2FOAA

Structure of porcine pancreatic elastase in 40/50/10 % benzene
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foaA01
1NFYA 3TU7H 3SQHE 2Q6DA 3A8AA 4MNWA 2BDIA 3D62A 2AERH 1DDJA 1SL3A 3QTVH 1UCYK 1JIMA 4TWWA 3A7WA 4HTCH 1C1MA 4DY7B 1G36A 3MNSA 2SGPE 1B5GH 4R8TB 4FU8A 2ESTE 3E6PH 2HVXA 1HAHH 2IJOB 1ELTA 1O3FA 3OSYA 1OYQA 3LGWA 1RIWB 3RMNH 5EG4A 4I33A 1O5EH 3RXHA 1NM6A 4NA8A 4DVAU 1PYTD 1PPGE 1TOMH 1F7ZA 1Y3YA 2ZTYA 4NIWA 4MQAA 3D49H 2QF0A 2OC8A 2BMGB 2WPHS 1OKXA 1ELDE 5A8YA 1AB9C 1S6HA 1T31A 3V13A 1DM4B 1GMDG 4OS5A 1RD3B 2OQ5A 1QB1A 1GGDB 2BDCA 2Y7XA 1Z71A 2SFAA 2UUYA 1G2MA 2BQWB 1ZMLA 1V2JT 3A89A 2PWXA 1OS8A 1CGJE 1TLDA 1JBUH 3SU0A 2O8WA 2JH0D 1P2IA 2Y7ZA 3MH7A 1FZZA 1INCA 1AU8A 2A1DB 1IHSH 1IQKA 1AD8H 1O2KA 1XUHA 3LONA 1P57B 3BTQE 2R3UA 2ZTXA 1BRUP 4K1TA 3U69H 1V2PT 1AN1E 1GJBB 2HNTE 2ZWLH 3HKIB 1MU6B 2R9PA 1AO5A 1THRH 3SORA 1PPBH 5J4QA 1P09A 1VJ9U 5EOKA 4ABJA 1ZSJA 2ZDVH 1HIAA 5B6OA 1KTSB 1TX7A 2R3YA 1WQVH 3OY6U 4A92A 3V3MA 3ENSB 5GXPA 1GJ8B 6GCHF 2FM2A 3SOSA 5GCHF 2WYGA 4J1YA 2BY7X 3TK9A 4CBOA 2Z9LA 3SI3H 1GBDA 1V2UT 2R2MB 4RKJB 2GZ8A 1FPHH 1IQNA 1LVYA 3RXMA 1C1RA 1E36B 1FONA 1O2YA 1TA2A 1TRMA 1WQSA 2VH0A 1O3PB 3M5NA 1ANDA 2BY5X 1DANH 1NROH 4GLYA 1O33A 1UHBA 2B9LA 5GWZA 2CHAB 4MG3A 1O5GH 3DFLA 1Z8RA 1YGCH 1T8NA 1WTHD 1O3GA 4ZKRU 1WV7H 1EJNA 1PPFE 1T32A 2H6MA 2QC2A 3ZVCA 4X2VA 3RXTA 1OPHB 3QO6A 1SHYA 1W13U 3U1IB 4VGCB 5LPEA 1GG6C 5JYIA 2LPRA 4LK4A 4K60A 3MO9A 1IQFA 3MU0A 3QZQA 3BEUA 1U6QA 2QGRA 1H1BA 2B5TB 3Q76A 4U2WA 4UFGH 2DE9A 4BAHB 1O5AB 2ZNKH 4K8BA 3AW1A 3LGYA 1DWBH 4XOJA 2P8OB 3BTTE 3NCLA 2BQ6B 2QXIA 3KEEA 6GCHG 1QGFA 4ZHMU 4DIIH 1AHTH 1CA8B 5GCHG 3A8CA 2BDAA 5DP9A 5DP5A 1GHZA 3GDSA 2FDAA 3VPKA 3TGKE 2ALPA 2BLVA 5FCKA 4WY3A 1NRQH 1NO9H 4BANB 3MI4A 3BF6H 3S7HB 2B7DH 2W26A 3U1JB 1V2WT 1TQ7B 1PQ8A 1J14A 3EYDA 1THSH 1OWKA 4BTIB 1YPEH 2G5VA 2VJ1A 2ZKSA 3F1SB 4F4OC 3HGPA 3M3SA 7ESTE 5FCRA 5CHAB 2ZHEH 5F8XA 3GY6A 2ZU5A 1CT4E 1WSSH 1VCWA 2A32A 3LGIA 3B9FH 2FESH 5K0HA 2QA9E 3FZZA 1QURH 3I78A 1QJ6B 1BCUH 1GCTC 1BB0B 1G3CA 2GV6A 1JWTA 5DJ7A 2PKSC 3RLYH 2RDLA 1UTJA 2P3TB 4K8YA 1N1LA 3V12A 1JXPA 3SHAH 1O30A 1DVAH 4K5ZA 3ZZAA 1SB1H 4KTSA 2WPLS 1TGBA 3TJNA 1ZOMA 4ABEA 1YPLH 4ABIA 1A0HB 2ZCKP 1O3LA 4K1EA 2VVUA 5HYOA 2JETB 4Y0ZE 3BTDE 1C1PA 1UVTH 5DO4H 5JBBS 1QRZA 3TNTA 1EZSC 3LOXA 3RLWH 1C4V2 1C4Y2 5FX6A 1Z8JB 1UVUH 3LDXH 1HJAC 1YPGH 5A09A 2J4IA 3E0PB 3ATLA 1O3OA 2XYAA 2CN0H 3BEFB 3A7XA 2C93B 5BPEA 3NXPA 1DFPA 3LGUA 1YCPK 5DK1A 1QJ7B 1WAYB 4AB8A 3FP7E 1H9HE 5GIBA 3SV8A 1QQUA 1EKBB 5DP3A 3VGCB 2P59A 2VVCA 1K1LA 2BDGA 1NFXA 3RMOH 1DWCH 1O5FH 1HAVB 1SLWB 4AZ2B 1Z8GA 1Y3VA 3CS0A 4ZHAA 1P3CA 1QL8A 1ZHRA 3ZVGA 3ATIA 1EB1H 3KIDU 4ISHH 1O2QA 3E16B 3FVFB 2AYWA 1PFXC 1DOJA 