2FOAA

Structure of porcine pancreatic elastase in 40/50/10 % benzene
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foaA01
4CBOA 3TITA 9LPRA 3PMJA 3A7YA 1CT4E 1HUTH 1EP5A 3RC4A 1CT0E 1SGRE 1V2UT 1S0RA 4DIIH 4ESTE 1V2NT 1BRCE 1Z8GA 1TMBH 1SBWA 2ZKSA 1O2MA 1OP8A 1RIWC 4TWYA 1MQ5A 1GI0A 1MD7A 1UCYH 3PLBA 1NN6A 4F49A 2BD7A 2PHBA 1Z6JH 3RLYH 2PV9B 3P95A 1YCPM 4O03A 1QJ6B 1C5WB 2XBXA 1HJ8A 1XXFA 7ESTE 1F5KU 3Q3XA 4NIVA 1T8LA 2XNIA 2F9UA 2BVRH 1TPPA 5CHAC 3Q3KA 1MKXH 1EP6A 2FS9A 1EPTC 2AS9A 4JYUH 1OWIA 1DY8A 1IQNA 1HAPH 1P9UA 3A7TA 2D26C 1SFQB 2R0KA 1D4PB 1Y3YA 3JZ2B 2KAIB 4JZ1A 4ZAEA 2NU1E 2FWWA 5EQQA 2GZ7A 4Y7BA 1ZMJA 2C4FH 3UR6A 4ASHA 1DXWA 4X1RU 1C5OH 1MMJN 3P8FA 1GI6A 2GZ9A 1FUJA 2F9NA 1RS0A 1S84A 2BM2A 4J1YA 1PPCE 2P3TB 1BMLA 1GJCB 2ULLA 5L6NH 1SGCA 5TCCA 3NUMA 3ZZ3A 1QRWA 3A84A 1T4UH 1C1RA 3RU4E 2ZNKH 2Z3DA 2R3YA 1HJAC 3BTEE 1QCPA 1QTFA 1AN1E 2ZFPH 3QWCH 1DLEA 2XCFA 3G01A 1GJ8B 4GCHF 4K1SA 1XUKA 2FLBH 4Q7XA 3L6PA 2SGFE 1PPHE 4NA9H 5JPMH 1DX5M 4NWLA 5PTPA 1C5UA 5FHTA 1N8OC 1Y5UT 2AIPA 2UWLA 3BTTE 5FXLA 4A6LA 3RXVA 5DK1A 2PGQB 2FOEA 3SGBE 1NU9A 4BAQB 4AFZA 2BZ6H 1BTZA 3ELAH 4YLUA 3GDSA 2ZECA 1FJSA 4ABDA 5HXFA 1YF4A 2QAAA 4AORA 1LCYA 1OP2A 3K6ZA 4CREA 1O5GH 3RXEA 2GD4B 1CVWH 3VB4A 3TIUA 3D65E 1SQAA 2BY6X 3GDVA 2B8OH 1DUEA 1O5FH 5JBTA 2A7CA 2BHGA 3BIUH 2IJOB 3BTWE 4IMZA 1CGIE 5A2MH 3ODFA 3SW2B 1IQJA 4AOQA 1C1NA 3TJNA 3SU2A 1HAGE 4E7RG 1AO5A 4I33A 4MPXA 1BBRH 4NZLA 5ESTE 5HM2A 4X8TH 1HRTH 3SJKA 3BEIB 1H4WA 1TNJA 1KIGH 2ZU4A 2ZTZA 2ZPQA 2ZHEH 3U8RH 5E0GA 8GCHG 4FU8A 1GCTB 3LGIA 3UREA 2EEKA 3SU3A 4OS2A 2Z3CA 2AMPA 1FY3A 1TQ0B 1GBBA 1ELTA 2BYAX 2VGCB 2VIOA 1YPHC 2ALPA 1IQEA 4ZH8A 1O3GA 3V3MA 5EODA 2VU8E 1ZMNA 2VNTA 1HBTH 2FX6A 2P8OC 3ZZDA 1QB9A 4K69A 4AYYB 4NA8A 1O3EA 1V2OT 2FOCA 3K65B 2Y5FA 4ZROA 3KIDU 5HMAA 5EG4A 5EU8A 2A4QA 1DPOA 1QRZA 3PYHA 1ANEA 3HK6B 2PGBB 2AGGX 3ZZAA 3RXJA 1SGDE 4GHTA 1L1GA 1TA2A 2UUYA 1EZXC 1Y3WA 1P10A 1AWFH 3SHCH 1AFQC 1DANH 7GCHG 2A2XH 4IW4E 1THSH 1EAXA 1ZMLA 4HGCA 1T8OA 3PLPA 5C20A 1SR5C 1ZTJA 1GBJA 1O33A 5E0JA 3SGQE 1YPHE 1WUNH 1AI8H 3V7TA 3M7UA 1C5XB 4Z0KA 1ANCA 3LH1A 2P16A 4UEHH 1GVKB 1RTFB 1GDNA 3RXMA 4O3TA 1VITH 1Z71A 1A5GH 4OS6A 2ASUB 4VGCB 1K22H 3EAJA 1GJ6A 1V2MT 2G81E 1SVPA 5DP4A 2VINA 4IC5A 4KTSA 1HAIH 1CE5A 1O3BA 4Y8ZA 3SJOA 3TK5A 3LGUA 4DGJA 4Y7AA 3SJ9A 1RFNA 2C93B 3ATLA 3QK1A 2AMQA 4CRBA 1SGPE 2CN0H 1ZHRA 4YLQH 1UTPA 3MU4A 4U2WA 3TH3H 1LPGB 1NESE 2VVCA 4X8UH 1NFUA 2PKSB 2F91A 1GBLA 4JZFH 1UTMA 5HGGA 3ATIA 3KL6A 1L1NA 1T31A 4ABIA 4ABBA 4LXBH 4WXIA 2GCTB 2JKHA 1MCVA 3F9EA 4IMQA 1GMHF 1ARCA 1O2IA 3MWIU 1NS3A 2V35A 2ILNA 4OGXA 2VWNA 1PQ5A 4X6OA 1UCYK 2PKAB 1B5GH 1KXCA 1D3QB 1AZ8A 3M5OA 1TAWA 1YPMH 1SHHB 2A5KA 4CR5A 1O2PA 3SQEE 1JIRA 2ZGHA 3SU5A 2W26A 3URDA 4B71A 1V2WT 3LPRA 3ZVEA 1UK3A 3L3TA 1UO6A 4DW2U 1MU6B 1YM0A 1MKXK 4MNYA 1WAYB 1W7XH 5J4QA 4BNRA 1LPKB 4MNVA 2A7JA 3UQOA 2G4UA 1QURH 3O8BA 3FANA 1AKSB 3GYMA 2A5IA 3LIWA 1G3EA 1UVTH 1F5RA 7GCHF 1LHGH 1V2TT 1UK4A 3URCA 3RMNH 1KTTB 2ZHQH 2ODQA 2A0QB 2G5NA 3P8OA 5F8XA 4THNH 1BDAA 1LTOA 2R9PA 3TGJE 4F4OC 4A5TS 4X6MA 3ZVAA 1C5LH 1MCTA 2PW8H 3PB1E 4SGBE 1UTQA 1OWDA 1C2DA 3PMHB 1UJ1A 3GICB 5DPAA 2RA3A 1K1LA 4WXVA 1ELGA 4FVDA 2ZCLP 1ORFA 4AFSA 1QB1A 2K1QA 5JB8S 4WH6A 2OC8A 4OS1A 2ZFRH 3HGPA 2A5AA 1J16A 4TPIZ 2SGQE 3BSQA 5IYTA 1MBQA 1V2ST 3MO3A 2HOBA 1KXAA 2BLQA 5JDUB 1MTNB 1KXBA 4B75A 2CJIA 1F92A 2HVXA 3Q76A 3A8AA 2FESH 5HYOA 1O2OA 4TY6A 1PQ8A 4KKDA 1ZGVA 2XCNA 3SUDA 3S7KB 1T8NA 3NK8A 5FPYA 1GDQA 1JWTA 4X2YA 2Z3EA 1AUTC 3BTME 4ABHA 1OWJA 5FPTA 1GCTC 1C4Y2 1ACBE 1BBRK 3WY8A 4TY7A 2Y82A 1UTKA 2BDBA 3ATMA 4ISHH 2PLXA 5LPEA 1T4VH 1GI5A 1W2KH 2VGCC 7LPRA 1TX6A 3RMOH 1WOFA 3M5NA 1GJ5H 3NPSA 1CHOF 2Q1JA 1MD8A 1GHAF 3TVJB 1SFIA 2OLGA 3RXHA 3KHVA 5JYIA 4Y8YA 2AMDA 1YPGH 2AIQA 2H6MA 4ZKOU 5FBIA 1QBOA 2SNWA 4I8HA 2C8WB 2GCHG 3A87A 1ZTKA 3GY3A 5C1UA 3ATKA 4GUXA 3ZVGA 3E0PB 3QZRA 1V2QT 2BDAA 4X2WA 1TRNA 1NRPH 2BDGA 1EQ9A 1YC0A 4E05H 3IG6B 1GG6B 5AF9H 5T3HA 2Q6DA 2TGDA 1P09A 3TJUA 4DY7B 1BA8B 2EI6A 1AE8H 1RGQA 4D7FA 3SI3H 1J8AA 3SUFA 2CXVA 1GJ7B 2FYQA 2W3KA 2HRVA 3LU9B 1MBMA 4SGAE 3KEEA 2ZIQH 2FLRH 1L1JA 1XUFA 1V2VT 2FYRA 2P93A 4CRCA 4D76A 1GMDG 3E3TA 1ELFA 2I6QA 4VGCC 1EAWA 3ZVDA 1EXFA 3RC6A 5C67A 1MKWH 2A4RA 3R3GB 1L4ZA 1XM1A 1C5QA 5F8ZA 3RXTA 4IBLH 2FM2A 2BY9X 3D49H 2PKSC 3AAUA 2FI5E 3A8BA 1ZZZA 2FIRH 3EE0B 4WWYA 2GCTC 3GY5A 2TGAA 4AFUA 1W13U 3TJVA 1GHBG 4NZQA 1DWCH 1O2QA 2R0LA 4I31A 4NFEA 1C1PA 4JK5A 1BRAA 1TIOA 4YOIA 4XBDA 1TABE 2ESTE 1ZJDA 1EB1H 4FUJA 1RJXB 4AYVB 1Z1IA 3ZYDA 5A0CA 3CENA 3R0FA 1C2FA 1WTHD 2OCVB 2TIOA 2XWAA 1GBHA 1OSSA 4TYDA 2BD9A 2V0BA 1XUIA 2GCHF 2ZG0H 1C2MA 5FBEA 1QBNA 4TPYA 4B74A 3QO6A 5BRRE 1C2GA 1OYTH 2V3OH 1CGHA 5E2OA 3MH6A 5DP8A 1ZYOA 3DA9B 1C5MD 1TBQH 3TJOA 3P17H 4I8GA 3K2UA 3T62A 3SU6A 2F9PA 1LKBA 1EX3A 1YGCH 5EQSA 1V6DA 2B0FA 5HM9A 3QX5H 2ZU5A 1C5VA 1NO9H 2JH0D 2QA9E 5EW1H 3GYLB 1C2HA 1LKAA 1B7XB 3NZIA 5GDSH 3MFJA 3UWJH 1HYLA 1IQKA 1BTYA 1KDQA 3RM2H 3S7HB 3PMBB 2FP7B 2WPHS 5L30H 1TRYA 1F7ZA 