3T2PA 1J12A 1OAUL 2HMIC 5GISH 5ID0A 1YPZF 3TFKC 4PJAF 1FDLL 5C3TA 1M7IB 4K8RD 4Y5VC 5IT2L 5JOEA 2VXUH 1CGWA 3UYRL 1KIRA 2GIYA 5E95B 2G75A 1T22A 2YKLL 4DOHB 3KNBB 1LO2L 2AJSH 1MVUB 2EDHA 1NCAH 3P9MB 1CE1H 2D03H 2V7HA 3BXNB 2EYTB 4EBQL 2VAAA 4AZ8A 1I1AB 4HCRH 3FCTB 5D96B 3L9RA 1PQZA 1A9EB 3BSZH 5E00A 2EH7L 4ODSL 1OQOA 5I15H 3ULUC 2HT2D 4YAQB 2C1OB 5CKGA 5IESL 4YHZH 1E6OH 4GQ9L 2EIDA 4XP6H 1EDQA 4DZ8B 5CEYA 5ICYA 1YYMH 1YQVH 1WT5C 4V1DE 3EYUH 3TPUB 1Q0XH 5HDQL 1IJ9A 1TZHA 2Z35A 4Y0GA 2F58H 1FZMA 2D7PA 3QB7C 4IOIB 4ZOBA 4QRQB 1A6AB 2P5WE 1SEBB 2DQTL 5TFSH 3RI5K 3JV6A 2DMKA 2Q76B 4HDIA 3O6KH 4UDTA 1I7RA 1RJYB 1F3DH 1U8IA 2DMCA 1XR8B 5DC9B 3O9WB 5FUZH 5JDSB 3OHXA 4E42A 4RAHA 3H9SB 3QUZD 5F88A 3QXTA 1U3JA 2P45B 5KOMC 4B50A 3LEYL 2FWOB 3SE9H 3VCLA 4ELMB 3MO1B 5ERWB 1BWMA 4JFDA 3GSQB 1INDH 3RNKB 4NDMB 3TN0B 5IIEA 5HHOE 3P9LB 1ADQA 2F19H 4PFEA 2FIKA 4M1DH 2XG4A 3WUWG 4Q9RH 5C07E 3T0EB 1WLHA 1WK0A 5DUBB 3RAJH 2CGRL 3GHEH 2B2XH 5L2JB 1FAKT 1L7TL 1LDPH 5E2TL 2YZ8A 1KG0A 3I75B 4CU7A 4DK3A 2P1YA 3E6FA 3LS4H 5L88H 1MJUH 4FQXD 3OAUH 4PR5B 3HZKA 5D2LB 2XWTB 3CFBB 1I4FA 2AQ2A 2DJSA 1S9YA 3MQIA 3BJ91 3SDDA 1AGCB 3M1BB 1RURL 2AJYH 2NXYD 2HJLA 1B4RA 1J0KA 3KPNA 4OZIA 3BZEA 4H0HB 4QXTA 2NX5D 4PG2A 1I7ZB 2VDQL 3LKSA 5GGSA 2HLAA 4YGVA 3FMGL 4QHUB 1FFNA 1BMGA 5D2NC 1F3JA 2NY7L 4N90D 3BWAB 5D72H 4KK9D 1FFPB 3WDIA 5IFHH 1JWMA 5ESQB 4RQQB 2YA1A 1ITBB 4U6VL 1A0QL 2CRMA 3M8OH 3NIFE 5FOJA 1Q9KA 3GK8L 3FO2A 3HE6A 4XAWH 1IE5A 4B5EA 2CMRL 3BZFA 3WIIL 2DF3A 3G5ZA 1YNKL 4I77H 4QRPB 5DRXA 2CDEB 4XCNB 3DGCR 4RGNE 2W0FA 3Q5TA 4P2OA 1K3IA 4Y19D 1OWRM 5E9DA 2ESVD 1B0RA 3K8LA 1JWSB 3D2UD 3F6LA 2VLME 4PJDF 3M07A 1A5FL 1N8ZB 1DLHA 3CU1A 4HIHB 1AQKH 3JV0A 5HGHB 4W70A 3O3BB 3ORJA 4LCWB 5EU4B 1WEJH 4OIIL 4TVPD 3NPSC 3PQYD 4DN4L 4HHAB 3ESUF 4XNXL 1G9ML 1CFQB 4QGTA 1FGNH 3HC4L 2LABA 4ORGB 1NCDH 4PRPA 3MV7A 1IAKA 4JVWA 2E9BA 1J8KA 3QUMB 4H5SB 3RGVC 4FN0A 4DCQA 4UNTA 5KVFH 4KJWC 3VXOB 5KS9E 4JJHA 2GYSA 1S7SB 1Z9LA 3BX7C 4HLZH 2IPKA 2I24N 5T3ZH 4BQ9A 3TBWB 3A6BH 2L0DA 5IM7B 2Z0BA 1UZ6E 5L6YH 3OWEA 3KXFA 4LEXH 3VDBA 5D7SL 5I16B 3VXQA 1U2CA 1ZS8A 3LKRB 2OX5A 4PJXA 5EO9B 5SWSE 2ZWLT 2WUBH 5A3IC 3OG4B 2WM0A 5J4MA 4KKLD 4XBPB 1JI1A 4K2UL 4HJGB 4GG6B 1T5WA 5EIIB 5HYIA 1VGKA 5TQ2H 2X4NA 4LVNC 1U8OA 2FD6L 5J1TC 4GBXB 3MV8B 5DMGC 3GSUB 1PKQB 4DVRH 5CP3H 5K9KA 4KVCL 4PRNA 1WQVT 4P46C 3AREC 1NGQH 1HQRB 5D70H 3VE0B 4PJ9A 3DUSA 6FABH 1FYTA 3RZCC 1H3XA 4YBLB 2OJEB 3GMQA 4Z18A 4S1DC 2VLKE 4D0DB 3FFCB 3W11D 5EUOB 1A47A 2DM4A 1NFDB 3SBWC 5HHNB 1RK0A 2VKXA 5E7BA 3A6OA 2MCG1 1CU4L 4Y4HA 3ZL4L 4Z7UF 3D85B 1HHHA 1JHTA 2J6EA 2XYCA 1U3HD 5TE7H 