2FO4B

Enhanced mhc class i binding and immune responses through anchor modification of the non-canonical tumor associated muc1-8 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Enhanced major histocompatibility complex class I binding and immune responses through anchor modification of the non-canonical tumour-associated mucin 1-8 peptide
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fo4B00
2K7PA 2YA0A 5KVGL 1G0DA 4JKWA 2BSTB 4GAGH 4G6JH 2GSIB 2Y7QB 1LD9A 4LSDA 4NRZA 4QRUB 1J1XH 1HHKB 1TDQA 4LLVB 3WS3B 1AGBA 2XFXB 4J3SA 1X5GA 4PBXA 3LDBB 3DYMA 1MIEH 1N3NA 2YD4A 3ROOA 3EDKA 4G6KH 3PWLA 5KVDH 4FZEH 1D6EB 4LSPL 1JHTB 3NIDF 1EAPA 2QQLH 2BVTA 3IVKA 3REVB 2IPKB 4YDIL 4KKCD 2AJXL 2VDLL 1ADQA 2DLIA 4OLWH 4ZOAA 1CLYL 1IL1B 4HUVB 1LP9F 2BVUA 1JF1B 5KSBF 3FHQA 5D1QC 3QUMA 1AE6L 4HUXB 1IGJA 5E8EB 1XGUA 3CZFA 3QUYC 3ZYIA 2EDXA 5HGAB 1MQKL 3VWJC 1O7VA 1MJJA 1FCGA 5DJXA 2Q6WA 4CDHA 3EYUL 3QQ9D 3O4OB 2D9QB 3OG4B 4QRSB 5BZDA 1FGVH 2AK4B 2FLBT 1MEXL 1YPZE 3OL2A 1I8KB 4M7KH 4G6MH 4F7PA 12E8H 4D3CH 5M95B 3H7LA 5E95B 2BVEA 3NCYS 5L88H 4XNXH 3MUY1 3O9WD 3AS0A 1TNMA 4TSBL 4HHAB 3TN0A 5K9JH 1RHHB 1AP2B 1KCLA 4XPGH 1L6ZA 4KUZH 4ZPVB 1ZEAH 1Y6NR 3WN5A 5FYJU 5IFHH 3R0NA 1JYWA 1BZ9A 4I18B 2VLRB 1JPSL 4XBGB 5IOPA 2Y07L 1WFUA 5GRYA 5D6CB 1X5XA 4A6YB 4E42B 2HKHL 2V2TA 4UILH 4KZDH 3JXAA 5F1NA 2DTMH 3LRHA 4ODVL 3UTSA 1J1PL 4LLUA 1R3JB 4X7EC 1A1NB 1QBBA 2GK2A 4FQXB 4UI2A 3BQUB 3QCTH 2WBJC 4LVHB 5DDHB 5D70H 4L3EB 2X2YA 3MC0A 3T3ME 3EJJX 4IOFD 5HHXL 4RBPK 2CGRL 3GBLA 5IB2B 4LOUC 1WK0A 3FQNA 4OSUH 4WW1B 3SE4C 3ZE0F 3BKJH 4OKVA 3ARFD 4RAVA 1KXVC 2P5EE 2H3NA 3IAPA 4OI9A 1U8LB 3TZVD 1HDMA 3PV6A 4TSCL 1NCBH 2DLFH 2R0KL 4G8EA 3DO7B 2OSLA 4JQIH 4F7EA 4NC1E 3T1FB 4M6OH 2B39A 3MV7D 3TFKD 1I7TB 3S37L 3WJLC 5IV2B 4JKLA 4D94A 1N0XH 1YNKL 4OZGE 3QIUB 2YK1L 3UMTA 4G6FB 4X6CA 1P2CA 2BMKA 3QXDA 2JTDA 3C8KA 1HIML 4AIOA 2C1OA 1QLEL 4FQCL 5K93A 1RUML 4QTIH 4HGKC 4OCLC 2YD7A 5JOPE 4UAOC 1RULL 1MF2L 4YPGA 2BJMH 3VFGL 3KPSE 2BSSA 2ZSWA 1TZHB 4OBRA 1E4KC 2DBLH 3MODL 4LCWE 3CCHB 5DC4B 3BIAX 2E7LC 4P2RB 2A74A 2DJSA 3Q6GL 3WNKA 4ZMAT 3TYGH 4U1GC 5CHNA 1GAFH 4EVNA 4GKNA 3KYOA 4EI5C 4P9HL 3RDTB 3O6LL 3MLWH 4ZXBB 3TCXA 3HE6C 5CIPB 4LFHD 3WUWB 5ANMB 2R8SL 1A1OA 3QI9C 4LKCB 3RWFB 5JDJA 2JIXB 4X0KA 4X5XA 4HIXL 5I2IA 3S5LB 2BRQA 4N1CA 1LE9B 1OAKH 4PJFE 5C6TL 3OHXA 4M9PA 4JRXE 5IBUG 5IK3A 5FAAA 2IAMC 3MLZL 2CDEB 3MCLL 2ATPB 1VHPA 1FVCB 3I9GL 3ARVA 3PGCA 1EERB 5EBGA 5C0IB 4GS7B 2IANA 2X4RA 3RX8A 3RNQA 1IFHH 1VADB 3CUPA 4MA8H 1QSFD 1IE5A 3FO0H 1F3RB 1MFDH 1F00I 5MENB 4HC1A 3MSPA 3UZQA 1CFSB 4K7PH 5I1GH 1I8MA 1S8DB 1FCCA 1NGPL 2BHUA 1NDMA 3MBEB 3MMEA 4WJ5A 4O4YL 4L8CA 4CAGA 3BIBX 1A02N 5EO0B 1LE5B 4GW4A 1JFQL 2XKNB 5I1HL 1PDKA 5A2LH 3VFTA 2PYEA 3IF1B 3X17A 1CIDA 5ADPL 1P7QB 4PV8A 4TSAH 1GHFL 2CSPA 1XF5A 3DUSB 2X4OB 1QG3A 5EBLB 3GI8L 1DQJB 1LP9E 1KLUA 1Q9WA 3ARYA 5HGBB 4L5FH 2FDBP 4NUGL 4UUJA 3CDFA 1FVDB 2KKQA 2GJ6E 1U6AL 2HLFC 2J88H 3D3VB 1K85A 3MGOA 2NY7L 2FJFB 4W68A 2KDGA 4ZS7H 1C5DA 5J8OA 1TTFA 3TH2T 5DFVC 1X44A 3VCLB 2VXSH 1QVOA 3CLFH 4DTGL 1TZIB 3B9DA 5HHMB 2FECI 3BKCL 5D1ZC 1L7IL 2OMNA 1S7VA 4LLYA 3OMZA 4PJ8A 4RGOH 1KN4H 4OGAC 2BOBB 4N8VB 1A1MB 3MRLB 4F57H 4ORGB 4YE4L 1IAKB 4OLVH 4PB9L 3ZT7A 3OXSB 5I66B 5JZ7D 1OAZH 3QJHB 3C6LA 4KDTC 2CKBL 3BSZL 2OTPA 2E9WA 2DQCL 1L0YA 1UYWL 3GMRB 1U2HA 2RFXB 3RZCA 2LFGA 4GRWH 3T0WA 1HYSD 4H25B 3FO9A 5DJZA 2HMIC 4MJID 1EVUA 1KOAA 3ORJA 1S9XA 2IQAB 2WQ8A 4O58L 1AGFA 2GTWA 5I73B 2V6HA 2A0LD 4RGNB 3MXVL 2UZYB 4GLRI 4J1UA 2I07A 4CU6A 1KT2A 3O6MH 1Q9KB 1RU9H 4YQXH 3IRPX 2AEPL 3LEVL 3MLVL 1B4JH 3PDDA 1CLOL 5F7NC 1D9KB 3I6KA 1CGYA 4JG0L 5AD0A 4MA1C 4Y5VC 4NM4L 1B90A 2DQUH 5GGSB 3ZHKA 1RZKL 5IVXA 2VXQH 3V5KA 5I1EL 1AGEA 4GRLD 1G7JB 3RWCB 1FFOA 5CGMA 1W72H 1R5VA 3HAEA 5I30L 4M8QB 3V0VB 2H2PD 3S9DB 3MRPB 4G8IB 4QRPE 4UV7H 3VXSA 1Y0LB 4G6AD 4OV5A 3C08H 2BHZA 1BVKB 4TUKL 4P2OA 1H3PL 3IRZA 3HC0B 5CJXA 5DA4A 4ZFZA 1RZFH 3FB5A 3P4OA 5DJYA 3F5WA 4AEFA 4HJ0C 3QCVH 1IC4L 5BZWA 4PJ5E 2I60L 4Z0XA 4N8PA 3RTQA 5IB3B 5CJQH 1GGCH 4CVUA 5B3JF 3SDAD 3G08B 3DHMA 1IAIH 5I1LA 2APVA 4G43A 2HT4D 3V6OE 4YHIA 4JCLA 2YRZA 2QKIB 2RCSH 5IW6B 5DD5H 2DD8L 5DSCB 3QDGA 4XPAL 1OP5H 3BRDA 4TNWK 4P4RA 5DA0B 5E1HB 2C26A 1WT5C 1OTSD 2NLJA 3HE7B 4QHMA 1FBIH 1OAUH 5L2JB 3CFDA 4YO0A 2CRZA 2W1NA 3VGDA 2ZUWA 4PJXB 5CJ8A 5I1AA 1MREL 3MRBA 3OPZL 1J8HB 3T0EC 4NQED 1S78C 5E94A 2VLME 3PGDA 4MAYD 4GMTH 2D7PA 4X4YA 3IDJA 3E3QE 1DQQB 3EYOA 1BJMA 4CU8A 5GGUB 1FZOB 1FLTX 1X4ZA 5AG9A 4R8WH 3ZKMD 4TUJB 4PG2C 5GGQL 1S9YB 3BWUC 4HJJL 4KRNA 3EJZD 3NZHL 1OD7A 1CL7I 4G8GB 2R2EB 3TVMB 5BS0E 1INQA 4PJ7B 1CG9A 3GSNA 5DS8B 1CR9L 1FC2D 3JWNC 3L3IB 4G9FE 2DQFB 4K7FA 3DXAB 4HW6A 5LGHL 4LCCB 4NGHL 3CVIH 4PY7B 3T65A 3EO1B 3ULVL 5C70A 2CIKB 1MFCH 1CXIA 4KMQA 4J6RL 1RUAH 4CVXB 1E4XI 4I2XA 3SKMB 5AYUH 5D2NE 1IBGL 5F3HA 5JHDE 3D69A 2MQCA 1BVZA 2PNDA 4CJ1A 5INDB 1RVFL 1EFXD 3VFRA 3GIVB 5EUOA 3KPMB 4JY5H 3QJFA 2A6IB 4H26A 4OQTH 2IPTL 1FNEA 1B0RB 2NNAA 5SWZD 3BGFC 3DMMC 3BYYA 1H8SA 5E7BA 4ZUWA 1R3LB 4MVBC 2P8PB 