3A7VA 1IQFA 3ENSB 4WMDA 3MU0A 4X2VA 1YPEH 4WVPE 1DUAA 1A0LA 1O3HA 1WV7H 1A2CH 2GVFA 2BOKA 2Z9KA 4ZHLU 3N7OA 5ABWA 2FOMB 4FUCA 1C9TA 3RU4D 3SQHE 1DOJA 4E06H 1TRMA 3GY8A 3IWMA 2BX3A 3KQDA 1K1IA 1CU1A 3S9AA 3MHWU 4HI3A 1C1QA 5T6GA 1O2TA 1C5SA 1PPGE 3SU1A 3V13A 2CV3A 4JYVH 1GVLA 1E0FD 2NU4E 1EPTA 4X1SU 1QRXA 4AZ2B 1MTNC 1LPZB 1J15A 4YM9A 3BEUA 1XUHA 1SGNE 3T27A 4X2XA 4Y0ZE 2THFB 1TGTA 4DJZB 3RXGA 4Y71A 3NXPA 1SLUB 1EAIA 1C5YB 1AVGH 4Q80A 4ZUHA 3B8JA 4JZDH 1FPCH 4M7GA 4D7GA 2PR3A 2ZU1A 4QT8C 1QHRB 3FFGA 4ABAA 3QLPH 1HAOH 1NRRH 2BZAA 2LNCA 1GJ4H 1LVMA 1SQTA 3EDXB 2GTBA 2XC0A 2XYAA 1BUIA 1GMCG 1D3PB 2D1JA 4GVUA 2HALA 1CO7E 5LGOA 1D9IA 1Q2WA 1YKTA 4X1QU 5DP5A 2PUQH 2C8YB 4RN6A 1RD3B 3A85A 1E35B 1V2PT 2FOBA 3SGAE 1P3CA 3A7XA 5FCKA 3VB6A 2GT7A 3LGTA 1QR3E 3VB3A 1A4WH 4CRDA 1A46H 1MAYA 2VJ1A 1ELBA 1K1NA 2ANYA 3ZZ7A 1GG6C 5DGJA 1OX1A 2O8UA 4MQAA 2C3SA 1H1BA 2H2ZA 1S6FA 1YP9A 3BV9B 4U32A 4CH8B 2WYJA 2GX4A 4R8TB 4UFGH 1X7AC 3M5LA 2HWLB 6GCHF 1WYKA 1TNLA 1SOTA 3RXBA 1UMAH 2IPHA 2VIWA 5E2PA 5GXPA 1ESBA 4DIHH 2ZPRA 1VGCB 2J38A 1GBKA 4RKJB 4X1NU 4XBBA 1C5RA 1H8IH 1MAXA 4Y6DA 1ZSKA 4DT7B 2BQ6B 3A88A 3SV8A 4OGYA 3TH2H 1T7CA 1GI4A 1BTHH 2ZU3A 3UWIA 1HXFH 1EOJA 4BOHA 2NWNA 4Y11E 1IHSH 2ZC9H 1P04A 2B7DH 1LDTT 2XC5A 3DT0H 2GDDA 2WINI 2VVUA 1NROH 2XTTB 2A4GA 1O2HA 2J95A 1G2LA 1L4DA 1H9IE 1MKWK 1OYQA 1IOEA 2LPRA 4JZIA 1T8MA 1VCWA 1BJUA 3AAVA 2ZDLA 4YOGA 1G9IE 3HKJB 3MMGA 4E7NA 3TK9A 3AW0A 1O2JA 1SL3A 2P94A 2JH5D 4GAWA 5L2YH 5GWZA 1C2JA 1PQ7A 2H5CA 4ISOA 4NIWA 1N6XA 1P0SH 1GHZA 2J92A 3BG4B 2C8ZB 2XC4A 4IN2A 1YPLH 1P3EA 4Y76A 5ESBA 5DP9A 3A86A 2WPIS 1TNIA 1FY4A 5FPSA 1SOZA 5A8YA 2WPJS 4ABEA 1V3XA 3NWUA 2OC7A 2OC0A 4ISNA 3QUMP 1HAZB 2VIDA 2BVSH 1F5LA 1ETRH 3D23A 2ZDVH 2TGPZ 1CT2E 2BLOA 4MPWA 3OX7U 1HIAA 1BTWA 1VCPA 2XBVA 4A1XA 1ARBA 1AVXA 1O2UA 4I7YH 1TBRH 2BD4A 2CF8H 3MU8A 2FI4E 3BTFE 2SNVA 2QCYA 4A92A 3HPTB 1ZGIA 1F2SE 4ZMAH 3QN7A 2ZFQH 2YNBA 1BITA 3RC5A 7KMEH 1FAXA 1T32A 3E1XB 4O3UA 1IAUA 4BAKB 1TWXB 1GHWH 2XWBI 1MQ6A 3EQ0H 1YPJH 3SNDA 3EYDA 1EJMA 5JBAS 1FLEE 5DG6A 2G51A 3O8DA 3MNSA 1YBWA 1Z6EA 2FDAA 3H5CB 4MG3A 3T25A 3UFAA 3BEFB 2OC1A 3GCOA 1HAVB 1VZQH 1O5BB 4JK6A 3FZDA 3P6ZB 3V0XA 1TGBA 3F1SB 1UVUH 1CA0B 1QJ1B 1KLTA 3VB5A 2BX4A 4U30A 5E0HA 2AGIX 1FQ3A 1O2WA 5T6FA 1QQ4A 1EB2A 3GY6A 1AU8A 3BN9A 2VB0A 1O3AA 2BVXH 3ZZ9A 1LQDB 1P01A 1GGDB 1OPHB 1N1LA 3GCNA 5K7RA 1XUJA 1LVOA 1TALA 4NG9H 3MYWA 2QIQA 1RTLA 2GV6A 5EQRA 3S9CA 1OS8A 3RXCA 2WPLS 4YT7H 1O2VA 5DJ7A 2WYGA 5AFYH 2HNTC 1NY22 1C2LA 1PJPA 1SGIB 2KAIA 4NIXA 5EOKA 8GCHF 3Q00A 5A0BA 1QB6A 3UY9A 4I32A 1QJ7B 4X6PA 1S6HA 4XDEA 5GCHG 3M7QA 5L2ZH 1GJAB 1P2MA 3PMAB 2JETB 1XVOA 1LHEH 1UHBB 4K3JA 1EAUA 4O97A 1BHXB 1E36B 2YOLA 2ZA5A 1GBDA 2QXHA 1ESAA 1HCGA 5C5OA 5K0HA 4XE4A 1KTSB 1JRTA 3FZZA 4BTIB 2Y5GA 1SMFE 2ZDNA 2ZFSA 4NGAH 1WSSH 3HK3B 2O8MA 3ATWA 1O3KA 3Q3YA 3SNAA 1Y3VA 3QDZB 1VITG 3F68H 3OYPA 3VXEH 1O31A 1KLJH 3HATH 9ESTA 2OP9A 1O5CB 2HNTE 4CHAB 3MU5A 5J4SA 1BRBE 3RXOA 1SGEE 2CGAA 2ZQ2A 2ANMH 4UE7H 2UUKB 5FAHA 3PM3A 3PROA 4B2BA 2A7HA 4INLA 1BHXF 1C5TA 1DDJA 1C2EA 4ABFA 1OWKA 2ZGCA 1HXEH 2P3UB 4Q7YA 3DD2H 1P2JA 2V3HH 1VR1H 5GIBA 1QGFA 1TPAE 2QGRA 1Y5AT 5LH8A 1JOUB 2OTVA 2D8WA 1HFDA 4GLYA 1VGCC 3B9FH 3RXUA 2G4TA 3AW1A 2ODPA 2QXIA 1WCZA 1QQUA 4HTCH 1ZJKA 2H5DA 1K28D 1N6YA 1ELAA 1QNJA 2QN5T 1ABJH 3SJIA 1GDUA 1QFKH 3RXLA 1FMGA 3E8LA 5C3NA 3SHAH 3M3TA 2Y7ZA 3ZZ6A 3DUXH 3EA9A 1G36A 2PFEA 2EI8A 1A0HB 1V2JT 2AGEX 4FU7A 5G4BA 4YZUA 3SV7A 1AD8H 3CP7A 3RXRA 1XKBC 1FONA 1PPBH 4H42U 3H7OA 1FY8E 1NFXA 1Y3UA 2G55A 4NIYA 2BLVA 2ZU2A 4BAMB 3RXIA 2G00A 1TNGA 1O2YA 3AVZA 2BD5A 4LK4A 3DFLA 4NWKA 1C2KA 1P9SA 1GBTA 1TMTH 4Y0YE 1GI9B 3RXPA 3BG4C 3SV2H 1AGJA 1QL8A 2Z9JA 4CRGA 1W0ZU 1ZHMA 3QTVH 5AVDA 1O37A 1DSTA 3D62A 1GI1A 3MU1A 1JBUH 1QA7A 1NRQH 2GV7A 3CS0A 1JXPA 2OINA 4X1PU 1SGFA 2A4OA 1Z7KA 2OBQA 2Z9IA 1KXEA 4J2YB 3A83A 3RMLH 1AB9B 1A3BH 4UD9H 3S0NA 1OXGA 3ZYEA 5SGAE 3UOUA 1ZPCA 1RTKA 4DURA 3T28A 2NU3E 3KCGH 2Q6FA 5A8ZA 2BY5X 1GPZA 2XXLA 1Y59T 3PO1B 2ZFFH 3E6PH 2GKVE 4ZXXH 1K9OE 5LPRA 3UNRA 2FXRA 1NC6A 1TOCB 4MLFB 2HLCA 1AZZA 3UUZA 2SGPE 1UCYE 3ZZ8A 2P59A 5FX6A 1O3JA 1O3CA 1V2LT 2QF3A 2OXSA 3T2NA 4AG2A 8ESTE 1ZHPA 2GZ8A 2C90B 2Y7XA 4K1EA 1A1RA 3I29A 1C1MA 2YNAA 3NCLA 3TU7H 4BAHB 4HZHA 4MPUA 1DM4B 1EATA 4WMFA 3AASA 1EKBB 1CA0C 1C5PA 1V2RT 2A31A 3GCTG 3ZZ5A 3U1JB 1F0UA 4WF8A 1D6WA 3S69A 2OUAA 1ELEE 1BQYA 2QXJA 2ZCKP 1O2XA 5I25A 1GHXH 4YTAA 4ABGA 1HV7A 1GBEA 1ZPZA 2ZWLH 2G5VA 1D6RA 1GGDC 2PKAA 4YO9A 2W7UA 1YLCA 2BDIA 1TQ7B 1MU8B 2ZGJA 1FDPA 1C1UH 1YYY1 1W14U 3LH3A 4JCNA 4AB9A 3UQVA 3LJJA 3RXKA 4X8SH 3OTJE 4MDSA 3UPEA 1SQOA 4TWWA 1BT7A 2VWMA 3RXSA 1O2LA 3F9GA 1P2QA 3EGKH 3P92A 3PLKA 4DCDA 1IQIA 3E91A 2FTMA 1TLDA 2JETC 2WV4A 1ANBA 1AY6H 1GBMA 2QXGA 2OBOA 3PWCA 1VJAU 1AKSA 1O3DA 1EJNA 1PPEE 1K21H 1WU1A 2ODYB 1CBWB 2Y5HA 5JBCS 3BG8A 4UFDH 2ZZUH 5DP6A 3NKKA 4BTTB 3RXAA 5H4IB 3M5MA 4NCYA 1GI8B 1Z8IB 2BD8A 4MNXA 5BPEA 1MUEB 5ETXA 3T26A 4D9QA 1VCQA 1WBGB 5DKMA 4DOQA 4CHAC 1P06A 1SG8B 3MI4A 2CMYA 