2J2UA 1NFUA 5C1XA 4E05H 2C90B 2FYRA 2GT8A 5C20A 3GDVA 1FMGA 5HM2A 1KLIH 4JK6A 5EW1H 2GD4B 1P11E 3T28A 1D6RA 3Q3KA 1G32B 1XXDA 2PGQB 1V6DA 3A86A 3GCOA 3KNXA 1P04A 1W8BH 1UTOA 1Y3UA 2VIVA 4KKDA 4FXGH 3ZZ3A 2ZCHP 3E1XB 1C1QA 1HFDA 1C2LA 2GGVB 4SGAE 1MTSA 4FUEA 4CBNA 1QRXA 1OSSA 2BHGA 1HAGE 2B0FA 3PO1B 3SN8A 2BDHA 2ANWA 1EUFA 4QT8C 5HMAA 3RC4A 6CHAB 1F92A 1SLXB 4IN2A 3PV4A 4WF8A 4YT7H 3ATMA 3DT0H 4IC6A 1EJAA 1ZPCA 3ZVEA 1UHBB 5EQRA 1KDQA 3ZVFA 2XNIA 1J15A 3BIUH 1HBTH 3RU4E 3M5OA 1ESTA 5C5NA 1ARCA 1E35B 1O2XA 1YP9A 3SW2B 2R0KA 1MH0A 4BAKB 1GJ6A 2PSYA 2J38A 1P03A 2F9VA 2FLBH 3ZV9A 4JZEH 1MTWA 1KIGH 1ETTH 1MUEB 4A5TS 4JZ1A 2A5AA 1GJAB 1LVMA 2ZFRH 1SGIB 4NSVA 1D4PB 1TMBH 4ZXXH 4CHAB 3AAVA 1GBIA 2STBE 3RC6A 1FLEE 1E37B 2CMYA 3SV7A 1GL0E 3RMMH 1GBTA 4JK5A 1TALA 1V2VT 1BJVA 8GCHF 3SJKA 3MH6A 1IAUA 1UTMA 4I8GA 1EAIA 4Z6AH 4KGAA 2FXRA 2WV5A 1XXFA 2NU0E 1TX6A 1C5OH 4INKA 4X8TH 1LVOA 1PPZA 1S0QA 4UFFH 3UQVA 1SLVB 2P16A 2EA3A 3U8OH 2A0QB 1TGTA 1O3JA 3K65B 5F6MA 1HJ9A 3BTME 1TGCA 3UTUH 1BZXE 4RKOB 2H9TH 1C2MA 3HK3B 3IITA 3HKJB 4X1SU 1KXEA 4AGKA 2H5CA 3S7KB 1UK2A 1UTQA 2RG3A 4H42U 3SU3A 3VB3A 2FIRH 3EA8A 3SNCA 2NU4E 1C2FA 1TBQH 1TMUH 3BG4B 3SI4H 2G52A 1NRNH 3M5MA 1S5SA 1Y3XA 1TMTH 1T4VH 4FVDA 1G9IE 2GDEH 1OP2A 3RXVA 2ZPSA 2VH6A 2XC0A 3UNSA 7KMEH 3VB6A 2HWLB 4JZFH 1ZPZA 2ZCLP 3NK8A 1ARBA 1Y5BT 1YYY1 8GCHG 1P01A 3E91A 3Q77A 4NGAH 2ZFPH 2G4UA 2ZPQA 3M3TA 2BX3A 4INLA 4WMFA 2ZHFH 1VGCC 3STIA 1UCYH 1QB6A 3K6YA 2WPMS 3JZ1B 3RXCA 2O8LA 1O3DA 1D3QB 4UE7H 2BVXH 1HAYB 2A5KA 1HGTH 7GCHF 1VITF 1TA6A 1MZAA 3PWCA 1YPKH 1CO7E 2EC9H 1OWEA 4OS7A 1MKXK 2F9NA 1S85A 1EXFA 4MNXA 3MU4A 3NZIA 4MPWA 2WUBA 1L1GA 3SUEA 1SGRE 4Y0YE 1SOZA 2IN2A 2ZDNA 1K21H 1C4U2 3SO3A 1C1VH 2VIWA 4HZHA 2H2ZA 2TPIZ 4DCDA 2FS9A 4X0WU 1TNKA 2H9EH 4Y8YA 1ZRKA 1IQHA 1SGFA 1SGTA 1AE5A 1ZMJA 2ZFSA 4XBCA 1GBEA 3ITIA 4NFEA 1GI0A 1UO6A 2A2QH 5CMXH 2XC4A 5A8ZA 1BMLA 1GVZA 1KXDA 4X6MA 1O2ZA 3OY5U 1Z1JA 1E0FD 4ZUHA 3RXUA 1C2JA 1P2QA 2CJIA 1MMJN 2SNWA 1SGFG 3GOVB 1ZGVA 1YLCA 1W7GH 1ELBA 1B7XB 2ZPRA 2O8UA 1AKSA 1GI9B 2Z9GA 7GCHG 1G3DA 1VITG 4ZROA 2BVSH 5FHTA 1CSOE 1P05A 1DICA 1O0DH 3ZZ9A 4WMEA 3RXSA 1GJ9B 1GHBF 1TIOA 4Q7ZA 3BTEE 2ZO3H 4YM9A 5EXLA 3SGBE 3RXJA 3NUMA 3TJUA 1O2JA 3MNCA 1LKBA 1FAKH 1XVOA 1ZRBA 2VIPA 2TGAA 1PPEE 1YPHC 2BLQA 2VIQA 4A6LA 4INHA 1FQ3A 2GV7A 3UWJH 5JDUB 2BZAA 1A0JA 1F5KU 3ATWA 1BMMH 1SLUB 3ESTA 2A4GA 2A5IA 2ZZUH 3VXFH 4AFUA 2PTCE 1O36A 2HLCA 1LHEH 2QIQA 3SBKA 1O2SA 2ANYA 2W7UA 1ZHMA 2ZQ1A 3F9FA 3LT3A 4TY7A 1W10U 5A0BA 1C1WH 1PYTC 3A8DA 3AVZA 1O2OA 3LKWA 1N8OC 3BIVH 2VWLA 4AORA 2WUCA 3MH5A 1C5ZB 3NKKA 4K3JA 2ZHDA 3TH2H 1FPCH 2BLOA 5F03A 3W95A 1ELAA 1AMHA 1K9OE 2A45B 2OXSA 1O2WA 4AX9H 1B0FA 1GHBG 3TK5A 1ABIH 1O2NA 5DP8A 1W11U 