4K8RH 1INEL 1NC2A 5C0CD 4IMKA 4M4PA 4DKDC 4XVTH 2H6PA 2NNAB 3FJTA 3HAEH 3U7WH 1DQJB 3PWUB 5FHBL 1JNHB 2HG5B 5B39B 4LU5L 3MPCA 2DB8A 1A3RH 3WE6A 3TNNA 1YA5A 1UXWA 1SMOA 3W39A 4WW2F 5FAAA 1P5VA 1PYWB 3QEQE 3GMLA 4QRUB 1TCMA 4FQJL 3PHQA 2X4OB 3AAZB 5B4MD 4JFZL 3EGSB 5J56B 1QSEB 2GQHA 1N3NA 2CO6B 1FZJA 3IFNH 5FO7B 2A9NH 5DQ9A 1DLFH 5FYLD 2BVPA 1OAZL 1XEDA 2ZKHL 1BBDH 2V7NB 4RSVA 5GIRA 4F33B 1A7QL 2AERT 4X7SL 4APQA 2OQJA 1MJJB 3RKPA 4KHXL 1CDJA 3KS0H 2H32H 2XOTA 4NP4H 3SN6N 4NCC2 2AV1A 3MCG1 3NABL 3BGFB 5JLZA 1AE6L 4MB5A 1OARL 4TUJA 2Y5TA 4XPFL 3GSWB 5DK2B 1FH5H 4Z7WA 2K3TA 1YECL 4O00A 4NT6B 3QDMA 3VFUA 5I1AB 5TDOB 1EGJH 4OM0H 1R3JB 5C2UB 3NCCB 3MV9A 1BGXL 3TM6A 4JFED 2PXYD 4XGZA 4JPIA 4FZEL 5J8OA 2PW2B 4FTVD 2G5BA 3KPQA 1XCQB 4GRWB 1LO3H 1T6WA 3KLAB 1AKJD 3RPKA 3V2AR 4U1KB 1MIMH 1A6VL 3FHQA 4L29B 4MNQD 4PP2B 1RZ7H 4N9OB 5EG6C 3U4BL 1G6RA 3FB5B 4PUBH 5IOPB 5F7HA 4M7JL 3QZWB 4PGJA 5TE6L 1RQ5A 2DM7A 3ZKMC 1CICB 4M43H 2KZ1B 4LCCB 5BRZE 5I75C 1DTUA 4JHAH 4X7CC 4F7EB 5MEPB 1YC7A 4GS7B 3S35L 1F4YL 3VWKD 3GMOA 5CD3B 1Q9OA 4NZDA 2XZQH 3TA3A 2CDGA 4OQTH 4WFGE 2R23A 3ZO0A 1IQDB 1N0XL 4UINH 5HDOA 3ZKXB 4N0UB 4UNUA 1EUTA 3K4DA 4TQEL 1MHPL 5CSZB 1CFVH 1YEJH 1R0AL 2D9CA 5F1SA 1DQML 1WBYA 5DTFA 2BC4A 4IRSC 4RCAA 4JO3H 1ZXQA 5KJRL 5HGDB 1FNEA 5DMIH 3U46A 1UWXK 3FN0H 2DLFH 2FGWH 4JO4L 3GNML 2ED9A 2FR4A 1IC4H 1U8MA 1Y6KR 1DFBH 4M9PA 2IF7A 5F7DB 4NHUA 4IRJD 4UB0H 4NYLA 1F6AA 1VERA 2NZIA 1P2CA 3MNVA 3WXWL 5F7KC 2YWZA 1QO3B 5MP6H 3QCTH 2EDRA 4UDUB 4OLWL 5B22A 4OM1H 5F9WC 1YN6B 4CW1B 2GJ6E 1I1AC 4ZAKB 4CJ1A 1L9MA 5EO1A 4J1UA 4M7KH 3FQNA 4JZOA 2EYSB 4UV7H 3LKOB 5ETUA 1OAQH 5IV2A 3TH3T 3MNZA 3G5XA 4LARL 3VXRD 1JI2A 1NKOA 4PRBB 2IFFL 3NN8A 4NNXA 4Q9BA 2V2WB 1NQBA 1CG9B 2BSED 4NRYB 3C09C 3QAZB 4R4BA 1UVQA 4QHKJ 5DMKA 3F62A 5IHZA 4XHJD 5AYQA 5GHWL 5FUOL 3CK0L 3G5VA 3LB6C 4G80A 3VXUA 5IGXH 1TZGL 2AK1H 1WV7T 5DHYA 4JM2B 4P4KA 1TJHH 1G7IA 1VFBA 2P47B 1MRDL 1YYLL 4AENB 2A6JB 3QFJA 4FXGA 4ODTL 3ZHLA 2NXZD 2HJFB 4J3UA 4OCYH 3OXRB 4X5WA 2R0WH 4XTRC 3I2CH 5SWQA 2FX9L 1RIUL 5EH1A 1HIMH 4XT1C 4NO2A 2AK4B 1HILB 2JB5L 5DRWA 4U6XA 5HVGB 3ARGA 1OSPL 4X9IA 4TSAL 2YC1B 4XNYH 4ZPTB 4ZMAT 5IUSA 5FDWB 1AFVH 3GGWA 2DOCA 4U1GB 2XRAH 1V7NL 4XAKE 1RHHB 1EZVY 1TJIL 5C7XH 5T3ZE 5C09D 4NJAH 4L8DB 1GGCH 5EC2B 3H0TA 3JXAA 1UB5B 4KJYA 2OR7A 4NZTH 4A2LA 3T4AA 4JKPL 1NCUA 3QULB 3A6CH 2QQNL 5ANMB 4OGXL 3HS0A 3PWLA 4CNIB 3CSYA 3ZDXE 1M7XA 1CD1B 4BKLA 1G84A 5LGKA 5F7FA 4ODHL 3HG1A 3OGCB 1YMHA 3ROLB 2D7MA 1FN4A 1DE4B 3S4SB 2JJUA 4KKBD 2BSTA 2XFXB 2F54E 3MZGB 3BKML 4MLSA 3SPVB 3S88H 3IRPX 3P11L 4N0RA 1N4XL 1NCCL 4HKJB 3O8XB 4JR9H 4Z5RB 