1TPSA 2Z6BD 3KGPA 1EOLA 1LHCH 2WUCA 1XVMA 1J14A 4X0WU 4AFQA 3E90B 3P8NA 1TONA 3FP6E 3GCHB 3KNXA 1DY9A 1LQEA 2FTLE 4Q7ZA 2GGVB 4UFFH 2BY8X 3RDZA 3QTOH 1W3CA 1XUGA 3UR9A 1PYTD 5B6OA 5GPIB 3EA8A 1DE7H 1KSNA 2TGTA 3ZVBA 1BBRE 1C1TA 1D3DB 4H4FA 1GI3A 4DVAU 2VWOA 1C5NH 2I6SA 2DE8A 1GMDF 1KXDA 2O8LA 4GCHG 1YLDA 1FV9A 5T6DA 1GJ9B 5DP7A 2R2WU 1EASA 1OP0A 1OWEA 2A45B 1W12U 5F03A 4I8LA 1HAHH 3M35A 1BB0B 2F3CE 5EXNA 6CHAB 3U9AH 1BTUA 3M61U 1DS2E 4IN1A 2NU0E 4FUHA 1PQAA 1DWDH 2STBE 1TNKA 1TA6A 3SV9A 1MZAA 2BLWA 1JIMA 1YCPK 2O9QA 1OKXA 2BOHB 3FAOA 1NTPA 4ZHAA 2AYWA 2FEQH 2FX4A 1HNEE 1GHBF 4I8JA 1S0QA 5JB9S 2XRCA 2RCEA 3HGNA 5I46H 1FNIA 2ANKH 2BXTH 1FY1A 1MTWA 3LJOA 1UVSH 4LZ1H 1ID5H 4B2CA 4BTUB 6LPRA 1O30A 3E16B 2R2MB 1C1OA 3ZZBA 1H8DH 1EUFA 4B73A 1PPZA 1ZSLA 4LOYH 2V6NA 1TFXA 1O2ZA 1HPGA 1HAYB 1GL0E 2BQ7B 4MNWA 1NRSH 3A89A 2HNTF 4FU9A 4GHQA 1AB9C 2BTCE 4BANB 4INKA 8LPRA 1O2GH 3C27B 2PUXB 1UK2A 1Q3XA 4GSOA 1HGTH 3QZQA 4IGDA 1K1PA 2FOHA 2DUCA 2CHAB 3M3VA 3PO1C 3S9BA 3RXDA 3VGCB 2QYIA 3RLWH 3ZVFA 4BAOB 2P3FH 4FXGH 3RU4T 1O2RA 1QL9A 3VEQB 1O36A 1DT2A 4NSVA 4Z6AH 5EPYA 2IN2A 1CA8B 4ISIH 3F9FA 4RSPA 4XOJA 1K1OA 3GISB 2D2DA 1BRUP 3LC5A 2XW9A 1B0FA 1TB6H 3QGNB 4WJG2 3BTKE 1O2SA 1EZQA 1TX7A 3JZ1B 2NU2E 1C4U2 3B23B 1W7GH 1SHYA 2RG3A 1TGNA 4CRFA 4K60A 1P2OA 4KTUA 4Y79A 1O5DH 1Z8RA 1THPB 1A0JA 2Y80A 3SOSA 4A7IB 4FUEA 2W5EA 4AB8A 1NRNH 1FIZA 1AFEH 3M36A 1LVBA 2FO9A 1SGFG 1SLXB 4NA7A 4KGAA 2CF9H 1GI7B 4X8VH 3SUEA 1PPFE 1AMHA 2ZDKA 1Z8JB 2J34A 3LGWA 1HDTH 1A3EH 2BDHA 3TPIZ 3ZV9A 3T5FH 2JH6D 4UONA 1Y8TA 1P05A 3U98H 4D9RA 1O0DH 4XBCA 2SGEE 1F0TA 3GY4A 2BDYA 1HAXB 2BDCA 1FZZA 1GCDA 1GMHG 2FZZA 1F0SA 2ZEBA 5CMXH 1ZRKA 1IQHA 3RMMH 3MO6A 1NM6A 3A80A 3ZVCA 1GMCF 1CBWC 1UVOA 1P2KA 1J17T 2PWXA 4WMEA 2W3IA 1NFWA 4IC6A 1TYNA 1ZTLA 1XMNB 4NSYA 2ZO3H 3TH4H 1HB0B 4ZKNU 3KQCA 2SGAA 3BF6H 4CH2B 2J2UA 2FOAA 3W94A 2WV5A 1GL1A 2Z94A 1CQQA 1G30B 1S81A 3A81A 3M3SA 1ELCA 3OY5U 3OU0A 1BMAA 3OY6U 1G32B 5EPNA 1DWEH 1P2NA 1S85A 2G8TA 2HPQH 3BTDE 1A5HA 1O3FA 1O5AB 3GCHC 1W10U 1AVWA 4K8YA 1B0EA 1BTPA 2FOFA 1BIOA 4PROA 4MTBA 2UUFB 3ODDA 5A8XA 1C1VH 1D3TB 1NZQH 1KXFA 1EZSC 3KN2A 4YT6H 2EI7A 1C5ZB 4ABJA 1O35A 2AERH 1BMNH 1GBAA 2GT8A 1ETTH 3K6YA 4CR9A 3KQBA 3TGKE 6ESTA 1QIXB 3BIVH 1IQLA 2ZDMA 1W11U 5JBBS 2VIQA 3BTHE 4X6NA 2DE9A 3EA7A 3PV4A 6CHAC 1DWBH 2B9LA 3VXFH 3O8CA 1P57B 2P95A 3L33A 3U1IB 4HFPB 4JZEH 1GHYH 1WTGH 3PTBA 3TK6A 1DVAH 3U8OH 1TGSZ 1LHFH 2J4IA 1ANDA 2O8TA 3ZZCA 1YPKH 2FMJA 1MTUA 1PFXC 2BXUH 1ELVA 1NFYA 3SNEA 2VIPA 1AQ7A 1CSOE 3I77A 1FN8A 1A5IA 3M37A 1KY9A 2C8XB 3HKIB 2HPPH 1LVYA 2ZF0H 3GOVB 3VB7A 1G3CA 1HLTH 1C1SA 1W8BH 3MNCA 1U6QA 1XX9A 1MTVA 3SU0A 1FI8A 1O3MA 2OQ5A 4KTCA 2QY0B 4A1TA 2ZGXH 1G3BA 4FVBA 2O8WA 1Y3XA 2BMGB 3VPKA 1IHTH 2ZDAH 4ZKRU 4Y8XA 2XBWA 1W0YH 4FUDA 1ZRBA 3P8GA 1GWAA 1O3IA 5C1YA 2Z7FE 1FPHH 2GMTB 2BD2A 2BD3A 1FIWA 1NT1A 4AN7A 1EZUC 4XFQA 3ZZ4A 1VJ9U 3ESTA 1XXDA 4WH8A 1C2IA 1A7SA 3UNSA 5IDKA 1CHOG 4JYTA 3SN8A 1GBIA 1GHAG 2FODA 2STAE 2UWPA 3ITIA 1L2EA 5A0AE 3A82A 3LONA 1P2IA 2CHAC 1BZXE 5TCAA 4NFFA 3VGCC 4ZXYH 2HGTH 1TGCA 5A09A 3FVFB 2VWLA 3FP7E 2ANWA 3PWBA 3DFJA 4AX9H 4CRAA 1OOKB 4MVNA 3RXQA 3M7TA 3SNCA 4ZHMU 2BB4A 1TBZH 3MTYA 2F9BH 3SZNA 4DG4A 5DO4H 2ZFTA 3U69H 3MNBA 1S82A 4FUBA 2F9VA 3TGIE 1K1MA 5GJ4B 1QL7A 4XSKU 4K2YA 4JMYA 5TJXA 1WQVH 1ESTA 2F9OA 3MH5A 1YCPH 2GP9B 5C1XA 1AWHB 2VH0A 1J9CH 3K9XB 3SV6A 1H9LB 1MH0A 1XKAC 2TPIZ 1L0ZA 4KP0A 2RDLA 3MH7A 1ABIH 8KME2 1AUJA 3OSYA 3SORA 2QV1A 1KDQB 1FY5A 3CS7A 1WQSA 2PSYA 4OS4A 2QF0A 2M5TA 3PTNA 1ZR0A 2VH6A 2PSXA 1Q31A 3P70B 3TLOA 2PTCE 3DHKH 2VIVA 4K8BA 4MPVA 4CBNA 1AE5A 4AGJA 3O8RA 3LDXH 1FN6A 1RIWB 1Y5BT 3E0NB 2EC9H 1SSXA 1GBCA 1ETSH 4FUGA 5AFZH 2OD3B 1JRSA 2ZTXA 4UDWH 5GCHF 1MTSA 2AFQB 1UVPA 2ALVA 2PTNA 1LO6A 2J94A 3LGYA 4Y10E 4GPGA 2Q6GA 1TNHA 4B76A 1O2KA 1V2KT 4R0IA 1ZOMA 3LOXA 4IS5A 1O3NA 1CHGA 5EXMA 1O34A 1GBFA 1SGQE 1AIXH 2AH4X 5CHAB 3Q77A 2Z9GA 3SUGA 1DXPA 1EPTB 2ZPSA 1VITF 1DLKB 1HJ9A 2SFAA 3T29A 3SBKA 2ZQ1A 3STJA 3UNQA 1O2NA 3SO3A 1K2I1 2W7SA 3BTGE 1TOMH 2F83A 2A32A 1NU7B 1THRH 1A61H 4OS5A 3SI4H 1INCA 1BJVA 2TRMA 2AEIH 1E38B 1SLVB 1SC8U 1LMWB 4H6TA 1HAVA 1M9UA 1F0RA 1ZSJA 4O9VA 1HJAB 5E8EH 3I78A 1G2MA 1LHDH 2H9EH 3RM0H 2WPKS 2FS8A 3MNXA 3QGJA 1UTNA 4U01A 1P03A 1RXPA 2UUJB 1DSUA 3MOCA 1TPOA 1AHTH 3BTQE 1C9PA 1RRKA 2SGDE 4AGKA 2A2QH 3IITA 3GY7A 1P8VC 2B5TB 1N8OB 2R3UA 1GJBB 3SJ8A 1ELDE 1IQGA 1UTLM 1G37A 1O5EH 5AHGH 1DITH 5C2ZA 1O39A 1UTOA 1E37B 1NPMA 4FUFA 1C1WH 4YOJA 5F8TA 2H9HA 2RA0A 2Y81A 2TBSA 1O3PB 1FAKH 3LGVA 4B1TA 5FX5A 3GDUA 3A8CA 4I8KA 3RXFA 4BXWA 1S83A 1ZLRA 1C4V2 1CGJE 4Q2KA 1UHBA 2XBYA 4A1VA 2OQUA 1BCUH 3LKWA 3UIRA 2ZHWH 4LZ4B 4YESB 1O38A 2H9TH 4D8NA 2ZI2H 2EA3A 2G52A 5FCRA 1GHVH 1TX8A 3W95A 3GY2A 1BMMH 4K5ZA 3UTUH 1DFPA 2WUBA 1SGTA 3A7ZA 1G3DA 2FOGA 2BY7X 1O32A 3TNTA 2Z9LA 3V12A 3LT3A 1SI5H 5EW2H 1KYNA 1O3LA 4ZKSU 3FP8E 1K1JA 1ZPBA 2GMTC 4RKOB 3SU4A 2IOTA 1QA0A 5F6MA 2VVVA 1KLIH 2P8OB 1UTJA 4B2AA 3A7WA 4UFEH 2ZCHP 2ZGBH 4KELA 1JMOH 1OWHA 3TNSA 1S5SA 1SB1H 4AG1A 5LPFA 2J9NA 1SGYE 1P12E 1TMUH 2ZTYA 1EJAA 2A1DB 4FUIA 1GI2A 1IQMA 5C5NA 1GVZA 1Z1JA 1H9HE 1O3OA 2QC2A 1E34B 2FI3E 4H6SB 4WY3A 1BTXA 3RP2A 1P02A 1AFQB 3F6UH 1BOQA 3MO9A 2H1UA 1FXYA 3C1KA 2ZHDA 2GDEH 2BQWB 3LC3A 5DP3A 1SLWB 1P11E 3H7TA 4BXSA 1HIAB 3KQEA 4ISLA 3U8TH 3KF2A 1QY6A 4K1TA 3F9HA 3SNBA 3ZV8A 3RUOA 3STIA 2ZHFH 4INHA 2ZP0H 3UOPA 2UWOA 1QBVH 1MZDA 5EGMA 6GCHG 1GJDB 5EXLA 1DICA 3GCTF 2Y6TA 1TE0A 4OS7A 3A8DA 2WPMS 3VFEA 1PYTC 2FPZA 1SPJA 5CE1A 3MH4A
