2FOAA

Structure of porcine pancreatic elastase in 40/50/10 % benzene
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords elastase-1
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foaA01
1ZR0A 4JYTA 2Z6BD 2C8YB 1LVOA 3FVFB 1K21H 3MU4A 3UTUH 1HJ8A 1OX1A 1A4WH 2FOMB 1Y3XA 4IC6A 3ODFA 2GX4A 1O2ZA 3U98H 1L4ZA 1WBGB 2D2DA 1O2VA 1V2TT 3K6ZA 5DP9A 1TMUH 3A8DA 1C1SA 2WPMS 1FAKH 2EI7A 2ZDMA 1O3DA 3KN2A 4OS2A 3CS0A 5GCHG 4XBCA 3ATLA 1SQAA 1HXFH 1IOEA 1MTVA 1HAGE 4NA7A 2CJIA 2FWWA 2QXIA 1LHGH 2BY8X 1EB2A 1GI9B 1W10U 3URCA 5L6NH 1LQDB 2PKAA 3SNEA 1AB9B 2ZDKA 4JZDH 3TJUA 5JBTA 1H4WA 1JRTA 1KXEA 4Y79A 4XE4A 2GV6A 1YPHC 2O8LA 2ZCKP 1VCWA 4BAHB 1ANCA 1GCDA 3SUEA 1VGCC 8ESTE 4K5ZA 1P57B 1BTWA 2ZTYA 1A3EH 1O2HA 1IQFA 1O5BB 4CHAC 2H9TH 1SGCA 1AO5A 4FUFA 4I8JA 4LZ1H 1SGFA 3RMOH 1GDNA 1HJAC 4D7FA 1T7CA 4BANB 1C1QA 1YF4A 2P95A 4U2WA 3SV9A 3G01A 4R0IA 1GHAF 4GHQA 3ZZ3A 1XUJA 3AW1A 1D6RA 5EQRA 3VXFH 2F9UA 4X8TH 2DUCA 1DWCH 1GBKA 3HKJB 4ZKNU 1TOMH 2FOGA 4FUIA 1C2DA 3OSYA 2CXVA 3M5LA 3RXSA 3HKIB 1ZZZA 2ALPA 2BZ6H 3DUXH 2NWNA 1BCUH 1IQGA 4ABAA 1EJNA 2XBXA 3BG4B 4KKDA 1KXBA 4O3TA 4D7GA 1RTKA 1DX5M 2A0QB 4NFEA 3E3TA 1Y5AT 2OCVB 3M61U 1WYKA 5IYTA 2G4UA 2ZF0H 3LGWA 1XKAC 1W2KH 2ESTE 2F9PA 1JBUH 3TGIE 1C2KA 1LPGB 1S5SA 1SBWA 2G55A 1GCTB 3RDZA 2JETB 1AFQC 2JETC 4NIVA 1H8IH 1O30A 2FLBH 1YPEH 2STBE 2BXUH 3GISB 5E2OA 1YPKH 1J8AA 1TRYA 1GMHF 2BQ7B 3C1KA 1GHVH 2F91A 4K1SA 1QJ1B 1G30B 1MZDA 5F8TA 4I32A 5DG6A 1IQJA 3GCNA 1TQ0B 2ZFSA 3A89A 5I46H 3GY2A 1SOTA 3UREA 5F6MA 1NRSH 1A1RA 1GMDG 1O2IA 3PMAB 1CVWH 1D4PB 1WU1A 3PV4A 1OWHA 4X8SH 1WSSH 4ZKSU 5T6FA 5H4IB 2FTMA 2Z94A 1GBIA 1K28D 1AI8H 1TNKA 1QR3E 2P8OB 1GMCF 2XC5A 5FBEA 4ABFA 1GBBA 1OXGA 2Y5HA 3VEQB 4QT8C 1GHAG 1F92A 1FV9A 1YPMH 3RU4D 2HVXA 1AQ7A 2GZ9A 2G81E 4B76A 3U8RH 4NIYA 4B2BA 3KCGH 1P09A 3LC3A 3NKKA 1HPGA 4AFUA 4DY7B 3QO6A 4YT7H 2OD3B 2ZIQH 1Z1IA 1C9TA 1AY6H 1C1OA 2R2MB 1YCPK 1ANBA 3E90B 3NK8A 4BAKB 1O3PB 2Y80A 3VB3A 1NO9H 2FI4E 1MQ5A 3UIRA 5C1XA 6CHAC 3MWIU 1QQ4A 1QGFA 1G3EA 1OP2A 1PFXC 5F8ZA 1ZMJA 1LHCH 2BY5X 1EAIA 4ISNA 1QL8A 1TBRH 1H8DH 4AX9H 1DY8A 3E1XB 4AN7A 3EE0B 4MTBA 4B73A 2CF9H 2PGQB 5AFZH 1V3XA 3UWIA 3M3TA 2FODA 3GYLB 2R3UA 1BJUA 1GMHG 3ZVAA 2LPRA 1QL7A 5C2ZA 2ZU2A 1W0ZU 3D23A 5HM9A 4X0WU 4CHAB 1PYTC 8LPRA 3T26A 2QIQA 1ZPCA 2ZEBA 2A45B 1O2GH 1ELTA 2ASUB 3ITIA 2P3TB 4NSYA 3SQEE 1AFQB 1BIOA 4INKA 4LZ4B 1YCPH 3DFLA 3M37A 1RRKA 2B9LA 2J38A 2ZDNA 4HFPB 2F9BH 3I29A 1ELFA 5K7RA 2SGEE 3A83A 5FCRA 3BN9A 3D65E 1W0YH 1ZSLA 4AG2A 4MPWA 2FO9A 2PTNA 1TX7A 2IOTA 4Y11E 2ODYB 1TPOA 1GI5A 3P92A 1MU8B 3BTME 1T8NA 1BITA 1QBNA 3M5MA 4X1NU 4NA8A 3GY5A 1G3DA 1GI6A 5AVDA 3M5NA 3TVJB 3E91A 1XX9A 2BDIA 1KLTA 3A82A 2A32A 1C9PA 2CMYA 1GDQA 5PTPA 5C3NA 1V2WT 3RP2A 3SHAH 1EUFA 1LTOA 1C5VA 3V13A 1T8OA 2FTLE 2QXHA 1FMGA 1HNEE 1O32A 5L30H 4O97A 2NU0E 5ETXA 3Q00A 1YPJH 3TH4H 5K0HA 1Z8IB 3SV7A 4DIIH 4Q2KA 3PM3A 3WY8A 1SFIA 3SNBA 1TNIA 3RC4A 4U01A 5C5OA 1P03A 4WF8A 1FY8E 1TGBA 2J34A 2FZZA 4XOJA 2RA3A 3M7TA 1GHWH 2WPHS 1BUIA 4KELA 2OXSA 3TK5A 1QRWA 1YKTA 4CRDA 3ESTA 1HFDA 2OUAA 1AKSA 1BRAA 4E7NA 3GCOA 1Q2WA 3KNXA 5HMAA 1OYTH 1P02A 2QF3A 4B71A 5EPYA 3BV9B 1E36B 4X2YA 2OBOA 2G8TA 2OC1A 1PQ5A 1GGDB 2AFQB 1WUNH 1V2VT 2AYWA 5JBCS 5EXMA 2EC9H 2BVRH 2WYGA 4BOHA 4A92A 5E0HA 3A7TA 1L4DA 1TGNA 1NY22 2BDGA 1GVZA 1SPJA 2GMTC 2GKVE 3VXEH 2CN0H 2YOLA 1VCPA 1AN1E 3UNSA 3HGPA 1TMTH 7GCHF 5JPMH 1NS3A 3MI4A 1ARBA 1G3BA 4JCNA 1P05A 2A2QH 3PB1E 4ZKOU 4SGBE 1WCZA 4OS5A 3CP7A 2P59A 1UVTH 1O34A 1G32B 1TQ7B 2AH4X 3QX5H 2I6QA 1LO6A 2UWOA 3GCHB 1XXDA 2FDAA 2ZTZA 1Y8TA 1C1TA 1DSTA 1EXFA 2BY9X 2ZPRA 5FPYA 2F83A 2FM2A 4YOJA 5EW2H 3GYMA 2SGPE 3O8CA 1HIAB 2G5NA 4I33A 3MYWA 3IG6B 3B23B 3ZZ5A 1GI3A 1HJ9A 1MUEB 1MZAA 1AVWA 3FAOA 2FI3E 1P2MA 3BG4C 1UK4A 5FPTA 1M9UA 1O5EH 1BBRK 1A46H 2FI5E 3ELAH 3BTEE 2Z9GA 1GI8B 3T27A 1O3MA 4Q80A 1OPHB 2PFEA 1PPHE 1D9IA 1QBOA 2FEQH 3F9FA 1C4U2 2TPIZ 1VJAU 2BZAA 1BOQA 3ZYDA 1GI4A 5E2PA 1DY9A 2ZCHP 5TCAA 1EJMA 1UVUH 2SGFE 1S6FA 1T31A 3HGNA 1F0SA 1ZLRA 2D8WA 5AF9H 1NESE 3RXFA 2R9PA 1N6YA 3SNCA 1C4V2 1P2JA 1VJ9U 1VITF 4LXBH 4VGCB 1V2MT 2P16A 1UTLM 2GCTC 1NN6A 4GCHG 2H2ZA 1UTKA 1P9SA 1FN8A 1UVSH 1QRXA 1FZZA 1THRH 1V2NT 1NZQH 2ODQA 1EP6A 1ETTH 3VB5A 1BTXA 3TIUA 1A5HA 3I78A 1AUJA 4NSVA 5ESTE 3MNSA 3PLPA 1EATA 2VH6A 1MKWK 2O8WA 4DCDA 1VZQH 3EGKH 2VIWA 5DP3A 1Z8GA 1TIOA 2BLWA 1O2SA 2BDHA 2ZA5A 1HLTH 4GVUA 5L2YH 1GBCA 3GCHC 4X2WA 1T8MA 4A7IB 1N1LA 3SO3A 4YOIA 1LHEH 1GHYH 1MKXH 5A8XA 1SGTA 1FUJA 1Z1JA 1LHFH 3QLPH 4NA9H 3P8OA 2HGTH 4F49A 2H9HA 1DANH 4O9VA 1OSSA 2ZWLH 1P12E 2ANMH 3TGJE 2OC0A 2GVFA 2AMQA 4ZAEA 5A09A 3P17H 1GWAA 3LGVA 1EX3A 1D3PB 1O33A 1ZMNA 2BMGB 1D6WA 3QUMP 4XBDA 1O2QA 3KIDU 4UFFH 1GJBB 2WINI 2P3UB 1GL0E 4JZIA 3GICB 3SJ9A 2R0KA 4ABGA 2IPHA 1Z7KA 2I6SA 1T4VH 1ZRKA 3GY7A 3RXPA 1G2MA 3U69H 4CREA 1RS0A 4UEHH 2ZHDA 4TYDA 3A81A 2XXLA 4FUDA 4H4FA 1GJ7B 2QF0A 1O38A 3E0PB 2H5CA 1ORFA 3TK6A 1WV7H 4ASHA 1MMJN 2AMPA 1FY4A 3MFJA 1C2HA 3TLOA 1AE8H 4TY7A 1C1WH 1NRQH 1P10A 1Q3XA 1O2UA 2ZGJA 2ZNKH 4X6OA 