4OI7A 3KPMB 5DRNB 43C9B 3TCLB 1A6PA 3D5OF 3THMH 3OR7A 1F4WH 3CSBA 3G9VA 5F8QC 1FL6A 3OTTA 4J3TA 1T7YA 5GRUH 1GXEA 4MGXA 3BUTA 2OL3A 3P30H 4HUVA 4PJFE 1ONQB 3G6JE 4LSQH 1JPFB 4QHNA 1PY4A 3OKLA 4RMWA 5AZ2H 4PGBB 2F5AL 4POYA 3QDAA 1HSBA 1T5XB 4O2EB 2GTZA 3BZ4B 3DVGA 4TNVK 4XWGL 2BMKA 5FYLH 2VWEE 3STBA 1SY6H 1FFOB 3HCVA 1T66D 3PWPA 4LAJH 3MJ8A 4YE4H 1KYOK 3TIDA 4ZFGL 5E70A 4WWKB 3QHFH 3W9DB 1KTRL 5T1KB 1F90H 1EX0A 1XT5A 3QRFM 5CD5C 4QRTB 1KENL 4LIQH 4NN6B 4XP1H 1A14H 3WMSA 2E7LA 4I5BB 3V6ZB 4HG4J 4Y1AA 5JXAL 3ZE0F 4OLVL 1NFIA 4ZTOH 2H26B 4POZC 3OKMB 3IXAB 3NBNA 2W9EH 3ZTNL 1NAMH 3LH2H 3BMVA 2E9JA 5CUSL 3RX5A 3QIUB 5EZIH 3MJ7A 3CD4A 1T2QH 3P0VL 1YDPB 4MAYB 3K2UL 3UDWC 3GRWH 4RRPG 4L4TA 4WHDA 3QNZA 2A9ML 4JVUA 1F8TL 4ZFFA 4P4RA 3D3VD 4GMTL 4LSSH 4HC1H 5JO5B 4HT1L 5IVXF 1BFSA 1HH9A 3OX8A 1CQYA 1R3KB 3BH8B 4BZ1H 4GSDL 2F53A 4HX1B 2BFVL 2MWCA 2BCKA 1KFAH 4LHUB 4X6CB 2BNQA 2P7TA 5I19H 3OZ9H 4LNRA 2CK0H 1OD9A 2X89D 5DVNA 3VFNA 1A6TA 5DD5H 2XIDA 4RAVA 5LAXB 1MWAB 4L4VD 1EHLH 5D1ZA 3MRHA 4L3AA 1R6VA 4NIKB 1D9KB 5AZEH 5C2BL 2HT4C 1C16A 1NJ9A 3RL2B 4J3SA 5C92A 3DBXA 1IC5H 3WKML 1I9JH 2UZXB 4D0CA 3O6FD 1PG7L 4WW2A 4AK1A 2A6IA 1CFTB 2JELL 5AG9A 5AAMA 5F3BB 3HNVL 4MQXC 4OGYH 1I9IH 4PLOB 3HI5L 1BREA 1RJZB 2GKIA 4KKCC 2CXKA 3X13A 4LRNH 2LQRA 4CMHB 3NAAH 5K9JL 2DQCL 5FXCH 5F6IB 2VXVH 2PETA 4ONFL 4PG9B 4YBQD 2VSCA 5F9OL 3ZDYE 3CLEL 4PJ5A 5EFIB 1KB5B 1U3ZA 4KRLB 4BELD 1J1OL 4JPWL 4O58H 4HH8A 1P4IH 4BH8A 1IM9A 2ICEA 5JXEA 4YO0B 4EOWL 3NFNB 2VDNH 2HTLC 4JN1H 2XQBH 5F3HB 2A74B 4GW5B 3IDMB 4JKWA 3CNKA 4DAGL 4L4JA 3WXVL 5KAQG 3LCYA 3ZHDA 2IQ9L 1LEGB 3IAPA 4DQOH 4OD3L 4PRAA 1LK2B 3FFDB 5HHMD 1C7TA 2HTKD 3U4AA 1QSFA 4UBDC 3WS6C 1MF2L 4NNPH 3B83A 3FQUB 3LD8C 4QRRB 1BZ9B 5DYOB 4PD4K 4ODVH 4Y19E 2YS4A 2ESVE 1FRGH 5E8NB 5FHAL 1N6UA 2XI9A 4PREB 4FABH 2XTJB 4XRCA 4MJ6B 5IFAL 5CJXC 1K5NA 4P5TD 1BM3L 4DVBB 4TVPE 1Z3GH 3PQYE 2D7QA 2X1XR 1IBGL 3LSOA 4NM4L 1NPUA 5C0BD 4J6RL 3MOBL 1RULL 3NIDF 4GXVL 2FIRT 1ZLUH 3SKJL 1GAFH 3DETC 3SDCA 2VLJA 4BSVB 4K94L 2R2HA 1JNNH 2XY1A 4FP8H 1T22B 4IBLT 2KPNA 1FNGA 5GISL 2V7HB 5HYEA 2VAAB 2DMBA 1M1SA 2NY6B 2VXUL 1M6OA 4XMPH 4HW6A 1PQZB 5IB3A 3V0AC 3SJVB 4ETQA 5JDJA 3QG6A 5E00B 4JJ5B 1FE8H 1EVTC 4ZUUA 1NCAL 2D03L 4AEHH 4QGYA 4MS8C 3S3PA 2C4FT 3BH9A 2JCCE 4HCRL 5CEYB 5ICYB 3H9HA 5J0BA 1XZ0A 2EE9A 2H2PC 3JWOL 2DS4A 3ES6A 4K3DH 4LHJB 1HHJB 1TZHB 4AIOA 4UT9L 1FZMB 5I15L 4KROB 1CL7I 3ULUD 5A16A 1H3PL 3JV6B 5J6HA 1KTKE 1E6OL 5JR1H 2L7UA 4HDIB 4Q6IA 1P6FA 1IGTA 1XIWD 4NRXA 1YYML 3SDXF 1TETH 1YQVL 2EZ0C 4H25A 1U8IB 3EYUL 5I6XC 1Q0XL 3OHXB 4G8FA 3MCKA 4E42B 2F58L 1JGDA 1XF5A 5F88B 1QEWA 