chains in the Genus database with same CATH superfamily
4CBOA 3TITA 9LPRA 3PMJA 3A7YA 3MQKC 1CT4E 1HUTH 1EP5A 3RC4A 1CT0E 1SGRE 1V2UT 1S0RA 4DIIH 4ESTE 1V2NT 1BRCE 1Z8GA 1TMBH 2XNDD 1YLNA 1SBWA 2EQNA 3PRDA 2ZKSA 2F43B 1O2MA 1OP8A 1RIWC 4TWYA 1MQ5A 1GI0A 1MD7A 1UCYH 3PLBA 1NN6A 4F49A 2BD7A 2PHBA 1Z6JH 3RLYH 2PV9B 3P95A 1YCPM 4O03A 1QJ6B 1C5WB 2XBXA 1HJ8A 1XXFA 7ESTE 1WDIA 1F5KU 3Q3XA 4NIVA 1T8LA 2XNIA 2F9UA 2BVRH 1TPPA 1E1QD 5CHAC 3Q3KA 1MKXH 1EP6A 2FS9A 1EPTC 2KM0A 2AS9A 4JYUH 1OWIA 1DY8A 1IQNA 1HAPH 1P9UA 3A7TA 2D26C 1SFQB 2R0KA 1D4PB 1Y3YA 3JZ2B 2KAIB 4JZ1A 4ZAEA 2NU1E 2FWWA 3FOAA 5EQQA 2GZ7A 4Y7BA 1ZMJA 2C4FH 3UR6A 4ASHA 1DXWA 4X1RU 1C5OH 1MMJN 1QZ8A 5KECA 3P8FA 1GI6A 2GZ9A 1FUJA 2F9NA 1RS0A 1S84A 2BM2A 4J1YA 1PPCE 2P3TB 1BMLA 1GJCB 2ULLA 5L6NH 1SGCA 5TCCA 3NUMA 3ZZ3A 1QRWA 4FETA 3A84A 1T4UH 1C1RA 3RU4E 2ZNKH 2Z3DA 2R3YA 1HJAC 3BTEE 1QCPA 1QTFA 1AN1E 2ZFPH 3QWCH 1DLEA 2XCFA 3G01A 1GJ8B 4GCHF 4K1SA 1XUKA 2FLBH 4Q7XA 3L6PA 2SGFE 1PPHE 4NA9H 5JPMH 1DX5M 4NWLA 5PTPA 1C5UA 5FHTA 1N8OC 1Y5UT 2AIPA 2UWLA 3BTTE 5FXLA 4A6LA 3RXVA 5DK1A 2PGQB 2FOEA 3SGBE 1NU9A 4BAQB 4AFZA 2BZ6H 2AHME 1BTZA 3ELAH 4YLUA 3GDSA 2ZECA 1FJSA 3FKSD 4ABDA 4TSFD 5HXFA 1YF4A 2QAAA 4AORA 1LCYA 1OP2A 3K6ZA 4CREA 1O5GH 3RXEA 2GD4B 1CVWH 3VB4A 3TIUA 3D65E 1SQAA 2BY6X 3GDVA 2B8OH 1DUEA 1O5FH 5JBTA 2A7CA 2BHGA 3BIUH 2IJOB 3BTWE 4IMZA 1CGIE 5A2MH 3ODFA 3SW2B 1IQJA 4AOQA 1C1NA 3TJNA 3SU2A 1HAGE 4E7RG 1AO5A 4I33A 4MPXA 1BBRH 4NZLA 5ESTE 5HM2A 2RFKC 4X8TH 1HRTH 3SJKA 3BEIB 1H4WA 1TNJA 1KIGH 2ZU4A 2ZTZA 2ZPQA 2ZHEH 3VG8A 3U8RH 3OE7D 2LP6A 5E0GA 8GCHG 4FU8A 1GCTB 3LGIA 3UREA 2EEKA 3SU3A 4OS2A 2Z3CA 2AMPA 1FY3A 1TQ0B 1GBBA 1ELTA 2BYAX 2VGCB 2VIOA 1YPHC 2ALPA 1IQEA 4ZH8A 1O3GA 3V3MA 5EODA 2VU8E 1ZMNA 2VNTA 1HBTH 2FX6A 2P8OC 3ZZDA 1QB9A 4K69A 4AYYB 2KCYA 4NA8A 2F4LA 1O3EA 1V2OT 2FOCA 3K65B 2Y5FA 4ZROA 3KIDU 1VKYA 5HMAA 5EG4A 5EU8A 4DT4A 2A4QA 1DPOA 1QRZA 3PYHA 1ANEA 3HK6B 2PGBB 2AGGX 3ZZAA 3RXJA 1SGDE 4GHTA 1L1GA 1TA2A 2UUYA 1EZXC 1Y3WA 1P10A 1AWFH 3SHCH 1AFQC 3KQ5A 1DANH 7GCHG 2A2XH 4IW4E 1THSH 2KR7A 1EAXA 5C0UA 1ZMLA 4HGCA 1T8OA 3PLPA 5C20A 1SR5C 1ZTJA 1GBJA 1NBME 1O33A 5E0JA 3SGQE 1YPHE 1WUNH 1AI8H 3V7TA 3M7UA 1C5XB 4Z0KA 1ANCA 3LH1A 2P16A 4UEHH 1GVKB 3FO8D 1RTFB 1GDNA 3RXMA 4O3TA 1VITH 1Z71A 1A5GH 4OS6A 1YWUA 3NRLA 2ASUB 4VGCB 1K22H 3EAJA 1GJ6A 1V2MT 2G81E 5EJLA 1SVPA 5DP4A 2VINA 4IC5A 4KTSA 1HAIH 1CE5A 1O3BA 4Y8ZA 3SJOA 3TK5A 3LGUA 4DGJA 4Y7AA 3SJ9A 1RFNA 2C93B 3ATLA 3QK1A 2AMQA 4CRBA 1SGPE 2CN0H 1ZHRA 4YLQH 2QF5A 1UTPA 3MU4A 4U2WA 3TH3H 1LPGB 1NESE 2VVCA 4X8UH 1NFUA 2PKSB 2F91A 1GBLA 4JZFH 1UTMA 5HGGA 3ATIA 3KL6A 1L1NA 1T31A 4ABIA 4ABBA 4LXBH 4WXIA 2GCTB 2JKHA 1MCVA 3F9EA 4IMQA 1GMHF 1ARCA 1O2IA 3MWIU 1NS3A 2V35A 2ILNA 4OGXA 2VWNA 1PQ5A 4X6OA 1UCYK 2PKAB 1B5GH 1KXCA 1D3QB 1AZ8A 3M5OA 3OTPA 1TAWA 1YPMH 1SHHB 2A5KA 5DN6D 4CR5A 1O2PA 3SQEE 1JIRA 2ZGHA 3SU5A 2W26A 3URDA 4B71A 1V2WT 3LPRA 3ZVEA 1UK3A 3L3TA 1UO6A 4DW2U 1MU6B 1YM0A 1MKXK 4MNYA 1WAYB 1W7XH 5J4QA 3WWBA 4BNRA 1LPKB 4MNVA 2A7JA 2JJ2D 3UQOA 2G4UA 1QURH 3O8BA 3FANA 1AKSB 3GYMA 2A5IA 3LIWA 4Q4LA 1G3EA 1UVTH 1F5RA 3F2GA 7GCHF 1LHGH 1V2TT 2YMSB 1UK4A 3URCA 3RMNH 2JIZD 1KTTB 2ZHQH 2ODQA 2A0QB 2G5NA 3P8OA 5F8XA 4THNH 1BDAA 1LTOA 2R9PA 3TGJE 4F4OC 4A5TS 4X6MA 3ZVAA 3DSPA 1C5LH 1MCTA 2PW8H 3PB1E 4SGBE 1UTQA 1OWDA 1C2DA 3PMHB 1UJ1A 3GICB 5DPAA 2RA3A 1K1LA 4WXVA 1ELGA 4FVDA 2ZCLP 1ORFA 4AFSA 1QB1A 2J5UA 2K1QA 5JB8S 4WH6A 2OC8A 3KYGA 4OS1A 2ZFRH 3HGPA 2A5AA 1J16A 4TPIZ 2SGQE 3BSQA 5IYTA 1MBQA 1V2ST 2HLDD 3MO3A 2HOBA 1KXAA 2BLQA 5JDUB 1MTNB 1KXBA 4B75A 2CJIA 1F92A 2HVXA 3Q76A 3A8AA 2FESH 5HYOA 1O2OA 4TY6A 1PQ8A 4KKDA 3GS9A 3DSOA 1ZGVA 2XCNA 3SUDA 3S7KB 1T8NA 3NK8A 5FPYA 1GDQA 1JWTA 4F55A 4X2YA 2Z3EA 1AUTC 3BTME 4ABHA 1OWJA 5FPTA 1GCTC 1C4Y2 1ACBE 1BBRK 3WY8A 4TY7A 2Y82A 1UTKA 2BDBA 3ATMA 4ISHH 2PLXA 5LPEA 1T4VH 1GI5A 1W2KH 2VGCC 7LPRA 1TX6A 3RMOH 1WOFA 3M5NA 1GJ5H 3NPSA 1CHOF 2Q1JA 1MD8A 1GHAF 3TVJB 1SFIA 2OLGA 3RXHA 3KHVA 5JYIA 4Y8YA 2AMDA 1YPGH 2AIQA 2H6MA 4ZKOU 5FBIA 2QF4A 1QBOA 2SNWA 4I8HA 2C8WB 2GCHG 3A87A 1ZTKA 3GY3A 5C1UA 3ATKA 4GUXA 3ZVGA 3E0PB 3QZRA 1V2QT 2BDAA 4X2WA 1TRNA 2V3MA 1NRPH 2BDGA 1EQ9A 1YC0A 4E05H 3IG6B 1GG6B 5AF9H 5T3HA 2Q6DA 2TGDA 1P09A 3TJUA 4DY7B 2XOKD 2VBCA 1BA8B 2EI6A 1AE8H 1RGQA 4D7FA 3SI3H 1J8AA 3SUFA 2CXVA 1GJ7B 2FYQA 2W3KA 2HRVA 3LU9B 1MBMA 3WW7A 4SGAE 3KEEA 2ZIQH 2FLRH 1L1JA 1MABB 1XUFA 1V2VT 2FYRA 2P93A 4CRCA 4D76A 1GMDG 3E3TA 1ELFA 2I6QA 4VGCC 1YY3A 1EAWA 3ZVDA 1EXFA 3RC6A 5C67A 1MKWH 