3GY8A 1O3KA 4GLYA 4F4OC 4A1TA 3GDVA 5GIBA 2OBQA 2BLOA 1YPHE 4UE7H 3MU0A 3R3GB 1TNJA 2VIQA 3RM0H 1BA8B 3B9FH 5LPRA 1C1NA 1QY6A 3MNXA 1C5UA 3M5OA 3BF6H 1C5ZB 1TFXA 2PGBB 4MPXA 1GI1A 2VVCA 1HAZB 2A1DB 2ZZUH 3SU2A 1F0RA 3TJNA 2ZFPH 1HAVA 1TB6H 5EQSA 1QTFA 3P6ZB 5DP6A 1LVMA 3STJA 4U30A 2WPKS 5GPIB 4WY3A 2CGAA 5CHAB 1BMMH 1FDPA 1GBAA 1NFUA 4K60A 4YZUA 3A88A 3PWCA 1J16A 2A4RA 1QNJA 2SGDE 1FY3A 1S81A 1FPHH 3ZZAA 1TRNA 4DJZB 1THSH 4JYUH 3ZV9A 2B8OH 3UNRA 1ZSKA 1H9HE 2VIVA 1RIWB 1IQNA 1GBFA 3RXJA 3S0NA 4YOGA 2C93B 5A0BA 5BPEA 3P8GA 1DOJA 1S6HA 9ESTA 1TA6A 4Q7ZA 4JZFH 1AWFH 1V6DA 1O37A 1CT4E 4BTUB 1T32A 5DP5A 3HATH 4AORA 3IWMA 1XUGA 1DWEH 1GVKB 1MTSA 4INLA 1FAXA 2P93A 1FLEE 1DLKB 1BMAA 3DD2H 1TNHA 3STIA 4RN6A 1E35B 4IW4E 1UTJA 3BTKE 4ISIH 1IAUA 2OQUA 1W7XH 1D3TB 2BHGA 5GDSH 1KTSB 3AAUA 1O5AB 2VWMA 3RC5A 2FPZA 1N6XA 1SGYE 1P06A 1S0QA 1O3BA 1J17T 1Y3WA 1GBHA 4E7RG 4FUGA 4E06H 2B0FA 1EJAA 2VNTA 1C2MA 1H9LB 2FLRH 1LQEA 1V2UT 2HALA 3M3SA 2C8XB 1XUIA 2ZPQA 5J4SA 1DWDH 1EPTB 1JIRA 3N7OA 5JB8S 3P8FA 3BTWE 2V6NA 2VIOA 2QYIA 4YLUA 3ZZ7A 1K1LA 2AMDA 1LKAA 1PJPA 3RXAA 3TH2H 5GWZA 4K1TA 3TNSA 1SL3A 3A85A 3RMMH 5FCKA 4M7GA 4D9RA 4OS7A 1TA2A 3RXBA 3ZVDA 1CGIE 1HV7A 3FANA 4ZH8A 5A0CA 1K1JA 4AFQA 2WPJS 3T5FH 4MNYA 3M7UA 2BTCE 4HGCA 4MDSA 2BOKA 5TJXA 3A7VA 1P2IA 3KHVA 4MLFB 1DLEA 1GHBG 3NXPA 2VIDA 2A5IA 4Y7AA 3L6PA 3U8OH 3QDZB 1GJAB 4Z0KA 1ZOMA 4TY6A 3PLBA 3EAJA 1G9IE 4AZ2B 4IC5A 3S9AA 3RXRA 2B7DH 2XNIA 3ATIA 1ZPZA 3UR6A 4UFEH 2IJOB 1SGDE 1GBLA 1EOLA 4UDWH 2C90B 1E0FD 2ZFFH 3LT3A 4CR9A 1QURH 1YCPM 3SOSA 5JDUB 4ZKRU 2QGRA 2PR3A 4JZEH 1T4UH 1KXFA 1ARCA 1HAYB 1EPTA 1GBJA 1UK2A 3KEEA 3LPRA 4MQAA 4ABDA 3RC6A 3I77A 1O5CB 2BYAX 4IN2A 3GY3A 2HRVA 1C1RA 1YBWA 2A4OA 3EA8A 1F5LA 2JH0D 4D76A 4BNRA 1KDQA 3EQ0H 2ZGHA 1SVPA 2R3YA 1A61H 3M36A 4RKOB 3F9GA 3L33A 1CA0C 2ANWA 2GZ8A 1FONA 2OC8A 1C2GA 4TWYA 3MU8A 3BTQE 2LNCA 3PO1B 3SI4H 2XYAA 1JMOH 3PMBB 3JZ2B 3BG8A 1AHTH 3SJ8A 2STAE 3RLWH 4WMEA 1ELCA 4GHTA 3BEIB 4O3UA 1Z6JH 2Z3CA 1PPGE 2YNAA 3SHCH 5SGAE 1HAVB 1MH0A 3BIUH 4YTAA 1DS2E 3OU0A 4CR5A 1O2YA 3SU5A 1P0SH 1JIMA 1BB0B 5DK1A 4JYVH 1PYTD 3F68H 4ZHLU 3RXUA 2Y82A 3TK9A 4FVBA 1QHRB 4SGAE 1ZTLA 3MNCA 4FXGH 1HAXB 4GAWA 3H7TA 1SG8B 1XM1A 2XW9A 1SHHB 2BD8A 4MNVA 1BTPA 1MCVA 5GXPA 4K3JA 1CU1A 1AGJA 2BD4A 3LGTA 1Q31A 1KXDA 4H6TA 4ABJA 1TABE 1B5GH 2HNTC 3QTVH 4X8UH 4D8NA 1Z8JB 3KQEA 3QZRA 1K1NA 3DHKH 4WJG2 2Q6FA 1LCYA 2C4FH 2PLXA 1P3CA 2ILNA 4K8YA 3ZZ9A 1OWKA 1LHDH 1YPGH 1GDUA 2RCEA 2UUKB 3T25A 4IGDA 5EW1H 4BTIB 2C3SA 3VB7A 4DURA 2VWNA 2BD7A 7LPRA 1EPTC 3S69A 1W11U 3D49H 2D1JA 1KY9A 1GPZA 4NWLA 4OGYA 1FPCH 1ELVA 1A0HB 1PQ7A 1O3IA 2J9NA 2P94A 2PUQH 4B74A 1ETSH 2BD9A 5EPNA 3TPIZ 1O2KA 1ZGVA 1VITG 4MNXA 1TBZH 4ZXYH 1B7XB 2V3HH 1H9IE 1GJ8B 3P95A 1DICA 1TALA 4ABHA 1ANEA 2WUCA 2C8ZB 4I8GA 5T3HA 1XMNB 2HNTE 3SJIA 3AVZA 5GJ4B 3ENSB 3PTNA 4AB9A 2OTVA 4CBNA 2YNBA 1IHSH 4NG9H 1V2JT 3SJKA 5JYIA 5CHAC 2A7JA 5T6GA 7KMEH 4BAMB 4Y76A 3VFEA 2BD5A 1K1MA 2NU3E 3UOPA 3U9AH 1SSXA 4YESB 1DXWA 2HLCA 3E16B 2G51A 2NU2E 4DT7B 1OWEA 1SGNE 4WWYA 1O36A 2R0LA 2R2WU 2F9VA 2VVVA 1TLDA 1GMCG 1NFYA 4BXSA 2ZI2H 3SV6A 1AE5A 2ZU5A 5E0JA 4X1RU 3K65B 5J4QA 4X1SU 1QBVH 3CS7A 1RTLA 5E0GA 2ZFTA 2D26C 2ZKSA 1EOJA 2UUYA 4B1TA 2GDEH 2XTTB 2GMTB 4ZMAH 1S82A 2BQWB 4X6NA 1YYY1 4KTSA 4XSKU 3MO6A 4NFFA 2A5KA 1AMHA 1ZHPA 1PPCE 4ZUHA 2AIQA 4A6LA 2BY6X 1BTHH 1KTTB 3SZNA 4A5TS 1E37B 1TRMA 3F1SB 3F9EA 1CGHA 1L1NA 1OP0A 2QCYA 4A1XA 5A0AE 5LH8A 1LVYA 1BTYA 4J2YB 1O3CA 2BM2A 1HDTH 2ZPSA 1OWDA 3URDA 1EZQA 4WVPE 5FXLA 2W26A 3M3VA 1WAYB 5AHGH 1A0JA 1RFNA 2FX6A 1LPZB 5GCHF 1ACBE 5A2MH 1HJAB 3BTDE 3RMNH 1WQVH 3UUZA 3SU3A 1V2OT 1ESTA 1C5SA 3P70B 2VIPA 3VGCC 1TNGA 2G5VA 1NRRH 4LK4A 1IQLA 4D9QA 1NU9A 1ELGA 4X1PU 1EP5A 1BRBE 1CBWB 3HK6B 3FZZA 3A8AA 1EB1H 1L1JA 4FUCA 4JMYA 1CA8B 2TIOA 1P2NA 1SLXB 5DP7A 3GDUA 3RLYH 1NROH 2FX4A 3AASA 3EA7A 3SBKA 1A5GH 3SNDA 4B75A 3OX7U 1GJ6A 1GBEA 4TPYA 3RU4E 1EZXC 2BD3A 2O8UA 5G4BA 1NPMA 2QA9E 1UMAH 2HWLB 2XBYA 1FIWA 1NU7B 1UVPA 2GCHF 2ZFQH 3LC5A 1FQ3A 3HPTB 2FOBA 1K2I1 3SUGA 6GCHG 3ZVCA 1LMWB 2EI8A 3FP6E 2O8MA 4ABIA 4R8TB 2ALVA 2PKAB 1THPB 2EI6A 2FXRA 3BTTE 5EODA 2ZDLA 5HM2A 3V0XA 3A7YA 3T62A 1QJ6B 2G52A 2HNTF 4KTUA 3KQBA 1O2XA 1MTWA 5BRRE 4ABBA 2PHBA 4HZHA 4I8KA 1CO7E 4NCYA 2V3OH 2SFAA 1T8LA 3QGNB 4YT6H 1GJ5H 4CRAA 3RXKA 2XBVA 1BMLA 1QA0A 1GVLA 2O9QA 1ELAA 4AYVB 3UQOA 2FOEA 4DW2U 1RD3B 2AERH 1CQQA 3PTBA 1HB0B 3RXTA 4DVAU 1SGFG 2BDYA 1UCYH 1O5DH 3UQVA 1BBRE 2PV9B 4KP0A 1EQ9A 2XWBI 1NFXA 2VWLA 2JKHA 2ZCLP 2A2XH 2FOCA 1ZMLA 4ISHH 3MO3A 1MTUA 2BD2A 1CT0E 2CF8H 1PPBH 1WOFA 3LGIA 1UVOA 3PROA 1O3NA 4Y7BA 5JBAS 2BLQA 1CE5A 1XUFA 2Z3EA 2ZFRH 3T28A 1NC6A 1H1BA 4Y8ZA 1SLUB 4Z6AH 5F8XA 2J95A 3OY6U 3RXLA 1EAXA 1P8VC 4IS5A 1C5YB 1UCYK 3RXGA 2TGPZ 3FFGA 1ELEE 1SMFE 1SLVB 1NFWA 3SV2H 2BOHB 1GJCB 4XDEA 1LDTT 1TAWA 1SHYA 1Y3VA 2QC2A 1TYNA 4FU7A 4GPGA 1J9CH 3SI3H 1UHBA 1MTNC 5JB9S 1HAOH 1S84A 1K22H 4AFZA 3UPEA 2BXTH 3D62A 3KGPA 5F03A 5EXNA 3VB6A 4X1QU 1O5FH 1AB9C 5CMXH 1A0LA 1BRUP 3SU4A 1P3EA 