1QY6A 3KCGH 4ISLA 1UVPA 1LQDB 3MU8A 2Y81A 2UUJB 5JPMH 2D2DA 1P9SA 2G55A 1NN6A 2AGGX 3RXDA 3TJVA 1A2CH 1LHFH 1AUJA 1LQEA 1OP0A 1VR1H 1GWAA 1NRPH 2F91A 3CENA 3PLPA 1A3EH 1PJPA 1EAWA 5AFZH 1QA7A 1UJ1A 3RDZA 2CV3A 1TFXA 4I8LA 1MKWK 4PROA 5LGOA 1ORFA 1DX5M 1S6FA 4A7IB 3T29A 2FOBA 5ETXA 2ASUB 1PPHE 1C9PA 2Y80A 3UR6A 5G4BA 4IS5A 1O3MA 3TLOA 1YF4A 2UWPA 1HXFH 2BD5A 1EZQA 1FNIA 1LVBA 4IN1A 3N7OA 5AHGH 1TNHA 1MAYA 2G8TA 3KL6A 3TPIZ 3KN2A 1UTPA 1CHOF 2P94A 3H7OA 2WV4A 3BG8A 4ISNA 5FPTA 1G37A 1CT2E 2OCVB 1BRAA 1K1NA 2A4QA 1BTHH 4TWYA 1KLJH 1SBWA 2CF9H 2XTTB 4A1TA 1DSTA 1XUFA 3RXOA 2G00A 1KLTA 3D23A 1OWHA 5GPIB 1L0ZA 1P3EA 3ZZ4A 4CR9A 1TRNA 1GDQA 2D1JA 2Z9IA 1RTKA 3Q00A 5FPYA 5CE1A 2C8YB 4FUFA 1GJDB 3BTKE 1XVMA 1O2RA 1AWFH 3PLBA 5E2OA 3PROA 1GBCA 1TOCB 3TVJB 1AUTC 3OU0A 1JRSA 1OWDA 3ELAH 2BDBA 4CREA 3KF2A 4HGCA 3M5LA 3RXPA 3SNBA 1ZJKA 4FUJA 1HPGA 1O5DH 1Z6EA 2VINA 2D8WA 4D7GA 1GG6B 2FX6A 3RXGA 1GBFA 1JOUB 3A87A 3QWCH 3SQEE 1SMFE 1RIWC 1YCPH 1CHOG 4Q7YA 3MO6A 3VB7A 3I29A 4ABAA 1O3EA 2A2XH 4KELA 2VIDA 2G4TA 4MDSA 4YTAA 1BHXF 1Y8TA 1TAWA 2V35A 1NFWA 2BDYA 2OTVA 1O2HA 4CH8B 1L2EA 2Q1JA 2TIOA 1ESBA 3UOUA 1SGEE 5FPSA 1RXPA 1GGDC 1TYNA 1SGQE 1GI7B 3S9BA 2F3CE 1V2TT 2NWNA 5HM9A 3SU6A 3A88A 2VWOA 2AEIH 2FOAA 1KXFA 3BTWE 4E7RG 3DHKH 4NWKA 1DUEA 1HAIH 3T2NA 3WY8A 1ELEE 3F9GA 3S9AA 1H8DH 1GJ5H 3URCA 1ELGA 1OX1A 1K1OA 3T27A 2ZTZA 1N6XA 3SU4A 2G51A 8LPRA 3MU5A 1O3NA 1SOTA 1WBGB 2BXUH 1D6WA 1UTLM 3RU4D 4DW2U 1BTWA 1EPTB 2FPZA 3ZVDA 4HI3A 4AFQA 5C67A 1GPZA 2ZI2H 3SHCH 4MPVA 4YT6H 1P10A 2JH6D 1GI2A 5ESBA 3RU4T 4FU9A 3A7YA 3A7ZA 4BOHA 1L4DA 2CXVA 1FY3A 1F0RA 2ZDAH 3VFEA 1EP5A 1O3KA 2BD9A 2XC5A 1Z8IB 3IG6B 5SGAE 2NU2E 4DT7B 5BRRE 1VCQA 2XWAA 5DGJA 2ZGCA 3TGIE 2IOTA 3BTFE 2W3KA 2BVRH 2FOFA 3M3VA 4B73A 2TGDA 4YLUA 4D9QA 2VVVA 1P9UA 3PM3A 2SGAA 2QF3A 1J17T 3QDZB 2FOMB 3LU9B 5L6NH 1TPSA 3GCTF 4FUGA 1Z7KA 1N6YA 3VB4A 2SGFE 1FXYA 1TNIA 3OX7U 1C2EA 1D9IA 4IC5A 1NTPA 1QR3E 1AVGH 3EQ0H 3QTOH 1QL7A 3MYWA 1ZMNA 2ZHQH 1DY9A 1O2MA 1TGNA 2P8OC 2Z9JA 1A61H 4X1PU 1LHDH 3MOCA 1Y5AT 4CRAA 2GMTC 3EGKH 2FYQA 3RXEA 2ODYB 5A0CA 5J4SA 1EJMA 3ODFA 4E7NA 3E8LA 1HAZB 1ACBE 4NA9H 4Y7AA 5TCAA 3RXAA 1TPOA 2GP9B 1IOEA 1TPAE 4R0IA 4XBDA 2DE8A 1DXPA 1O3HA 3SU2A 4ZKNU 4BAQB 1BITA 2GKVE 1OP8A 5JB8S 2F9PA 4TY6A 2FS8A 1TGSZ 3LH1A 3QGJA 5PTPA 3LPRA 2ZGJA 1Y3WA 3O8CA 3GY2A 3GCTG 3W94A 2Q6FA 2YOLA 1G3EA 3C1KA 3M7UA 2FI4E 2GCHF 3FP8E 1NPMA 4FVBA 3SNDA 1C5WB 5C1UA 1C1SA 1W14U 2BD3A 2WPJS 1P8VC 5GDSH 2J94A 1T8MA 1HV7A 4TPYA 1BMNH 1XUKA 3ZVBA 1V2KT 1H9IE 1SVPA 3QGNB 3SU5A 4O3TA 1V2MT 1BIOA 1LO6A 4Q7XA 1YLDA 3T62A 5H4IB 2AGEX 1O2VA 3LGVA 4Y6DA 2HALA 4DURA 3SNEA 1ETSH 2J92A 1K28D 1K22H 2JETC 3UNRA 3S0NA 1V2NT 1DT2A 3PTNA 1S81A 2ZG0H 2O8MA 