2A4RA 3R3GB 4ACBA 1L4ZA 1XM1A 1C5QA 5F8ZA 3RXTA 4IBLH 2FM2A 2BY9X 3D49H 2PKSC 3AAUA 2FI5E 3A8BA 2QE7D 1ZZZA 2FIRH 3EE0B 4WWYA 2GCTC 3GY5A 2TGAA 4AFUA 1W13U 3TJVA 1GHBG 4NZQA 1DWCH 1O2QA 2R0LA 4I31A 4NFEA 1C1PA 4JK5A 1BRAA 1TIOA 4YOIA 4XBDA 1TABE 2ESTE 1ZJDA 1EB1H 4FUJA 1RJXB 2WSSD 4AYVB 1Z1IA 3ZYDA 5A0CA 3CENA 3R0FA 1E1RD 1C2FA 1WTHD 2OCVB 2TIOA 2XWAA 1GBHA 1OSSA 4TYDA 2BD9A 2V0BA 1XUIA 2GCHF 2ZG0H 1C2MA 5FBEA 1QBNA 4TPYA 4B74A 3QO6A 5BRRE 1C2GA 1OYTH 2V3OH 1CGHA 5E2OA 3MH6A 5DP8A 1ZYOA 3DA9B 1C5MD 1TBQH 3TJOA 3P17H 3PRBA 4I8GA 3K2UA 3T62A 3SU6A 2F9PA 1LKBA 1EX3A 1YGCH 5EQSA 1V6DA 2B0FA 5HM9A 3QX5H 2ZU5A 1C5VA 1NO9H 2YMSC 2JH0D 2QA9E 5EW1H 3GYLB 1C2HA 1LKAA 1B7XB 3NZIA 5GDSH 3MFJA 3UWJH 1HYLA 1IQKA 1BTYA 1KDQA 2PP6A 3RM2H 3S7HB 3PMBB 2FP7B 2WPHS 5L30H 1TRYA 1F7ZA 4F48B 3A7VA 1IQFA 3ENSB 4WMDA 3MU0A 4X2VA 1YPEH 4WVPE 1DUAA 1A0LA 4FOUC 1O3HA 1WV7H 1A2CH 2GVFA 2BOKA 2Z9KA 4ZHLU 3N7OA 5ABWA 2FOMB 4FUCA 1C9TA 3RU4D 3SQHE 1DOJA 4E06H 1TRMA 3GY8A 3IWMA 2BX3A 3KQDA 1K1IA 1CU1A 3S9AA 3MHWU 4HI3A 1C1QA 5T6GA 1O2TA 1C5SA 1PPGE 3SU1A 3V13A 2CV3A 4JYVH 1GVLA 1E0FD 2NU4E 1EPTA 4X1SU 1QRXA 4AZ2B 1MTNC 1LPZB 1J15A 4YM9A 3BEUA 1XUHA 4RT1A 1SGNE 3T27A 4X2XA 4Y0ZE 2THFB 1TGTA 4DJZB 3RXGA 3W1EA 4Y71A 3NXPA 1SLUB 1EAIA 1C5YB 1AVGH 4Q80A 4ZUHA 3B8JA 4JZDH 1FPCH 4M7GA 4D7GA 2PR3A 2ZU1A 4QT8C 1QHRB 3FFGA 5F53A 4ABAA 3QLPH 1HAOH 1NRRH 2BZAA 2LNCA 1GJ4H 1LVMA 1SQTA 3EDXB 2GTBA 2XC0A 2XYAA 2GJGA 1BUIA 1GMCG 1D3PB 2D1JA 4GVUA 2HALA 1CO7E 5LGOA 1D9IA 1Q2WA 1YKTA 4X1QU 5DP5A 2PUQH 2C8YB 4RN6A 1K0HA 1RD3B 2WZQA 3A85A 1E35B 1V2PT 2FOBA 3SGAE 1P3CA 3A7XA 5FCKA 3VB6A 2GT7A 3LGTA 1QR3E 3VB3A 1A4WH 2W6ID 4CRDA 1A46H 1MAYA 2VJ1A 1ELBA 1K1NA 2ANYA 3ZZ7A 1GG6C 5DGJA 1OX1A 2O8UA 4MQAA 2C3SA 1H1BA 2H2ZA 1S6FA 1YP9A 3BV9B 4U32A 4CH8B 2WYJA 2GX4A 4R8TB 4UFGH 1X7AC 3M5LA 2HWLB 6GCHF 1WYKA 1TNLA 1SOTA 3RXBA 1UMAH 2IPHA 2VIWA 5E2PA 5GXPA 1ESBA 4DIHH 2ZPRA 1VGCB 2J38A 1GBKA 4RKJB 4X1NU 4XBBA 1C5RA 1H8IH 1MAXA 4Y6DA 1ZSKA 4DT7B 2BQ6B 3A88A 3SV8A 4OGYA 3TH2H 1T7CA 1GI4A 1BTHH 2ZU3A 3UWIA 1HXFH 1EOJA 4BOHA 2NWNA 4Y11E 1IHSH 2ZC9H 1P04A 2B7DH 1LDTT 2XC5A 3DT0H 2GDDA 2WINI 2VVUA 1NROH 1NBMD 2XTTB 2A4GA 4RI0A 1O2HA 2EY4C 2J95A 1G2LA 1L4DA 1H9IE 3SYJA 1MKWK 1OYQA 1IOEA 2LPRA 4JZIA 1T8MA 1VCWA 1BJUA 3AAVA 2ZDLA 4YOGA 2KFWA 1G9IE 3HKJB 3MMGA 4E7NA 3TK9A 3AW0A 1O2JA 1SL3A 4Q63A 2P94A 2JH5D 4GAWA 5L2YH 5GWZA 1C2JA 1PQ7A 2H5CA 4ISOA 4NIWA 1N6XA 1P0SH 1GHZA 2J92A 3BG4B 2C8ZB 2XC4A 4IN2A 5EJZA 1YPLH 1P3EA 4Y76A 5ESBA 5DP9A 3A86A 2WPIS 1TNIA 1FY4A 4P00A 5FPSA 1SOZA 5A8YA 2WPJS 4ABEA 2KZ4A 1V3XA 3NWUA 2OC7A 2OC0A 4ISNA 3QUMP 1HAZB 2VIDA 2BVSH 1KMHB 1F5LA 1ETRH 3D23A 2CK3D 2ZDVH 5C0TA 2TGPZ 1CT2E 2BLOA 4MPWA 3OX7U 1HIAA 1BTWA 1VCPA 2XBVA 4A1XA 1ARBA 1AVXA 1O2UA 4I7YH 1TBRH 2BD4A 2CF8H 3MU8A 2FI4E 3BTFE 2SNVA 2QCYA 3WWFA 4A92A 3HPTB 1ZGIA 1F2SE 4ZMAH 3QN7A 2ZFQH 2YNBA 1BITA 3RC5A 7KMEH 1FAXA 1H8ED 1T32A 3E1XB 4O3UA 1IAUA 4BAKB 1TWXB 1GHWH 2J98A 1MQ6A 2XWBI 3EQ0H 1YPJH 3SNDA 5HKKD 3EYDA 1EJMA 5JBAS 1FLEE 5DG6A 2G51A 3O8DA 3MNSA 1YBWA 1Z6EA 2FDAA 3H5CB 4MG3A 3T25A 3UFAA 3BEFB 2OC1A 3GCOA 1HAVB 1VZQH 1O5BB 4JK6A 3FZDA 3P6ZB 3V0XA 2K8IA 4XRNA 1TGBA 3F1SB 4B6EA 1UVUH 1CA0B 1QJ1B 1KLTA 5CHBA 3VB5A 2BX4A 4U30A 5E0HA 2AGIX 1FQ3A 1O2WA 5T6FA 1QQ4A 1EB2A 3GY6A 1AU8A 3BN9A 2VB0A 1O3AA 2BVXH 3ZZ9A 1LQDB 1P01A 2RDEA 1GGDB 1OPHB 1N1LA 3GCNA 5K7RA 1XUJA 1LVOA 1TALA 4NG9H 3MYWA 2QIQA 1RTLA 2GV6A 5EQRA 3S9CA 1OS8A 4ACAA 3RXCA 2WPLS 4YT7H 1O2VA 5DJ7A 2WYGA 5AFYH 2HNTC 1NY22 1C2LA 1PJPA 1SGIB 2KAIA 4NIXA 5EOKA 8GCHF 3Q00A 5A0BA 1QB6A 3UY9A 4I32A 1QJ7B 4X6PA 1S6HA 3F0PA 4XDEA 5GCHG 3M7QA 5C17A 5L2ZH 1GJAB 1P2MA 3PMAB 2JETB 1XVOA 1LHEH 1UHBB 4K3JA 1EAUA 4O97A 1BHXB 1E36B 2YOLA 2ZA5A 1GBDA 2QXHA 1ESAA 1HCGA 5C5OA 5K0HA 4XE4A 1KTSB 1JRTA 3FZZA 4BTIB 2Y5GA 1SMFE 2ZDNA 2ZFSA 4NGAH 1WSSH 3HK3B 2O8MA 3ATWA 1O3KA 3Q3YA 3SNAA 1Y3VA 3QDZB 1VITG 1FX0B 3F68H 3OYPA 3VXEH 1O31A 1KLJH 3HATH 9ESTA 5KEDA 2OP9A 5GNDA 1O5CB 2HNTE 4CHAB 3F3BA 3MU5A 5J4SA 1BRBE 3RXOA 1SGEE 2CGAA 2ZQ2A 2ANMH 4UE7H 2UUKB 5FAHA 3PM3A 3PROA 4B2BA 2A7HA 4INLA 1BHXF 1C5TA 1DDJA 1C2EA 4ABFA 1OWKA 2ZGCA 1HXEH 2P3UB 4Q7YA 3DD2H 5C94A 1P2JA 2V3HH 1VR1H 5GIBA 2K0QA 1QGFA 1TPAE 2QGRA 1Y5AT 5LH8A 1JOUB 2OTVA 2D8WA 1HFDA 4GLYA 1VGCC 3B9FH 3RXUA 2G4TA 3AW1A 2ODPA 2QXIA 1WCZA 1QQUA 5CDFE 4HTCH 1ZJKA 2H5DA 1K28D 1N6YA 1ELAA 1QNJA 2QN5T 1ABJH 3SJIA 1GDUA 1QFKH 3RXLA 1FMGA 3E8LA 5C3NA 3SHAH 5EJ1A 3M3TA 2Y7ZA 3ZZ6A 3DUXH 3EA9A 1G36A 2EI8A 2PFEA 1A0HB 1V2JT 2AGEX 4FU7A 5G4BA 4YZUA 3SV7A 1AD8H 3CP7A 3RXRA 1XKBC 1FONA 1PPBH 4H42U 3H7OA 1FY8E 1NFXA 1Y3UA 2G55A 4NIYA 2BLVA 2ZU2A 4BAMB 3RXIA 2G00A 1TNGA 1O2YA 3AVZA 2BD5A 4LK4A 3DFLA 3PV2A 4NWKA 1C2KA 1P9SA 1GBTA 1TMTH 4Y0YE 1GI9B 3RXPA 3BG4C 3SV2H 1AGJA 1QL8A 2Z9JA 4CRGA 1W0ZU 2WV9A 5HIYA 1ZHMA 3QTVH 3N7DA 5AVDA 1O37A 1DSTA 3D62A 1GI1A 3MU1A 1JBUH 1QA7A 1NRQH 2GV7A 3CS0A 1JXPA 2OINA 4X1PU 1SGFA 2A4OA 1Z7KA 2OBQA 2Z9IA 1KXEA 4J2YB 3A83A 3RMLH 1AB9B 1A3BH 4UD9H 3S0NA 1OXGA 3ZYEA 5SGAE 