3CENA 1C5XB 1SGQE 2GD4B 3MU5A 3ZVFA 1UTOA 2TGDA 1EZSC 3NPSA 1QIXB 1ZGIA 1C2IA 2XRCA 1L1GA 3BTGE 4Y8XA 2BDCA 4B2CA 1XUHA 1E38B 1NM6A 2A31A 3PYHA 2PTCE 1UCYE 1MD7A 1CHOG 1SGPE 1IQEA 2ZU4A 1F0TA 3MH4A 2VINA 3TJVA 1P9UA 4IMZA 1KIGH 2VU8E 5L2ZH 1PPEE 2F9OA 2WPLS 2ZU3A 5HGGA 3LDXH 2Z7FE 3EDXB 1AFEH 3RXMA 4O03A 1GHZA 3C27B 4PROA 1XKBC 2H9EH 4YO9A 2XC4A 1NRPH 1AD8H 4CBOA 1DVAH 5DJ7A 3H7OA 4GUXA 1UJ1A 3TH3H 3TU7H 2UUFB 2Y81A 1OS8A 2XBWA 2VB0A 3LGYA 1O2LA 1Y5UT 4E05H 1AU8A 1SGRE 1XXFA 3LKWA 4X2VA 3B8JA 4DG4A 2SGAA 4X2XA 1L0ZA 1NT1A 2Y5FA 3Q3KA 4ABEA 3ZZBA 1J15A 1FXYA 3SGQE 3GDSA 1RJXB 1VGCB 3UFAA 3GY4A 2PSYA 1A7SA 1QB6A 1BQYA 1V2QT 4ESTE 1ESBA 1G36A 4OS4A 1GJ9B 1D3DB 3ZVBA 3H5CB 5FAHA 1E34B 3UNQA 3S9CA 3L3TA 2J92A 1KXCA 1GI7B 1XUKA 4YLQH 5LPEA 1KSNA 3LH3A 4Y10E 1BDAA 3PLKA 1ZHMA 1DE7H 1AWHB 1V2PT 1MKXK 2K1QA 2BX4A 2AEIH 2V35A 4DOQA 3NZIA 2BY7X 2HOBA 2ZGXH 4DGJA 1GG6C 4I7YH 4WH8A 1KYNA 2Z3DA 4MVNA 1DPOA 1N8OB 1BJVA 1FY1A 1JWTA 3SJOA 1ETRH 1GMDF 3MU1A 1ZSJA 5T6DA 1MKWH 2ZDAH 4OS6A 4YM9A 1QFKH 2THFB 3S7KB 1Z71A 1VCQA 2Q6DA 7ESTE 2B5TB 2KAIA 1WQSA 2F9NA 3BSQA 4ZXXH 2HPQH 2OP9A 3RXEA 1O2RA 2TGTA 4ISLA 1P11E 4UFGH 1UK3A 3OYPA 4Y0ZE 1C2LA 1S0RA 1QB9A 2FOFA 3QGJA 3BIVH 4U32A 3ZZ4A 3DA9B 1PQ8A 2Z9JA 4A1VA 2QXJA 4FU8A 1C4Y2 1TE0A 4I31A 3FP7E 1YLDA 3TNTA 3GCTG 1UTNA 1F5KU 4AYYB 1TGTA 2QN5T 5JBBS 1BHXB 1L2EA 3Q3XA 1C5QA 1TMBH 3ZYEA 1QRZA 4MG3A 2AS9A 3LONA 1O3GA 3U1IB 1SR5C 5EXLA 1Y5BT 4FUBA 3V7TA 1AVXA 1DWBH 1RIWC 4WXVA 5EG4A 8KME2 3KQCA 2PSXA 3ATMA 2G4TA 1AIXH 1F7ZA 4I8HA 3O8DA 2ZHQH 1HBTH 1FNIA 5C67A 3RXOA 1LVBA 2VGCB 1IHTH 1HXEH 2W3KA 4H42U 1ABJH 1CT2E 3ZZCA 2XWAA 1BZXE 3BTHE 4ZROA 5C5NA 4K8BA 3SU0A 2FS9A 1GI2A 2A7CA 4UFDH 2OQ5A 3LGUA 4K2YA 1A3BH 3EA9A 3EYDA 3NUMA 5A8YA 5IDKA 4K1EA 1OWIA 4UD9H 1O39A 3SUFA 1B0FA 3MH7A 1X7AC 3LJJA 2BLVA 3MH6A 1ZYOA 1W8BH 1WTHD 1DUEA 4JK5A 1JOUB 2H6MA 1LPKB 2OLGA 1NRNH 4Q7XA 1GJDB 3MTYA 3T29A 2XC0A 8GCHG 5I25A 1TX6A 1PPFE 4J1YA 3NCLA 1ELDE 1ELBA 1GG6B 5FPSA 4XFQA 3A8BA 4GSOA 1N8OC 4OS1A 4THNH 2RDLA 2OINA 1MTNB 3O8BA 9LPRA 2Y6TA 2AGIX 2BQ6B 3QWCH 4BXWA 2VVUA 1CGJE 1CHGA 1Z8RA 1TOCB 5DO4H 1C1MA 2CV3A 2FESH 1C5TA 1QCPA 1RXPA 1DXPA 2ANYA 2WPIS 3PO1C 2JH6D 3V3MA 1ABIH 2J94A 5A8ZA 1ESAA 4AB8A 2C8WB 1RTFB 1SOZA 6ESTA 1O3HA 1C1PA 1SGEE 4NGAH 3IITA 3S9BA 1UTMA 2IN2A 1O3LA 1GBMA 1UTPA 1O31A 3ZVGA 1S83A 3AAVA 2XCNA 1W12U 3BEFB 1FIZA 1FN6A 3RMLH 3U1JB 3RXHA 1W3CA 1TWXB 2WV5A 2ZHFH 4AG1A 5EQQA 4WMDA 1QA7A 2W5EA 1ZJDA 4AFSA 2FYRA 2GDDA 1KLIH 3JZ1B 3LOXA 6GCHF 4B2AA 3A7ZA 3Q76A 1TPPA 1HGTH 1G3CA 2ULLA 4RKJB 1KDQB 1ZPBA 2FOAA 3MNBA 1C2JA 4NZQA 4X6MA 1OKXA 1K1PA 4ISOA 2QY0B 1GL1A 1GI0A 3LJOA 2P8OC 2JH5D 1ZTJA 4AGJA 1O2TA 2ZQ2A 4FUEA 1BTUA 5CE1A 4LOYH 1B0EA 1TNLA 2ZECA 5E8EH 2ZHWH 3SU1A 1V2KT 2G00A 4FVDA 1ID5H 1TX8A 4FUJA 1BT7A 2Z9LA 3F6UH 1QJ7B 2GGVB 4H6SB 5ESBA 1IQMA 3RM2H 3SGBE 4KTCA 1A2CH 1HRTH 2WUBA 2PWXA 3ZZDA 5FBIA 3PMHB 4HI3A 1PQAA 2A4QA 4AOQA 1TGCA 1QB1A 2ZGBH 1HAPH 1UTQA 1EZUC 1O0DH 3A8CA 1HAIH 2CHAB 1G2LA 2NU1E 1LKBA 2ZU1A 3SQHE 1O3OA 3DT0H 3E8LA 2XCFA 1KLJH 1HUTH 3MOCA 2BDBA 1HIAA 5EGMA 3SW2B 2PKSC 1EAWA 1O2MA 2ZO3H 3V12A 3S7HB 1VR1H 1C5RA 3SN8A 1K9OE 2BVXH 1HAHH 2ZP0H 3TJOA 1BBRH 2WYJA 1U6QA 5DPAA 1QL9A 2NU4E 3BEUA 2W3IA 1GJ4H 3RXQA 2VH0A 4BAQB 2Z9IA 1O5GH 1OP8A 3UR9A 4Y71A 1BTZA 3SORA 2RG3A 1C2FA 4UONA 1IQIA 3KF2A 4X6PA 1C1VH 4MPVA 3UWJH 2M5TA 5FX6A 5LPFA 4IMQA 3KQDA 1DT2A 1BRCE 1F5RA 1ZJKA 3PWBA 1SI5H 4TWWA 2V0BA 3R0FA 2TBSA 1WTGH 5AFYH 2UUJB 4I8LA 2W7SA 2ZHEH 3E0NB 3A86A 3QTOH 4BTTB 2EA3A 1YP9A 1SC8U 3BTFE 3RXCA 1AUTC 1IQHA 1XVMA 2ZQ1A 3VB4A 5DGJA 1AZZA 1QQUA 1UHBB 2VJ1A 2FYQA 4MNWA 2SGQE 1NTPA 3VPKA 1Y3UA 4CH8B 3GOVB 1AKSB 2BX3A 5FX5A 3A80A 1P2QA 1O2NA 1ZHRA 2Y5GA 1MAYA 3OTJE 2H5DA 1V2ST 3HK3B 3QZQA 1SB1H 2FP7B 1YLCA 4TPIZ 1VITH 3RUOA 3TITA 1YGCH 1Z6EA 1OWJA 3LIWA 1DSUA 3SU6A 4MPUA 1Y59T 3PMJA 4DIHH 3W95A 1GHXH 1MU6B 2ZTXA 3ATWA 1MBQA 3TGKE 1MD8A 6LPRA 1ZRBA 1EKBB 3ODDA 1P2KA 2FS8A 1F2SE 1ZTKA 1DITH 2CHAC 2GT7A 1IQKA 1W7GH 2AGEX 5TCCA 2FMJA 3MMGA 1SLWB 1YM0A 3SGAE 1P01A 5EOKA 3Q77A 1JRSA 2OC7A 2TGAA 4NIXA 2BVSH 1F0UA 2ANKH 3K2UA 3MH5A 4CRBA 1BHXF 4ZHMU 5FHTA 4VGCC 2AIPA 1MAXA 2ODPA 5DP8A 2EEKA 2BB4A 4JK6A 3RXVA 1EAUA 3E6PH 2TRMA 1TPAE 2FOHA 3RU4T 1O3JA 4NIWA 2GV7A 1SQOA 1ANDA 1C5OH 1GBTA 2DE9A 2A5AA 3FP8E 3AW0A 3VGCB 1BMNH 5C1YA 3DFJA 2Y7XA 1O2JA 2VWOA 3K6YA 1FY5A 2QAAA 1JXPA 1V2RT 3SV8A 2ZC9H 4XBBA 4NWKA 1AVGH 1DUAA 4FU9A 6CHAB 2ZDVH 5HYOA 1O2OA 3A84A 3F9HA 1TGSZ 1SGIB 3ATKA 1AZ8A 1OOKB 1A5IA 2DE8A 3OY5U 1G37A 1TPSA 3GY6A 4CRFA 2Z9KA 3SUDA 3ZZ6A 2AGGX 3M7QA 2ZGCA 4KGAA 3FZDA 4FUHA 4IN1A 3UY9A 1GBDA 3W94A 1C5WB 3GCTF 2F3CE 2GTBA 3A7WA 3MHWU 2A7HA 2Q1JA 1P2OA 1K1IA 2J2UA 2PKSB 1O3FA 5C20A 2W7UA 1FJSA 1RGQA 4JZ1A 5C1UA 1HCGA 1S85A 1O2WA 1O3EA 1SFQB 7GCHG 2SNVA 5ABWA 3P8NA 4HTCH 1PPZA 3SNAA 1GCTC 1YC0A 4GCHF 1UO6A 1O35A 5LGOA 2UWLA 2FIRH 2BDAA 1CHOF 2WV4A 4RSPA 4CRCA 3RXDA 4AGKA 4K69A 1P04A 1CBWC 1HYLA 1D3QB 2GT8A 1DDJA 1C5LH 2GCTB 1YPLH 3MO9A 5DKMA 3UOUA 1FI8A 2GP9B 1J14A 1V2LT 1W14U 3KL6A 3QK1A 1INCA 4WH6A 3T2NA 3LH1A 2QV1A 3M35A 5DP4A 2ZG0H 1TBQH 8GCHF 4OGXA 4Y8YA 2Q6GA 4ZHAA 1C5NH 3Q3YA 3A87A 3NWUA 1CSOE 5HXFA 2A4GA 1C5MD 4WMFA 1DM4B 1MCTA 2VGCC 4NZLA 5EU8A 1W13U 1GGDC 3QN7A 4CRGA 2UWPA 3A7XA 1TONA 1C5PA 5B6OA 1OYQA 3ZVEA 2PW8H 4IBLH 4Y0YE 1C2EA 2O8TA 4INHA 3LU9B 1EASA 1Y3YA 2GZ7A 1SQTA 4X8VH 1O3AA 2P3FH 2PUXB 3RXIA 3U8TH 4Y6DA 2KAIB 1K1OA 1MBMA 1XVOA 4WXIA 1CA0B 2QXGA 3ZV8A 1GHBF 2SNWA 2HPPH 4Q7YA 2GCHG 1DFPA 2J4IA 3K9XB 4CH2B 1KXAA 2Y7ZA 3O8RA 2H1UA 2RA0A 1MQ6A 1C1UH 4BAOB 1O2PA 3ZZ8A