3QEUA 1LEIA 15C8H 2NTFA 1IM9A 3ARDA 4I8DA 5F9WC 1FO0A 3LKPA 3NH7H 2Q7YB 3A6CH 4LEXH 1AI1L 2APFA 1EV2E 4JPIB 2EYRA 1MCDA 2IGFH 3V6ZB 5DI8A 3I2CH 4U6TA 5FB8A 4A6YL 2MQ0A 4P46C 3AU1A 2E8ZA 5C08E 4HKJA 3H9HB 4WO4C 3DX6B 4OFYD 1HH6A 3EDJA 1D5XA 5HJ3B 2HT3D 3FAWA 3W39B 3FQWA 3BKYL 2DIAA 4Z7UF 5ID0A 2NY6B 5DK0A 5TE6H 5FGBC 5DXWA 2BZDA 3U30C 4TPRH 3V6BR 3QFJB 4PLJC 3WCYA 3R1GH 2F5BL 5D5MA 2E8YA 2XXCB 1OTTD 1S3KH 4P4KD 2X1QA 4HIHB 5ERWA 3ZL4H 1JI1A 2G5BB 3L6FA 2E5EA 3IDGB 2QSQA 1FLRH 5F6IC 4TQEL 1K8IA 1NC4B 5CUSL 3QNYB 3TCLA 4HEPG 1GPOL 3VXUD 4LSSH 1RJZB 2X4PB 2BY3A 1NGWB 4G42B 4K9EH 4GG6E 1TJHL 4QHNB 2ZG2A 3SGEH 4U05A 5EU6B 1GXEA 1K2DA 3RUGA 1E6OL 3LV3A 5C0ND 4BSWA 3FFCE 4N0UA 3VXOA 4X98B 5I8KL 4MD0B 4RGMC 4I9WE 4DGVH 4UQ3A 1CGXA 3V8OA 4OZIB 3KG5A 1JRHH 4N0RA 3D0VA 2LU4A 2HJLB 3BPCA 4MXQD 5L0QC 4WI7A 4LF3B 2CLVB 3MLXH 4PJIB 2IG2H 2FX8H 3BE1L 3VG0H 2ED7A 4LGPB 3QWQB 4NQXB 2DL9A 1I9EA 1AXSA 3MV9D 4MCZA 5EWIL 5B3JE 3HG1A 4R26H 4BSVA 1DTUA 1A4JB 5DVLA 2WQRA 5KS9E 3D48R 3RBGA 2A6KA 3I84A 4CVZB 2D0FA 2V2XB 3O11A 3MRFB 3U0PA 1KJ3L 2XZQH 3DRTA 4H1LH 5FF6A 5DGQA 2X4TB 5F7DA 1M7DB 1HILB 5ESAA 1QR1A 2W9DH 3LHPH 3PNWA 3MROB 1JGDB 2EICA 3PWPD 3HRZA 5DVMA 5FV1L 3ULUC 5GSRB 4NFDA 3NTCL 4N1HB 4ZPTB 4XAKD 3WN5C 1FL3A 4YC2B 2DI7A 5HVFB 3H8NA 5C9KA 3GFUA 4UTBH 4ZFOB 5A43C 1XR9A 4JFQA 4HK0B 4XC3H 4OGYH 2P1YA 2W9EH 2VDPL 5DFWH 1MVUB 1NGXA 2Y25A 4M7ZC 1K4DB 2CO7B 3RVTD 3SQOL 2R0WH 2A77L 4K3DH 3D18A 5B39G 5C92A 5T3XH 1RIUL 1FYTD 43CAB 5JMOC 4E9LA 5LCVL 1DUZB 4WHTB 1ADQH 2EIDA 3BVNA 1PKOA 5GS0L 2XV6B 3DETC 3T2OA 3IJYB 4GO6B 2XY1A 5E8DH 2QEJA 2QQKH 4JRYA 1W0VA 2JE8A 2EDOA 4F33A 2QADD 3QUMH 5KVFH 5D2LA 1V7ML 5FYKL 5HHOA 4QXWA 4LCYB 5I1CL 2QBWA 3WE6A 2PXYA 3KXFD 4PRIB 3T8XB 4FQIL 3RJQB 4IJ3C 1MAML 2AXHA 3CMGA 3JWOL 3EFFB 1F11A 1BM3H 4F7CA 1EHLL 2FSEB 1ZT4A 1VFAB 1JWSA 4HS3B 4UINL 5LJYH 1UG9A 4L4VD 4TULL 5EN2A 1BMGA 5FUCE 4MNGB 4AM0B 1P4IL 1Q9LA 4UTAL 3D2UD 5CZVH 3K4AA 4J3VA 4K7PY 4XZUA 4AENA 2O61B 3S37X 1KIRB 3WIFB 3ULUH 5CEZD 2NW3B 2Z31D 4M5YL 1BIIA 3QO1A 3BGMA 3MRIA 4PR5B 1QNZL 4JANA 3MPCA 1X5FA 3T2PA 3GSVB 1JZ4A 2BNUB 1CT8B 4KVCH 4D9LL 3B9KB 3SO3C 4AEIH 1UWEL 4TOYL 3KPQB 3RWHA 3PJSA 1NH6A 1IGTA 3SBWA 4NN5C 5TPWL 4Z8FH 3IFNL 5J1AA 4PJGB 5EC2A 3Q5YA 1EUTA 2W65B 1MJUH 3IFPB 1ZV5A 5IKCB 4FG6C 4KPHL 5I0ZA 1XMWA 3OKOB 2VQUA 4B50A 4PG9A 2CRYA 4I0PA 2Z0BA 3LZFH 5IEKA 3PWJA 3PUCA 5DRWB 2VB5A 4HBCL 3MV7E 4Z7UE 5TDPA 1OGAD 5KG9B 4ZTOL 1MCFA 2WUCL 5IHLB 3MGAA 1GC1H 2DLTA 4X7SH 4Z78A 2J8UA 4P23B 4FFYL 4L9LA 4ODUB 4O02H 4K8RL 4C59B 4OGXL 4YWGH 3MA7A 4Y16B 4GXVH 3BEWA 1K4CB 4C56A 1MHEA 4AT6B 3RVUD 4RMVA 4HUNB 3FRUA 3B2VL 2OL3B 3LH2H 5DJ0B 3KHOA 3CMOH 5ALBL 1M05A 3GMMB 2ADGB 3P30L 1HE7A 3P11L 5F8QC 2A6DB 5IW1B 2G60L 4ODTH 1HSBB 4JFYB 4MSWA 1OF2B 3AAZA 3KR3H 4G3YH 5I76A 4KK6C 3LQAC 3WLWC 1I7ZB 2IBBA 4LU5H 1NFDE 2EYSA 4GKZA 4OI7A 1QLRB 2VLJB 2ZG1A 4EOWH 4PGBB 5HYEA 1NJ9A 4XHJC 3UTZB 3O0RL 4Z76B 4UMGA 1NDGA 3QXAA 4LAJH 2NY2D 1EJ6A 1A4KA 3QZWG 5BXFA 3ULVD 1U2CA 1PKQB 5E8OB 1XR8A 2ITDB 2R2HA 1QSFE 4UBDD 1BD2B 3TBTA 4LSUH 1J88A 5M94B 1VFMA 1XT5A 3L7EB 2JJSA 2Y36H 2AK4D 3C5ZA 5DK2A 3CSYA 1AHWC 4NQUA 4LVNB 4NYLB 4ZS6D 1ZHNA 3X14A 3IDMB 1BQLH 1MCRA 5A16B 1QUNA 3GIZL 4KI1A 3C6LC 2F9BT 3VD7A 1RZJL 5HHPA 4HZLA 4MCYA 3S36H 5B4MD 5FO7A 1M7IB 3RZCC 1RQ5A 35C8H 4JFOB 5IESL 3TBSA 3ARBB 3OR7B 3IFLH 4L4VA 1OCWL 4KI5C 4HC1H 43C9B 4X8XA 4HS6B 1TETL 4ZOCA 2C7UB 4LMQE 2ADFH 3OWEA 4XWOD 5T1DH 1IEBA 3MJ9L 2VLRD 4IMKA 5BV7H 2EO9A 1C5CL 3PG2A 3ELAT 1QBLL 4PGEA 4P59H 1SJHA 1BJ1H 1EMTL 1RIVH 1UCBH 1T2QL 4G7YL 2J7LA 5ICXB 5J11B 1ZA6A 2VH5H 5KSBA 3CC5A 2E6QA 2NXYB 1JGUL 4P0DA 4FQXD 3BQUD 2BX5A 3E2HB 4S2SA 5EULV 3TT3L 4L3ED 3BRGC 3P9LA 1F4WL 2X4SB 4C54A 4HWZB 2CXGA 1SYVB 2Z35A 5F7EH 3C60A 1KG0B 4P2OC 4OUUB 2K1MA 3G9VA 5CJXC 1R0AL 1F58H 1I4FB 5TQ0H 4NQTA 2XZZA 4PYHA 2AK1L 4IRJA 4Q0XL 4F58L 4MJIE 3SEPA 3RTQC 1FNSH 2R1YA 1IQWH 3IXAA 3L3DB 4ZTPH 1BFVH 5DJAA 1S7RB 4J3OC 4QXGH 3QIUD 4ELME 5IROA 3VGFA 4QRRB 1ZT7B 2ZP0T 4M6NL 1Z9OA 3PWUB 2VQ1A 4XMKL 5FECA 4G6FD 1CGWA 5C0GB 2OQJA 3BH8B 4DEPC 4EQ3A 1XGYL 4PGJA 1Q1JH 1W0WA 1CFQA 1JP5A 4NNYB 1JN6B 4U6VL 3Q3GB 2P5WA 2XZCL 1TXKA 5EB9A 1NCWL 3TESA 1MCOH 5EU7E 4IDLA 5H8DA 4FN0A 4FNLH 3WDHA 4P2RD 2MCG1 4I3SH 4F7TB 5C0AB 1VPOH 2Y9RT 4CJ0A 4KK9D 3SHSA 3LEXB 5JO5B 1ACYL 3HAEH 3RDTD 4ZXBD 1KJ2L 5HDQL 1WZ1L 2NY5L 3WFEL 2XTLA 3M07A 2D7MA 5KSAB 4X6BA 4XP9H 2H45A 3C8HA 3H9SB 4U1SA 3O6FA 2JIXD 1IL1A 5DJ2B 2DICA 1ZHKB 4U6XA 3PHQB 2EO1A 3NZ8A 5KVEL 1L9NA 3ZDYF 1G6RB 1F13A 5C09B 2CDGA 4EN3B 1VKXA 2VC2H 1ORQB 1HKFA 3KLSA 3IDUA 3IDYB 3GGWA 3BPLC 5H94A 5C0RH 3NCFB 1IKFL 4HQQL 1D5MB 3TIEA 4YHKL 5MEND 4Z6AT 3NFPA 5DMGD 4PP1C 2NPLX 1ZLSH 5GGVL 4NIKB 4NQEE 1J0KA 2LU7A 3FQRB 4BFIB 4IIQB 3MBED 4QHKJ 3U7WL 3VFPB 2PYFA 1V3LA 3UTPD 4GKOA 1WAAA 4PGZA 1X4XA 1DBBH 2YN3A 4OLUL 4Q2ZB 5DD6A 1V7NL 3LN4B 1UA6L 1P7QD 2Z92B 5GQBA 1XH3B 2V9RA 4OZHF 1EVTC 2ADJB 4NZJA 1AC0A 1U8IB 1QA9B 1JYXA 1D5IH 4ZO7A 2IH1B 2DOCA 3D3VD 3ARDC 1Q38A 4MZ2A 1KF9B 3QIWB 4EDXA 1PW3A 3CSBA 2IPUG 5CCKH 5F88B 