3UOUA 1ZPCA 1RTKA 4DURA 3T28A 2NU3E 3KCGH 3EE7A 2Q6FA 5A8ZA 2BY5X 1GPZA 2XXLA 1Y59T 3PO1B 2ZFFH 3E6PH 2GKVE 4ZXXH 1K9OE 5LPRA 3UNRA 2FXRA 1NC6A 1TOCB 4MLFB 2HLCA 1AZZA 3UUZA 2SGPE 1UCYE 3ZZ8A 2P59A 5FX6A 1O3JA 1O3CA 1V2LT 2QF3A 2OXSA 3T2NA 4AG2A 8ESTE 1ZHPA 2GZ8A 2C90B 1SKYE 2Y7XA 4K1EA 1A1RA 3I29A 1C1MA 2YNAA 3NCLA 3TU7H 4BAHB 4HZHA 4MPUA 1DM4B 1EATA 4WMFA 3AASA 1EKBB 1CA0C 1UW7A 1C5PA 1V2RT 2A31A 3GCTG 3ZZ5A 3U1JB 1F0UA 4WF8A 1D6WA 2IPQX 3S69A 2OUAA 1ELEE 1BQYA 2QXJA 2ZCKP 1O2XA 5I25A 1GHXH 4YTAA 4ABGA 1HV7A 1GBEA 1ZPZA 2ZWLH 2G5VA 5EIYA 1D6RA 1GGDC 2PKAA 3F2FA 4YO9A 2W7UA 1YLCA 2BDIA 1TQ7B 1MU8B 3OAAD 2ZGJA 1FDPA 1C1UH 4P02A 1YYY1 1W14U 3LH3A 4JCNA 4AB9A 3UQVA 3LJJA 3RXKA 4X8SH 3OTJE 4MDSA 3UPEA 1SQOA 4TWWA 1BT7A 2VWMA 3RXSA 1O2LA 3F9GA 1P2QA 3EGKH 3P92A 3PLKA 4DCDA 1IQIA 3E91A 2FTMA 1TLDA 2JETC 2WV4A 1ANBA 1AY6H 1W0JD 1GBMA 2QXGA 2OBOA 3PWCA 1VJAU 1AKSA 3N7EA 1O3DA 1EJNA 1PPEE 1K21H 1WU1A 2ODYB 1CBWB 2Y5HA 5JBCS 3BG8A 4UFDH 2ZZUH 5DP6A 3NKKA 1SQRA 4BTTB 3RXAA 5H4IB 3M5MA 4NCYA 1GI8B 1Z8IB 2BD8A 4MNXA 5BPEA 1MUEB 5ETXA 3T26A 4D9QA 1VCQA 1WBGB 5DKMA 4DOQA 4CHAC 1P06A 1SG8B 3MI4A 2CMYA 1TPSA 2Z6BD 5KGOA 3KGPA 4YXWD 1EOLA 1LHCH 2WUCA 1XVMA 1J14A 4X0WU 4AFQA 3E90B 3P8NA 1TONA 3FP6E 3GCHB 3KNXA 1DY9A 1LQEA 2FTLE 4Q7ZA 2GGVB 4UFFH 2BY8X 3RDZA 3QTOH 1W3CA 1XUGA 3UR9A 1PYTD 5B6OA 5GPIB 3EA8A 1DE7H 1KSNA 2TGTA 4OM9A 3ZVBA 1BBRE 1C1TA 1D3DB 4H4FA 1GI3A 4DVAU 2VWOA 1C5NH 2I6SA 2DE8A 4Z1MD 1GMDF 1KXDA 2O8LA 4GCHG 1YLDA 1FV9A 5T6DA 1GJ9B 5DP7A 2R2WU 1EASA 1OP0A 1OWEA 2A45B 1OHHD 1W12U 5F03A 4I8LA 1HAHH 3M35A 1BB0B 2F3CE 5EXNA 6CHAB 3U9AH 1E79D 2JJ1D 1BTUA 3M61U 1DS2E 4IN1A 2NU0E 4FUHA 1PQAA 1DWDH 3OEED 2STBE 1TNKA 1TA6A 3SV9A 1MZAA 3F0OA 2BLWA 1JIMA 1YCPK 2O9QA 1OKXA 2BOHB 3FAOA 1NTPA 4ZHAA 2AYWA 2FEQH 2FX4A 1HNEE 1GHBF 4I8JA 1S0QA 5JB9S 2XRCA 2M2AA 2RCEA 3HGNA 5I46H 1FNIA 2ANKH 2BXTH 1FY1A 1MTWA 5DSFA 3LJOA 1UVSH 4LZ1H 1ID5H 4B2CA 4BTUB 6LPRA 1O30A 3E16B 2R2MB 1C1OA 3ZZBA 1H8DH 1EUFA 4B73A 1PPZA 1ZSLA 4LOYH 2V6NA 1TFXA 1O2ZA 1HPGA 1HAYB 1GL0E 2BQ7B 4MNWA 1NRSH 3A89A 2HNTF 4FU9A 4GHQA 1AB9C 2BTCE 4BANB 4INKA 8LPRA 1O2GH 2KCAA 3C27B 2PUXB 1UK2A 1Q3XA 4GSOA 1HGTH 3QZQA 4IGDA 1K1PA 2J97A 2FOHA 2DUCA 2CHAB 3M3VA 3PO1C 3S9BA 3RXDA 3VGCB 2QYIA 3RLWH 3ZVFA 4BAOB 2P3FH 4FXGH 3RU4T 1O2RA 1QL9A 3VEQB 1O36A 1DT2A 4NSVA 4Z6AH 5EPYA 2IN2A 1CA8B 4ISIH 3F9FA 1EFRD 4RSPA 4XOJA 1K1OA 3GISB 2D2DA 2W6JD 1BRUP 3LC5A 2XW9A 1B0FA 1TB6H 3QGNB 4WJG2 3BTKE 1O2SA 1EZQA 1TX7A 3JZ1B 2NU2E 1C4U2 3B23B 1W7GH 1SHYA 2RG3A 1TGNA 4CRFA 4K60A 1P2OA 4B6FA 4KTUA 2JDID 3PV5A 4Y79A 1O5DH 1H8HD 1Z8RA 5T1VA 1THPB 1A0JA 2Y80A 3SOSA 4A7IB 4FUEA 2W5EA 4AB8A 1NRNH 1FIZA 1AFEH 3M36A 1LVBA 4I86A 2FO9A 1SGFG 1SLXB 4NA7A 4KGAA 2CF9H 1GI7B 3FN8A 4X8VH 3SUEA 1PPFE 1AMHA 2ZDKA 1Z8JB 2J34A 3LGWA 1HDTH 1A3EH 2BDHA 3TPIZ 3ZV9A 3T5FH 2JH6D 4UONA 1Y8TA 1P05A 3U98H 4D9RA 1O0DH 4XBCA 2SGEE 1F0TA 3GY4A 3CNRA 2BDYA 1HAXB 2BDCA 1FZZA 1GCDA 1GMHG 2FZZA 1F0SA 2ZEBA 5CMXH 1ZRKA 1IQHA 3RMMH 3MO6A 1NM6A 3A80A 3ZVCA 1GMCF 1CBWC 1UVOA 1P2KA 1J17T 2PWXA 4WMEA 2W3IA 1NFWA 4IC6A 1TYNA 1ZTLA 1XMNB 4NSYA 2ZO3H 3TH4H 1HB0B 4ZKNU 3KQCA 2SGAA 3BF6H 4CH2B 2J2UA 2FOAA 3W94A 2WV5A 1GL1A 2Z94A 1CQQA 1G30B 1S81A 3A81A 3M3SA 1ELCA 3OY5U 3OU0A 1BMAA 2LELA 1G32B 3OY6U 5EPNA 1DWEH 1P2NA 1S85A 2G8TA 2HPQH 3BTDE 1A5HA 1O3FA 1O5AB 3GCHC 1W10U 1AVWA 4K8YA 1B0EA 1BTPA 2FOFA 1BIOA 4PROA 4MTBA 2UUFB 3ODDA 5A8XA 1C1VH 1D3TB 1NZQH 1KXFA 1EZSC 3KN2A 4YT6H 2EI7A 1C5ZB 4ABJA 1O35A 2AERH 1BMNH 1GBAA 2GT8A 1ETTH 3K6YA 4CR9A 3KQBA 3TGKE 6ESTA 1QIXB 3BIVH 1IQLA 2ZDMA 4TT3D 1W11U 5JBBS 1W0KD 2VIQA 3BTHE 4X6NA 2DE9A 3EA7A 3PV4A 6CHAC 1DWBH 2B9LA 3VXFH 3O8CA 1P57B 2P95A 3L33A 3U1IB 4HFPB 4JZEH 3OEHD 1GHYH 3F2HA 1WTGH 3PTBA 3TK6A 3SZEA 1DVAH 3U8OH 1TGSZ 1LHFH 2J4IA 1ANDA 2OK5A 2O8TA 3ZZCA 1YPKH 2FMJA 1MTUA 1PFXC 2BXUH 1ELVA 1NFYA 3SNEA 2VIPA 1AQ7A 1CSOE 3I77A 1FN8A 1A5IA 3M37A 1KY9A 2C8XB 3HKIB 2HPPH 1LVYA 2ZF0H 3GOVB 3VB7A 1G3CA 1HLTH 1C1SA 1W8BH 3MNCA 1U6QA 1XX9A 1MTVA 3SU0A 1FI8A 1O3MA 2OQ5A 4KTCA 2QY0B 4A1TA 4XD7D 2KX4A 2ZGXH 1G3BA 4FVBA 2O8WA 1Y3XA 2BMGB 3VPKA 1IHTH 2ZDAH 4ZKRU 1COWD 2XBWA 4Y8XA 1W0YH 4FUDA 1ZRBA 3P8GA 1GWAA 1O3IA 3N99A 5C1YA 2Z7FE 1FPHH 2GMTB 2BD2A 2BD3A 1FIWA 1NT1A 4AN7A 1EZUC 4XFQA 3ZZ4A 1VJ9U 3ESTA 1XXDA 4WH8A 1C2IA 1A7SA 3UNSA 5IDKA 1CHOG 4JYTA 3SN8A 1GBIA 1GHAG 2FODA 2STAE 2V7QD 2UWPA 3ITIA 1L2EA 5A0AE 3A82A 3LONA 1P2IA 2CHAC 1BZXE 5TCAA 4NFFA 3VGCC 4ZXYH 2HGTH 1TGCA 3DSGA 5A09A 2KCPA 3FVFB 2VWLA 4HG6A 3FP7E 2ANWA 3PWBA 2WHXA 3DFJA 4AX9H 2WPDD 4CRAA 1OOKB 4MVNA 3RXQA 3M7TA 3SNCA 4ZHMU 2BB4A 1TBZH 3UB0A 3MTYA 2F9BH 3SZNA 4DG4A 5DO4H 2ZFTA 3U69H 3MNBA 1S82A 4FUBA 2F9VA 3TGIE 1K1MA 5GJ4B 1QL7A 4XSKU 4K2YA 4JMYA 5TJXA 1WQVH 1ESTA 2F9OA 3MH5A 1YCPH 2GP9B 5C1XA 1AWHB 3ZIAD 2VH0A 1J9CH 3K9XB 3SV6A 1H9LB 1MH0A 1XKAC 2TPIZ 1L0ZA 4KP0A 2RDLA 3MH7A 1ABIH 8KME2 1AUJA 3OSYA 3SORA 2QV1A 1KDQB 1FY5A 3CS7A 1WQSA 2PSYA 4OS4A 2QF0A 2M5TA 3PTNA 1ZR0A 2VH6A 3DCLA 2PSXA 1Q31A 3P70B 3TLOA 