5DP7A 2Z3EA 4Z0KA 4GUXA 1MKXH 1BT7A 2WINI 1HIAB 2SGEE 1Q31A 3TH4H 1IQJA 4GCHF 4CR5A 3T26A 4B1TA 1C5NH 4ZH8A 2Y5FA 3GDUA 2WPKS 1O2UA 4BTTB 1Q3XA 2BD4A 4Q2KA 3T25A 1C5MD 2Y82A 4Y8XA 4NZLA 3O8DA 4WVPE 2VWMA 3M61U 1BTUA 3LC5A 3VGCC 4BAMB 2BD7A 5F8ZA 1EB2A 2GCHG 2BQ7B 2ZP0H 1GHXH 5JB9S 1FY5A 2Y5GA 1SFIA 2F9BH 3GY7A 4LOYH 3U9AH 1GDNA 4DG4A 2ZU3A 2FODA 5EXNA 2BX4A 1C2KA 3IWMA 1F5RA 4AYYB 1GI4A 4B74A 4A1XA 3RXQA 2SNVA 2QXHA 2FOGA 4X2XA 4MPXA 2FLRH 3EE0B 4NFFA 1DE7H 4BTUB 1A5HA 4GCHG 1V2LT 2W5EA 4IW4E 1XUGA 3ZZ6A 3A8BA 3U98H 4BXWA 4WMDA 2QYIA 3PMHB 2Y5HA 3HATH 4CRFA 1K1MA 4NWLA 2PGBB 1KSNA 1O3IA 1QFKH 5DG6A 1ZGIA 2RA3A 4I7YH 1RS0A 2AMQA 5ESTE 1TBRH 4D8NA 2OBOA 2ZDKA 3LIWA 2F9UA 3PO1C 4JYUH 4B76A 2BTCE 4XBBA 1D3DB 3SNAA 6CHAC 3L33A 5JBCS 1QTFA 1W2KH 5IDKA 1NESE 1O3BA 3DA9B 4D9RA 4ABHA 3M36A 3SJ8A 1WUNH 1QBNA 1GHYH 1SQTA 2GVFA 3AAUA 5E2PA 4RSPA 3A81A 4XDEA 4YLQH 3SUGA 2BD2A 3F9EA 2VGCC 1AY6H 4D7FA 3SGAE 1MQ6A 4Y7BA 1XMNB 2HNTC 1Y5UT 3UREA 3QUMP 1FV9A 1H8IH 1KXCA 4CRBA 1HYLA 3TIUA 1CT0E 2VIOA 1GDUA 4YOJA 2H1UA 2H5DA 4X8VH 2QV1A 1A0LA 1MCVA 3UOPA 2F83A 1K1JA 1IQLA 2HGTH 1E34B 1QNJA 3AASA 1LHGH 3QX5H 1YKTA 4MTBA 2H9HA 2XW9A 3U8TH 3F68H 2BOHB 1UVOA 3SJIA 1MTNB 1BBRH 1C5SA 4GSOA 2OD3B 3ZYEA 4KTUA 1P02A 3P8NA 1ABJH 3EA9A 1C2IA 1MKWH 2A7JA 4O97A 1QBVH 1C5QA 4HFPB 2ZFFH 4CRCA 3TITA 4GHQA 3B23B 5EPNA 1GJ4H 1SQOA 1S84A 4K2YA 3HPTB 1P06A 5I25A 1UMAH 4I32A 4UD9H 1DWDH 3DD2H 4ABDA 3ZZ5A 4AGJA 2EI7A 2GCTC 2F9OA 1NU9A 1J9CH 1PPCE 1BRBE 9ESTA 2ZECA 2TBSA 3SV9A 2P95A 1BBRE 2XBWA 4ASHA 1NZQH 2VNTA 1PQ7A 3SV2H 1ZLRA 2ANMH 2OP9A 1XKAC 5LH8A 3ATKA 1ZJDA 3A80A 2I6QA 4YESB 2ILNA 4MLFB 4DIHH 1CGIE 3SUDA 3CS7A 1ANEA 1EP6A 1CU1A 5DP4A 2D26C 2QAAA 3S69A 3U8RH 4F49A 1CQQA 1J16A 1BRCE 4LZ1H 1A46H 1C5PA 3M7TA 1KXBA 1AI8H 1MTUA 2SGQE 4I8JA 4WWYA 1CA0B 2VB0A 5EW2H 2NU3E 5C2ZA 2VWNA 2XWBI 3MMGA 1AFQC 1BTYA 1V2ST 4ISOA 1IQEA 1MQ5A 5GJ4B 4FU7A 2BYAX 1CBWC 2A7CA 3UNQA 2FZZA 2RA0A 4Q80A 1MU8B 2WYJA 1FN8A 1F0TA 2ZIQH 1A3BH 3GY3A 2AMDA 1BTZA 1X7AC 3R0FA 2QN5T 3K9XB 5DKMA 3SU1A 1E38B 3RM2H 1FAXA 1Z6JH 1FUJA 1LTOA 2A31A 1SFQB 2R2WU 3MWIU 1KDQB 2OQUA 3NWUA 2UUFB 2A4OA 2QXJA 2ZFTA 3O8RA 4AG2A 2FTLE 1A1RA 1HUTH 4TPIZ 1W0YH 1DWEH 4IBLH 2BZ6H 4WH8A 1K1PA 2OBQA 2C4FH 1XUIA 2PW8H 4B2AA 2RCEA 1GBLA 5EQSA 2AGIX 4GVUA 1Z1IA 2G81E 2Q6GA 1QRWA 1XX9A 3EAJA 1AQ7A 3R3GB 3SV6A 1AB9B 3OTJE 3UPEA 1IQGA 1GHWH 3AW0A 1O2PA 4AOQA 1NS3A 5EU8A 1JRTA 3QK1A 2QCYA 1T7CA 2K1QA 1RFNA 4ABFA 2XRCA 4ABGA 1WTGH 5A0AE 1CE5A 5EQQA 4UFDH 1BBRK 2KAIA 1LDTT 2UWLA 5K7RA 1SGPE 2BD8A 1EZUC 5T6DA 3GY8A 4AYVB 4E06H 3GCHC 2M5TA 3ZZBA 3UY9A 2ALVA 1RTFB 1LCYA 1BA8B 4X6NA 2FI3E 1BTPA 1O5CB 1AVXA 2FX4A 2C3SA 2FO9A 1RTLA 4WXIA 4DOQA 2V3HH 4X6PA 4MNVA 1DITH 1ZSLA 1FDPA 