5C0GA 4DKEH 2MPAH 3QISA 2J8HA 5IQ9A 4M7LH 5IROC 4KI5C 3O6KL 3ROOA 5EO0A 1JZ4A 4WUUD 5C0CE 3UTSD 1MCSA 3TIEA 4JFDB 4WCYH 3QUKA 1IGJA 3R4DA 1HINL 2CJUH 2XXMB 3V4VL 5FUZL 2IPUG 4X8JA 4XCYA 5IIEB 2LVCA 3K81A 4OFVA 2FIKB 2BVUA 1ZLUK 5FV2A 2X1OA 4Z95H 1S7UA 1WFOA 3BKJL 1C5DA 1YMMD 4KTDL 4U31A 3V6OA 1QFUL 4P23D 1BZ7A 2VLLB 3RUGF 5C1MB 1KG0B 3V5HB 3BPOC 4OZGF 2FH8A 1INDL 3E6FB 3P0YL 1I8MA 4QCIB 3HZKB 5CIPA 1EFXA 5ACLA 4G8GA 1I4FB 4Z7QE 4M1DL 1AP2A 2XT1B 4Q9RL 2F8VA 1S9YB 5A1AA 1A64A 4JM2C 4QTIH 2ARJB 2EC9U 3RAJL 3SE3C 3X17A 5IWLC 3LZFH 5FYLE 2B4CH 1TMCB 2E27H 2OLDA 4NKQB 3WFDH 3KPNB 3CDCA 1GGYA 3LS4L 4F37K 5L88L 3BZEB 4OZIB 4QXTB 3LKSB 5GGSB 4YGVB 5I1KH 5JORA 2BRRL 4MCYA 1FFNB 4P49A 4UTAH 1KCLA 3MLUH 1F3JB 1QYGH 4OF7A 4IMLB 2NX5A 1WGOA 2IBGA 1JWMB 4C59B 3QEHA 1CI5A 4NO0D 1II4E 2X44D 3OKOA 5J1AA 4XXDA 3WIHH 5JHDD 3DPBA 2NY2C 2C26A 3FO2B 3HE6B 1U95A 3BZFB 3NCEB 5E0QA 2R0LL 3AS3A 4JFEE 1R24A 2HFFA 2Z91A 5IFHL 3G5ZB 3U83A 1FL3A 4FTVE 3PWNB 1OAXL 3DNKA 3Q5OA 3V6FA 2W0FB 1KIUA 4HMEA 2QQLH 4PGDA 2PR4L 5E9DB 1B0RB 4MNQE 4XAWL 3V7AG 5BO1H 2IMNA 1J0YA 3FZUC 5C71A 4LLWA 4OKVA 2G60H 4WTZA 4I77L 4KU1A 1DLHB 1UZ8A 5D1QB 1OP5H 2BRQA 1XGYL 3TZVA 4F80A 2UWEF 1UJ3A 3RVTC 5I0DA 4QEGA 4XPAH 3V8OA 1QPXA 1B2WH 4PRPB 1IAKB 2HH0H 1NGYB 1UG9A 4PJ7E 4PJGE 2Y6SC 5E94A 1S7XB 5EOCH 4X7DC 1B0WA 5DS8A 1GL4B 1WEJL 1S7WA 1NCDL 5D6DA 1G9NH 3KXFB 2V5SA 4F9PC 1ZS8B 3GFUA 4LKCB 2ERJC 5KVFL 3I02A 5HBBA 4HBCL 1QFPA 1ZVSB 3ZKSD 1AD0A 1T5WB 3FONB 1EERB 1VGKB 4KUZL 5L6YL 3DURA 4D0BA 4LEXL 3GSNH 5K93A 3VFMA 5KSBE 1U8OB 1E27A 2WUBL 5CZVL 4TSBH 4JQXC 5TQ0H 4XXCC 9CGTA 3MZTA 4JRXD 3QFDA 4E0RA 4PRNB 1PG7X 1MNUH 1TFHA 5EORH 4DTGL 2C5DC 4PJ9B 5TQ2L 1RZFH 3QWRD 4PRHA 4YHLH 4FQ2H 3X11A 3GMQB 5IVXA 2ADJA 3CFJA 1ZT7A 3B9KC 1BJ1J 5DMGD 2GSGB 1HNFA 2CXGA 1QQDB 1RUAH 3VXRE 3BVNA 3PXJA 6FABL 3WFCL 1QFOA 3RZCD 1RK0B 1GOHA 2ITDA 4HPYH 2QKIA 3VRJB 3V4UH 3MLYH 4S1DD 3MBXH 4Y4HB 2FECL 5F1NB 5IHBA 4NC1E 1HHHB 1JHTB 3CPLA 1QLEL 3TPKA 4RGMC 5INDB 1BBJB 1NC2B 2J5LB 1Y18A 1P9MA 3NIFF 4S0TD 3BW9B 3FT2A 5I0ZA 1GOGA 2WAHA 3EOBB 4TRPH 5CBEA 3QBTB 4G6KH 5IB5B 1J88A 3WE6B 3DXAA 3TNNB 4KRNA 1UXWB 1WCBA 3W39B 3C60A 1FBIL 4TULH 5GGTH 4B7IA 4O9HL 4C56D 3GMLB 3ARBA 4XVTL 3RVVC 3U7WL 3IDXH 2JIXD 3QEGH 4E41A 1CXFA 2Q3AA 3Q6GH 4HK3J 1F11A 5A2KH 1N3NB 1QBLL 1FZJB 4XMKH 5DQ9B 3TNMA 3NZHL 5GIRB 4APQB 5IG7B 5C09E 1WWWX 4Q58C 3AC0A 4HEME 2AV1B 3DJ9A 2X7LA 1CF8H 1DSFL 1WAAA 1DLFL 5KS9F 3NCYS 5T1MA 2Y5TB 1KN4L 1SJVA 3RNQA 3PDOA 4D3CH 3W5NA 3KYMA 4OLUH 4Z7WB 1PSKL 5BW7C 1RHFA 3QDMB 1U58A 5ID1A 4MHHG 3D39D 1UA6H 1BQLH 3F7VA 3QI9D 3LKPB 4G7YH 5ESVA 4XGZB 1P7QA 4L9LA 