1CE6A 3FJTA 5J89A 4TTDC 2D7TH 4GAJH 4KTDH 5HHMD 1MFEH 1HXMA 1KB5A 5I8EB 4JPWL 2HJKB 5E99H 4F37K 1Q0XH 5IMLB 4IHOB 2CLZB 3GSNH 2A83A 1GGYA 5D72L 2BRRH 3GB7B 4JPVL 4MYWB 1FDLH 3L5WB 2EKSA 3IB4A 2YRPA 3KYMB 4FABL 4PJBF 1KENL 2RAMA 2GSGB 4NRXB 4ZNCD 5BVJB 4YGVB 4BZ1L 5E6ZA 5SWZE 1XZ0A 2ZPKL 1U3JA 4G8FA 4OT1H 4S1RL 4DGYL 3S35H 2F58H 5KTEL 4PJHB 1ED3A 3OKNA 2ENSA 4RGND 3CLEH 2R23B 1ZLUK 5HYSA 3I3DA 3WKMH 1UT9A 3T0DA 3FKUS 5JIPA 4Q97A 5D2LE 1S7UB 4LKXA 1D9KD 2PCPA 4D0CA 3JTTB 1PQZA 4HH9A 3L3GB 4JO4H 2JCCB 4H1LG 1ZGLP 1GCFA 4Z77A 2IALB 1UM5L 3T08A 1YN6B 5E2TL 1SHMA 2VR5A 3W9EA 3G5YA 5EU4B 4M1DL 3GSUA 1ZGLA 1UEMA 3MLRL 4IDJL 2VZUA 5J9PB 1IGYA 1FO0H 1MSPA 1YEKL 2X9WA 4POZD 3TO4C 1LEGA 3KPOA 4PV9A 2CLRB 3O2DL 4K8RD 1CGSL 2IQ9H 2GK0B 2O26U 4MB3A 5EIVA 1KTRL 4RX4D 4M4PA 3PXJA 2PTTB 3SDDA 4WUUA 1A6WL 4OTXH 3H0TB 1F4YH 1N59B 1AIFB 3QAZC 1YYMH 3Q48A 4BFEA 1I85A 4ZO9A 5GGRA 3MXWL 2HH0H 2G75A 1FNGB 4XRCB 5B21A 4BQBA 4QOKA 1YEGL 2AJYL 4ZYKA 3BT2L 3IYLW 2ZCKL 5TE7L 1WBYB 4TVSa 1EXUA 4JB9L 2BFVL 4M5ZL 1HKLL 3VXUE 2EIZB 5ESVA 4NO2A 3D0LA 5D8JH 1EBPA 2FEDC 5E2WL 1AH1A 3RWDB 1NFIA 1QFWL 3VJ6A 3UPAA 1NEZA 3QUXA 2JJTA 4CN1A 5FGCB 1RZGA 2X5PA 2WSKA 4RCAA 4KV5E 3HE7D 2I9LB 2B5IC 3G6JF 3QDAA 4TRPH 5LKNA 3BZEB 3L5IA 2IPUK 4WTXA 4H88L 2AXGB 3BXNB 4PB0L 4YAQA 4Z7VB 1I7RA 1J8HD 5T1MB 1A6UH 2F54B 4IS6A 1ZXQA 2BC4B 2OL3L 1RUKH 4NT6A 5LWYL 3W9DB 1CE1L 4QWWC 2VDQH 2Z8VC 2FEEL 1FJ1A 1I9JL 1U93B 4AQOA 4Z7WA 3MV9E 2V7NB 5C8JA 1MRFL 4YR6B 4UT9L 2AEQL 2W60A 4S0TD 2ATKA 2Y72A 3CFKB 1YY9D 5BQ7B 4LCIH 1AGCA 3ULVF 2BNQB 2GY5A 4KAQH 3VRJB 5GGTL 3J8F7 4HF5L 4NDMA 1IGML 3CPLB 3ZDYE 5IIEA 4MNQB 1BEYH 1CI5A 4G8GD 3TVMD 2PXYC 4GQ9L 5CEYA 1WQVT 3DSNA 4X6FB 2VL5A 3VMNA 4MQ7A 4QHLB 5L7XL 3BZFA 4PRHB 5E2VL 5DC9B 5E5UB 4R4NC 4MQXD 4ZD3H 4XP1H 3X13A 3PWPE 4PJEB 3U4BL 2R56H 4ZUTA 3DXAD 5FYJL 2V9QA 5DT1H 1MI5B 4R6UA 5F1OB 3J7HA 5MEPA 3GUTB 4XAKE 2F53B 3KWWA 3CDGB 1Q0YL 1H8OA 2V17L 4LHJB 2HFFB 5D1QB 2DWDA 1HXYB 1SM3L 3FMGL 4HS8H 1NAMH 3GSOA 3FT3B 3QUYB 2ZUQC 3VWJB 4Y2DC 4MA3A 3R8QA 4G7VH 1W0YT 2EEDA 1FYTE 2C4FT 2FGWL 4YBQC 3INUL 1U8QA 4O51A 3A6BL 5IT2L 1ZHLA 3QH3A 2FB4H 1CF8H 4V1DB 2ICWJ 5IMOA 4O2FB 1A6TB 2X7LB 3SBWC 4S1DC 5JLZB 3QUZB 3CFEA 5KOVC 1PSKH 4GBXA 3KXFE 4KQ3H 5DUPH 3I02B 1EO8H 1KPUA 4X7CC 1WWWX 4N0FA 1KTLA 3ZKQD 1XF1A 5HHNB 1S7TA 3E6HB 3WFCH 1DR9A 4I0PC 4L4VE 2ERJC 3O8XA 3OJ2C 1FPTH 4KMTL 5DC0A 2DI8A 3VRIB 4MHHG 2QHRH 1R3IL 2DKUA 1DP0A 4LRNH 1ZLWH 1F42A 4PJBE 4X7TA 2E3VA 5CEZE 2OK0L 3O45B 1JGVH 1H3GA 3O81A 1VFOA 3U6RA 5CJ5A 3VW3L 2NY6D 4L9LC 4AL8L 2I9TB 3GSXA 2HFEB 2WBJB 3O4LA 3QFJD 4M6AA 1INDH 3V5DA 3STLA 3QXWA 4P99A 2VITA 1PEZA 4N5UA 4HD9A 3KYKL 5TH2A 2RQ8A 8CGTA 3QIBA 1NC4D 4GKSB 4DZBB 2J2ZA 1AKJB 1KPVA 1U8PA 4XXCC 3U1SL 3BESR 2C1PA 1QFPA 5EU6D 3P9MA 4GG8B 3T4AB 5F96H 2VE6A 1S5IL 5IVNA 4FFVC 1YJDL 3RWGA 1ND0B 3LS5H 1I8IA 2CR3A 3PABB 5D9SA 3TA3A 4KHXL 2VISB 3EYQC 1OGAE 2EC8A 4AG4L 2OTWA 3ILQD 4PJDE 5HGHB 4XCEB 3TWCH 3PGFH 1WZMA 2YOCA 3NMEA 2O5XL 4X4ME 4RFEB 2HAZA 2FATH 4UAOB 2EDHA 3CH8A 1CD1A 3GHBH 1LO3L 2NYYC 2DWEA 2WINB 4Y19A 3SKOB 2FR4A 2OZ4A 2EDBA 2JJSC 3FN0H 3C5ZC 5E6YA 1DFBH 4JPKL 3U48A 4U1GB 1CS6A 4ZQKB 2YZ8A 4EI5B 4LSTH 3DX7B 3HE6B 5E2UH 2XWBB 1F3DH 4NNPL 3QI9B 1G9MC 4PJ9A 2E7MA 1J0JA 4AH2B 1G6RL 4JFPA 1QKZH 4J3UA 5IBTH 2CMRL 3W0WA 4RNRA 2Y5EA 4NO3B 5EZLA 2HKFH 4JY6B 4R3SA 1A5FH 4IOIA 2IAMB 4IMKC 4WW2A 5KSVB 4UIMA 4KH2A 1JCKA 3ABZA 3FN3A 1ZT1B 3AMKA 2A9NH 3U7YL 5KVMC 4X80L 3VFNA 2KH2B 2YN5A 1T83A 3ZYJA 3K3QA 2VXUL 1OB1A 3I50L 5HI5D 4ONFL 1VGEH 1QRNA 3QA3A 3DYPA 1AJ7L 3ULVE 5DK3A 4GRWB 4RFOL 1MH5B 4Z0BH 4PRPA 1LDPL 3EBAA 2DYPA 4AIXA 4J3TA 3BISA 3DJ9A 2N7AA 3WFHB 5J6GB 2AK4E 5FYLD 5LG1A 3C2AL 4M43L 3SE8L 2X4QA 1CFVL 2Q8AH 2X10A 3IDXH 2EEBA 2GTZB 3QWRA 4LPWA 4ONGH 3C60C 3QZWB 4PRID 1YMMA 4XX1G 1HSAB 1OTUD 1JIBA 4YHOL 5GJSH 5F7YC 4YHLH 5JQ6L 3DV6A 4IRJC 4WEBL 3BHBB 3TJEH 4WTZA 2P49B 4O00A 1F4AA 2KBGA 1MRDL 3HAEG 5K9KB 1YQ2A 4J4PD 3EYSH 4FTVA 3ULSA 2PW2A 5KOMC 5C9JB 5HJ3A 3RX7A 2VLRE 4LQ1A 1G9MH 1G7MB 3LD8C 4DVRL 3RBSA 3THML 4NZUL 5IROC 2YMXL 2CJUH 5D1ZB 3UPRB 1PZ5B 3O3UN 4UNVA 4KK5C 1OY3B 4LFHG 1G9EA 4OCYH 4JFEA 4CMMA 4HPYL 4ZSOB 2Z8SA 5CEZH 1T5WA 4WHYH 5LAXB 1HHJB 1BFSA 2X70B 1YUHB 3B9KD 1MJ8L 3MJ6A 4BQ8A 4MDJB 1WEJL 2DAVA 1G0YR 2BVYA 2PR4H 4L3EE 5JXED 2IFGA 4EIZC 1KNOA 4LPVA 4G80A 1IC7L 2HRPH 4DVBA 2W91A 4PTUA 5GZND 4YFLI 1P1ZA 4FA8A 1KC5H 3AY4A 2BNRA 1HHGA 4JFFA 1HWGB 3KLHD 1G7HB 4JO3L 1S7SB 3OKEA 3RKDD 5E9DA 5D1XA 3DX8A 1BP3B 1RSFA 3MRDB 3SDCC 4XP4H 4NNXA 1QSVA 1MHHB 3DBXB 1E4XH 3PQYB 5IM7A 4MA1B 4Y5VB 4BFGA 1GGTA 7FABH 4PGDB 1DEEA 1K8DB 2D7OA 3QDMA 4WU7B 1VEPA 2P8MA 4NM8L 4P23D 5KAQF 3FB7A 4GAGL 2FZ3B 4HT1H 2ARJB 3BD3A 3LRSA 3OR6B 4Z7OF 3M1BA 1JHKH 4Y16D 5FDWA 1MIEL 1RURH 5D71H 3IDNB 3NFSL 4G6KL 4P57B 3V6OC 1NMAL 4FZEL 4BKLB 2UY7A 3SPVA 1HCFX 1SEQH 2Z91B 4BH8B 1YZZA 2W0FB 1UKQA 4GQPH 2YC1B 4P2RE 1JGDA 1FG2A 2HLAA 3K4ZA 4FQHA 5DQ9A 3RGVA 2G5RA 4M3JA 4OLWL 4PBVC 3PHOB 3FO1B 5DEZA 4U1MB 5D6DA 5E8PA 2M1KA 4XGZA 2DKSA 3S88H 2ZUUA 3X3GH 5ANME 4LHUB 4QO1A 