chains in the Genus database with same CATH superfamily
1ZR0A 3PRDA 3PV2A 4JYTA 2Z6BD 2C8YB 1LVOA 3FVFB 1K21H 3MU4A 3GS9A 3UTUH 1HJ8A 1OX1A 1A4WH 2FOMB 1Y3XA 4IC6A 3ODFA 2GX4A 1O2ZA 3U98H 1L4ZA 1WBGB 2D2DA 1O2VA 1V2TT 3K6ZA 5DP9A 1TMUH 3A8DA 1C1SA 2WPMS 1FAKH 2EI7A 2ZDMA 1O3DA 3KN2A 4OS2A 3CS0A 5GCHG 4XBCA 3ATLA 1SQAA 1HXFH 1IOEA 1MTVA 1HAGE 4NA7A 2CJIA 2FWWA 2QXIA 1LHGH 2BY8X 1EB2A 1GI9B 1W10U 3URCA 5L6NH 1LQDB 2PKAA 3SNEA 1AB9B 5EJLA 2ZDKA 4JZDH 3TJUA 5JBTA 1H4WA 1JRTA 1KXEA 4Y79A 4XE4A 2GV6A 1YPHC 1E1RD 2O8LA 2ZCKP 1VCWA 4BAHB 1QZ8A 1ANCA 1GCDA 3SUEA 1VGCC 8ESTE 4K5ZA 1P57B 1BTWA 2ZTYA 1A3EH 1O2HA 1IQFA 1O5BB 4CHAC 2H9TH 1SGCA 1AO5A 4FUFA 4I8JA 4LZ1H 1SGFA 3RMOH 1GDNA 1HJAC 4D7FA 1T7CA 4BANB 1C1QA 1YF4A 2P95A 4U2WA 3SV9A 3G01A 4R0IA 1GHAF 4GHQA 3ZZ3A 1XUJA 3AW1A 1D6RA 5EQRA 3VXFH 2F9UA 4X8TH 2DUCA 1DWCH 1GBKA 3HKJB 4ZKNU 1TOMH 2FOGA 4FUIA 1C2DA 3OSYA 2CXVA 3M5LA 3RXSA 3HKIB 1ZZZA 2ALPA 2BZ6H 3DUXH 5FL7D 2NWNA 1BCUH 1IQGA 4ABAA 1EJNA 2XBXA 3BG4B 4KKDA 1KXBA 4O3TA 4D7GA 2JJ2D 1RTKA 1DX5M 2A0QB 4NFEA 3E3TA 1Y5AT 2OCVB 3M61U 1WYKA 5IYTA 2G4UA 2ZF0H 3OEHD 3LGWA 1XKAC 1W2KH 2ESTE 2F9PA 1JBUH 3TGIE 1C2KA 1LPGB 1S5SA 1SBWA 2G55A 1GCTB 3RDZA 2JETB 1AFQC 2JETC 4NIVA 1H8IH 1O30A 2FLBH 1YPEH 2STBE 2BXUH 3GISB 5E2OA 1YPKH 1J8AA 1TRYA 1GMHF 2BQ7B 3C1KA 1GHVH 2F91A 4K1SA 1QJ1B 1G30B 1MZDA 5F8TA 4I32A 5DG6A 1IQJA 3GCNA 4ASUD 1TQ0B 2ZFSA 3A89A 5I46H 3GY2A 1SOTA 3UREA 5F6MA 1NRSH 1A1RA 1GMDG 1O2IA 3PMAB 1CVWH 1D4PB 1WU1A 3PV4A 1OWHA 4X8SH 1WSSH 1YWUA 4ZKSU 2JDID 5T6FA 5H4IB 2FTMA 2Z94A 1GBIA 3N7DA 1K28D 1AI8H 1TNKA 1NBME 1QR3E 2P8OB 1GMCF 2XC5A 2KCYA 5FBEA 4ABFA 1GBBA 1OXGA 2Y5HA 3VEQB 4QT8C 3FN8A 1GHAG 1F92A 1FV9A 1YPMH 3RU4D 2HVXA 1AQ7A 2GZ9A 2G81E 4B76A 3U8RH 4NIYA 4B2BA 3KCGH 1P09A 3LC3A 3NKKA 1HPGA 4AFUA 4DY7B 3QO6A 4YT7H 2OD3B 2ZIQH 1Z1IA 1C9TA 1AY6H 1C1OA 1OHHD 2R2MB 1YCPK 1ANBA 3E90B 3NK8A 4BAKB 1O3PB 2Y80A 3VB3A 1NO9H 2FI4E 1MQ5A 3UIRA 5C1XA 6CHAC 3MWIU 1QQ4A 1QGFA 1G3EA 1OP2A 1PFXC 5F8ZA 1ZMJA 1LHCH 2BY5X 1EAIA 4ISNA 1QL8A 1TBRH 5C17A 1H8DH 4AX9H 1DY8A 5CDFE 3E1XB 4AN7A 3EE0B 4MTBA 4B73A 2CF9H 2PGQB 5AFZH 1V3XA 3UWIA 3M3TA 2FODA 3GYLB 2R3UA 1BJUA 1GMHG 3ZVAA 2LPRA 1QL7A 5C2ZA 2ZU2A 1W0ZU 3D23A 5HM9A 4X0WU 4CHAB 1PYTC 8LPRA 3T26A 3U28C 2QIQA 1ZPCA 2ZEBA 2A45B 1O2GH 1ELTA 2ASUB 3ITIA 2P3TB 4NSYA 3SQEE 1AFQB 1BIOA 4INKA 4LZ4B 1YCPH 3DFLA 3M37A 1RRKA 2B9LA 2J38A 2ZDNA 4HFPB 2F9BH 3I29A 1ELFA 5K7RA 2SGEE 3A83A 3VG8A 5FCRA 3BN9A 3D65E 1W0YH 1WDIA 1ZSLA 4AG2A 4MPWA 2FO9A 2PTNA 1TX7A 2IOTA 4Y11E 2ODYB 1TPOA 1GI5A 3P92A 1MU8B 3BTME 1T8NA 1BITA 1QBNA 3M5MA 4X1NU 4NA8A 3GY5A 1G3DA 1GI6A 5AVDA 3M5NA 3TVJB 3E91A 1XX9A 2BDIA 1KLTA 3A82A 2A32A 1C9PA 2CMYA 1GDQA 5PTPA 5C3NA 1V2WT 3RP2A 3SHAH 1EUFA 1LTOA 1C5VA 3V13A 1T8OA 1E79D 2FTLE 2QXHA 1FMGA 1HNEE 1O32A 5L30H 4O97A 2NU0E 5ETXA 3Q00A 1YPJH 3TH4H 5K0HA 1Z8IB 3SV7A 4DIIH 4Q2KA 3PM3A 3WY8A 1SFIA 3SNBA 1TNIA 3RC4A 4U01A 5C5OA 1P03A 4WF8A 1FY8E 1TGBA 2J34A 2FZZA 4XOJA 2RA3A 3M7TA 1GHWH 2WPHS 3WW7A 1BUIA 4KELA 2OXSA 3TK5A 1QRWA 1YKTA 3NRLA 4CRDA 3ESTA 1HFDA 2OUAA 1AKSA 1BRAA 4E7NA 3GCOA 3OFND 1Q2WA 3KNXA 5HMAA 1OYTH 1P02A 2QF3A 4B71A 5EPYA 3BV9B 1E36B 4X2YA 2OBOA 2G8TA 2OC1A 1PQ5A 1GGDB 2AFQB 1WUNH 1V2VT 2AYWA 5JBCS 5EXMA 2EC9H 2BVRH 2WYGA 4BOHA 4A92A 5E0HA 3A7TA 1L4DA 1TGNA 1NY22 2BDGA 1GVZA 1SPJA 2GMTC 2GKVE 3VXEH 2CN0H 2YOLA 1VCPA 1AN1E 3UNSA 3HGPA 1TMTH 7GCHF 5JPMH 4YXWD 1NS3A 3MI4A 1ARBA 1G3BA 4JCNA 1P05A 2A2QH 3PB1E 4ZKOU 4SGBE 1WCZA 4OS5A 3CP7A 2P59A 1UVTH 1O34A 1G32B 1TQ7B 2AH4X 3QX5H 2I6QA 1LO6A 2UWOA 3GCHB 1XXDA 2FDAA 2ZTZA 1Y8TA 1C1TA 1DSTA 1EXFA 3UAIC 2BY9X 2ZPRA 5FPYA 2F83A 2FM2A 4YOJA 5B6LA 5EW2H 3GYMA 5KECA 2SGPE 3O8CA 1HIAB 2G5NA 4I33A 3MYWA 3IG6B 3B23B 1UW7A 3ZZ5A 1GI3A 1HJ9A 1MUEB 1MZAA 1AVWA 3FAOA 2FI3E 1P2MA 3BG4C 1UK4A 5FPTA 1M9UA 1O5EH 1BBRK 1A46H 2FI5E 4HG6A 2W6JD 3ELAH 3BTEE 2Z9GA 1GI8B 3T27A 1O3MA 4Q80A 1OPHB 2PFEA 1PPHE 1D9IA 1QBOA 2FEQH 3F9FA 1C4U2 2TPIZ 1VJAU 2BZAA 1BOQA 3ZYDA 1GI4A 2IPQX 5E2PA 1DY9A 2ZCHP 5TCAA 1EJMA 1UVUH 2SGFE 1S6FA 1T31A 3HGNA 1F0SA 1ZLRA 2D8WA 5AF9H 1NESE 3RXFA 2R9PA 1N6YA 3SNCA 1C4V2 1P2JA 1VJ9U 1VITF 4LXBH 4VGCB 1V2MT 2YMSC 2P16A 1UTLM 2GCTC 1NN6A 4GCHG 2H2ZA 1UTKA 1P9SA 5DSFA 1FN8A 1UVSH 1QRXA 1FZZA 1THRH 1V2NT 1NZQH 2ODQA 1EP6A 1ETTH 3VB5A 1BTXA 3TIUA 1A5HA 3I78A 1AUJA 4NSVA 5ESTE 3MNSA 3PLPA 1EATA 2VH6A 1MKWK 2O8WA 4DCDA 1VZQH 3EGKH 2VIWA 5DP3A 1Z8GA 1TIOA 2BLWA 1O2SA 2BDHA 2ZA5A 1HLTH 4GVUA 5L2YH 1GBCA 3GCHC 