4GUPA 1JF5A 5IMLA 2G5BB 3KWWB 1NANI 3OKDA 1TZIA 3KPQB 3MGAA 3IDJA 3DRTB 1P1ZA 2FNBA 4Y4FA 4OM0L 2DQJH 3TVMA 4GJTB 1MCIA 3B8YA 1FG9C 1G6RB 1NGXB 1U8QB 4N9GA 5E2VH 1W0VA 3BRFA 5CEXA 1JYNA 3UJTH 5FOBB 3G6DL 3H3PL 1LO3L 1FCCA 4JB9L 4JCLA 4Y16A 2VLRA 1MIML 4U6YA 4ZOEA 1YEIH 5E6ID 5I8CB 3GMOB 3TA3B 2CDGB 1CK0L 2R23B 2OI9C 4PUBL 1T89C 4E5XB 1LP9E 5BV7C 3S5LB 1S9KC 5KVDH 3U0TA 4M43L 4MA8H 1S5IL 4PJAB 1BOYA 3P4LA 3WFZA 4JHAL 5EU6E 3LIZL 4WI9A 5DTFB 4MX7A 5HVHB 2BC4B 2XZQL 4OQTL 4LSTH 1HXMA 4Q97A 1EHXA 1UH2A 4UINL 4X98A 1A7NH 1QR1A 5HYSG 5EA0L 3U46B 4TNWK 3ZYJA 1VACA 1U8MB 1NEZA 4XCCH 1QA9A 1J11A 1FVCA 4IM8A 4IRSD 4UIMB 5BJTA 4NYLB 1F6AB 1P2CB 3MNVB 3UTTA 4OD2B 3ALXA 1IRAY 2Q87A 4XNUL 1F13A 5IMMA 1IC4L 1YY9C 5KSBA 4LSPH 3UXFA 4KZDH 3I84A 1HHGA 3UJIH 3BIKB 5EO1B 3O11A 2YPKA 1P4LA 2HRLA 1MLBA 3D3VE 4J1UB 4EDXB 4YX2L 3WYRA 3FQNB 4JZOB 4NQVA 1BVLA 4X6BA 3UTPD 4JQVA 5MP6L 1NEUA 3QCTL 1ZLVH 3QPQD 5ETUB 4U6HA 3MNZB 3G5XB 3RVWC 3SDXA 4RDQF 1I1AD 1JGVH 4R4BB 2AXHA 3O0RH 4UV7L 5DMKB 5F9JA 5IHZB 4QYOA 1CVSC 4L4VE 1EEYA 5HVFB 1J8HE 1Q38A 1CIUA 1YEGH 3G5VB 4L3EB 1PKOA 1EXUA 1KCUH 2H2SC 4G80B 3VXUB 5A43C 2K7QA 5DHYB 4LHQB 4P4KB 3CX5J 1FFQA 1VFBB 3FQRA 4PBVC 3WV0A 4EIZC 3T0BA 4FXGB 3QFJB 1LO5A 1E4XI 3RUGA 2ADIA 5DJ8A 1XGPB 3H2WA 3LB6D 3KYOA 3SCMC 4FG6D 5SWQB 2EEDA 3VG9C 1KF9B 5IGXL 3CXDL 2AK1L 4U0QB 4YDKH 1MAKA 3GI8H 4NO2B 1TJHL 5IW6A 4M3KB 3O9WD 3U2SA 3H9SD 5DRWB 3ARGB 5GGRA 3F7QA 2F8OA 5DMJB 4ODWB 2R0WL 2XICA 3I2CL 4O4YH 3QEUB 2VMFA 1KCSL 1H5BC 1MCLA 3MBEC 1HIML 2F9BT 1KOAA 1FGVL 3VFWA 5K9QG 4KHTL 4ZSOA 4CKVX 2CUIA 3C9NA 3ZT7A 4KJYB 3T4AB 4K3EH 2VXQH 3T0ED 1AFVL 3SDDC 2NY1C 4MXWH 5HDLA 4LLAA 3HS0B 1AD9A 4X4ME 5C7XL 4BKLB 3LMJL 4NJAL 3HG1B 1GGCL 4NCC1 1YMHB 2BNUA 1BQHA 4LNVA 3S3JA 4GW4A 1J0IA 1PX4A 3GEWB 4F57L 1SBSL 4NZTL 1FN4B 3ARFC 2BSTB 5HHME 4AYFA 3MREA 4RMRA 4XH2A 3BPNB 4G6AC 1OB1A 5DUML 3MROA 4JPKH 1BVKA 4ELKA 1T0NA 2W38A 4PJDB 3BKYH 5B38G 2A83A 5GS2H 1AGDA 2OL3B 5GS0C 3S88L 4HUVB 3BP4A 4P59L 3T08A 4JDVA 2UWEA 2G2RA 2BY3A 4JR9L 5L0QB 5HYJA 2ZCHH 5MEOA 3MC0A 3ZSTA 1HSBB 4WIQA 2YPLD 5C0BE 1DP0A 3DVGB 1FLRH 4P2OC 2J8UF 5TGBB 1GC1C 3Q1SH 4XC1H 1F4XH 2BMKB 4GAFB 1RZIA 5GRUL 1T03H 4KY1L 3EHBD 4AM0A 3QQ4A 1WIPA 4LSQL 4P99A 3MJ8B 5AZ2L 2AJXH 3TIDB 4QRPD 4FFYH 3KR3L 4JGUA 5SX4I 5C86A 3ILPA 4MQTB 5C0JA 1ACYH 1TQBB 2IMMA 1U8KA 4KDWA 4J3VA 4OLZH 2XN9B 1VPOH 1EIBA 3JUZA 2A38A 3FRPG 4MD0A 3VD9A 1SY6L 2X41A 1YEKL 1OTUC 1B0GA 2CIIA 3EAKA 4YE4L 4Y1AB 1UM5H 4PJIE 4PB9H 1NFIB 1WTLA 4LCWD 2V17H 2Y06H 1F90L 2QSCH 3PP3K 4P2QB 4PJ8C 4LIQL 4XP1L 4BFIA 1A14L 1K6QL 3QXAA 2XXCB 5KW9H 3UBXG 5D93C 4YDIH 3UPAA 1A3QA 