1BJ1J 5C6PB 4S0SD 2HVKB 1WIUA 3BP6B 4DW2H 5KJRH 1C7TA 1CZ8H 1QLFA 2HG5A 4L8DA 4PJCA 4APQC 1AO7A 1J10A 5EC1A 1V3MA 3G5XA 2CUIA 2VLJD 1MHPH 1Z0NA 2DQJH 1KIQA 2Z93A 1X3DA 1FGVL 1O0VA 3F12A 2P7TB 2XY2A 1MQ8A 4PJ7F 3V7AE 12E8L 4D3CL 3SGDI 1NLDH 3NIFF 1HK6A 5L88L 5FO8A 3IAQA 1ODAA 4XNXL 4XVUD 1JHLH 1BD2D 3UZEA 5IJVB 3T0EB 2GAZA 5MENE 5J1TC 5EO9A 4F7MA 5K9JL 4TNVF 4XPGL 4KUZL 1AR1D 1HQRA 1CLZH 4JHWH 1VFUA 5GZOD 2VRAA 3RY6A 2DQEH 4WVRA 3U0WH 3OKMA 4U31A 5F1KC 4RAUA 3UTPE 1I7UB 1V05A 3RL1A 1A47A 3ARBD 2FWOA 4MAUH 4YDJA 4MDIB 2R0ZH 4ZAKD 4XI5D 4R4BA 5IBLC 2YPLB 2ZOLB 4KZDL 4XTRD 2DTML 1DBMH 4JDZB 5BCAA 3O3AA 2MCPL 4N0CD 1FC1A 2ARWA 1H15B 3D3VE 3QCTL 4HGMA 1YQVH 3ZT6A 5I18H 4EXKA 3EGSB 2JLLA 3QQ3B 3V2AR 3RWEB 3FO2A 4OSUL 4R7DA 5HHME 4LPTA 1P69B 2GJZB 4E41A 4U49A 4BQ9A 3HFMH 1XGQA 2D7NA 3JV5A 2NXYD 1IGFH 4XB7A 4NKIH 1RZ8A 5FOJA 5DRNB 1YDPA 5B3NA 3UJTH 3S98A 4HFUH 5ESQB 1L6XA 1G7PB 4YHNA 1HQ4A 3EJYC 3P4MB 5AZEH 3KGRA 4PJ5B 3U7AA 5IGXH 3ES6B 3GSWB 4CMHC 2NX5B 4M6OL 4HFWB 3VI3F 1ORSA 1KB5H 3BGFB 3RWJA 3DMMB 3DV4A 4F3FB 3EYVA 4OCNC 1I85C 1QSEB 4DGIH 5BMFH 5C0CA 2W0LA 1FN4A 5EORL 4XNQB 3T04D 4RGNE 1C1EH 3MRHA 1IM3B 1MLCA 3UJJL 4CU7A 5HPMA 2WBKA 1DQML 4HGWA 4NQDB 3EYFB 2MKLC 3FCTA 2XKSA 2BJML 5HXMA 4W6YB 4KJWD 1MUJB 1YY8A 4KXZI 4QRRD 5BO1H 2QV2A 1U95A 4NO0A 3QUXC 4OZFA 3LSOB 5INCA 1LHZA 1TVHB 4P46B 4K2UH 3QG6A 4QF1A 4WO4B 5IB4B 1MFAL 3PWNB 4UQ2B 1IJ9A 1NBZB 1H5BA 1JGLH 3MLWL 1GOGA 2Y6SD 4OFPA 4MD4B 1VGKA 3TBVB 5F7UA 4OZIF 3V7MA 1X9QA 4H1LB 5DHVA 1UXWB 3U30B 2QSCH 2MNUA 5C0AD 1F2XK 2H9GA 4PJIF 2SEBB 2MJWA 4MS8C 1J7VR 1OAKL 2LTQC 3BP4B 4I77H 1LEKA 1JI2A 1INEH 1G6VK 4HCRA 3SO5A 4NC0B 2ZNWA 4BELD 2Q7NA 3S3JA 4NRZB 1LD9B 5KSAD 1A7QH 2OM5A 3H9SD 2FJHA 1IFHL 5TE4H 1E28A 5ETUA 1H3XA 1N3NB 4M62H 4MA8L 5FM4A 1VCAA 3FO0L 4P2QA 3ROOB 3ET9F 1MFDL 3PWLB 3U0TA 2EH8L 4Z7OE 4RGMB 3JUYA 5C09D 1PX4A 4MQTB 5IB1A 4EN3D 1EAPB 1NMCC 5I1GL 4ETQA 2L4OA 1P7KA 1UB5A 3AS1A 5K59F 4I13B 5LQBH 2YBRA 3IVKB 4L3CA 3FRPA 5A1AA 5L0QB 2HTLC 2YKLH 1YYLL 2W0PA 3L7EA 4I3RH 1UQSA 1DQLH 2EZ0D 3D9AH 3EUUA 1FIEA 1LQSR 4PJXE 1IT9H 2X6MA 3QUMB 2MSPA 4TSAL 1IGJB 4D0BA 1XGUB 4LVEA 1J8HE 3CZFB 1CD8A 1X5JA 1DN0A 1B0GA 4IBLT 4L5FL 1MJJB 5DJXB 2Q6WB 2J88L 1WWAX 1V8HA 3CK0H 4ZAKA 5BZDB 1HINH 1V3KA 4W4NA 4U0RC 5CP3A 2NR6D 3U4EA 4LP4A 2VIRA 5CKGA 4F7PB 2ZNXA 3CLFL 3GBNL 1MRCH 1R24A 5CZXC 4WI8A 4XVTL 1RD6A 1KN4L 2ED9A 4RGOL 1IAOA 4X99A 4G8GE 3DVNA 3BD5A 4GBXC 4PJ7E 1L9MA 4F57L 2FO4A 3TN0B 4OLVL 3QIWD 3DVFA 3VH8A 3NIFE 1LILA 1RJCA 1BBDH 3DXAE 4WGWB 4YUEL 3WN5B 1OAZL 4TVPD 1BZ9B 1HEZA 3DIFA 3E6FA 1KULA 4WDIA 3M17A 1CU4L 4X6EA 1KN2H 5IOPB 4M7ZB 2WWMC 2FX7H 2XN9A 5LGJA 2FBJL 5FUOL 2V2TB 3KLDA 5AUMA 4YLQT 4FQJL 5F1NB 3UTSB 3O6ML 4LLUB 1RU9L 1BGXH 4YQXL 3GMPA 25C8H 1B4JL 1WZKA 5FUCC 5DJ6A 5DVKA 4WNQA 3RWIA 4L8SA 3EDDA 5SV3A 5SV4A 3V6FA 1HCVA 4UT6H 4XNYH 2VZVA 1FSKB 3FQNB 4YHPA 2VXQL 4URTB 3QHFH 4OKVB 4I4WA 4RAVB 4IJ3B 2DQIH 1KCSH 1W72L 1PG7H 1T2JA 2Q3ZA 2H3NB 2FRGP 4OZHA 2A73A 1HDMB 4DK6A 4PLOB 1JZ2A 4UV7L 5B38G 3PV6B 2F8VA 4JO2H 1QQDA 4G8EB 4MB4A 4PJGF 2OSLB 3RPIA 3C08L 3DURA 4XPTH 4TUOA 4F7EB 3ZLQC 1M6OA 5ALCH 4ZFGH 3UYRL 3QRGH 1RZFL 5IB5A 3TA3C 3QCVL 5L2KB 1KCUL 1A6PA 3CU1A 3VI3E 2DM7A 5CJQL 4X6CB 1GGCL 1P2CB 2BMKB 2GT9A 3C8KB 3FZUC 1N5AA 3TZVC 4L4TB 2C1OB 1JTPA 2X1OA 2EXWC 3JV0A 5HVWA 3L5XH 3QFJE 5HYQA 1T1YA 4YPGB 5I9QC 4JAMA 2BSSB 2ZSWB 3MCG1 4Z18A 5T3ZH 1BF2A 4HIIA 2P8LA 4K94C 3HR5A 4NN5B 4NWUL 4EJ1C 2A74B 4FQPA 4U1IA 5CHNB 3RP1A 3L1OH 1K9TA 4EVNB 1Z2KA 4GKNB 3KYOB 1C5BH 1KEGH 3VWKA 4JQVA 2L7UA 2EYTA 5EU6E 1A1OB 4JFDA 4GT7A 4PJ9C 5JPNA 1AD9A 2DBJA 4X0KB 4X5XB 5F9OL 5I2IB 4OCXH 1D5MA 4OZIE 5A2FA 3RX5A 4GMTL 2A9MH 4LPUA 3OHXB 5IK3B 1SYSA 3DSFL 4YFDB 2MTPA 4WW2C 5SWSA 2V2WA 3OJVC 4PJIE 3PGCB 2F54D 5H37H 1T83C 2IANB 2X4RB 4MXVE 4FXGA 3RNQB 4MX7A 3CUPB 2DQTH 1A3LL 1MCQA 2NTSP 3M45A 4U1NA 3UBXI 3MRRA 4N9OB 4JM4L 4K23H 5JA8B 3PP3K 1UENA 1ERNA 5F3BA 4RAHA 1NBYA 1XH3A 1VFBA 5DMIH 1T3FA 5DRZA 4AEHH 1I8MB 2BNQD 3F62A 3RVWC 4HJGA 1NDMB 4WJ5B 3CVIL 3MMEB 5DFTA 5SWQA 4L8CB 4JN2B 4WHYG 4RFNC 4MNQD 1U42A 5BV7B 1E6JL 4GW4B 1XF2A 1J8KA 1MFCL 2ZUSA 5K59E 2CR6A 3VFTB 1RUAL 2PYEB 3R0MA 4PRHD 4ISVA 1T1XA 5AYUL 1Y18A 4PV8B 2QTEA 3GJFK 1XF5B 4RMTA 2YXMA 5ELIA 3LCYA 2OZ4H 4F9PA 5F9JA 1KLUB 1Q9WB 1MI5D 2J6EL 2NY0C 4UUJB 5JUEH 1OAYH 3FTGA 2F53D 1J0HA 3MGOB 4JY5L 3QPXH 1C5DB 3GSRA 1QFHA 3K4DA 5IWLA 5D1QD 5JHLH 3C8DA 1KCVH 4DUXA 1QVOB 2FIRT 3G6JA 3QUYD 1DBKH 1S7VB 4LLYB 4XXDA 1NUNB 4PJ8B 3VWJD 3WNLA 1ZOXA 1BIHA 4J12A 3L5JA 1TCRA 3NH7L 3GK8L 3A6CL 3DROA 5FHAH 3MJ7A 1RMFL 4V1DD 3C6LB 2JB5H 4JEGB 4Q7DA 5CJBA 2IGFL 3FL7A 2V5SA 5FYLE 4X5WA 3Q1SL 3I2CL 5KN5A 4PRAA 4ODWA 1H9VA 4ALAH 3WFBH 3QUZD 3RZCB 3OF6D 4HV8A 4OAWA 4PRIE 5I15L 4RA0C 3FO9B 1HH9A 5DJZB 5A2JH 3H42H 4NKDA 1S9XB 2XQYG 4KQ4L 4RMQA 1AGFB 1ULVA 2GTWB 3S4SA 1IQDA 1JZ5A 3TH4T 3G5ZA 4P9MH 1TZGH 5BOZG 3Q5OA 5TDOA 5D1XC 2I07B 1KT2B 5TE6L 3DOSA 1T7WA 4TPRL 4WWID 3UTTA 4MNGE 1CVRA 3I6KB 1OSPH 5AD0B 3FQTA 1HZHH 4H20H 1AXTH 3HUJF 4BUGA 1IEHA 2E7CA 1UCTA 1CFTA 