2STAE 4ZKSU 1UK3A 1MD8A 4OS2A 4UFEH 3RXKA 2PV9B 3GY5A 2ZQ2A 4RN6A 1GI5A 1YC0A 1S82A 2GZ7A 1C2GA 5L2YH 1O3AA 4NIXA 2LNCA 5E0JA 2Z9KA 2P3FH 2AFQB 4JZIA 1HAVA 5C5OA 5ABWA 2ZGXH 1O35A 3LJOA 2BY8X 5C3NA 3KHVA 5FAHA 1MBQA 3RXRA 1GMCF 1CVWH 2BXTH 2P93A 3KQDA 1EX3A 4OS6A 5EGMA 3H7TA 2ODPA 2ZEBA 3Q3XA 1TE0A 3BSQA 4O9VA 1O37A 3STJA 1CHGA 1O2LA 2XCFA 3TH3H 1MBMA 1UTNA 1GJ7B 4CH2B 5E8EH 2AIQA 5LPFA 4AFSA 2C8ZB 1O3CA 1C2HA 2HPPH 1UVSH 4NG9H 4AB9A 1C1NA 1J8AA 1GBMA 1M9UA 1GBKA 4XE4A 3ODDA 4LZ4B 1HB0B 1ZHPA 1MZDA 4AN7A 1HCGA 1F0UA 1EOJA 2HNTF 2FWWA 1P12E 4UDWH 4XSKU 2FTMA 5C1YA 3VEQB 2ZU2A 3V7TA 1CGHA 4ZMAH 2PUXB 2OC7A 1D3PB 3GY4A 2ZU1A 4K69A 5A8XA 1GMHF 2XBYA 3OYPA 4OS4A 3P8GA 1FIZA 1TRYA 3I77A 2PLXA 3ZVAA 1BMAA 1AZ8A 1DPOA 2Z7FE 1GMCG 4X6OA 2YNAA 1C5RA 1AFEH 3A84A 3SGQE 1BQYA 1QJ1B 1O38A 2TGTA 3NPSA 3RMLH 2AMPA 1AKSB 1EAXA 1TPPA 1BUIA 1TQ0B 1C5XB 3LJJA 1DLKB 1ZSKA 5L2ZH 1H9LB 4GPGA 1GCTB 1MAXA 3QLPH 2WPIS 1EATA 2PKSB 4Y10E 3KQBA 4CRDA 4X2YA 2NU1E 4SGBE 2PUQH 2BOKA 4IMQA 1C9TA 4ZXYH 1QHRB 1NC6A 1YPMH 2YNBA 2PR3A 2GMTB 4Y71A 1C1TA 3GYMA 3K2UA 1GMHG 4H6SB 1ELFA 2OUAA 1C5LH 3GCNA 2CHAC 1O31A 4GHTA 1P2KA 1VZQH 2BY9X 1ANCA 9LPRA 2FOEA 1P2JA 2Z3CA 1QCPA 1HRTH 1O5BB 1T8OA 2OC1A 1HJAB 3UFAA 1W3CA 1TABE 1HAPH 4FUBA 2HOBA 1TB6H 4FUCA 1AGJA 3P8OA 4VGCC 1LPGB 2GT7A 4YO9A 3ZYDA 1YPJH 3T5FH 2Z3DA 4MPUA 3MTYA 1YPHE 1OWIA 4X1RU 4BAOB 1HNEE 1SPJA 4ABBA 2CF8H 1OXGA 2EEKA 1GI3A 5HGGA 3MFJA 5FX5A 3L3TA 1O39A 1EPTC 1AE8H 1SGCA 1TBZH 1P0SH 2KAIB 4O03A 8ESTE 3TNSA 1NY22 2ZGBH 1FIWA 1ZPBA 4M7GA 5I46H 1KY9A 4X1QU 3BN9A 2CGAA 2PSXA 1MTVA 1QBOA 1HDTH 2Z94A 6LPRA 3GICB 4X2WA 3EDXB 2ZGHA 1SHHB 4KP0A 1EASA 6ESTA 4DJZB 1C5YB 3PMAB 1BOQA 3ZZ8A 3RM0H 5CHAC 1ELVA 1GBHA 3TGJE 1SI5H 1DUAA 3SJ9A 3PLKA 2V0BA 2XBXA 4U01A 4X8UH 1FI8A 4LXBH 3TJOA 1ZYOA 3MU1A 3A7VA 1Y59T 2G5NA 3B8JA 1GJCB 1O32A 5A2MH 2SGDE 2ZC9H 4IGDA 1JMOH 3G01A 4MNYA 1YCPM 3DFJA 4FUIA 3P8FA 5AFYH 2O9QA 3RC5A 1C5TA 3FP6E 3D65E 2XXLA 4TYDA 5EPYA 2ZA5A 4H4FA 2PKAA 5FXLA 4DGJA 3PTBA 4NIVA 2FMJA 3VXEH 4OGXA 4ZHLU 2FEQH 1A5GH 4I8KA 1PQAA 2XBVA 2ZF0H 2HPQH 4Y8ZA 3BV9B 4WJG2 3SZNA 1HXEH 1L4ZA 1MD7A 1PQ5A 4I31A 1BJUA 4K1SA 1SGYE 1NU7B 2W7SA 4YOIA 1GI8B 1O2GH 2ODQA 3A7TA 1W12U 2HRVA 2C8WB 3ZV8A 1B0EA 4ZAEA 4ISIH 3KGPA 1DXWA 2XCNA 4JZDH 3LC3A 1DS2E 4NA7A 2Z6BD 3A82A 1RGQA 1Q2WA 1IQMA 1W0ZU 4KTCA 1XM1A 3M7QA 5AVDA 4A1VA 3E90B 5DPAA 1C2DA 3L6PA 1WYKA 2A7HA 8KME2 4X1NU 1LMWB 3BTGE 4Y76A 1K1IA 3LGTA 4YOGA 3URDA 3QZRA 5F8TA 3PWBA 4U30A 4B2CA 3MNBA 1EAUA 3RXBA 3Q3YA 2V6NA 1C5VA 1DY8A 1NT1A 2GTBA 4ESTE 1TNLA 3RUOA 1AVWA 3P70B 4Y11E 1XKBC 2ZHWH 4MVNA 3RXFA 1HLTH 1RJXB 1GI6A 2FOCA 1KXAA 3PYHA 1THPB 2VGCB 1BHXB 2PFEA 4B75A 4WXVA 1IHTH 1ELCA 1JIRA 3KQEA 3UIRA 3UQOA 1WOFA 4YZUA 