4X2WA 1T8MA 4A7IB 1N1LA 3SO3A 4YOIA 1LHEH 1GHYH 1MKXH 1WXRA 5A8XA 1SGTA 1FUJA 1Z1JA 1LHFH 2RDEA 3QLPH 1W0JD 4NA9H 3P8OA 2HGTH 4F49A 2H9HA 1DANH 4O9VA 1OSSA 2ZWLH 1P12E 2ANMH 3TGJE 2OC0A 2GVFA 2AMQA 4ZAEA 5A09A 3P17H 1GWAA 3LGVA 1EX3A 1D3PB 1O33A 1ZMNA 2BMGB 1D6WA 3QUMP 4XBDA 1O2QA 3KIDU 2EQNA 4UFFH 1GJBB 2WINI 2P3UB 1GL0E 4JZIA 3GICB 3SJ9A 2R0KA 4ABGA 2IPHA 4RI0A 1Z7KA 2I6SA 1T4VH 1ZRKA 3GY7A 3RXPA 1G2MA 3U69H 4CREA 1RS0A 4UEHH 2ZHDA 4TYDA 3A81A 2XXLA 4FUDA 4Q63A 4H4FA 1GJ7B 2QF0A 1O38A 3E0PB 2H5CA 1ORFA 3TK6A 1WV7H 4ASHA 1MMJN 2AMPA 1FY4A 3MFJA 1C2HA 3TLOA 1AE8H 4TY7A 1C1WH 1NRQH 1P10A 1Q3XA 1O2UA 2JJ1D 2ZGJA 2ZNKH 4X6OA 3GY8A 1O3KA 4GLYA 4F4OC 4A1TA 4RT0A 3GDVA 5GIBA 2OBQA 2BLOA 1YPHE 4UE7H 3MU0A 3R3GB 1TNJA 2VIQA 3RM0H 1BA8B 3B9FH 5LPRA 1C1NA 1QY6A 2W6ID 3MNXA 1C5UA 3M5OA 3BF6H 1C5ZB 1TFXA 2PGBB 4MPXA 1GI1A 2VVCA 1HAZB 2A1DB 2ZZUH 3SU2A 1F0RA 3TJNA 2ZFPH 1HAVA 1TB6H 5EQSA 1QTFA 3P6ZB 3DSPA 5DP6A 1LVMA 3STJA 4U30A 2WPKS 5GPIB 2XNDD 4WY3A 2CGAA 5CHAB 1BMMH 1FDPA 1GBAA 1NFUA 4K60A 4YZUA 3A88A 3PWCA 1J16A 2A4RA 1QNJA 2SGDE 1COWD 1FY3A 3DSOA 2YMSB 1S81A 1FPHH 3ZZAA 1TRNA 4DJZB 1THSH 4JYUH 3ZV9A 2B8OH 3UNRA 4P00A 1ZSKA 1H9HE 2VIVA 1RIWB 1IQNA 1GBFA 3RXJA 3S0NA 4YOGA 2C93B 5A0BA 5BPEA 3P8GA 1DOJA 1S6HA 9ESTA 1TA6A 4Q7ZA 4JZFH 1AWFH 1V6DA 1O37A 1CT4E 4BTUB 1T32A 5DP5A 3HATH 4AORA 3IWMA 1XUGA 1DWEH 1GVKB 1MTSA 4INLA 1FAXA 2P93A 1FLEE 1DLKB 1BMAA 3DD2H 1TNHA 3STIA 4RN6A 4DT4A 2KFWA 1E35B 4IW4E 1UTJA 3BTKE 4ISIH 1IAUA 2OQUA 1W7XH 1D3TB 2BHGA 5GDSH 1KTSB 3AAUA 1O5AB 2VWMA 2KCPA 3RC5A 2FPZA 1N6XA 1SGYE 1P06A 1S0QA 1O3BA 1J17T 1Y3WA 1GBHA 4E7RG 4FUGA 4E06H 2B0FA 1EJAA 2VNTA 1C2MA 1H9LB 2FLRH 1LQEA 1V2UT 2HALA 3M3SA 2C8XB 1XUIA 2ZPQA 5J4SA 1DWDH 1EPTB 1JIRA 3N7OA 5JB8S 3P8FA 3BTWE 2V6NA 2VIOA 2QYIA 3F2HA 4YLUA 3ZZ7A 1K1LA 2AMDA 1LKAA 1PJPA 3RXAA 3TH2H 5GWZA 4K1TA 3TNSA 1SL3A 3A85A 3RMMH 5FCKA 4M7GA 4D9RA 4OS7A 1TA2A 3RXBA 3OTPA 3ZVDA 1CGIE 1HV7A 3FANA 4ZH8A 5A0CA 1K1JA 4AFQA 2WPJS 3T5FH 3ZIAD 4MNYA 3M7UA 2BTCE 4HGCA 4MDSA 2BOKA 5TJXA 3A7VA 1P2IA 3KHVA 4MLFB 1DLEA 1GHBG 3NXPA 2VIDA 2A5IA 4Y7AA 3L6PA 3U8OH 3QDZB 1GJAB 4Z0KA 1ZOMA 4TY6A 3PLBA 3EAJA 1G9IE 4AZ2B 4IC5A 3S9AA 3RXRA 2B7DH 2XNIA 3ATIA 1ZPZA 3UR6A 4UFEH 2IJOB 1SGDE 1GBLA 1EOLA 4UDWH 2C90B 1E0FD 2ZFFH 3LT3A 4CR9A 1QURH 1YCPM 3SOSA 5JDUB 4ZKRU 3W1EA 2QGRA 2PR3A 4JZEH 1T4UH 1KXFA 1ARCA 1HAYB 1EPTA 1GBJA 1UK2A 3KEEA 3LPRA 4MQAA 2JIZD 4ABDA 3RC6A 3I77A 1O5CB 2BYAX 5CHBA 4IN2A 3GY3A 2HRVA 1C1RA 1YBWA 2A4OA 3EA8A 1F5LA 2JH0D 4D76A 4BNRA 1SKYE 1KDQA 3EQ0H 2ZGHA 1SVPA 2R3YA 1A61H 3M36A 4RKOB 3F9GA 3L33A 1CA0C 2ANWA 2GZ8A 1FONA 2OC8A 1C2GA 4TWYA 2GJGA 3MU8A 3BTQE 2LNCA 3PO1B 3SI4H 3UB0A 4XRNA 2XYAA 2WV9A 1JMOH 3PMBB 3JZ2B 3BG8A 1AHTH 3SJ8A 2STAE 3RLWH 4WMEA 1ELCA 4GHTA 3BEIB 3OE7D 3MQKC 4O3UA 1Z6JH 2Z3CA 1PPGE 2YNAA 3SHCH 5SGAE 1HAVB 1MH0A 3BIUH 4YTAA 1DS2E 3OU0A 4CR5A 1O2YA 3SU5A 1P0SH 1JIMA 1BB0B 5DK1A 4JYVH 1PYTD 3F68H 4ZHLU 3RXUA 2Y82A 3TK9A 4FVBA 3OAAD 1QHRB 4SGAE 1ZTLA 3MNCA 4FXGH 1HAXB 4GAWA 3H7TA 1SG8B 1XM1A 2XW9A 1SHHB 2BD8A 4MNVA 1BTPA 1MCVA 5GXPA 4K3JA 1CU1A 1AGJA 2BD4A 3LGTA 1Q31A 1KXDA 4H6TA 4ABJA 1TABE 1B5GH 2HNTC 3QTVH 4X8UH 4D8NA 1Z8JB 3KQEA 2K0QA 2KCOA 1K1NA 3DHKH 3QZRA 2QE7D 4WJG2 2Q6FA 4OM9A 1LCYA 2C4FH 2PLXA 1P3CA 2ILNA 4K8YA 3ZZ9A 3WWBA 1OWKA 1LHDH 1YPGH 2UUKB 1GDUA 2RCEA 2F43B 3T25A 4IGDA 5EW1H 4BTIB 2C3SA 3VB7A 4DURA 2VWNA 2BD7A 7LPRA 1EPTC 3S69A 1W11U 3D49H 2D1JA 1KY9A 1GPZA 4NWLA 4OGYA 1FPCH 1ELVA 4M9FA 1A0HB 1PQ7A 1O3IA 2J9NA 2P94A 2PUQH 4B74A 1ETSH 2BD9A 5EPNA 3TPIZ 1O2KA 1ZGVA 1VITG 4MNXA 1TBZH 4ZXYH 2XOKD 1B7XB 2HLDD 2V3HH 1H9IE 1GJ8B 3P95A 1DICA 1TALA 4ABHA 1ANEA 2WUCA 2C8ZB 4I8GA 5T3HA 1XMNB 2HNTE 3SJIA 3AVZA 5GJ4B 3ENSB 3PTNA 4AB9A 2OTVA 4CBNA 2YNBA 1IHSH 4NG9H 1V2JT 3SJKA 5JYIA 5CHAC 2A7JA 5T6GA 4RT1A 7KMEH 4BAMB 1S6LA 4Y76A 3VFEA 2BD5A 1K1MA 2NU3E 3UOPA 3U9AH 1SSXA 4YESB 1DXWA 2HLCA 3E16B 2G51A 2NU2E 4DT7B 1OWEA 1SGNE 4WWYA 1O36A 2R0LA 2R2WU 2F9VA 2VVVA 1TLDA 1GMCG 1NFYA 4BXSA 2ZI2H 3SV6A 1AE5A 2ZU5A 5E0JA 4X1RU 3K65B 5J4QA 4B6EA 4X1SU 1QBVH 3CS7A 1RTLA 1K0HA 5E0GA 2ZFTA 2D26C 2ZKSA 3PV5A 1EOJA 2KZ4A 2UUYA 4B1TA 2GDEH 2XTTB 3F0PA 2GMTB 4ZMAH 1S82A 2BQWB 4X6NA 5C94A 1YYY1 4KTSA 4XSKU 3MO6A 4NFFA 2A5KA 1AMHA 1ZHPA 1PPCE 4ZUHA 2AIQA 4A6LA 2BY6X 1BTHH 1KTTB 3SZNA 3DSGA 1NBMD 4A5TS 1E37B 1TRMA 3F1SB 3F9EA 1CGHA 1L1NA 1OP0A 2QCYA 4A1XA 5A0AE 5LH8A 1LVYA 1BTYA 4J2YB 1O3CA 3F2FA 2BM2A 1HDTH 2ZPSA 1OWDA 3URDA 1EZQA 5HIYA 5KGOA 4WVPE 5FXLA 2W26A 3M3VA 3KYFA 1WAYB 5AHGH 1A0JA 1RFNA 2FX6A 1LPZB 5GCHF 1ACBE 5A2MH 1HJAB 3BTDE 3RMNH 1WQVH 3UUZA 3SU3A 1V2OT 1ESTA 1C5SA 3P70B 2VIPA 3VGCC 1TNGA 2G5VA 1NRRH 4LK4A 1IQLA 4D9QA 1NU9A 1ELGA 4X1PU 1EP5A 1BRBE 1CBWB 3HK6B 3FZZA 3A8AA 4Z1MD 1EB1H 3FOAA 1L1JA 4FUCA 4JMYA 1CA8B 2TIOA 2WSSD 1P2NA 1SLXB 5DP7A 3GDUA 3RLYH 1NROH 4ACAA 2FX4A 3F3BA 3AASA 3EA7A 3SBKA 3N7EA 1A5GH 3SNDA 4B75A 3OX7U 1GJ6A 1GBEA 4AC9A 4TPYA 3RU4E 1EZXC 2BD3A 2O8UA 5G4BA 1NPMA 1H8ED 2QA9E 1UMAH 2HWLB 2XBYA 1FIWA 1NU7B 1UVPA 