5IVXB 1FLRL 4OCWH 3V5KB 5HYJA 2Q86A 3OV6A 1AGEB 1FFOB 4LSSL 1CDGA 3QRFM 1R5VB 3HAEB 2WBJD 3C09C 3QYCA 4K9EL 3E8UH 5F72S 5T5FH 1RIHH 1YNTA 3SKJL 3VXSB 2D0HA 1F3DJ 2NMSA 2XA8H 5E08H 1BX2A 4HAFA 4OV5B 1PX3A 3RA7H 4LOUD 4P2OB 1T7VA 3GMQA 4DGVL 1CQKA 4ZFZB 1JRHL 1MCNA 3FB5B 1AKJD 1F45A 1QFWM 2PTVA 2QL1A 3F5WB 3P4OB 5DJYB 5BZWB 4XNUH 3RGVC 4Y5XA 3DUHA 1UXSA 1CFNA 4Z0XB 3RTQB 4JGUA 3MLXL 3QPQC 2IG2L 3V79C 2DB8A 5D6DC 1DDHA 1TENA 2FO1A 2FX8L 2I9LA 1WBZA 3CJJA 4ZO6A 3VG0L 3CVHL 5I1LB 4G6AC 1CCZA 5ACZA 1YEHH 1U3ZA 4G43B 4YHIB 1DSFL 3GBML 1IRAY 4NN7C 2R9HC 3QDGB 3FT4A 3MYJA 4P4RB 4P5KA 3P9WB 4DEPB 3OGCB 4MD5A 2UWEF 2C3XA 4DKEH 4DQOH 1FFNA 2NLJB 4QHMB 1G9NC 1DLHA 5CJOH 3OB0H 5CFHA 3CFDB 2IWGA 4YO0B 3GI9H 2W9DL 3LHPL 4HX1A 5DZOA 1QFUH 2IBZY 1F4HA 5I1AB 5EDXA 4JJ5A 3MRBB 2BOCA 2XRAH 3ARGC 2HT4C 3CPLA 4XAWH 2IBGA 3QXTA 1NSNH 4NJAH 5E94B 3WDJA 3PGDB 1X5HA 3M8OL 4FFZH 4X6FA 4QXUL 4EI5D 4X4YB 3IDJB 3HE6D 4LSVL 3RY6C 4UTBL 3EYOB 3AS2A 5EZJA 1OTSC 3HMXA 1WZLA 3JV4A 4R7NA 4XC3L 4OGYL 1U91A 3QI9D 1IMHC 4KZEH 5DEFA 2VSCA 2R0WL 1L7TH 5DUMH 4K3DL 2WIIA 5ITBH 2PO6C 1INQB 1T66C 1CG9B 4U2ZA 3GSNB 2XQYK 2BXZA 5I8OH 1ADQL 4K7FB 3S6CA 2IAMD 2VLJE 2FLRT 1Q94A 1XF3A 1I1AA 2QQKL 5CLWA 3BPLB 2RIKA 4QYOA 1P4BH 3T65B 5KVFL 3LQZA 3ZKMC 4YIQA 3OZ9L 1Y6KR 1V3JA 3WLBA 1PKQE 2DQHL 4I2XB 3EO9H 3REWA 3PDOA 1BD2E 3HR6A 5F21B 4CNIA 1BM3L 5F3HB 1S7XA 4ODSH 1D3CA 1A7OL 4XBEH 5KVGH 5HYSG 2D2OA 4OD1L 2CIIA 4RRPG 1G9NH 3VFRB 3O3BA 5CSGA 4KU1A 5EUOB 4HUKB 2VAAA 2EDLA 3QJFB 3S3PA 4H26B 3B3IA 5CZVL 1FNEB 3MUJA 4IRSA 2NNAB 3E6HA 4XP6H 3ULUL 1UEYA 5TF0A 4ZUWB 4XH2B 1MFBL 3B83A 2H1PL 3QEUB 1S9KC 1LEIB 2HLFD 1OVZA 2EXYD 1MCWW 2NTFB 4OIBA 4LSQL 1IM9B 3ARDB 1FO0B 3LKPB 4KK8D 4YDIH 4KVCL 2KPNA 3O45A 4PLKD 1U36A 2UYLA 4PJHF 5I6XC 5DFVD 4AEIL 3L9RA 5T1LA 3OKKA 2EYRB 4M1CC 2XYCA 5DI8B 5IVZA 5D1ZD 4YHZH 2H26A 5FB8B 1AGDA 4OGAD 4Q6IA 1ZA3A 2FHFA 3AU1B 5ABDE 4HKJB 4PP2A 4PS4H 5D7JA 2JCCF 1HH6B 1D5XB 4YBHA 1MNUH 3P40A 2VOTA 1UADC 3S5LG 1QBMH 3FQWB 5ID0B 1MEXH 4WWKA 5DK0B 3LZFL 1N6VA 5C0DA 1DVFA 4WEUD 2I26N 5DRXA 2AJVH 3U79A 5D5MB 4YK4C 2D7QA 1CICA 1UJ3A 2A6JA 3B6SA 5ERWB 3PP4H 1NEZG 2HMID 3L6FB 4GSDH 4TSBH 3T3PF 2X4NA 2JJVA 1CQYA 3U2SA 3WJLA 4X7SL 1GC1L 4KRMB 5IW3A 4ZOBA 4TTGA 4BZYA 1K8IB 5E6IA 3UJIH 3TCLB 2AI0L 2UZIH 3MO1A 5K9OA 1FGNH 3BUYA 3BO8A 4GXVL 3PQYD 5F1IA 1K2DB 3RUGB 3LV3B 1JPSH 4BSWB 5IF0A 3MRNA 4N0UB 3WD5H 3VXOB 3GMLA 1OTTC 2VDKH 3D39A 2GYSA 4L29A 4P4KC 4QRRE 2X09A 1QFWI 2AJSL 4UQ3B 3HLAA 4U6YA 1IARB 3FOLA 3D0VB 1TJGH 4K7PX 3CMOL 5FHBH 4EXPX 1CDJA 3BPCB 5K9QG 1ZVHA 4Y5YC 2ZCLH 4LLQA 2YPKA 4P9HC 1CTOA 1KEML 4ODTL 3IXTA 4CN4A 1KTKE 3WJJC 4OZFH 3WFZA 5HHXH 5ITFA 1AXSB 3QAZB 4MCZB 2IFFH 3U46B 1FP5A 5C0AE 3HG1B 4FFWC 1FRGL 3AREA 4Z7VF 4BSVB 2FD6H 2QQNH 2R4RH 2FEEI 2XQBL 2A6KB 3RZWA 4N8VG 3O11B 3U0PB 4LHUD 3DRTB 4TSCH 5FF6B 5DHVH 5F7DB 5ESAB 1QR1B 3H9SE 3LS4H 2R0LL 5GGSY 2VABA 3PNWB 4ZFFA 1P53A 3S37H 2UVFA 2OYPA 3HRZB 3WFDH 4HCRH 2Y36L 3SQBA 4GAYA 5C09E 4O2CA 1UACH 1QP1A 1AQDA 2GIYA 1FL3B 5IJKA 4Z5RB 4JQXC 1XR9B 1QLEH 4FQCH 4JFQB 1RUMH 3K2UH 3MRQA 3S36L 5SX5K 35C8L 1RULH 3T0ED 2OR7A 1NGXB 1S78D 4HC1L 3D18B 2ADFL 5T1DL 3KJ6L 2HJFA 5CBEA 3BEVA 3EOAA 2GUOA 3BVNB 3VGHA 5BV7L 4JM2A 5BRZA 4P9HH 5JR1H 3MFFA 1T04A 4JRYB 1W0VB 3MFGB 4CBPA 2YD8A 4F33B 2R8SH 3HS0A 4KGLA 5HHOB 2YPLD 2X44D 4L8SC 3UBXA 1UCBL 3WE6B 2PXYB 3O6KL 3RVTC 4X6DA 3STBA 1F11B 3A6OA 3MOBL 1VERA 3STZA 3RNKA 4F7CB 1BWWA 1OP9A 1ZT4B 5CP3H 1JWSB 3MLZH 4ZSOA 3NIGF 3MCLH 5EN2B 1ZSDA 3BJLA 4Y4KA 5F7EL 4TVPE 1Q9LB 1GGIL 1F58L 5I1IL 4XPBH 4XZUB 4AENB 3EOBA 3LKOA 3MACH 4BFBD 9CGTA 3GZKA 3PIQB 2J5LC 1BIIB 3QO1B 3BGMB 1G1YA 3MRIB 1FNSL 5HPOA 4K71C 3KHQA 4C4KT 4ZDHA 1IQWL 5C07A 4JANB 1P5VA 2ZZUT 4OBSA 3N06B 3MJ9A 4ZTPL 2NX5D 1BFVL 5DHXB 3ZHDA 4WI3A 4ELKA 4HUUA 1RV6X 3DMMD 5H37G 3RWHB 3PJSB 4JR9H 1QSED 1IGTB 1MHHA 2VXTH 5ADPH 1EPFA 4MVBD 1GHFH 4YEFA 4PJHE 3GI8H 5J1AB 3OAUH 5EC2B 1EEYA 4LGRB 3HZVA 5JW5A 1U8KB 4UDUA 3VWKC 4NQDD 2NY7H 4PG9B 3F7YA 4I0PB 4BK4A 2JCCE 2ERJB 1MCOL 4WRLA 2M26A 5IEKB 4FNLL 4P46D 3PWJB 4JN1H 2YD9A 4I3SL 4WGVB 3H3KA 1L7IH 4GW5A 1G84A 4WO4D 3QG7H 5DR5L 2QJDA 5FO9A 3OQ3B 4JRWA 4Z78B 1SMAA 5GRVK 2J8UB 4PB9H 2BVQA 4NSKA 5ACLA 4L9LB 3TV3L 1X5LA 4PLJD 2GY7B 3MA7B 3BSZH 4L3AA 3T3PE 3BP7A 4L4JA 1RJYA 1XCTA 2DQCH 1JPGA 4C56B 1MHEB 3P0YH 5CILL 1UKTA 3FRUB 1A9BA 3HZKA 5SX4I 2VC2L 4O58H 3SJVA 1YPZF 1FFPA 2FX9H 2YD3A 5DTFA 1M05B 3MXVH 1S9VA 5C0RL 1T0PB 2OXGA 3MV8A 3RU8H 4PD4J 1H0DA 2B7DT 4OCRH 5D7LA 4MSWB 3VE0A 1ZWIA 4XNMA 3AAZB 2FIKA 4NM4H 2I5YH 5I76B 3SGJA 5FGCE 5T3XD 4F9PC 4PY8I 2EYSB 5BW7C 4GKZB 4WI6A 5LVEA 1OHQA 3R06A 4OUOA 3TEUA 1DBBL 1A6ZA 1CN4A 4H5SA 1UM6L 1NJ9B 2P43B 1KJ2A 5DJ8A 3O2VL 4Z7VE 1MCEA 1NDGB 3QXAB 2BCKA 1A4KB 2BSED 2F54E 2UUDH 5BXFB 1FNAA 1XR8B 3GKWH 3GDBA 2R2HB 3NAAH 2FL5A 3TBTB 3BDYH 4KWUA 1D5IL 5DZNA 1A6VL 2YPVH 4HKZA 4Y4FA 1GZPA 3RI5K 3Q2CA 2YPLA 5DK2B 1AY1L 1FZKB 3C5ZB 2H2SC 3CSYB 3X14B 1GIGH 1ZHNB 1ZTXL 4M1GL 2BNQE 3VXRA 4GRWF 4XVSL 4QRTA 1J1OH 5IMKA 3U9PH 5HHPB 4LQFH 4HZLB 1IEAA 4MNQE 