3DX7A 4MHHI 5LQBL 2NPLX 5LGHH 3SHSA 4CBPA 4L4TB 3QNZB 2W9EL 2Z92B 3UJJH 5D9SB 4J8RA 1HCVA 3ULUE 1D6VH 4ZQKA 5EPMA 1U41A 5CZXD 4LDEB 1HH9B 3OX8B 4XCEB 2DYPA 1IGCH 3O45B 1DR9A 3GRWL 2F53B 3D3VA 5I1CH 3NACH 2BCKB 5HYQA 5DQJA 5I1GH 2BNQB 2BOBB 2D9QB 3HZYA 1OVZA 2IH1B 1FJ1B 4LSSL 3TJHD 4HC1L 4PLNC 1A6TB 2AP2A 4Z7UB 5ESAA 1KB9J 4ODUB 4OZHE 2WBJA 4RAVB 4GBXD 2C3XA 3MV8D 4BZ1L 5D1ZB 4WUUE 3UTSE 2VL5B 1KFAL 3TBYB 2FHFA 4OZFA 5I19L 2AJZA 3U0WH 4TPRH 2IANB 5T5FH 1NJ9B 1NH6A 2CK0L 3RIAK 3MV11 2BNRA 1QBMH 1YMME 4WW2B 1EHLL 1CN4A 2A6IB 3RBSA 5C0FB 3FFCD 2W9LA 3AM8C 1S9VA 2HT4D 1KLFA 1PY9A 2CKBH 3EIFA 5D7IA 4ZS7H 4CADB 1SJEA 3HA0A 1I9JL 3INUH 2AEIT 3QO1A 4ZS6D 4PJFF 4U33A 3D85D 1CLOH 1F02I 4OGYL 2VO5A 4MQXD 3MFFB 4PJ5B 4JHWH 5DD0L 3B2UC 5DA0B 1N2RA 2BHYA 4FFZL 2R1YA 4LRNL 1GPOL 1XGTA 3DMMB 3NAAL 3VXME 1RUML 1ETZA 2ICEB 4PTTA 2HKFL 3FB7B 3WHE0 1A3LH 2R9HC 1S3KL 1WISA 3T4YA 2W59A 3P3YA 5JHDE 1RY7B 1AIFA 4O51A 4W4NA 5I74C 4L8CA 5C08A 1QSED 2VDNL 4PRAB 1LK3H 4JN1L 4NCDA 5BVPH 3MACL 4CVZA 1AGFA 3BGMA 5IBUG 1VGEL 5F7EH 5IBTL 1OP3H 3QIBA 3X12A 2LU4A 2X5PA 5E99H 5D7JC 3QJFA 4DQOL 3FO1A 1MCWW 4JQIH 4XRCB 4H88L 1ZVHA 3KYAA 4R8WL 1BWWA 4UBDD 3LSOB 4RGOH 3GMPA 4PJEE 3V95A 3GIZH 2EDFA 4U0RB 1CL7H 1CDCA 3NTCL 1CXHA 3WJJA 5F1IB 3EJZC 2R56H 3SDCB 3MSPA 2VLJB 4NKOA 2AKRA 4CDGC 4DEPB 5FYJL 1QNZH 1ZHBA 2HFTA 3PJSB 4MSWB 1OAKH 3ZMRA 1KXTB 2V5MA 3TA3C 1P84J 2NY0B 2OP4H 2KL6A 5K9QI 2YXFA 5JQ6H 1CICD 4R0LA 5MHSE 3QXVA 1M6OB 3PABA 2I5YH 5IB3B 3GO1L 2O5YL 3WNOA 4LSUH 3QG6B 5DJ6B 3NOIA 4ZUUB 2VXTL 4PB0H 4JRXE 4BUGA 2EC9T 4OT1H 4LCIL 5D6CA 1AY1L 3BH9B 4AEEA 3N1GC 3EBAA 4PS4H 1I7UA 2F5BH 3H9HB 1XZ0B 2AJUH 1EO5A 1NDMA 2RJMA 4HG4K 2VDOH 1FE8L 4Q9CA 3LN9A 2I07A 3ZYZA 1QLRA 2Y7QB 4R26H 1X5GA 5A16B 1EH9A 4JLRA 5J6HB 4FQLH 2O93L 3DX6A 3SKNB 5BZWB 1WZKA 1EA9C 1IGTB 4Q6IB 3MLRH 3ZDYF 4NRXB 4K23H 4EI5C 3P73A 1PLGH 2O26U 1NDGA 4G8FB 3MCKB 4UNVA 1JTOA 4GRLA 5IMKA 4X4ZA 1JGDB 2OJZH 1XF5B 5F93C 1QEWB 2A1WL 4FFWD 5C0GB 5IQ9B 3NCBB 5JR1L 3ROOB 3WD5L 3JTSA 5EO0B 2EZ0D 3TIEB 1I3GH 1IGFH 3QUKB 3PUCA 3EZ8A 4HCRA 3U4EA 4C58B 2XA8H 2X1PA 4ZAKD 2OM5A 3EO9L 3LS5L 3D48R 4DKEL 2MPAL 2HP4A 4M7LL 1Z6JT 2G5RA 1C5DB 4KI5D 4ZYKA 5J13B 1BZ7B 4C56E 3NMEA 4WCYL 1H3TA 2M8XA 2CJUL 1I8MB 1IARB 5ACZA 1EFXB 2OMBA 4G8GB 1AP2B 1YNLH 4XZUA 2GSIA 4Z95L 4P4KC 3P4NA 1A8JH 2AJ3A 3GIVB 5MEQA 4P5KB 3CFDA 5GPRA 1HHIB 4HFWA 4MJ5A 5C6WH 4Z9KB 3G5YA 1X5HA 5DJYA 5JORB 2ZPKH 4MCYB 2HVKA 3QWOA 1ZEAL 2Z8SA 5BCAA 5MI0B 1TDQA 4JM2D 4JPVH 1RK1B 3LZFL 2JJSA 1JRHI 3QHZL 2B4CL 4IDLA 2E27L 5IB1B 1Q9WA 4FOMA 3ARGC 3N9GH 4BQ8A 3HUJE 3QEHB 1OM3H 3WFDL 1INQA 3ULVL 3OKOB 4WHYG 