2GCHF 2ZFQH 3LC5A 1FQ3A 3HPTB 2FOBA 1K2I1 3SUGA 6GCHG 3ZVCA 1LMWB 2EI8A 3FP6E 3EE7A 2O8MA 4ABIA 4R8TB 2ALVA 2PKAB 1THPB 2EI6A 2FXRA 3BTTE 5EODA 2ZDLA 5HM2A 3V0XA 3A7YA 3T62A 1QJ6B 2G52A 2HNTF 4KTUA 3KQBA 1O2XA 1MTWA 5BRRE 4ABBA 2PHBA 4HZHA 4I8KA 1CO7E 4NCYA 1W0KD 2AHME 2V3OH 2SFAA 1T8LA 3QGNB 4YT6H 1GJ5H 4CRAA 3RXKA 2XBVA 1BMLA 1QA0A 1GVLA 2O9QA 1ELAA 4AYVB 3UQOA 2FOEA 4DW2U 1RD3B 2AERH 1CQQA 3PTBA 1HB0B 2PP6A 3RXTA 4DVAU 1SGFG 2BDYA 1UCYH 1O5DH 3UQVA 1BBRE 2PV9B 4KP0A 3SZEA 1EQ9A 2JKHA 1NFXA 2VWLA 2XWBI 2ZCLP 2A2XH 2FOCA 1ZMLA 4ISHH 3MO3A 4TSFD 1MTUA 2BD2A 1CT0E 2CF8H 1PPBH 1WOFA 3LGIA 1UVOA 3PROA 1FX0B 1O3NA 4Y7BA 5JBAS 2BLQA 1CE5A 1XUFA 5KEDA 2Z3EA 2ZFRH 3T28A 1NC6A 1H1BA 4Y8ZA 1SLUB 4Z6AH 5F8XA 2J95A 3OY6U 3RXLA 1EAXA 1P8VC 4IS5A 1C5YB 1UCYK 3RXGA 2TGPZ 3FFGA 1ELEE 1SMFE 1SLVB 1NFWA 3SV2H 2BOHB 1GJCB 4XDEA 1LDTT 1TAWA 1SHYA 1Y3VA 2QC2A 1TYNA 4FU7A 4GPGA 1J9CH 3SI3H 1UHBA 1MTNC 5JB9S 1HAOH 1S84A 1K22H 4AFZA 3UPEA 2BXTH 3D62A 3KGPA 5F03A 5EXNA 3VB6A 1KMHB 4X1QU 1O5FH 1AB9C 3FKSD 5CMXH 1A0LA 2K8IA 1BRUP 3SU4A 1P3EA 3CENA 1C5XB 1SGQE 2GD4B 3MU5A 3ZVFA 1UTOA 2L6OA 2TGDA 1EZSC 3NPSA 1QIXB 1ZGIA 1C2IA 2XRCA 1L1GA 2KR7A 3BTGE 4Y8XA 2BDCA 4B2CA 1XUHA 1E38B 1NM6A 3PRBA 2A31A 3PYHA 2PTCE 1UCYE 1MD7A 1CHOG 1SGPE 1IQEA 2ZU4A 1F0TA 3MH4A 2VINA 1MABB 3TJVA 1P9UA 4IMZA 1KIGH 2VU8E 5L2ZH 1PPEE 2F9OA 2WPLS 2ZU3A 2J98A 5HGGA 3LDXH 2Z7FE 3EDXB 1AFEH 3RXMA 4O03A 1GHZA 3C27B 2QF5A 4PROA 1XKBC 2H9EH 4YO9A 2XC4A 1NRPH 1AD8H 4CBOA 1DVAH 5DJ7A 3H7OA 4GUXA 1UJ1A 3TH3H 3TU7H 2UUFB 2Y81A 1OS8A 2XBWA 2VB0A 3LGYA 1O2LA 1Y5UT 4E05H 1AU8A 1SGRE 1XXFA 3LKWA 4X2VA 3B8JA 4DG4A 2SGAA 4X2XA 1L0ZA 1NT1A 2Y5FA 3Q3KA 4ABEA 3ZZBA 1J15A 1FXYA 3SGQE 3GDSA 1RJXB 1VGCB 3UFAA 3GY4A 2PSYA 1A7SA 1QB6A 1BQYA 1V2QT 4ESTE 1ESBA 1G36A 4OS4A 1GJ9B 1D3DB 3ZVBA 3H5CB 5FAHA 1E34B 3UNQA 3S9CA 3L3TA 2J92A 1KXCA 2OK5A 1GI7B 1XUKA 4YLQH 5LPEA 2J98B 1KSNA 3LH3A 4Y10E 1BDAA 3PLKA 1ZHMA 1DE7H 1AWHB 1V2PT 1MKXK 5EJZA 3AK5A 2K1QA 2BX4A 2AEIH 2V35A 5T1VA 4DOQA 3H09A 5C0TA 3NZIA 2BY7X 2HOBA 2ZGXH 4DGJA 1GG6C 4I7YH 4WH8A 1KYNA 2Z3DA 4MVNA 1DPOA 3SYJA 1N8OB 1BJVA 1FY1A 1JWTA 3SJOA 1ETRH 1GMDF 5F53A 3MU1A 1ZSJA 5T6DA 1MKWH 2ZDAH 4OS6A 4YM9A 1QFKH 2THFB 3S7KB 1Z71A 1VCQA 2Q6DA 7ESTE 2B5TB 2KAIA 1WQSA 2F9NA 3BSQA 4ZXXH 2HPQH 2OP9A 3RXEA 1O2RA 2TGTA 4ISLA 1P11E 4UFGH 1UK3A 3OYPA 4Y0ZE 1C2LA 1S0RA 2LELA 1QB9A 2FOFA 3QGJA 3BIVH 4U32A 3ZZ4A 3DA9B 1PQ8A 2Z9JA 5HIZA 4A1VA 2QXJA 2WPDD 4FU8A 1C4Y2 1TE0A 4I31A 3FP7E 1YLDA 3TNTA 3GCTG 1BMFD 1UTNA 1F5KU 4AYYB 1TGTA 2QN5T 5JBBS 1BHXB 1L2EA 3Q3XA 1C5QA 1TMBH 3ZYEA 1QRZA 4MG3A 2AS9A 3LONA 1O3GA 5HKKD 3U1IB 1SR5C 5EXLA 1Y5BT 4FUBA 3V7TA 1AVXA 1DWBH 1RIWC 4WXVA 5EG4A 8KME2 3KQCA 2PSXA 3ATMA 2G4TA 1AIXH 1F7ZA 4I8HA 3O8DA 2ZHQH 1HBTH 1FNIA 5C67A 3RXOA 1LVBA 2VGCB 1IHTH 2EY4C 1HXEH 2W3KA 4H42U 4F55A 2HVYB 1ABJH 1CT2E 3ZZCA 2XWAA 1BZXE 3BTHE 4ZROA 5C5NA 4K8BA 3SU0A 2FS9A 1GI2A 2A7CA 4UFDH 2OQ5A 3CNRA 3LGUA 4K2YA 1A3BH 3EA9A 3EYDA 4Q4LA 3NUMA 5A8YA 5IDKA 4K1EA 1OWIA 4UD9H 1O39A 3SUFA 1B0FA 3MH7A 1X7AC 3LJJA 2BLVA 3MH6A 4B6FA 1ZYOA 1W8BH 2RFKC 1WTHD 1DUEA 4JK5A 1JOUB 2H6MA 1LPKB 2OLGA 1NRNH 4Q7XA 1GJDB 3MTYA 3T29A 2XC0A 8GCHG 5I25A 1TX6A 1PPFE 4J1YA 3NCLA 1ELDE 1ELBA 1GG6B 5FPSA 4XFQA 3A8BA 4GSOA 1N8OC 4OS1A 4THNH 2RDLA 2OINA 2KX4A 1MTNB 3O8BA 9LPRA 2Y6TA 2AGIX 2BQ6B 3QWCH 4BXWA 3OEED 2VVUA 1CGJE 1CHGA 3WWFA 1Z8RA 1TOCB 2M2AA 5DO4H 1C1MA 2CV3A 2FESH 1C5TA 1QCPA 2V3MA 1RXPA 1DXPA 2ANYA 2WPIS 3PO1C 2JH6D 3V3MA 1ABIH 2J94A 5A8ZA 4FOUC 3F2GA 1ESAA 4AB8A 2C8WB 1RTFB 1SOZA 6ESTA 1O3HA 1C1PA 1SGEE 4NGAH 3IITA 3S9BA 1UTMA 2IN2A 1O3LA 1GBMA 1UTPA 1O31A 2KCAA 3ZVGA 1S83A 3KQ5A 3AAVA 2XCNA 1W12U 3BEFB 1FIZA 1FN6A 3RMLH 3U1JB 3RXHA 1W3CA 1TWXB 2WV5A 2ZHFH 2KM0A 4AG1A 5EQQA 4WMDA 1QA7A 2W5EA 1ZJDA 4AFSA 2FYRA 2GDDA 1H8HD 1KLIH 3JZ1B 3LOXA 6GCHF 4B2AA 3A7ZA 3Q76A 1TPPA 1HGTH 1G3CA 2ULLA 4RKJB 1KDQB 1ZPBA 2FOAA 5DN6D 2IJD1 3MNBA 1C2JA 4NZQA 4X6MA 1OKXA 1K1PA 4ISOA 2QY0B 1GL1A 1GI0A 3LJOA 2P8OC 2JH5D 1ZTJA 4AGJA 1O2TA 2ZQ2A 4FUEA 1E1QD 5IK2D 1BTUA 5CE1A 4LOYH 1B0EA 1TNLA 2ZECA 5E8EH 2ZHWH 3SU1A 1V2KT 2G00A 4FVDA 1ID5H 1TX8A 4FUJA 1BT7A 2Z9LA 3F6UH 1QJ7B 2GGVB 4H6SB 5ESBA 1IQMA 1YLNA 3RM2H 3SGBE 4KTCA 1A2CH 1HRTH 2WUBA 2PWXA 3ZZDA 5EIYA 5FBIA 3PMHB 4HI3A 1PQAA 2A4QA 4AOQA 1TGCA 1QB1A 2ZGBH 1HAPH 1SQRA 1UTQA 1EZUC 4P02A 1O0DH 3A8CA 1HAIH 2CHAB 1G2LA 2NU1E 1LKBA 2ZU1A 3SQHE 1O3OA 3DT0H 3E8LA 2XCFA 1KLJH 1HUTH 3MOCA 2BDBA 1HIAA 5EGMA 2J97A 3SW2B 2PKSC 1EAWA 1O2MA 4I86A 2ZO3H 3V12A 3S7HB 1VR1H 1C5RA 3SN8A 1K9OE 2BVXH 1HAHH 2ZP0H 3TJOA 1BBRH 2WYJA 1U6QA 5DPAA 1QL9A 2NU4E 3BEUA 3DCLA 2W3IA 1GJ4H 3RXQA 2VH0A 4BAQB 2Z9IA 4FETA 1O5GH 1OP8A 3UR9A 2L74A 4Y71A 1BTZA 3SORA 2RG3A 1C2FA 4UONA 1IQIA 3KF2A 4X6PA 1C1VH 4MPVA 3UWJH 2M5TA 5FX6A 5LPFA 4IMQA 3KQDA 1DT2A 1BRCE 1F5RA 1ZJKA 3PWBA 1SI5H 4TWWA 2V0BA 3R0FA 2TBSA 1WTGH 5AFYH 2UUJB 4I8LA 2W7SA 2ZHEH 3E0NB 3A86A 3QTOH 4BTTB 2EA3A 1YP9A 1SC8U 3BTFE 3RXCA 1AUTC 1IQHA 1XVMA 2ZQ1A 3VB4A 5DGJA 1AZZA 1QQUA 1UHBB 1YY3A 