1MFEL 4MCYB 5FO7B 5E99L 1Q0XL 3GSNL 3OJMB 3TBSB 3H9ZA 4D2NA 4L4VB 3ULUD 1DJSA 4PRHE 3TN0D 5DMJB 3PWVA 1FDLL 4PJEE 2L0DA 1FFRA 1MI5E 1IEBB 3UX9B 1JWMA 3O41B 4JG1H 4NKOA 3G9AB 2F53E 1SBSL 1C08A 4EEEA 1F90H 4PGEB 3VMOA 1SJHB 3VFMA 4MB5A 1U8HA 4OT1L 2F58L 1DANU 3E0GA 4EKXA 1ZA6B 3UTSD 2C5DC 5KSBB 1KCKA 3CC5B 3WKML 4S2SB 3P9LB 4JO4L 3V0AC 3QDHA 4V1DE 1QOKA 2Z35B 3RAJL 1CDHA 3C60B 4HJJH 1FL6A 5GSVA 3UCRA 2ZWLT 1YEDA 5C0JA 4MMZC 3V4UH 4TNVK 1P9MA 3WUZA 3NIGE 3VXNA 4QHUA 1CGTA 1FO0L 4OM1H 5HI4C 2VTFA 3BPNB 4IRJB 4NWTH 4UDTA 5CWSA 1CR9H 4Y5XC 5C0BA 2R1YB 3FHAA 2IQ9L 3IXAB 1KBGH 1NANI 5DJAB 2VDML 3LD8B 1S7WA 5T1KA 3W2DH 3AM8A 4WUKL 4NN6C 1YYML 3TC9A 2DMKA 2XTJC 1DE4A 2VLKA 2VLLA 3WHXA 5L2KD 2HH0L 2ZJSH 2VQ1B 4HWBA 2R1XA 5FECB 4WCYH 2OQJB 1R3HA 1IBGH 3ZT5A 4AQ1B 4LIQH 1W0WB 1YEFH 4U1JA 1CFQB 4L4TD 4F9LA 1RVFH 3V8CA 4NFCA 1WICA 3ALPA 4F80A 2P5WB 4NBXB 2IPTH 4U0QB 3T77A 5GJTH 4NZRH 3ZE1F 2C3GA 3QNXA 5JPMA 4R2GC 2HT2C 1FYHB 4FG6D 2EECA 5DF0A 4F37F 3QQ4A 1JNNH 3AC0A 4X6BB 1EFQA 3O2DA 4IOSD 1A6UL 1MLBA 4U1SB 1JK8A 3O6FB 2JK5A 4U6XB 1RUKL 4HWEL 2VDQL 1C16A 3NZ8B 2GFBA 1T89A 2VN4A 3TBYA 3I75A 3T0VA 1KUMA 2W59A 2C3VA 2NY2B 3MQIA 2CDGB 1VKXB 3MRGA 1U8MA 2O5ZL 4LCIL 1CDYA 4OLEA 5FA4A 1I1AC 3BKYH 3GGWB 2IAND 5H94B 1Z3GH 4WENB 1BEYL 1CXKA 2EIBA 4OGZA 2F5BH 4LLAA 3TIEB 1JTTA 1QBAA 1XGPA 2QLVB 4ZD3L 3GEWB 4XP1L 3NFPB 1WV7T 4JZJA 5DT1L 5ILTL 4P3DA 2PYFB 5CUSH 3DARA 5AYQA 2HTKC 1CXEA 1K6QL 2IADA 1VEOA 3QXUA 4KXZH 4WU5A 2PYED 5DD6B 4IRSC 4HS8L 1NAML 4KK6D 3WLWD 5GISH 4G7VL 4OJFH 1LK3L 4OF3A 3QXVA 3LKRA 4O2EA 2ED8A 3HMXH 4XHJD 2Q20A 4EDXB 5GS0C 3MLTA 4U7SA 2WMPA 1CVSC 1X5YA 1CE6B 3B5GA 1UWXH 3UTQA 3OAZK 1MCSA 4PJ8D 4WI9A 1HXMB 4Q6IC 3JTSA 1KB5B 3S8WA 1PSKL 1J18A 2LAGB 3F6LA 5DUPL 4GRWE 1Q72L 2A83B 5D7JC 3L3JA 2OLDA 2PW1A 5HY9A 4BH7A 2EKSB 5I19H 1W8OA 3C6LD 4WWKC 3MRMA 3HHRB 2QR0A 1DVFC 1JNLH 1TFHA 4Z95L 3RZCD 1CICC 1UJ3C 3ALXA 4QGYA 3SN6N 4LRNL 1OAQH 4KI5D 4XP5L 4OZFG 1XZ0B 4G8FB 4LLWA 4M7JL 1N7MH 1ED3B 3WXVL 3OKNB 1JGVL 1OQOA 5JW3L 5E6IC 4DOHB 5HYSB 3NTCH 4N1EA 4PUBH 3HC3H 5F70A 5L2KA 5ADOL 4LKXB 2PCPB 5ISZA 1CGVA 3NABL 1INDL 5E2JA 1PQZB 4HH9B 4D0CB 4OF0A 5ACMA 2F74A 2XIDA 4L4TA 4Z77B 1KIPA 3SOBH 5I75B 4XCCH 3SQOH 3W9EB 2RBLA 3G5YB 2C3HA 5HSFA 1UB6A 3KJ4B 3GSUB 1ZGLB 3P77A 5I73C 1IGYB 1RIUH 4XPFL 4DAGL 4ZSOE 4XC1L 1SVCP 1BHGA 1WBXA 5GS0H 1LEGB 3KPOB 3A67H 3H3BC 4P5TA 5H2BA 3VXSD 3KPRA 2ESVA 2V7HA 4PV9B 5F96L 3NN8A 1ZANL 1KFAH 4GFTB 5CEXA 3K74B 4LSRH 4MZ3A 4CMHB 4X4XA 4P2OD 3LS5L 2IC2A 1V7MH 3SDDB 5FYKH 4WUUB 3X12A 5I1CH 3EDFA 3CU7A 1F3JA 4PJAA 4FQIH 4XCNA 4Q6YA 4HG4K 5GGRB 3AREC 1MAMH 2G75B 4J7RA 4C83A 3RTQD 2D0GA 4QOKB 4FZ8H 3TWCL 4ZYKB 1FORH 3B2UC 1EHLH 1MY5A 1NCCL 1FG9C 4HKXA 4X9HA 3C6SA 1T1WA 4YXHH 1EXUB 1MAJA 2EH7L 4TULH 2EC9U 5ESVB 3SKNA 2FATL 3VFWA 4ZODA 3HNTL 4NO2B 3D0LB 1P4IH 1PBYA 4OB5H 1OWRM 1OT1A 1PVHA 3PQYE 1NFIB 5E5MA 4MWFA 3GHBL 1NEZB 3VJ6B 1KPRA 1KLFA 3QUXB 3QDGD 4LDLB 1RZGB 4PBWD 1DFBL 1FIGL 3HI1A 1AQKL 4Q9BA 4AZ8A 3HUJA 1ETZA 5IJKC 4R90H 4LVOC 3SDXA 1T22A 3EFDH 4YAQB 2EDYA 1I7RB 3ZE1E 1T5XA 3S36X 3VXTA 3DPBA 4IS6B 4JN2A 5IBTL 1BREA 1QKZL 5TF1H 4NT6B 1MJ7H 1QO3A 1LO5A 5J7CC 4OCSL 1FJ1B 4Z7WB 3IFNH 2HKFL 2LTQB 5C8JB 3BZDA 1BLNA 1M7XA 3VGBA 3VH8G 2W60B 2ATKB 4XMPH 4JM2C 3WIIH 1AGCB 3DGGA 4M93C 3ARSA 2A9NL 3HKFA 5AAMA 2R2CA 4NDMB 4KJYA 4LEOA 5IIEB 1LO0L 2LU3A 2COQA 4MLSA 4HG4J 5CEYB 2VL5B 4MQ7B 3BZFB 5EIQA 4D9QD 3X13B 1NMCB 1UH3A 2AV7A 2WUCH 4ZUTB 5C0EA 2VR9A 5HVGB 2DIJA 3AFLA 3G6AA 3DVIA 1MWAL 4ORZC 2OJZL 5D93C 5MEPB 4ZUVA 3HB3C 4YX2H 5J6HA 3KWWB 3QULA 4OGXH 3VXMA 4Y4KC 5JXAH 1AHWA 3ULUF 3QBTB 1N6QL 1RZIA 3KPLA 2DWDB 2UWEA 3NVQA 4PP1D 5GS2H 3GSOB 3T0EE 1I1YA 5GJSL 3IU3A 3LN9A 3TJEL 5F7WC 4NHUA 4MA3B 2CH8A 3EYSL 4JDTL 3WO4C 3P30H 1U8QB 4O51B 4QHKI 2NQCA 4U0RB 5FKPA 1KJMA 3DTXA 3P11H 1ZHLB 3QH3B 1OPGH 1J12A 1A14H 2G60H 5IMOB 4HIEA 4LNRA 3MA9H 2UY6A 3D25A 3FAXA 2APTA 2YPLE 3CFEB 4GBXB 5F7KC 3UP1A 1IM9D 3ARDD 3K80A 4Q9CA 5CEZL 4KMLB 4GG6F 1KPUB 4N0FB 2EDKA 1KTLB 1FZJA 3A0OA 2PR4L 5JDSA 1S7TB 5EOQL 1ZLVK 4TTDD 2WANA 4W4OA 1BZ7A 1JMZA 3O8XB 3U9UA 1YMHA 3T0BA 1F4XL 1XIWA 3HTLX 4FQ2L 3SY0A 2H6PA 4X7TB 3V95A 3NA9L 4E0RA 5IR1A 3U6RB 3RJDA 1DBJL 5BVPH 3GIZH 3GSXB 3O4LB 4CDGC 5GIRA 1PEWA 2NX5E 1E4XL 3V5DB 3STLB 4X6CF 2VITB 1L0QA 5KS9F 5TH2B 5FGRA 5C71A 1QSEE 1OCWH 3QIBB 1URLA 4FQ1L 4LARL 1LK2A 3CXHK 2EDNA 3MNWA 3KVQA 1KPVB 1U8PB 2R15A 1DLFH 5DMKA 4O5LL 1BFOA 1AC6A 2C1PB 3TLRA 1A2YA 4JFXA 5TFSL 3P9MB 4Y1AA 3OGCA 3R4DA 4NQDE 4ZNEA 3EHBD 2CPCA 2VE6B 2DTSA 3RWGB 3NPSC 1JZ6A 3GNML 1I8IB 4JO1L 2F5AH 5D9SB 4YHYC 2EDEA 3TA3B 1T2QH 3SGJC 4G7YH 2W9LA 4HSQA 4JLRA 5EZOL 3D1MC 4FOMA 2XI9A 3NCEB 5IHUH 1T1ZA 3TO4D 3WL9A 5IFAH 4R9HA 3CSGA 2OTWB 1T6WA 2D31A 3S88L 1H3TA 1Z5LA 1YN7A 3BRFA 3TJHC 2AJ3A 1F4WH 2NY5C 4RZCA 4DW2L 5KJRL 1CZ8L 4OZ4A 3OAYH 4J2XA 5F7MC 3QEQA 3HG1D 2ARJQ 1CD1B 5FK9A 2DWEB 2DQJL 4Y19B 5TQ2L 4FRWA 2H41A 2FR4B 4Y4FC 2AK1H 4U2YA 1GH7A 1NKOA 4Q0XH 3DI2B 4F58H 5F7HA 4DFHA 2YUVA 5IEHA 5HYFA 4Y8DC 2AABH 1DL7H 3MREA 4PJ9B 1II4E 3F7VA 4JFPB 