5J1AB 3I6KA 4XXDB 2Q7NA 4OSUH 5I1KL 5ADPH 3O3DA 1A7BA 3U36A 2X05A 3D39E 2ZUTA 4UTAL 2FHCA 3IU4H 1U95B 3MLUL 2AK4D 4NO0A 4Y5XA 1CXIA 3I9GH 4N5UA 4D2NA 2WWMD 1R24B 2FEEL 2HFFB 4YFDB 3WEXB 3O4OB 1BQUA 1FL3B 3ET9F 4TNVF 1RFDH 3F58L 4GW1A 4N0FA 3WIFA 3WIHL 4DUVA 1MELA 2MCPL 3V6FB 4CMMA 3DTXA 1VFAA 4X9GA 5BZDA 4AL8H 2WV3A 2PF6A 2AEQL 5DJ0A 3SKUD 1KSRA 3ULVD 5EU7C 4LLWB 2ZCLH 4OKVB 2UVFA 3RWDA 2DTML 1T83A 2CIKA 4Q2ZB 3TZVB 3WO4B 4IIQA 3WL9B 4X4YA 1UJ3B 5D4QA 2J8UA 2DICA 3FZUD 1H3WM 4JRYA 3KPSA 4YUEH 5E94B 2G60L 1HOCB 2DQEL 5DS8B 4MD4A 5GGVL 1S7WB 3WJLA 4AG4H 1B2WL 2GFBA 2GI7A 3O8XD 5L0QC 3K46A 3WHXB 3BO8A 2C1PA 2HH0L 5ILTH 5ICXA 4S1SL 3L5JA 1DANU 1RUPL 2OBGA 1AGBA 4HXAH 1AD0B 4V2BA 3HMXH 3RDTC 4FXLA 1G9NL 4D0BB 2UUDK 1OHQA 3IKKA 1T20A 1KELH 1OT2A 3OKNA 1E27B 5I1HH 4YXLL 5L9DL 4WVRA 3JZ7A 1OD7A 5BXFB 2E7LC 1OAYH 3H7BB 2JK5A 4NKMA 1TPXB 3GSNL 4PRHB 2P44B 1XF2B 4Z7QF 3KVQA 2YK1H 4WWKD 2ICWA 2X1WL 5T1KD 2VISA 3UTPE 5IVXB 2ADJB 3CFJB 5TQ0L 3RRQA 4KJPC 5L2KB 1UM6H 4DOHE 4P0DA 2C3GA 3ARPA 1LEIA 3CFKA 3CCHB 3PGCA 5IEKA 3BVNB 1A9BA 4QF1A 4GMSH 3DVFA 3R1GH 3NIGE 3BOVA 1OTSC 3IETA 3EYVA 2QKIB 4KQ4H 2BY2A 1FSKB 4Q0XH 3OJDB 4HPOH 5A2FA 3RY6A 3S37X 4YJZL 4YXKH 3HZMA 4U6TA 1NGZA 1TCRA 2J4WL 1KJ3H 4NUJB 3QIUD 3WFEH 4JY4A 2YZ1A 4MAYD 1Y18B 3VGDA 5B3JE 2YA2A 3V4UL 4F7TA 3FT2B 4PJBF 5IF0A 5CBEB 4OV5A 4XX1G 1N6QH 3DXAB 3VWJC 4GKNA 1WCBB 3P4MA 5CGYC 5CP3A 4F3FA 4HKXA 3DVNA 3ARBB 5E08L 1NANH 3ZSSA 4J3OC 4LHUD 4X80L 1WSST 2LTQC 3EYQD 1IKFH 1F11B 3H9SE 1Y0LA 4Z78B 4PBXA 4K07A 2MSPA 2F74A 1IEAA 4TULL 3UZQA 1TVHA 4PRDA 3TNMB 4CN1A 3MMEA 2NCMA 4ELME 3V5DA 1D5BA 5FK9A 5DDHA 3VGAC 1A7RH 3NH7L 3Q6GL 4I3RH 3MRMA 2Q1EA 4GO6B 4PJ7F 2DQFB 1JGLH 5JA8B 2ARJQ 3IXTB 2X7LB 4NUGH 1D5ZB 5BVJB 1FNFA 4XMKL 3VA6A 3KPOA 3T0EE 3QG7H 2VOTA 5T1MB 3RU8H 4ZO8A 3FB6A 4J2XA 3RNQB 2IAMA 2X4QA 2L4OA 3KYMB 3GJFB 1SMAA 2DL9A 4HIEB 4FMFA 5F96L 1KN2H 1U58B 3LDBC 2RR3A 5ID1B 4JFFA 5D2LE 2WIMA 3V7MA 5E5RB 3E2HC 1P7KA 1CF8L 1F58H 1PEZA 3D18A 4KUCF 1RZJC 1R5VB 5ESVB 4D3CL 4OLUL 3IDGA 4GUPB 2A6KA 2QLVB 3ME0A 4L9LB 5DXWA 4OJFH 3OKDB 1KBGH 2WQRA 1BZQK 1G7LB 1RV6X 1K9TA 1SBBA 2XNAA 4OCNC 3TVMB 3B6SA 1EFQA 4KKAC 4G7YL 12E8L 4MCZB 5TPWH 4N9GB 5CEXB 3RWCA 5JOPE 5K9OA 4X99B 3I3EA 1TTFA 4ZUVA 4Y16B 2VLRB 1F3DJ 1HN1A 2DQJL 4U6YB 2YPLE 2OTUA 3GM0A 5DJAA 2H32A 3ARXA 3HNSH 2ZUSA 4OUUA 5DO2D 5E2VL 3QDJA 4NHCL 3VDCA 3MFGB 2ZNWA 3BP5A 3IDYB 1T1ZA 1G1CA 4X6FA 5BS0B 4QRPE 1R5WB 3SDYH 2EDBA 1JWUA 1YEIL 4MX7B 3D1MC 5IQ7L 3KLHC 1KGCD 5FO8A 2H8PA 3GUTA 2VRAA 1FG2A 5B38B 3DV4A 4X98B 1UACH 2XTJD 1NL0H 4MA8L 3LAFA 1HKLH 2CLRB 3I50H 4LCWE 1VACB 1NEZB 5EBGA 4MJ4A 