2ZU4A 4JYTA 2ULLA 1UTKA 4AFZA 1HAXB 1RRKA 3PMBB 1K2I1 3RXIA 3FAOA 3KQCA 2UWOA 1FN6A 1C5UA 1L1NA 1GBBA 3A83A 2AIPA 1GI1A 2JKHA 1A5IA 1GHAF 1VGCB 2B8OH 4JCNA 4CRGA 1F0SA 3ZZ7A 1VITH 1LKAA 1OWJA 3F9HA 2J95A 2EI6A 2P3UB 3ZZDA 3V0XA 3RXLA 1QQ4A 3F6UH 3SUFA 1SGDE 2TRMA 1P2OA 2AH4X 2DUCA 1V2RT 4XFQA 5TCCA 2GX4A 1G2LA 1GCDA 4NIYA 1G3BA 3A85A 5T6FA 4WH6A 4UONA 2QY0B 1EQ9A 1ZTLA 2W3IA 4NCYA 4X8SH 2GCTB 3UWIA 1G30B 4CHAC 1HJ8A 3SJOA 3UR9A 1ANBA 4NSYA 3GISB 1EZXC 1NRSH 1TNGA 2BM2A 3MH4A 2OLGA 3HGNA 1A7SA 1LHCH 4JYVH 3C27B 3QN7A 4BNRA 1VJAU 1OYTH 1H4WA 1P2MA 4B71A 3H5CB 2TGPZ 4ZKOU 2BY6X 1GHAG 1HAOH 4GAWA 1XUJA 3P92A 1F5LA 2A4RA 3P95A 4J2YB 2OC0A 1F2SE 3BTHE 3PB1E 1C1UH 1SSXA 3ZZCA 3EA7A 4D76A 4H6TA 3TK6A 3DUXH 1NRRH 2JH5D 1O34A 1ETRH 1LPZB 1UK4A 1ZTJA 4IMZA 1V3XA 2AS9A 2ZDLA 3PMJA 5E0HA 1D3TB 2ZDMA 2OINA 3BG4C 1ZR0A 1AFQB 5TJXA 4I8HA 1TNJA 3M35A 1ESAA 1AZZA 1AWHB 3P17H 2VU8E 1GL1A 2UUKB 1MCTA 2THFB 3GYLB 1CBWB 4JMYA 2ANKH 5DP6A 1V2QT 2I6SA 3MHWU 1S83A 1C1OA 1LPKB 1OOKB 5JBAS 1UCYE 2EI8A 1DLEA 1L1JA 1TX8A 1TWXB 2PKAB 4UEHH 1ZZZA 1VCPA 1WCZA 5T6GA 1MTNC 1YM0A 1FY8E 1N8OB 4AG1A 1QB9A 3E0NB 2GDDA 4FUDA 3E3TA 1O2IA 1S0RA 2PTNA 5JBTA 1WU1A 1O2TA 3RP2A 3LH3A 3M37A 1GBAA 3FFGA 3P6ZB 1GHVH 1A4WH 1ID5H 5E0GA 5FBEA 2O8TA 1AIXH 3K6ZA 1BDAA 1SG8B 1V2OT 3VB5A 1GBJA 1EPTA 1QIXB 4OS1A 4BXSA 1EOLA 2J9NA 4THNH 2FOHA 2R0LA 1FY4A 2IPHA 2J34A 5T3HA 7LPRA 1KTTB 3GCHB 1KYNA 3HK6B 1YBWA 3UUZA 3S9CA 2FI5E 5IYTA 3CP7A 1P2NA 1QL9A 1BTXA 4NZQA 1FJSA 2V3OH 2BLWA 1SR5C 4OGYA 3JZ2B 1ZTKA 2FP7B 1GVKB 4Y79A 2BB4A 5LPRA 3O8BA 2Y6TA 3MO3A 5HXFA 4U32A 2QXGA 1T8LA 3FZDA 1FY1A 1T4UH 1W7XH 5FBIA 1CA0C 5L30H 2C8XB 5EXMA 1GMDF 3BEIB 1IQIA 1DSUA 4FUHA 2PHBA 1GVLA 1SQAA 1TONA 1SC8U 2ZFQH 4O3UA 5AF9H 3FANA 1SGNE 2GZ9A 3MNXA 1QA0A 4B2BA 5EODA
chains in the Genus database with same CATH superfamily
1NFYA 3OE7D 3TU7H 3SQHE 2Q6DA 1VKYA 3A8AA 4MNWA 2BDIA 3D62A 2AERH 1DDJA 1SL3A 3QTVH 1UCYK 1JIMA 4TWWA 3A7WA 4HTCH 1C1MA 4DY7B 1G36A 3MNSA 2SGPE 1B5GH 4R8TB 4FU8A 2ESTE 3E6PH 2HVXA 1HAHH 2IJOB 3KQ5A 1ELTA 1O3FA 3OSYA 1OYQA 3LGWA 1RIWB 3RMNH 5EG4A 4I33A 1O5EH 3RXHA 1NM6A 4NA8A 4DVAU 1PYTD 1PPGE 1TOMH 1F7ZA 1Y3YA 2ZTYA 4NIWA 4MQAA 3D49H 2QF0A 2OC8A 2BMGB 2WPHS 1OKXA 1ELDE 5A8YA 1AB9C 1S6HA 1T31A 3V13A 1DM4B 1GMDG 4OS5A 1RD3B 2OQ5A 1QB1A 1GGDB 2BDCA 2Y7XA 1Z71A 2SFAA 2UUYA 3UB0A 1G2MA 2BQWB 1ZMLA 1V2JT 3A89A 2PWXA 1OS8A 1CGJE 1TLDA 1JBUH 3SU0A 2O8WA 2JH0D 1P2IA 2Y7ZA 3MH7A 1FZZA 1INCA 1AU8A 2A1DB 1IHSH 1IQKA 1AD8H 1O2KA 1XUHA 3LONA 1P57B 3BTQE 2R3UA 3WWFA 2ZTXA 5C17A 1BRUP 4K1TA 3U69H 1V2PT 1AN1E 1GJBB 2HNTE 2ZWLH 3HKIB 1MU6B 2R9PA 1AO5A 1THRH 3SORA 1PPBH 5J4QA 1P09A 1VJ9U 5EOKA 4ABJA 1ZSJA 2ZDVH 1HIAA 5B6OA 1KTSB 1TX7A 2R3YA 1WQVH 