3ZKXC 3CXHJ 4CW1A 3W0WB 4RNRB 2XWTA 3G5VA 2XZAL 5EZLB 1UH2A 4DN3L 1CLZL 5CD5C 4LDEB 1FNHA 3P0VH 4YDVA 3D5OF 5T3XE 4HAGA 4R3SB 1TMCB 2A38A 4IOIB 3ZMRA 3U0WL 4WW2B 3UTOA 4U6VH 5E03A 1GYAA 5EBWA 4UIMB 5DD0H 3O3DA 1OP3K 1JYVA 4B7IA 3MLUL 3VFNB 1X5KA 1M71A 1JUFA 2YRLA 1OB1B 2R0ZL 5D7IA 4QWWD 1QRNB 3QA3B 1I1RA 3S35X 3T2NH 2WLZA 2E7HA 2HWZH 4NUJA 4PRPB 1FV1A 2DYPB 1P4LA 3V4VL 3S4SG 5I18L 4XH2A 3CDCA 4JRYD 1WZ1H 1IZKA 2NY5H 2X4QB 3KDMA 5HHOD 2PXYD 1YMMB 3QHZL 3HFML 4R4ND 5ENWA 1IGFL 1P9MC 4HEME 4NKIL 3DV6B 3ULUE 3LKQA 4M8VA 2NY0B 4HFUL 2O5YH 2MPAH 2ICCA 1FNLA 5KANG 5AZEL 5IGXL 4FTVB 3ULSB 2PW2B 5FV2A 5B22A 2B2XH 4KKLC 2ILLA 2DMCA 4YFEA 3AM8C 1RJLA 3FB6A 3ZKSD 4QRQA 4DGIL 4YHKH 5BMFL 2X9XA 5DQJA 5T5NF 1OTUC 5FIEA 1NBQA 4KRPB 4NCDA 4JFEB 4CMMB 4YBQD 3UTSE 4F9LC 1T5WB 1MCPH 2WV3A 3ZDZF 4ENEC 2LAAA 4NO5A 4U3HA 2D03H 3IGAA 5BO1L 4RBPH 3UYOD 1KNOB 4G80B 2E7BA 4DVBB 4K2UL 2ICWI 4PTUB 3IETA 3VXQA 1P1ZB 1J05A 1MCLA 2BNRB 1HHGB 4JFFB 4JKPL 1JGLL 3VXPA 2VYRE 3KS0H 3D85A 3OKEB 3P4LA 5E9DB 1NC2A 5D1XB 3DX8B 3QDJA 4I0PD 1EGJL 4NNXB 3TO4A 2HYMA 1MIMH 5IM7B 1NFDF 4XCFH 5B39A 1T89C 4LK4A 2NXZC 2M8XA 1DEEB 1T0NA 2DQGL 4I77L 3RHWF 1INEL 3QDMB 1FNFA 5F97E 5L2KE 5JMRA 2P8MB 1E4WL 2J8HA 3FB7B 3U46A 4X6CE 2BSRA 4EDWH 4KJPD 3LRSB 3VFSA 3C09B 3M1BB 4L4TE 5DGRA 5FDWB 1CDBA 4HDIA 4C56D 1TVBA 4MA7L 4NQCA 2YEZA 3UXFA 4BZ1H 3SPVB 2WP3T 1J5OL 2F19H 4HWBH 5C2BH 2ZPKH 3CXDL 4MXWH 1XCQA 4JZJC 5IG7A 5KTEH 1WWBX 1FG2B 2HLAB 4FQHB 4UB0H 4WI2A 5DQ9B 1IAMA 3RGVB 4P23C 3RVXC 2YKLL 1RAMA 4RISL 1DQLL 5E8PB 2VDRH 4XGZB 5DMYA 4UV4L 1IT9L 4JZOA 1P7HL 1P84K 1A7RH 4Z5RA 1R6VA 2I24N 3VD4A 1QLFB 5FUZH 2HG5B 5GRWA 4L8DB 3EYQD 4NN7B 4PJCB 1AO7B 1I3RA 5EC1B 3G5XB 3WKNA 3LY6A 3ARQA 1KIQB 3CK0L 2Z93B 1HINL 2NZ9C 3F12B 1LO4L 3JUZA 5C0FA 1MRCL 4QNPE 4WFFD 2IANE 4NQVA 4QCIA 5EZIH 4U1KA 1WFOA 5CBAA 5I8CA 5FO8B 3UAJC 1SBBA 2MHAA 2CK2A 1XGTA 3DGCR 2GAZB 3C5ZD 5EO9B 4F7MB 1HQRB 1B2WL 4ZUUA 1YEGH 3VA2C 3ROLA 3L3OA 3QO0A 3OKMB 4RAUB 3RL1B 1YPZA 1KN2L 5LBSH 1HHIA 2FWOB 2PYEE 4YDJB 1D5ZA 2EIEA 4XVUC 2FX7L 4R4BB 5EUOF 2PO6B 1SY6A 1R3KA 1T21A 2HRLA 3O3AB 4LVNC 4NBYB 3CFCH 1AR1C 1BGXL 4KJQC 3PIQA 5GZOC 2VXVH 4Y2DA 1P84J 4H88H 4KC3B 4ELMF 4PB0H 3IKCA 3FO2B 3JZ7A 1I75A 2ICEA 4F8TA 4XNYL 4R7DB 4E41B 3QHFL 5LWYH 1XGQB 5I71C 1CE1H 5ECJE 2DQIL 1KCSL 5GRVL 1LMKA 3O2WL 5HHQA 3BDBA 1CK0L 1RZ8B 3TNNA 3T1WA 3SCMC 5LGKA 1YDPB 1QEWA 4UT9H 4HWNA 5CP7B 5F89A 1IGCL 4P5TC 1HQ4B 2X42A 4YEEA 4YHNB 2C9AA 4DUWA 2NY3C 4XPTL 4LCUA 3C60D 2OR9L 5L8KB 5ALCL 1JNJA 1U8KA 4U1LA 1IGMH 2AQ2A 4ZFGL 1ORSB 1GGBH 3QRGL 5ICZA 3RWJB 1NCUA 2IH3A 3DV4B 4LAQL 4GQ9H 2CO6B 3EYVB 4IRJD 5C0CB 4KI5E 3MUGA 4U3CA 4HXAL 3U4BH 4J3XA 1FN4B 5D5MF 5FYJH 2FHBA 3MRHB 1MLCB 2P5EA 5HPMB 5I6XB 4HGWB 1ZS8A 3ARWA 2AEIT 3FCTB 3OJDA 1Q0YH 3NCJH 2AKRA 1YY8B 1DQDH 1WFNA 4XX1E 5FOBA 5T3ZL 5FA3A 1U95B 4NO0B 4KK5D 1SM3H 1CDIA 4OZFB 1C12A 3ZDZE 1UWGH 5INCB 3QG6B 5IVXE 4QF1B 4OZGA 1EEUA 3L1OL 4M6MH 4GW1A 1C5BL 4OD2A 5KZCB 1KEGL 1H5BB 1OM3L 1W72A 3MLPA 4JREC 4XWGH 3EIFA 2FGWH 2P5WD 4LPYA 5E56A 4D0DA 2X89A 3INUH 4QXTA 2VWEE 1T03L 1CYGA 3A6BH 5IT2H 4XXCA 4OM0H 1VGKB 2WW8A 3VXSE 5DHVB 3IJHA 4YK4B 1YJDC 4FXLA 4MHHI 4OCXL 2APWA 5CD3A 4L8BA 2H9GB 4FP8L 3V5HA 4JY4A 3KPSA 1LEKB 4CADA 3AVEA 4LCWA 2X05A 4U4BA 4P48A 5FGSA 4KHTH 3AROA 1NMBH 2FJHB 2JF1A 3O6FD 1MCWM 1E28B 5ETUB 3ISWA 2DQTL 1QSZA 4P2QB 3TPKA 4IMLA 3DI3B 3P2TA 3U0TB 3RL2A 1Q8MA 5IB1B 1WCQA 3QDGE 3SDCA 4ETQB 1P7KB 1UB5B 3UEZA 3SDYL 2YBRB 4L3CB 4DKAA 1SVZA 1TTUA 4AL8H 4PJFA 1RUPH 4JRXA 3G04A 1FZKA 4PREA 1UQSB 1S7QA 3BKML 3JV6A 3ZKNC 5JNYA 1EO7A 2UZXB 5J13C 4RDQG 4R96A 4D0BB 1U92A 1DN0B 1B0GB 2OZ4L 4Y4HA 1OSZA 5JOFA 2DM2A 1KB9K 5JUEL 4XPHL 1OAYL 2ZCHH 4KGJA 1F6AA 4QEGA 5MEQA 4ZAKB 3MJ8B 3IDYC 3U1SH 2CKNA 3EZJB 2R69H 3U4EB 1KCVL 4KY1H 4ZG1A 2IF7A 4AIZA 2VIRB 3QEGL 5D7SH 3O41A 4LLDA 1S5IH 1R24B 1YJDH 4XVJL 3I6GA 1DBKL 3AXLB 3SGKA 4APQD 2B0SH 2B1HH 3AS3A 3TM6A 1IAOB 4X99B 3DVNB 4MNHA 4UOW1 1RK0A 2DMBA 2FO4B 1JWUA 4NJ9H 3LQAH 5D2LF 1AFVH 3TPUA 4D9QE 3VH8B 1LP9A 5FHAL 2XNAA 1B6UA 2D9CA 5EIIA 2JB5L 1HEZB 3DIFB 5TGBA 5B8CA 2GJ6A 4W4OC 3E6FB 4JHAH 4WDIB 3M17B 3WFBL 4X6EB 1KELL 2PUQT 1XIWC 4I2XE 4U6HA 2XN9B 3DHJA 3FQXA 1I9RL 4X83A 4HKBA 5LGJB 3MRKA 5I17A 3PL6A 5ICYB 1S5HA 5AUMB 2OX5A 1BAFH 4P9ML 1TZGL 2J6EA 5DHYA 4JDVA 4WV1A 3GMPB 5EUOE 2YA1A 1ONQA 5D7IE 2A1WH 5DJ6B 1N64H 3R8BB 4J23A 4NNPH 1MELA 1HZHL 4H20L 1AXTL 3EOYG 3MGTA 4WNQB 5EFIA 5IBLD 3RWIB 3GO1L 4L8SB 5DLML 1FE8H 3OXRA 3V6FB 1E27A 1KB9J 3LKSA 4YHPB 2CMRH 4RSVA 4I4WB 2WIMA 4HULB 4MLIA 3HPJA 3MCKA 4OZHB 3E8UL 2A73B 4L9DA 4JZNA 2GCYA 1QQDB 2XA8L 5E08L 3RPIB 3OB8A 3DURB 2R1WA 4M02A 4TUOB 3RA7L 4X80H 5HD8C 1M6OB 3I50H 5GRJL 1PY9A 1BVLA 4LHUG 5IB5B 2WWKT 4KV5F 1S9WA 5CSBA 1YEEH 2J5LB 5IFJA 1EJOH 3GHEL 3EJYD 1LO2H 4U7MA 2GT9B 1N5AB 2R2BA 3W11C 3C2AH 1I9IH 3SDDD 2G9HA 4WUUD 1YEHL 5HYQB 3BN9C 4QRPA 1T1YB 5D5ME 3S96A 4KRLB 3UC0L 2EDDA 4JAMB 1JVKA 4XT1C 1ES0A 4HIIB 2P8LB 3HR5B 4QOKD 2FH6A 2YUXA 4PRBA 4WEBH 1ZVYA 4U1IB 2VUYA 5HTSA 1FH5L 2CD0A 3MRCA 3F6IA 5CJOL 