2PTCE 3UAIC 3DHKH 1WXRA 2VIVA 4K8BA 4MPVA 4CBNA 1AE5A 4AGJA 3O8RA 3LDXH 1FN6A 1RIWB 1Y5BT 3E0NB 2EC9H 1SSXA 4AC9A 1GBCA 1ETSH 4FUGA 5AFZH 2OD3B 1JRSA 2ZTXA 4UDWH 5GCHF 1MTSA 2AFQB 1UVPA 2ALVA 2PTNA 1LO6A 2J94A 3LGYA 4Y10E 4GPGA 2Q6GA 1TNHA 4B76A 1O2KA 1V2KT 4R0IA 1ZOMA 3LOXA 4IS5A 1O3NA 1CHGA 5EXMA 1O34A 1GBFA 1SGQE 3H09A 1S6LA 1AIXH 2AH4X 5CHAB 3Q77A 2Z9GA 3SUGA 1DXPA 1EPTB 2ZPSA 1VITF 1DLKB 1HJ9A 2SFAA 3T29A 3SBKA 2ZQ1A 3STJA 3UNQA 1O2NA 3SO3A 1K2I1 2W7SA 3BTGE 3OFND 1TOMH 2F83A 2A32A 1NU7B 1THRH 1A61H 4OS5A 3SI4H 4ASUD 1INCA 1BJVA 2TRMA 2AEIH 1E38B 1SLVB 1SC8U 1LMWB 4H6TA 1HAVA 1M9UA 1F0RA 1ZSJA 2HVYB 3AK5A 4O9VA 1HJAB 5E8EH 3I78A 1G2MA 1LHDH 2H9EH 3RM0H 2WPKS 2FS8A 3MNXA 3QGJA 1UTNA 4U01A 5B6LA 1P03A 1RXPA 2UUJB 1DSUA 3MOCA 1TPOA 4M9FA 1AHTH 3BTQE 1C9PA 1RRKA 2SGDE 4AGKA 2A2QH 3IITA 3GY7A 1P8VC 2B5TB 1N8OB 2R3UA 1GJBB 2L74A 3SJ8A 1ELDE 1IQGA 1UTLM 1G37A 1O5EH 5AHGH 1DITH 5C2ZA 1O39A 1UTOA 1E37B 1NPMA 4FUFA 1C1WH 4YOJA 5F8TA 2H9HA 2RA0A 2Y81A 2TBSA 1O3PB 1FAKH 3LGVA 4B1TA 5FX5A 2IJD1 3GDUA 3A8CA 4I8KA 3RXFA 4BXWA 1S83A 1ZLRA 1C4V2 1CGJE 4Q2KA 1UHBA 2XBYA 4A1VA 2OQUA 1BCUH 3LKWA 3UIRA 2ZHWH 4LZ4B 4YESB 1O38A 4ZCNA 2H9TH 4D8NA 2ZI2H 2EA3A 2G52A 5FCRA 1GHVH 1TX8A 3W95A 3GY2A 1BMMH 4K5ZA 3UTUH 1DFPA 2WUBA 1SGTA 3A7ZA 1G3DA 2FOGA 2BY7X 1O32A 3TNTA 5IK2D 2Z9LA 1BMFD 3V12A 3LT3A 1SI5H 5EW2H 1KYNA 3KYFA 1O3LA 4ZKSU 3FP8E 1K1JA 1ZPBA 2GMTC 4RKOB 3SU4A 2IOTA 1QA0A 5F6MA 2YMSD 2VVVA 2L6OA 1KLIH 2P8OB 1UTJA 4B2AA 3A7WA 4UFEH 2ZCHP 5HIZA 2ZGBH 4KELA 1JMOH 1OWHA 3TNSA 1S5SA 1SB1H 4AG1A 5LPFA 2J9NA 4RT0A 1SGYE 1P12E 1TMUH 2ZTYA 1EJAA 2A1DB 4FUIA 1GI2A 1IQMA 5C5NA 1GVZA 1Z1JA 1H9HE 1O3OA 2QC2A 1E34B 2FI3E 4H6SB 2KCOA 4WY3A 1BTXA 3RP2A 1P02A 1AFQB 3F6UH 1BOQA 3MO9A 2H1UA 1FXYA 3C1KA 2ZHDA 2GDEH 2BQWB 3LC3A 3U28C 5DP3A 1SLWB 1P11E 3H7TA 4BXSA 1HIAB 3KQEA 4ISLA 3U8TH 3KF2A 1QY6A 5FL7D 4K1TA 3F9HA 3SNBA 3ZV8A 3RUOA 3STIA 2ZHFH 4INHA 2ZP0H 3UOPA 2UWOA 1QBVH 1MZDA 5EGMA 6GCHG 1GJDB 5EXLA 1DICA 3GCTF 2Y6TA 1TE0A 4OS7A 3A8DA 2WPMS 2J98B 3VFEA 1PYTC 2FPZA 1SPJA 5CE1A 3MH4A
chains in the Genus database with same CATH topology
4CBOA 3TITA 9LPRA 3PMJA 3A7YA 1CT4E 1HUTH 1EP5A 3RC4A 1CT0E 1SGRE 1V2UT 1S0RA 4DIIH 4ESTE 1V2NT 1BRCE 1Z8GA 1TMBH 1SBWA 2ZKSA 1O2MA 1OP8A 1RIWC 4TWYA 1MQ5A 1GI0A 1MD7A 1UCYH 3PLBA 1NN6A 4F49A 2BD7A 2PHBA 1Z6JH 3RLYH 2PV9B 3P95A 1YCPM 4O03A 1QJ6B 1C5WB 2XBXA 1HJ8A 1XXFA 7ESTE 1F5KU 3Q3XA 4NIVA 1T8LA 2XNIA 2F9UA 2BVRH 1TPPA 5CHAC 3Q3KA 1MKXH 1EP6A 2FS9A 1EPTC 2AS9A 4JYUH 1OWIA 1DY8A 1IQNA 1HAPH 1P9UA 3A7TA 2D26C 1SFQB 2R0KA 1D4PB 1Y3YA 3JZ2B 2KAIB 4JZ1A 4ZAEA 2NU1E 2FWWA 5EQQA 2GZ7A 4Y7BA 1ZMJA 2C4FH 3UR6A 4ASHA 1DXWA 4X1RU 1C5OH 1MMJN 3P8FA 1GI6A 2GZ9A 1FUJA 2F9NA 1RS0A 1S84A 2BM2A 4J1YA 1PPCE 2P3TB 1BMLA 1GJCB 2ULLA 5L6NH 1SGCA 5TCCA 3NUMA 3ZZ3A 1QRWA 3A84A 1T4UH 1C1RA 3RU4E 2ZNKH 2Z3DA 2R3YA 1HJAC 3BTEE 1QCPA 1QTFA 1AN1E 2ZFPH 3QWCH 1DLEA 2XCFA 3G01A 1GJ8B 4GCHF 4K1SA 1XUKA 2FLBH 4Q7XA 3L6PA 2SGFE 1PPHE 4NA9H 5JPMH 1DX5M 4NWLA 5PTPA 1C5UA 5FHTA 1N8OC 1Y5UT 2AIPA 2UWLA 3BTTE 5FXLA 4A6LA 3RXVA 5DK1A 2PGQB 2FOEA 3SGBE 1NU9A 4BAQB 4AFZA 2BZ6H 1BTZA 3ELAH 4YLUA 3GDSA 2ZECA 1FJSA 4ABDA 5HXFA 1YF4A 2QAAA 4AORA 1LCYA 1OP2A 3K6ZA 4CREA 1O5GH 3RXEA 2GD4B 1CVWH 3VB4A 3TIUA 3D65E 1SQAA 2BY6X 3GDVA 2B8OH 1DUEA 1O5FH 5JBTA 2A7CA 2BHGA 3BIUH 2IJOB 3BTWE 4IMZA 1CGIE 5A2MH 3ODFA 3SW2B 1IQJA 4AOQA 1C1NA 3TJNA 3SU2A 1HAGE 4E7RG 1AO5A 4I33A 4MPXA 1BBRH 4NZLA 5ESTE 5HM2A 4X8TH 1HRTH 3SJKA 3BEIB 1H4WA 1TNJA 1KIGH 2ZU4A 2ZTZA 2ZPQA 2ZHEH 3U8RH 5E0GA 8GCHG 4FU8A 1GCTB 3LGIA 3UREA 2EEKA 3SU3A 4OS2A 2Z3CA 2AMPA 1FY3A 1TQ0B 1GBBA 1ELTA 2BYAX 2VGCB 2VIOA 1YPHC 2ALPA 1IQEA 4ZH8A 1O3GA 3V3MA 5EODA 2VU8E 1ZMNA 2VNTA 1HBTH 2FX6A 2P8OC 3ZZDA 1QB9A 4K69A 4AYYB 4NA8A 1O3EA 1V2OT 2FOCA 3K65B 2Y5FA 4ZROA 3KIDU 5HMAA 5EG4A 5EU8A 2A4QA 1DPOA 1QRZA 3PYHA 1ANEA 3HK6B 2PGBB 2AGGX 3ZZAA 3RXJA 1SGDE 4GHTA 1L1GA 1TA2A 2UUYA 1EZXC 1Y3WA 1P10A 1AWFH 3SHCH 1AFQC 1DANH 7GCHG 2A2XH 4IW4E 1THSH 1EAXA 1ZMLA 4HGCA 1T8OA 3PLPA 5C20A 1SR5C 1ZTJA 1GBJA 1O33A 5E0JA 3SGQE 1YPHE 1WUNH 1AI8H 3V7TA 3M7UA 1C5XB 4Z0KA 1ANCA 3LH1A 2P16A 4UEHH 1GVKB 1RTFB 1GDNA 3RXMA 4O3TA 1VITH 1Z71A 1A5GH 4OS6A 2ASUB 4VGCB 1K22H 3EAJA 1GJ6A 1V2MT 2G81E 1SVPA 5DP4A 2VINA 4IC5A 4KTSA 1HAIH 1CE5A 1O3BA 4Y8ZA 3SJOA 3TK5A 3LGUA 4DGJA 4Y7AA 3SJ9A 1RFNA 2C93B 3ATLA 3QK1A 2AMQA 4CRBA 1SGPE 2CN0H 1ZHRA 4YLQH 1UTPA 3MU4A 4U2WA 3TH3H 1LPGB 1NESE 2VVCA 4X8UH 1NFUA 2PKSB 2F91A 1GBLA 4JZFH 1UTMA 5HGGA 3ATIA 3KL6A 1L1NA 1T31A 4ABIA 4ABBA 4LXBH 4WXIA 2GCTB 2JKHA 1MCVA 3F9EA 4IMQA 1GMHF 1ARCA 1O2IA 3MWIU 1NS3A 2V35A 2ILNA 4OGXA 2VWNA 1PQ5A 4X6OA 1UCYK 2PKAB 1B5GH 1KXCA 1D3QB 1AZ8A 3M5OA 1TAWA 1YPMH 1SHHB 2A5KA 4CR5A 1O2PA 3SQEE 1JIRA 2ZGHA 3SU5A 2W26A 3URDA 4B71A 1V2WT 3LPRA 3ZVEA 1UK3A 3L3TA 1UO6A 4DW2U 1MU6B 1YM0A 1MKXK 4MNYA 1WAYB 1W7XH 5J4QA 4BNRA 1LPKB 4MNVA 2A7JA 3UQOA 2G4UA 1QURH 3O8BA 3FANA 1AKSB 3GYMA 2A5IA 3LIWA 1G3EA 1UVTH 1F5RA 7GCHF 1LHGH 1V2TT 1UK4A 3URCA 3RMNH 