3OY6U 4A92A 3V3MA 3ENSB 5GXPA 1GJ8B 6GCHF 2FM2A 3SOSA 5GCHF 2WYGA 4J1YA 2BY7X 3TK9A 4CBOA 2Z9LA 3SI3H 1GBDA 1V2UT 2R2MB 4RKJB 2GZ8A 1FPHH 1IQNA 1LVYA 3RXMA 1C1RA 1E36B 1FONA 1O2YA 1TA2A 1TRMA 1WQSA 2VH0A 2EQNA 1O3PB 3M5NA 1ANDA 2BY5X 3WW7A 1DANH 1NROH 4GLYA 1O33A 1UHBA 2B9LA 5GWZA 2CHAB 2KCPA 4MG3A 1O5GH 3DFLA 1Z8RA 1YGCH 1T8NA 1WTHD 1O3GA 4ZKRU 1WV7H 1EJNA 1PPFE 1T32A 2H6MA 2QC2A 3ZVCA 2K0QA 4X2VA 3RXTA 1OPHB 3QO6A 1SHYA 1W13U 3U1IB 4VGCB 5LPEA 1GG6C 3H09A 5JYIA 2LPRA 4LK4A 4K60A 3MO9A 1IQFA 3MU0A 3QZQA 3BEUA 1U6QA 2QGRA 1H1BA 2B5TB 3Q76A 4U2WA 4UFGH 1W0JD 5C0TA 2DE9A 4BAHB 1O5AB 2ZNKH 4K8BA 3AW1A 3LGYA 1DWBH 4XOJA 2P8OB 3BTTE 3NCLA 2BQ6B 2QXIA 3KEEA 2M2AA 1QGFA 4ZHMU 6GCHG 1AHTH 1CA8B 5GCHG 3A8CA 2BDAA 5DP9A 5DP5A 1GHZA 3GDSA 2FDAA 3VPKA 3TGKE 2ALPA 2BLVA 5FCKA 4WY3A 1NRQH 1NO9H 4BANB 3MI4A 3BF6H 3S7HB 2B7DH 2J5UA 2W26A 3U1JB 1V2WT 1TQ7B 1PQ8A 1J14A 3EYDA 1THSH 1OWKA 4BTIB 1YPEH 2G5VA 2VJ1A 2ZKSA 3F1SB 4F4OC 3HGPA 3M3SA 7ESTE 5FCRA 5CHAB 2ZHEH 5F8XA 3GY6A 2ZU5A 1CT4E 1WSSH 1VCWA 2A32A 3LGIA 3B9FH 2FESH 5K0HA 2QA9E 3FZZA 2WPDD 1QURH 3I78A 1QJ6B 1BCUH 1GCTC 1BB0B 1G3CA 2GV6A 1JWTA 5DJ7A 2PKSC 3W1EA 1OHHD 3RLYH 2RDLA 1UTJA 2P3TB 4K8YA 1N1LA 3V12A 1JXPA 3SHAH 1O30A 1DVAH 3NRLA 4K5ZA 3ZZAA 1SB1H 4KTSA 2WPLS 1TGBA 3TJNA 1ZOMA 4ABEA 2QF5A 1YPLH 4ABIA 1A0HB 2ZCKP 1O3LA 4K1EA 2VVUA 3U28C 2JETB 4Y0ZE 3BTDE 5HYOA 1C1PA 1UVTH 5DO4H 5JBBS 1QRZA 3TNTA 1EZSC 3KYGA 3LOXA 3RLWH 1C4V2 1C4Y2 5FX6A 1Z8JB 1UVUH 3LDXH 1HJAC 1YPGH 5A09A 2J4IA 3E0PB 3ATLA 1O3OA 2XYAA 2CN0H 3BEFB 3A7XA 2C93B 5BPEA 3NXPA 1DFPA 3LGUA 1YCPK 5DK1A 1QJ7B 1COWD 1WAYB 2IJD1 4AB8A 3FP7E 1H9HE 1SQRA 5GIBA 3SV8A 1QQUA 1EKBB 5DP3A 3VGCB 2P59A 2VVCA 1K1LA 2BDGA 1NFXA 3RMOH 1DWCH 1O5FH 1HAVB 1SLWB 4AZ2B 2W6ID 1Z8GA 1Y3VA 3CS0A 4ZHAA 1P3CA 1QL8A 1ZHRA 2WSSD 3ZVGA 3ATIA 1EB1H 3KIDU 4ISHH 1O2QA 3E16B 3FVFB 2AYWA 1PFXC 1DOJA 2J2UA 1NFUA 4TSFD 5C1XA 4E05H 2C90B 2FYRA 2GT8A 3PRDA 5C20A 3GDVA 1FMGA 5HM2A 1KLIH 4JK6A 5EW1H 2GD4B 1P11E 3T28A 1D6RA 3Q3KA 1G32B 1XXDA 2PGQB 1V6DA 3A86A 3GCOA 3KNXA 1P04A 1W8BH 1UTOA 1Y3UA 2VIVA 4KKDA 4FXGH 3ZZ3A 2ZCHP 3E1XB 1C1QA 1HFDA 1C2LA 2GGVB 4SGAE 1MTSA 4FUEA 4CBNA 1QRXA 1OSSA 2BHGA 1HAGE 2B0FA 3PO1B 3SN8A 2BDHA 2ANWA 1EUFA 1W0KD 4QT8C 5HMAA 3RC4A 6CHAB 1F92A 1SLXB 4IN2A 3PV4A 4WF8A 4YT7H 3ATMA 3DT0H 4IC6A 1EJAA 1ZPCA 3ZVEA 1UHBB 5EQRA 1KDQA 3ZVFA 2XNIA 1J15A 1H8HD 3PRBA 3BIUH 1HBTH 3RU4E 3M5OA 1ESTA 5C5NA 1ARCA 1E35B 1O2XA 1YP9A 3SW2B 2R0KA 1NBMD 1MH0A 4BAKB 1GJ6A 2PSYA 2J38A 1P03A 2F9VA 2FLBH 3ZV9A 4JZEH 1MTWA 1KIGH 1ETTH 1MUEB 4A5TS 4JZ1A 2A5AA 1GJAB 1LVMA 2ZFRH 1SGIB 4NSVA 1D4PB 1TMBH 4Q4LA 4ZXXH 4CHAB 3AAVA 5HIYA 1GBIA 2J98B 2STBE 3RC6A 1FLEE 1E37B 2CMYA 3SV7A 1GL0E 3RMMH 4Q63A 1GBTA 4JK5A 