4YXKL 1TQCC 3VWKB 1UC6A 2EYTB 3GI9L 2AJUH 4JFDB 1MHCA 1HHHA 3GKZA 1X4YA 3RUGE 1T7ZA 3QUXD 3THMH 2XRAL 5JPNB 4N0UE 1AD9B 2ICWA 4NZUH 1U3HA 5EG6C 1NSNL 2YMXH 1G7IA 5L6YL 1MVFA 3V6OA 4HH8A 4EZMA 3FT2A 2R29H 2X41A 5FKAA 4HPYH 2AJZA 3ARTA 2BVOA 4FXKA 4N5EC 1SYSB 2CDFA 5HI3D 3B5TA 2PETA 1KJVA 1NGZA 1OP5K 5SWSB 2V2WB 2C4XA 4ZUSA 1WEJH 1EHXA 4FXGB 1A3RL 1L7TL 4MX7B 1IC7H 2OCFD 3CVHA 5ITBL 1EEZA 4MS8D 3DLQR 4U1NB 3MRRB 6FABH 4R4FL 1U3YA 3HG1E 5F3BB 5I8OL 4NHCL 3MBXH 1NBYB 5DD3L 1VFBB 2DJUA 1BJ8A 1T3FB 3QNZA 4HLZH 5DRZB 3WNMA 3ZTNL 4APQA 2BVPA 5HGDA 3VFUA 4HJGB 3VG9C 4LMQI 5SWQB 1P4BL 5DD1L 4ZFOL 3QFDA 2N4IA 1XF2B 4N9GA 4A2MA 3KPTA 2IJ0C 4ISVB 3EO9L 1T1XB 2GI7A 4O9HH 3AGVA 1Y18B 4IEFB 3CFBA 2VZ3A 1UZ6E 5F9JB 4XBEL 4YNYA 5BS0A 4NM8H 2HTLD 1G9NL 2JELH 4P5MA 3FTGB 2KQNA 4S10A 4G9FA 3GSRB 4LBEA 2XWJA 4Y89A 4OIAA 5FYLL 1ACZA 1T0MA 3NFSH 4XP6L 1NMAH 3G6JB 3HZYA 3JWDL 4KTEH 4XXDB 1R5IA 3C9NA 2H32A 4UT7L 5F6HI 2IBZX 3PDGA 1RUQL 1TCRB 3BAEL 5D2NA 4HXBL 5JHDA 3QCUH 3DROB 3MJ7B 5T33H 3ARRA 2ICES 4JRYE 5CZXD 4X5WB 5D4QA 1GZQA 4YHZL 1BZQK 4NRYA 5KN5B 4PRAB 4ODWB 5HHOE 3FFDA 4GBXD 4HV8B 4M48L 1KTDA 4OAWB 3GJEA 4PS4L 5D96C 1HH9B 4ODXA 4Q58C 1JNHA 1H3VA 1MNUL 4HWUA 4NKDB 4NQSA 3S4SB 1QBML 1IQDB 3X11A 3WEXA 3G5ZB 5TDOB 1OLLA 4LLMA 3O8XD 2EE6A 1KXTB 3UTTB 1QPXA 2AJVL 1QD0A 2OTUA 1OT2A 4MGXA 1FL5A 4JFZL 2WWMD 3PP4L 3FQTB 3KLAA 4OI8A 5T3ZD 3QUZC 4GSDL 4S1QH 3ALWA 1HOCA 2ZSVA 3U36A 4PJDF 1CFTB 3N9GL 5BOPA 5HYJB 3UJIL 2Q86B 1CGUA 2LV4A 1N4XH 2AQ1A 3K46A 2UZIL 3PXHA 2E9BA 3CH1A 5C08A 1UJTA 1QYGL 3QB7C 4LNVA 3O4LD 1FGNL 1MPAH 1A64A 3MR9A 1YNTB 1J9CT 5EU3A 4RWYL 1BX2B 1N2RA 3WD5L 3IAGC 1GOFA 4DKFH 5EBMA 2VDKL 5EH1A 3GMQB 3QIBD 4MJ6A 1D5BA 1U9KA 1NAKL 1TJGL 5FHBL 5F8RC 3IS0X 3MUHL 4Y5XB 1UXSB 2ZCLL 4WFGD 1CFNB 2MCPH 6CGTA 1DDHB 4PGCA 4CVWA 2DIBA 2NY1C 4I5BA 1WBZB 4WY7H 4GG6A 5ACZB 3DUUA 2GITA 1EA9C 3B5HA 3TA3D 4NN6B 2IFFL 4S11A 3N50A 2XTJB 4EIGB 4IRZH 3FFCA 4GUPA 2FD6L 2QQNL 1NCDH 2R4RL 3FT4B 3MYJB 2DDQH 4P5KB 2Q8BH 3P73A 3FZUD 2J8UE 2YWYA 4MD5B 3F7RA 3KYNA 1FFNB 1JPFA 1DLHB 2EXWD 2P42B 4JGMA 3RY5A 3JVGA 3LS4L 5F1SA 4HX1B 4HK3J 3LMJH 1N5YH 3PE9A 4JJ5B 4C56E 2QQQA 3WFDL 2BOCB 2OBGA 4Y19D 2OR8A 3BZ4A 4HCRL 2E9JA 5C2UB 4LHQB 4I48A 2LE9A 1BBJA 3U4AA 1UACL 4R2GB 5A2IH 3HRPA 5EORH 3W5MA 4KROC 5KS9A 5EZJB 5F7LB 3JV4B 4R7NB 3UJJH 5I1DA 3K2UL 3QWOA 1N26A 1U91B 1DQMH 2AGJH 4PJ9D 1PFCA 5DEFB 4LP5A 1JMXA 4KVNH 3W0WD 1WAAF 2WIIB 1OD9A 4N90D 3HZMA 1DCLA 3DX9A 1I1FA 2Y23A 1MFAH 5EOTA 2VNCA 2P4AB 5JR1L 4LASL 1Q94B 1XF3B 1I1AB 4DJMA 2AEWA 2DQDH 2FCBA 4QYOB 3JBG7 3CGTA 1UZ8A 3GRWA 3LQZB 1QRND 4YIQB 3HNSL 1I3VA 4WFFE 3WLBB 1WITA 5J0BA 5JOEA 1PLGH 3REWB 1OAXH 4PRPD 3PDOB 3UPCA 2DF3A 1ITCA 2DYPD 4DZ8A 4CNIB 1Z6JT 3WO3B 1S7XB 1YA5A 1JTOA 1PG7X 2Y5TA 3RVWD 3KS0J 2IMNA 5I16A 2CIIB 3TP4A 3O3BB 4RMUA 5L9DL 3QWRD 3V52H 2VAAB 4OQ1A 1YMMD 3B3IB 3WIHA 2ZUVA 4IRSB 3OBAA 4XPBL 3X3FH 4AK1A 3MACL 2EH8H 2NY0D 1F2QA 2YHGA 2OS7A 5GS3A 4OLZH 2VR4A 4G5ZH 3L7FA 4M9OA 3O9WA 4FTVD 2Z9TA 1JV5A 1NGQH 3NIDE 5JORA 4YXLH 1YYLH 2UYLB 3DWTA 5IMMA 3L9RB 5T1LB 3OKKB 3IJSA 5DQDL 4JR9L 5IVZB 4M61B 2F8OA 2H26B 2XT1B 2VXTL 4NKMA 1AGDB 4NC1C 4Q6IB 4KRPD 1ZA3B 1SY6H 1G7LA 4JFED 4PYGA 3OAUL 1LNUB 4PP2B 2OP4H 5D7JB 5KSBE 4H8WL 4Q9QH 3HI6L 2EXYC 1KV3A 2ZOKA 2APXA 4KK8C 3QISA 1M1SA 4WWKB 4PLKC 4PTTA 5ID1A 1IC5H 5C0DB 1DVFB 4NBZB 1PGRB 3CX5K 3GBNH 4N0YL 5DRXB 4JN1L 1U58A 2VAJA 1CICB 1UJ3B 8FABB 4XVTH 2A6JB 3B6SB 1IGIH 1OGTA 3QG7L 2BNRD 4Z7NF 4F2MA 1B88A 4JFFD 1JYNA 1WTGT 4KKNA 3U2SB 2X4NB 1GRWA 3L3HA 3MZTA 5E6IB 5E9DD 5D1XD 5GHWH 4Q9RL 1EEQA 3ARFA 3MO1B 4YUEH 5K9OB 2Y06H 3BUYB 3BO8B 5F1IB 3MJGX 1CU4H 3P0YL 3TZVA 2YSSA 5IF0B 3MRNB 4NZTL 2NZIA 3GMLB 3SE9L 3QDMD 4L29B 3D39B 4NPYA 3HLAB 4U6YB 3MV7A 1EX0A 2FBJH 3FOLB 4GRMA 5FUOH 5MP6H 4Z7UA 1A6AA 2FX9L 4JE4B 5CINL 4YDKH 4OIIL 4FQJH 2G2RA 3C5JA 4LLQB 4GLRH 3RU8L 3O3EA 2YPKB 5IHZA 4OCRL 2P5WE 3IXTB 1IC1A 3H9YA 2I5YL 1A9EA 3KPNA 4WTWA 5ITFB 4Y4HC 3AREB 3RGVD 1WWCA 3K8KA 3QPQD 2ITCA 4QY8A 4BM7A 5C7XH 3G6DL 3TYFB 3ZE0E 3CX5J 4Z7WF 1OW0A 3TO2A 1B0WA 1TCMA 3ECBA 3BPOC 2QSVA 1NEUA 4HMDA 3HNVL 2VABB 3GKWL 3SGKC 1AO7D 4ZFFB 2FYYB 3UYRH 3Q6FA 3NAAL 2R9HD 3BDYL 5I1KL 3ARXA 2YPVL 4YH6A 3CZJA 4OFDA 1KCUH 3FQUA 4GAYB 1GIGL 4O2CB 1NFDA 2ORBL 1AQDB 3MOAH 1EHAA 4U1HA 1J1OL 1N8ZA 3U9PL 5B8CC 3F58H 4LQFL 4LVOB 3MRQB 2V5YA 3BIKA 3ARGD 2J12B 5T5NG 2EDWA 2VL4A 2ZUTA 2X9YA 2YZ1A 4NWUH 2DM3A 2VDNL 2OJEA 3PL6C 4HUWA 1TPXC 1QSFA 2HJFB 5CBEB 3BEVB 3EOAB 2GUOB 4JG1L 3KPPA 4JM2B 4WV1C 5BRZB 4M93B 2L7JA 5AZ2H 3DVGA 1WAAE 3RIAF 3MFFB 1F90L 1T04B 4XCYA 3HMWL 4TVPL 3HS0B 3BP5A 2YD1A 3UBXB 1DN2A 2PO6D 3FB8A 1H8NA 4E5XA 4PIRF 1T66D 3B43A 2V5TA 3L3KA 5F9OH 4X6DB 4OD3L 5GS1A 4BZ2H 3IU4L 3IDIA 3STZB 3QSKB 4HPOH 3RNKB 1OARH 1U0QA 5MERA 5D93B 3AUVA 4RQQA 3DSFH 4XMLH 2H8PA 3LIZH 4KKAC 1ZSDB 1FVEA 4Y4KB 1I3GH 4EUPA 1EH9A 5DJCA 4E41D 5MEOA 4GMSH 3V4UL 3LKNA 1A3LH 4X9BA 3EOBB 3LKOB 4JM4H 5FCUH 4OM1L 5GRZA 4NWTL 1CL7H 4OLYH 1UM4H 2VSDA 1WIPA 2ENYA 4ZDHB 5C07B 1JBJA 3UDWA 1KBGL 2C4FU 3WO4B 2B1AH 3TT1L 5IQ9A