4RFNB 1FVCB 2NTFA 1EJOH 3LN4A 1TQCB 3GMRA 4LSTL 5BJTB 2VWEC 5SWZB 5BQ7B 5T1DL 4JRWA 1A7NL 2JJTA 5EDXA 1E4KA 1GHFL 1E4XH 3QDGB 5T1LA 5DR5H 5IMMB 2BXYA 2NY0C 4KK8D 5JPMA 4XCCL 4JREB 1HHGB 3QXWA 3CVHB 2YPKB 1P4LB 1MLBB 3QWQB 5KVGL 3EDEA 3RWHA 4OQTA 2EYRA 2FX7L 4K7PH 2E7HA 1LE9A 3MXWH 1YY9D 3RWGA 3SDXB 3GSOA 1PW3A 4OF5A 1QRKA 3GSRB 4GG6E 4RMQA 3T65A 3QSKB 2HLFD 2NY6D 2DJUA 3KNBA 4M5YL 3SJVD 2VABA 3P9MA 3HPLA 3BXNA 4QYOB 3MV8E 1EEYB 3FCTA 3SGKA 1PKQE 4I0KA 1CLZH 1F4AA 2W1NA 1JGVL 1UQSA 3LRGA 3CMOH 1LO5B 4QWWD 3RUGB 2ADIB 5DJ8B 1YEGL 3FFCE 4UZGA 1RSFA 3VW3H 3KYOB 4WJ5A 4OZGB 2X42A 1KCUL 2DQGH 2H2SD 1MEXH 4M7ZC 4M61B 4WU5B 3EW3B 3JTTA 5I17B 3TO2A 2RB8A 5IW6B 2R1WA 4QRQA 5M7QA 1SEBA 4HD9A 3U2SB 2Y1VA 4LK4A 3ALWA 5GGRB 4LBEB 4I48B 5F9AC 5HDBF 1HZHH 1JK8A 4NFBA 1J1PL 3S34L 2D7TH 3V6OC 1XR8A 3EYOB 3O9WA 4YNYA 5JDSA 3AUVA 1X5LA 1KACB 3MRGA 2YD4A 3GI8L 4JFDD 3VRLF 4ZSOB 2R69H 2Q6WB 4C55A 3SO3C 3F6IA 2M1KA 4M1GH 1LP9F 4IRZH 2NR6D 3GSQA 3RX8A 1S7QA 3TN0A 3P9LA 1AD9B 2AV7A 4UT7H 2FB4L 3SQBA 4GW4B 1Q72H 5H37G 1QSEE 1OGAA 3BI9X 4JANA 1JMZA 1RU9H 5E8EA 2YUXA 3NCYP 4HWNA 1FC2D 2AXFA 3CFBA 4YH6A 1S5HB 5CWSA 2DL2A 3DIFA 3MROB 5I66A 1BVKB 5H2BB 4ELKB 1T0NB 2CRIA 3M1BA 4BZYA 4BFEA 1UFUA 1C5BL 2PO6B 4KK9C 1HCFX 5EBLB 2A83B 4N8VA 4XB7A 5JOFA 1KPUA 1V7MH 4U1NB 5EWIH 2QADB 2ZUVA 1H15B 1XGUA 4A2MA 2UZIH 4JDVB 2UWEB 2G2RB 2VYRE 4DN3L 5HYJB 4QHUA 2B1AH 5MEOB 3CXHJ 1GVIA 3BKYL 4IJ3B 3BWAA 2O5XH 1RZIB 4XWOC 3HE6D 5DK0A 1NCWH 5C0EB 4LVOB 4DGYL 5E5MB 4AM0B 4UILL 2ZCHL 3WO4C 4OBRA 3IFLL 1U8KB 3Q1SL 4XC1L 1F4XL 3VXSA 5E9DD 3C8KA 3C6LB 3LEVH 2VIRB 2RQ8A 2VZUA 4MD0B 4X7EC 5ICZB 3OF6A 2VJXA 4TTGA 1B0GB 2CIIB 4FFYL 1Q1JH 1JWSA 1Q9LB 1ACYL 2DD8L 4OLZL 1VPOL 5T3XD 2FSEA 4WI3A 4BFIB 3ALPA 4PRPD 3QXAB 1M4KA 4YC2B 5HGHA 3O3BA 1OTUD 3EDKA 1UM5L 1CFQA 1BVZA 4N0UE 2V17L 1HH6B 3BP7A 5DVKA 2XKUA 3KLSA 1P69B 3HE7A 3KS0J 4GAGH 1G9MC 4J8RB 3EOAA 2W9DH 3KXFD 2CLZA 5GRYA 4EN3B 4KKLC 3MYJA 4ZQKB 4X6EA 1DVFA 3WSQH 3M45A 2ZJSL 4YDIL 3DRQA 2DYPB 1SY6A 3PWJA 5CEZD 5IM7A 4Z7VF 5LGHL 5HYQB 1W0YT 5DQJB 4TN9A 5I16A 2PYEA 3HZYB 3WNMA 3LKRA 1X6LA 1OWWA 2IALA 2WBJB 4RBPH 3PL6A 1K4CA 1IGCL 4HJGA 1X3DA 5TE4L 5EIIA 4FNLL 4HUXA 5F6HI 3PV7A 5I8KH 4OZFB 1G7QB 2AJZB 4W4OC 3U79A 4PJ9D 4PJBA 3B2VH 1FYTD 3FB8A 4ALAH 3RWEB 5FA3A 5BV7H 1IFHL 5FYKL 4J12A 5HI4D 3FQXA 3MLZH 3W11C 4HMCA 2BNRB 4KI5E 1FSKC 1HQRA 3N1MC 2Y25A 4RGNB 1NBVH 1S9VB 4PBWD 3FQWA 3U0WL 2NY4B 2OJEA 3GRWA 1C5CH 5T5FL 2R0ZL 1SJEB 3NFSL 3T3MF 5KSUB 1FC1A 4LL9A 1P9MC 4UT6H 5I73B 4HV8A 4HC1A 1QBML 5EUOA 3QO1B 4Y4HD 4MNGE 3SGEI 3CX5K 1NFDA 3ISWA 1ZA3A 5HHNA 4W6XB 5KOVC 2Z31A 3H3BC 5FYKD