1KTTB 2ZHQH 2ODQA 2A0QB 2G5NA 3P8OA 5F8XA 4THNH 1BDAA 1LTOA 2R9PA 3TGJE 4F4OC 4A5TS 4X6MA 3ZVAA 1C5LH 1MCTA 2PW8H 3PB1E 4SGBE 1UTQA 1OWDA 1C2DA 3PMHB 1UJ1A 3GICB 5DPAA 2RA3A 1K1LA 4WXVA 1ELGA 4FVDA 2ZCLP 1ORFA 4AFSA 1QB1A 2K1QA 5JB8S 4WH6A 2OC8A 4OS1A 2ZFRH 3HGPA 2A5AA 1J16A 4TPIZ 2SGQE 3BSQA 5IYTA 1MBQA 1V2ST 3MO3A 2HOBA 1KXAA 2BLQA 5JDUB 1MTNB 1KXBA 4B75A 2CJIA 1F92A 2HVXA 3Q76A 3A8AA 2FESH 5HYOA 1O2OA 4TY6A 1PQ8A 4KKDA 1ZGVA 2XCNA 3SUDA 3S7KB 1T8NA 3NK8A 5FPYA 1GDQA 1JWTA 4X2YA 2Z3EA 1AUTC 3BTME 4ABHA 1OWJA 5FPTA 1GCTC 1C4Y2 1ACBE 1BBRK 3WY8A 4TY7A 2Y82A 1UTKA 2BDBA 3ATMA 4ISHH 2PLXA 5LPEA 1T4VH 1GI5A 1W2KH 2VGCC 7LPRA 1TX6A 3RMOH 1WOFA 3M5NA 1GJ5H 3NPSA 1CHOF 2Q1JA 1MD8A 1GHAF 3TVJB 1SFIA 2OLGA 3RXHA 3KHVA 5JYIA 4Y8YA 2AMDA 1YPGH 2AIQA 2H6MA 4ZKOU 5FBIA 1QBOA 2SNWA 4I8HA 2C8WB 2GCHG 3A87A 1ZTKA 3GY3A 5C1UA 3ATKA 4GUXA 3ZVGA 3E0PB 3QZRA 1V2QT 2BDAA 4X2WA 1TRNA 1NRPH 2BDGA 1EQ9A 1YC0A 4E05H 3IG6B 1GG6B 5AF9H 5T3HA 2Q6DA 2TGDA 1P09A 3TJUA 4DY7B 1BA8B 2EI6A 1AE8H 1RGQA 4D7FA 3SI3H 1J8AA 3SUFA 2CXVA 1GJ7B 2FYQA 2W3KA 2HRVA 3LU9B 1MBMA 4SGAE 3KEEA 2ZIQH 2FLRH 1L1JA 1XUFA 1V2VT 2FYRA 2P93A 4CRCA 4D76A 1GMDG 3E3TA 1ELFA 2I6QA 4VGCC 1EAWA 3ZVDA 1EXFA 3RC6A 5C67A 1MKWH 2A4RA 3R3GB 1L4ZA 1XM1A 1C5QA 5F8ZA 3RXTA 4IBLH 2FM2A 2BY9X 3D49H 2PKSC 3AAUA 2FI5E 3A8BA 1ZZZA 2FIRH 3EE0B 4WWYA 2GCTC 3GY5A 2TGAA 4AFUA 1W13U 3TJVA 1GHBG 4NZQA 1DWCH 1O2QA 2R0LA 4I31A 4NFEA 1C1PA 4JK5A 1BRAA 1TIOA 4YOIA 4XBDA 1TABE 2ESTE 1ZJDA 1EB1H 4FUJA 1RJXB 4AYVB 1Z1IA 3ZYDA 5A0CA 3CENA 3R0FA 1C2FA 1WTHD 2OCVB 2TIOA 2XWAA 1GBHA 1OSSA 4TYDA 2BD9A 2V0BA 1XUIA 2GCHF 2ZG0H 1C2MA 5FBEA 1QBNA 4TPYA 4B74A 3QO6A 5BRRE 1C2GA 1OYTH 2V3OH 1CGHA 5E2OA 3MH6A 5DP8A 1ZYOA 3DA9B 1C5MD 1TBQH 3TJOA 3P17H 4I8GA 3K2UA 3T62A 3SU6A 2F9PA 1LKBA 1EX3A 1YGCH 5EQSA 1V6DA 2B0FA 5HM9A 3QX5H 2ZU5A 1C5VA 1NO9H 2JH0D 2QA9E 5EW1H 3GYLB 1C2HA 1LKAA 1B7XB 3NZIA 5GDSH 3MFJA 3UWJH 1HYLA 1IQKA 1BTYA 1KDQA 3RM2H 3S7HB 3PMBB 2FP7B 2WPHS 5L30H 1TRYA 1F7ZA 3A7VA 1IQFA 3ENSB 4WMDA 3MU0A 4X2VA 1YPEH 4WVPE 1DUAA 1A0LA 1O3HA 1WV7H 1A2CH 2GVFA 2BOKA 2Z9KA 4ZHLU 3N7OA 5ABWA 2FOMB 4FUCA 1C9TA 3RU4D 3SQHE 1DOJA 4E06H 1TRMA 3GY8A 3IWMA 2BX3A 3KQDA 1K1IA 1CU1A 3S9AA 3MHWU 4HI3A 1C1QA 5T6GA 1O2TA 1C5SA 1PPGE 3SU1A 3V13A 2CV3A 4JYVH 1GVLA 1E0FD 2NU4E 1EPTA 4X1SU 1QRXA 4AZ2B 1MTNC 1LPZB 1J15A 4YM9A 3BEUA 1XUHA 1SGNE 3T27A 4X2XA 4Y0ZE 2THFB 1TGTA 4DJZB 3RXGA 4Y71A 3NXPA 1SLUB 1EAIA 1C5YB 1AVGH 4Q80A 4ZUHA 3B8JA 4JZDH 1FPCH 4M7GA 4D7GA 2PR3A 2ZU1A 4QT8C 1QHRB 3FFGA 4ABAA 3QLPH 1HAOH 1NRRH 2BZAA 2LNCA 1GJ4H 1LVMA 1SQTA 3EDXB 2GTBA 2XC0A 2XYAA 1BUIA 1GMCG 1D3PB 2D1JA 4GVUA 2HALA 1CO7E 5LGOA 1D9IA 1Q2WA 1YKTA 4X1QU 5DP5A 2PUQH 2C8YB 4RN6A 1RD3B 3A85A 1E35B 1V2PT 2FOBA 3SGAE 1P3CA 3A7XA 5FCKA 3VB6A 2GT7A 3LGTA 1QR3E 3VB3A 1A4WH 4CRDA 1A46H 1MAYA 2VJ1A 1ELBA 1K1NA 2ANYA 3ZZ7A 1GG6C 5DGJA 1OX1A 2O8UA 4MQAA 2C3SA 1H1BA 2H2ZA 1S6FA 1YP9A 3BV9B 4U32A 4CH8B 2WYJA 2GX4A 4R8TB 4UFGH 1X7AC 3M5LA 2HWLB 6GCHF 1WYKA 1TNLA 1SOTA 3RXBA 1UMAH 2IPHA 2VIWA 5E2PA 5GXPA 1ESBA 4DIHH 2ZPRA 1VGCB 2J38A 1GBKA 4RKJB 4X1NU 4XBBA 1C5RA 1H8IH 1MAXA 4Y6DA 1ZSKA 4DT7B 2BQ6B 3A88A 3SV8A 4OGYA 3TH2H 1T7CA 1GI4A 1BTHH 2ZU3A 3UWIA 1HXFH 1EOJA 4BOHA 2NWNA 4Y11E 1IHSH 2ZC9H 1P04A 2B7DH 1LDTT 2XC5A 3DT0H 2GDDA 2WINI 2VVUA 1NROH 2XTTB 2A4GA 1O2HA 2J95A 1G2LA 1L4DA 1H9IE 1MKWK 1OYQA 1IOEA 2LPRA 4JZIA 1T8MA 1VCWA 1BJUA 3AAVA 2ZDLA 4YOGA 1G9IE 3HKJB 3MMGA 4E7NA 3TK9A 3AW0A 1O2JA 1SL3A 2P94A 2JH5D 4GAWA 5L2YH 5GWZA 1C2JA 1PQ7A 2H5CA 4ISOA 4NIWA 1N6XA 1P0SH 1GHZA 2J92A 3BG4B 2C8ZB 2XC4A 4IN2A 1YPLH 1P3EA 4Y76A 5ESBA 5DP9A 3A86A 2WPIS 1TNIA 1FY4A 5FPSA 1SOZA 5A8YA 2WPJS 4ABEA 1V3XA 3NWUA 2OC7A 2OC0A 4ISNA 3QUMP 1HAZB 2VIDA 2BVSH 1F5LA 1ETRH 3D23A 2ZDVH 2TGPZ 1CT2E 2BLOA 4MPWA 3OX7U 1HIAA 1BTWA 1VCPA 2XBVA 4A1XA 1ARBA 1AVXA 1O2UA 4I7YH 1TBRH 2BD4A 2CF8H 3MU8A 2FI4E 3BTFE 2SNVA 2QCYA 4A92A 3HPTB 1ZGIA 1F2SE 4ZMAH 3QN7A 2ZFQH 2YNBA 1BITA 3RC5A 7KMEH 1FAXA 1T32A 3E1XB 4O3UA 1IAUA 4BAKB 1TWXB 1GHWH 2XWBI 1MQ6A 3EQ0H 1YPJH 3SNDA 3EYDA 1EJMA 5JBAS 1FLEE 5DG6A 2G51A 3O8DA 3MNSA 1YBWA 1Z6EA 2FDAA 3H5CB 4MG3A 3T25A 3UFAA 3BEFB 2OC1A 3GCOA 1HAVB 1VZQH 1O5BB 4JK6A 3FZDA 3P6ZB 3V0XA 1TGBA 3F1SB 1UVUH 1CA0B 1QJ1B 1KLTA 3VB5A 2BX4A 4U30A 5E0HA 2AGIX 1FQ3A 1O2WA 5T6FA 1QQ4A 1EB2A 3GY6A 1AU8A 3BN9A 2VB0A 1O3AA 2BVXH 3ZZ9A 1LQDB 1P01A 1GGDB 1OPHB 1N1LA 3GCNA 5K7RA 1XUJA 1LVOA 1TALA 4NG9H 3MYWA 2QIQA 1RTLA 2GV6A 5EQRA 3S9CA 1OS8A 3RXCA 2WPLS 4YT7H 1O2VA 5DJ7A 2WYGA 5AFYH 2HNTC 1NY22 1C2LA 1PJPA 1SGIB 2KAIA 4NIXA 5EOKA 8GCHF 3Q00A 5A0BA 1QB6A 3UY9A 4I32A 1QJ7B 4X6PA 1S6HA 4XDEA 5GCHG 3M7QA 5L2ZH 1GJAB 1P2MA 3PMAB 2JETB 1XVOA 1LHEH 1UHBB 4K3JA 1EAUA 4O97A 1BHXB 1E36B 2YOLA 2ZA5A 1GBDA 2QXHA 1ESAA 1HCGA 5C5OA 5K0HA 4XE4A 1KTSB 1JRTA 3FZZA 4BTIB 2Y5GA 1SMFE 2ZDNA 2ZFSA 4NGAH 1WSSH 3HK3B 2O8MA 3ATWA 1O3KA 3Q3YA 3SNAA 1Y3VA 3QDZB 1VITG 3F68H 3OYPA 3VXEH 1O31A 1KLJH 3HATH 9ESTA 2OP9A 1O5CB 2HNTE 4CHAB 3MU5A 5J4SA 1BRBE 3RXOA 1SGEE 2CGAA 2ZQ2A 2ANMH