2VJ1A 3FO8D 2FYQA 4MNWA 2SGQE 1NTPA 3VPKA 1Y3UA 4CH8B 4TT3D 1VKYA 3GOVB 1AKSB 2BX3A 5FX5A 3A80A 1P2QA 1O2NA 1ZHRA 2Y5GA 1MAYA 3OTJE 2H5DA 2VBCA 1V2ST 3HK3B 3QZQA 1SB1H 2FP7B 5EJ1A 1YLCA 4TPIZ 1VITH 3RUOA 3TITA 1YGCH 1Z6EA 1OWJA 3LIWA 1DSUA 3SU6A 4MPUA 1Y59T 3PMJA 4DIHH 3W95A 1GHXH 1MU6B 2ZTXA 3ATWA 1MBQA 3TGKE 1MD8A 6LPRA 1ZRBA 1EKBB 3ODDA 1P2KA 4F48B 2CK3D 1F2SE 2FS8A 1ZTKA 1DITH 2CHAC 2GT7A 1IQKA 1W7GH 2AGEX 5TCCA 2FMJA 3MMGA 1SLWB 4ACBA 1YM0A 3SGAE 1P01A 5EOKA 3Q77A 1JRSA 2OC7A 2TGAA 4NIXA 2BVSH 2F4LA 1F0UA 2ANKH 3K2UA 3MH5A 4CRBA 1BHXF 4ZHMU 5FHTA 4VGCC 2AIPA 1MAXA 2ODPA 5DP8A 2EEKA 2BB4A 4JK6A 3RXVA 1EAUA 3E6PH 2TRMA 1TPAE 2FOHA 3RU4T 1O3JA 4NIWA 2WHXA 2GV7A 1SQOA 2J5UA 1ANDA 3F0OA 1C5OH 1GBTA 2DE9A 2A5AA 3FP8E 3KYGA 3AW0A 3VGCB 1BMNH 5C1YA 3DFJA 2Y7XA 1O2JA 2VWOA 3K6YA 1FY5A 2QAAA 1JXPA 1V2RT 3SV8A 2ZC9H 4XBBA 4NWKA 1AVGH 1DUAA 2V7QD 4FU9A 6CHAB 2LP6A 2ZDVH 5HYOA 1O2OA 3A84A 3F9HA 1TGSZ 1SGIB 3ATKA 1AZ8A 1OOKB 1A5IA 2DE8A 3OY5U 1G37A 1TPSA 3GY6A 4CRFA 2Z9KA 3SUDA 3ZZ6A 2AGGX 3M7QA 2ZGCA 4KGAA 5GNDA 3FZDA 4FUHA 4IN1A 3UY9A 1GBDA 3W94A 1C5WB 3GCTF 2F3CE 2GTBA 3A7WA 3MHWU 2A7HA 2QF4A 2Q1JA 1P2OA 1K1IA 2J2UA 2PKSB 1O3FA 5C20A 2W7UA 1FJSA 1RGQA 4JZ1A 5C1UA 1HCGA 1S85A 1O2WA 1O3EA 1SFQB 7GCHG 2SNVA 2WZQA 5ABWA 1EFRD 3P8NA 4HTCH 1PPZA 4XD7D 3SNAA 1GCTC 1YC0A 4ZCNA 4GCHF 1UO6A 1O35A 5LGOA 2YMSD 2UWLA 2FIRH 2BDAA 1CHOF 2WV4A 4RSPA 4CRCA 3RXDA 4AGKA 4K69A 1P04A 1CBWC 1HYLA 1D3QB 2GT8A 1DDJA 1C5LH 2GCTB 1YPLH 3MO9A 5DKMA 3UOUA 1FI8A 2GP9B 1J14A 1V2LT 1W14U 3KL6A 3QK1A 1INCA 4WH6A 3T2NA 3LH1A 2QV1A 3M35A 5DP4A 2ZG0H 1TBQH 8GCHF 4OGXA 4Y8YA 2Q6GA 4ZHAA 1C5NH 3Q3YA 3A87A 3N99A 3NWUA 1CSOE 5HXFA 2A4GA 1C5MD 4WMFA 1DM4B 1MCTA 2VGCC 4NZLA 5EU8A 1W13U 1GGDC 3QN7A 4CRGA 2UWPA 3A7XA 1TONA 1C5PA 5B6OA 1OYQA 3ZVEA 2PW8H 4IBLH 4Y0YE 1C2EA 2O8TA 4INHA 3LU9B 1EASA 1Y3YA 2GZ7A 1SQTA 4X8VH 1O3AA 2P3FH 2PUXB 3RXIA 3U8TH 5C0UA 4Y6DA 2KAIB 1K1OA 1MBMA 1XVOA 4WXIA 1CA0B 2QXGA 3ZV8A 1GHBF 2SNWA 2HPPH 4Q7YA 2GCHG 1DFPA 2J4IA 3K9XB 4CH2B 1KXAA 2Y7ZA 3O8RA 2H1UA 2RA0A 1MQ6A 1C1UH 4BAOB 1O2PA 3ZZ8A
chains in the Genus database with same CATH topology
1ZR0A 4JYTA 2Z6BD 2C8YB 1LVOA 3FVFB 1K21H 3MU4A 3UTUH 1HJ8A 1OX1A 1A4WH 2FOMB 1Y3XA 4IC6A 3ODFA 2GX4A 1O2ZA 3U98H 1L4ZA 1WBGB 2D2DA 1O2VA 1V2TT 3K6ZA 5DP9A 1TMUH 3A8DA 1C1SA 2WPMS 1FAKH 2EI7A 2ZDMA 1O3DA 3KN2A 4OS2A 3CS0A 5GCHG 4XBCA 3ATLA 1SQAA 1HXFH 1IOEA 1MTVA 1HAGE 4NA7A 2CJIA 2FWWA 2QXIA 1LHGH 2BY8X 1EB2A 1GI9B 1W10U 3URCA 5L6NH 1LQDB 2PKAA 3SNEA 1AB9B 2ZDKA 4JZDH 3TJUA 5JBTA 1H4WA 1JRTA 1KXEA 4Y79A 4XE4A 2GV6A 1YPHC 2O8LA 2ZCKP 1VCWA 4BAHB 1ANCA 1GCDA 3SUEA 1VGCC 8ESTE 4K5ZA 1P57B 1BTWA 2ZTYA 1A3EH 1O2HA 1IQFA 1O5BB 4CHAC 2H9TH 1SGCA 1AO5A 4FUFA 4I8JA 4LZ1H 1SGFA 3RMOH 1GDNA 1HJAC 4D7FA 1T7CA 4BANB 1C1QA 1YF4A 2P95A 4U2WA 3SV9A 3G01A 4R0IA 1GHAF 4GHQA 3ZZ3A 1XUJA 3AW1A 1D6RA 5EQRA 3VXFH 2F9UA 4X8TH 2DUCA 1DWCH 1GBKA 3HKJB 4ZKNU 1TOMH 2FOGA 4FUIA 1C2DA 3OSYA 2CXVA 3M5LA 3RXSA 3HKIB 1ZZZA 2ALPA 2BZ6H 3DUXH 2NWNA 1BCUH 1IQGA 4ABAA 1EJNA 2XBXA 3BG4B 4KKDA 1KXBA 4O3TA 4D7GA 1RTKA 1DX5M 2A0QB 4NFEA 3E3TA 1Y5AT 2OCVB 3M61U 1WYKA 5IYTA 2G4UA 2ZF0H 3LGWA 1XKAC 1W2KH 2ESTE 2F9PA 1JBUH 3TGIE 1C2KA 1LPGB 1S5SA 1SBWA 2G55A 1GCTB 3RDZA 2JETB 1AFQC 2JETC 4NIVA 1H8IH 1O30A 2FLBH 1YPEH 2STBE 2BXUH 3GISB 5E2OA 1YPKH 1J8AA 1TRYA 1GMHF 2BQ7B 3C1KA 1GHVH 2F91A 4K1SA 1QJ1B 1G30B 1MZDA 5F8TA 4I32A 5DG6A 1IQJA 3GCNA 1TQ0B 2ZFSA 3A89A 5I46H 3GY2A 1SOTA 3UREA 5F6MA 1NRSH 1A1RA 1GMDG 1O2IA 3PMAB 1CVWH 1D4PB 1WU1A 3PV4A 1OWHA 4X8SH 1WSSH 4ZKSU 5T6FA 5H4IB 2FTMA 2Z94A 1GBIA 1K28D 1AI8H 1TNKA 1QR3E 2P8OB 1GMCF 2XC5A 5FBEA 4ABFA 1GBBA 1OXGA 2Y5HA 3VEQB 4QT8C 1GHAG 1F92A 1FV9A 1YPMH 3RU4D 2HVXA 1AQ7A 2GZ9A 2G81E 4B76A 3U8RH 4NIYA 4B2BA 3KCGH 1P09A 3LC3A 3NKKA 1HPGA 4AFUA 4DY7B 3QO6A 4YT7H 2OD3B 2ZIQH 1Z1IA 1C9TA 1AY6H 1C1OA 2R2MB 1YCPK 1ANBA 3E90B 3NK8A 4BAKB 1O3PB 2Y80A 3VB3A 1NO9H 2FI4E 1MQ5A 3UIRA 5C1XA 6CHAC 3MWIU 1QQ4A 1QGFA 1G3EA 1OP2A 1PFXC 5F8ZA 1ZMJA 1LHCH 2BY5X 1EAIA 4ISNA 1QL8A 1TBRH 1H8DH 4AX9H 1DY8A 3E1XB 4AN7A 3EE0B 4MTBA 4B73A 2CF9H 2PGQB 5AFZH 1V3XA 3UWIA 3M3TA 2FODA 3GYLB 2R3UA 1BJUA 1GMHG 3ZVAA 2LPRA 1QL7A 5C2ZA 2ZU2A 1W0ZU 3D23A 5HM9A 4X0WU 4CHAB 1PYTC 8LPRA 3T26A 2QIQA 1ZPCA 2ZEBA 2A45B 1O2GH 1ELTA 2ASUB 3ITIA 2P3TB 4NSYA 3SQEE 1AFQB 1BIOA 4INKA 4LZ4B 1YCPH 3DFLA 3M37A 1RRKA 2B9LA 2J38A 2ZDNA 4HFPB 2F9BH 3I29A 1ELFA 5K7RA 2SGEE 3A83A 5FCRA 3BN9A 3D65E 1W0YH 1ZSLA 4AG2A 4MPWA 2FO9A 2PTNA 1TX7A 2IOTA 4Y11E 2ODYB 1TPOA 1GI5A 3P92A 1MU8B 3BTME 1T8NA 1BITA 1QBNA 3M5MA 4X1NU 4NA8A 3GY5A 1G3DA 1GI6A 5AVDA 3M5NA 3TVJB 3E91A 1XX9A 2BDIA 1KLTA 3A82A 2A32A 1C9PA 2CMYA 1GDQA 5PTPA 5C3NA 1V2WT 3RP2A 3SHAH 1EUFA 1LTOA 1C5VA 3V13A 1T8OA 2FTLE 2QXHA 1FMGA 1HNEE 1O32A 5L30H 4O97A 2NU0E 5ETXA 3Q00A 1YPJH 3TH4H 5K0HA 1Z8IB 3SV7A 4DIIH 4Q2KA 3PM3A 3WY8A 1SFIA 3SNBA 1TNIA 3RC4A 4U01A 5C5OA 1P03A 4WF8A 1FY8E 1TGBA 2J34A 2FZZA 4XOJA 2RA3A 3M7TA 1GHWH 2WPHS 1BUIA 4KELA 2OXSA 3TK5A 1QRWA 1YKTA 4CRDA 3ESTA 1HFDA 2OUAA 1AKSA 1BRAA 4E7NA 3GCOA 1Q2WA 3KNXA 5HMAA 1OYTH 1P02A 2QF3A 4B71A 5EPYA 3BV9B 1E36B 4X2YA 2OBOA 2G8TA 2OC1A 1PQ5A 1GGDB 2AFQB 1WUNH 1V2VT 2AYWA 5JBCS 5EXMA 2EC9H 2BVRH 2WYGA 4BOHA 4A92A 5E0HA 3A7TA 1L4DA 1TGNA 1NY22 2BDGA 1GVZA 1SPJA 2GMTC 2GKVE 3VXEH 2CN0H 2YOLA 1VCPA 1AN1E 3UNSA 3HGPA 1TMTH 7GCHF 5JPMH 1NS3A 3MI4A 1ARBA 1G3BA 4JCNA 1P05A 2A2QH 3PB1E 4ZKOU 4SGBE 1WCZA 4OS5A 3CP7A 2P59A 1UVTH 1O34A 1G32B 1TQ7B 2AH4X 3QX5H 2I6QA 1LO6A 2UWOA 3GCHB 1XXDA 2FDAA 2ZTZA 1Y8TA 1C1TA 1DSTA 1EXFA 2BY9X 2ZPRA 5FPYA 2F83A 2FM2A 4YOJA 5EW2H 3GYMA 2SGPE 3O8CA 1HIAB 2G5NA 4I33A 3MYWA 3IG6B 3B23B 3ZZ5A 1GI3A 1HJ9A 1MUEB 1MZAA 1AVWA 3FAOA 2FI3E 1P2MA 3BG4C 1UK4A 5FPTA 1M9UA 1O5EH 1BBRK 1A46H 2FI5E 3ELAH 3BTEE 2Z9GA 1GI8B 3T27A 1O3MA 4Q80A 1OPHB 2PFEA 1PPHE 1D9IA 1QBOA 2FEQH 3F9FA 1C4U2 2TPIZ 1VJAU 2BZAA 1BOQA 3ZYDA 1GI4A 5E2PA 1DY9A 2ZCHP 5TCAA 1EJMA 1UVUH 2SGFE 1S6FA 1T31A 3HGNA 1F0SA 1ZLRA 2D8WA 5AF9H 1NESE 3RXFA 2R9PA 1N6YA 3SNCA 1C4V2 1P2JA 1VJ9U 1VITF 4LXBH 4VGCB 1V2MT 2P16A 1UTLM 2GCTC 1NN6A 4GCHG 2H2ZA 1UTKA 1P9SA 1FN8A 1UVSH 1QRXA 1FZZA 1THRH 1V2NT 1NZQH 2ODQA 1EP6A 1ETTH 3VB5A 1BTXA 3TIUA 1A5HA 3I78A 1AUJA 4NSVA 5ESTE 3MNSA 3PLPA 1EATA 2VH6A 1MKWK 2O8WA 4DCDA 1VZQH 3EGKH 2VIWA 5DP3A 1Z8GA 1TIOA 2BLWA 1O2SA 2BDHA 2ZA5A 1HLTH 4GVUA 5L2YH 1GBCA 3GCHC 4X2WA 1T8MA 4A7IB 1N1LA 3SO3A 4YOIA 1LHEH 1GHYH 1MKXH 5A8XA 1SGTA 1FUJA 1Z1JA 1LHFH 3QLPH 4NA9H 3P8OA 2HGTH 4F49A 2H9HA 1DANH 4O9VA 1OSSA 2ZWLH 1P12E 2ANMH 3TGJE 2OC0A 2GVFA 2AMQA 4ZAEA 5A09A 3P17H 1GWAA 3LGVA 1EX3A 1D3PB 1O33A 1ZMNA 2BMGB 1D6WA 3QUMP 4XBDA 1O2QA 3KIDU 4UFFH 1GJBB 2WINI 2P3UB 1GL0E 4JZIA 3GICB 3SJ9A 2R0KA 4ABGA 2IPHA 1Z7KA 2I6SA 1T4VH 1ZRKA 3GY7A 3RXPA 1G2MA 3U69H 4CREA 1RS0A 4UEHH 2ZHDA 4TYDA 3A81A 2XXLA 4FUDA 4H4FA 1GJ7B 2QF0A 1O38A 3E0PB 2H5CA 1ORFA 3TK6A 1WV7H 4ASHA 1MMJN 2AMPA 1FY4A 3MFJA 1C2HA 3TLOA 1AE8H 4TY7A 1C1WH 1NRQH 1P10A 1Q3XA 1O2UA 2ZGJA 2ZNKH 4X6OA 3GY8A 1O3KA 4GLYA 4F4OC 4A1TA 3GDVA 5GIBA 2OBQA 2BLOA 1YPHE 4UE7H 3MU0A 3R3GB 1TNJA 2VIQA 3RM0H 1BA8B 3B9FH 5LPRA 1C1NA 1QY6A 3MNXA 1C5UA 3M5OA 3BF6H 1C5ZB 1TFXA 2PGBB 4MPXA 1GI1A 2VVCA 1HAZB 2A1DB 2ZZUH 3SU2A 1F0RA 3TJNA 2ZFPH 1HAVA 1TB6H 5EQSA 1QTFA 3P6ZB 5DP6A 1LVMA 3STJA 4U30A 2WPKS 5GPIB 4WY3A 2CGAA 5CHAB 1BMMH 1FDPA 1GBAA 1NFUA 4K60A 4YZUA 3A88A 3PWCA 1J16A 2A4RA 1QNJA 2SGDE 1FY3A 1S81A 1FPHH 3ZZAA 1TRNA 4DJZB 1THSH 4JYUH 3ZV9A 2B8OH 3UNRA 1ZSKA 1H9HE 2VIVA 1RIWB 1IQNA 1GBFA 3RXJA 3S0NA 4YOGA 2C93B 5A0BA 5BPEA 3P8GA 1DOJA 1S6HA 9ESTA 1TA6A 4Q7ZA 4JZFH 1AWFH 1V6DA 1O37A 1CT4E 4BTUB 1T32A 5DP5A 3HATH 4AORA 3IWMA 1XUGA 1DWEH 1GVKB 1MTSA 4INLA 1FAXA 2P93A 1FLEE 1DLKB 1BMAA 3DD2H 1TNHA 3STIA 4RN6A 1E35B 4IW4E 1UTJA 3BTKE 4ISIH 1IAUA 2OQUA 1W7XH 1D3TB 2BHGA 5GDSH 1KTSB 3AAUA 1O5AB 2VWMA 3RC5A 2FPZA 1N6XA 1SGYE 1P06A 1S0QA 1O3BA 1J17T 1Y3WA 1GBHA 4E7RG 4FUGA 4E06H 2B0FA 1EJAA 2VNTA 1C2MA 1H9LB 2FLRH 1LQEA 1V2UT 2HALA 3M3SA 2C8XB 1XUIA 2ZPQA 5J4SA 1DWDH 1EPTB 1JIRA 3N7OA 5JB8S 3P8FA 3BTWE 2V6NA 2VIOA 2QYIA 4YLUA 3ZZ7A 1K1LA 2AMDA 1LKAA 1PJPA 3RXAA 3TH2H 5GWZA 4K1TA 3TNSA 1SL3A 3A85A 3RMMH 5FCKA 4M7GA 4D9RA 4OS7A 1TA2A 3RXBA 3ZVDA 1CGIE 1HV7A 3FANA 4ZH8A 5A0CA 1K1JA 4AFQA 2WPJS 3T5FH 4MNYA 3M7UA 2BTCE 4HGCA 4MDSA 2BOKA 5TJXA 3A7VA 1P2IA 3KHVA 4MLFB 1DLEA 1GHBG 3NXPA 2VIDA 2A5IA 4Y7AA 3L6PA 3U8OH 3QDZB 1GJAB 4Z0KA 1ZOMA 4TY6A 3PLBA 3EAJA 1G9IE 4AZ2B 4IC5A 3S9AA 3RXRA 2B7DH 2XNIA 3ATIA 1ZPZA 3UR6A 4UFEH 2IJOB 1SGDE 1GBLA 1EOLA 4UDWH 2C90B 1E0FD 2ZFFH 3LT3A 4CR9A 1QURH 1YCPM 3SOSA 5JDUB 4ZKRU 2QGRA 2PR3A 4JZEH 1T4UH 1KXFA 1ARCA 1HAYB 1EPTA 1GBJA 1UK2A 3KEEA 3LPRA 4MQAA 4ABDA 3RC6A 3I77A 1O5CB 2BYAX 4IN2A 3GY3A 2HRVA 1C1RA 1YBWA 2A4OA 3EA8A 1F5LA 2JH0D 4D76A 4BNRA 1KDQA 3EQ0H 2ZGHA 1SVPA 2R3YA 1A61H 3M36A 4RKOB 3F9GA 3L33A 1CA0C 2ANWA 2GZ8A 1FONA 2OC8A 1C2GA 4TWYA 3MU8A 3BTQE 2LNCA 3PO1B 3SI4H 2XYAA 1JMOH 3PMBB 3JZ2B 3BG8A 1AHTH 3SJ8A 2STAE 3RLWH 4WMEA 1ELCA 4GHTA 3BEIB 4O3UA 1Z6JH 2Z3CA 1PPGE 2YNAA 3SHCH 5SGAE 1HAVB 1MH0A 3BIUH 4YTAA 1DS2E 3OU0A 4CR5A 1O2YA 3SU5A 1P0SH 1JIMA 1BB0B 5DK1A 4JYVH 1PYTD 3F68H 4ZHLU 3RXUA 2Y82A 3TK9A 4FVBA 1QHRB 4SGAE 1ZTLA 3MNCA 4FXGH 1HAXB 4GAWA 3H7TA 1SG8B 1XM1A 2XW9A 1SHHB 2BD8A 4MNVA 1BTPA 1MCVA 5GXPA 4K3JA 1CU1A 1AGJA 2BD4A 3LGTA 1Q31A 1KXDA 4H6TA 4ABJA 1TABE 1B5GH 2HNTC 3QTVH 4X8UH 4D8NA 1Z8JB 3KQEA 3QZRA 1K1NA 3DHKH 4WJG2 2Q6FA 1LCYA 2C4FH 2PLXA 1P3CA 2ILNA 4K8YA 3ZZ9A 1OWKA 1LHDH 1YPGH 1GDUA 2RCEA 2UUKB 3T25A 4IGDA 5EW1H 4BTIB 2C3SA 3VB7A 4DURA 2VWNA 2BD7A 7LPRA 1EPTC 3S69A 1W11U 3D49H 2D1JA 1KY9A 1GPZA 4NWLA 4OGYA 1FPCH 1ELVA 1A0HB 1PQ7A 1O3IA 2J9NA 2P94A 2PUQH 4B74A 1ETSH 2BD9A 5EPNA 3TPIZ 1O2KA 1ZGVA 1VITG 4MNXA 1TBZH 4ZXYH 1B7XB 2V3HH 1H9IE 1GJ8B 3P95A 1DICA 1TALA 4ABHA 1ANEA 2WUCA 2C8ZB 4I8GA 5T3HA 1XMNB 2HNTE 3SJIA 3AVZA 5GJ4B 3ENSB 3PTNA 4AB9A 2OTVA 4CBNA 2YNBA 1IHSH 4NG9H 1V2JT 3SJKA 5JYIA 5CHAC 2A7JA 5T6GA 7KMEH 4BAMB 4Y76A 3VFEA 2BD5A 1K1MA 2NU3E 3UOPA 3U9AH 1SSXA 4YESB 1DXWA 2HLCA 3E16B 2G51A 2NU2E 4DT7B 1OWEA 1SGNE 4WWYA 1O36A