1TALA 1V2VT 1BJVA 8GCHF 3SJKA 3MH6A 1IAUA 1UTMA 4I8GA 1EAIA 4Z6AH 4KGAA 2FXRA 2WV5A 1XXFA 2NU0E 1TX6A 1C5OH 4INKA 4X8TH 1LVOA 1PPZA 1S0QA 4UFFH 3UQVA 1SLVB 2P16A 2EA3A 2F43B 2A0QB 3U8OH 1TGTA 1O3JA 3K65B 5F6MA 1HJ9A 3DSGA 3BTME 1TGCA 3UTUH 1BZXE 4RKOB 2H9TH 1C2MA 3HK3B 3IITA 3HKJB 4X1SU 5KEDA 1KXEA 4AGKA 2H5CA 3S7KB 1UK2A 1UTQA 2RG3A 4H42U 3SU3A 3VB3A 2FIRH 3EA8A 3SNCA 2NU4E 1C2FA 1TBQH 1TMUH 3BG4B 3SI4H 2G52A 4OM9A 1NRNH 3M5MA 1S5SA 1WDIA 1FX0B 1Y3XA 1TMTH 1T4VH 4FVDA 1G9IE 2F4LA 2GDEH 1OP2A 3RXVA 2ZPSA 2VH6A 2XC0A 3UNSA 7KMEH 3VB6A 2HWLB 4JZFH 1ZPZA 2ZCLP 3NK8A 1ARBA 1Y5BT 1YYY1 8GCHG 1P01A 3E91A 3Q77A 4NGAH 2ZFPH 2G4UA 2ZPQA 3M3TA 2BX3A 4INLA 4WMFA 2ZHFH 1VGCC 3STIA 1UCYH 1QB6A 3K6YA 2WPMS 3JZ1B 3RXCA 2O8LA 1O3DA 1D3QB 4UE7H 2BVXH 1HAYB 2A5KA 1HGTH 7GCHF 1VITF 1TA6A 1MZAA 3PWCA 1YPKH 1CO7E 2EC9H 1OWEA 4OS7A 1MKXK 2F9NA 1S85A 1EXFA 2KZ4A 4MNXA 3MU4A 3NZIA 4MPWA 2WUBA 1L1GA 3SUEA 1SGRE 4Y0YE 1SOZA 2IN2A 2ZDNA 1K21H 1C4U2 3SO3A 1C1VH 2VIWA 4HZHA 2H2ZA 2TPIZ 4DCDA 2FS9A 4X0WU 1TNKA 2H9EH 4Y8YA 1ZRKA 1IQHA 1SGFA 1SGTA 1AE5A 1KMHB 1ZMJA 2ZFSA 4XBCA 1GBEA 3ITIA 4NFEA 1GI0A 1UO6A 2A2QH 5CMXH 2XC4A 5A8ZA 2QE7D 1BMLA 1GVZA 1KXDA 4X6MA 1O2ZA 3OY5U 5T1VA 1Z1JA 1E0FD 4ZUHA 3RXUA 1C2JA 1P2QA 2CJIA 1MMJN 2SNWA 1SGFG 3GOVB 1ZGVA 2V3MA 1YLCA 1W7GH 1ELBA 1B7XB 2ZPRA 2O8UA 1AKSA 1GI9B 2Z9GA 7GCHG 1G3DA 1VITG 4ZROA 2BVSH 5FHTA 1CSOE 1P05A 1DICA 1O0DH 3ZZ9A 4WMEA 3RXSA 1GJ9B 1GHBF 1TIOA 2YMSC 3BTEE 4Q7ZA 2ZO3H 4YM9A 5EXLA 3SGBE 3RXJA 3NUMA 3TJUA 1O2JA 3MNCA 1LKBA 1FAKH 1XVOA 1ZRBA 2VIPA 2TGAA 1PPEE 1YPHC 2BLQA 2VIQA 4A6LA 4INHA 1FQ3A 2GV7A 3UWJH 5JDUB 2BZAA 1A0JA 1F5KU 3ATWA 1BMMH 1SLUB 3ESTA 2A4GA 2A5IA 2ZZUH 3VXFH 4AFUA 2PTCE 1O36A 2HLCA 1LHEH 2QIQA 3SBKA 4F55A 1O2SA 2ANYA 2W7UA 1ZHMA 2ZQ1A 3F9FA 3LT3A 4TY7A 1W10U 5A0BA 1C1WH 1PYTC 3A8DA 3AVZA 1O2OA 3LKWA 1N8OC 3BIVH 2VWLA 4AORA 2WUCA 3MH5A 1C5ZB 3NKKA 4K3JA 5HIZA 2ZHDA 3TH2H 1FPCH 2BLOA 5F03A 3W95A 1ELAA 1AMHA 1K9OE 2A45B 5KGOA 2OXSA 1O2WA 2YMSD 4AX9H 1B0FA 1GHBG 3TK5A 1ABIH 1O2NA 5DP8A 1W11U 1QY6A 3KCGH 4ISLA 1UVPA 1LQDB 3MU8A 2Y81A 2UUJB 5JPMH 2D2DA 4P00A 1P9SA 2G55A 1NN6A 2AGGX 3RXDA 3TJVA 1A2CH 1LHFH 1AUJA 1LQEA 5EJLA 1OP0A 1VR1H 3MQKC 1GWAA 1NRPH 2F91A 3CENA 3PLPA 1A3EH 1PJPA 1EAWA 5AFZH 1QA7A 1UJ1A 3RDZA 2CV3A 1BMFD 1TFXA 4I8LA 1MKWK 4PROA 5LGOA 1ORFA 1DX5M 1S6FA 4A7IB 3T29A 2FOBA 5ETXA 2ASUB 1PPHE 1C9PA 2Y80A 3UR6A 5G4BA 4IS5A 1O3MA 3TLOA 1YF4A 2UWPA 1HXFH 2BD5A 1EZQA 1FNIA 1LVBA 4IN1A 3N7OA 5AHGH 1TNHA 1MAYA 2G8TA 3KL6A 3OAAD 3KN2A 5DSFA 3TPIZ 1UTPA 1CHOF 2P94A 3H7OA 2WV4A 3BG8A 4ISNA 5FPTA 1G37A 1E1QD 1CT2E 2OCVB 1BRAA 1K1NA 2A4QA 1BTHH 4TWYA 1KLJH 1SBWA 2CF9H 2XTTB 4A1TA 1DSTA 1XUFA 3RXOA 2G00A 1KLTA 3D23A 1OWHA 4B6EA 5GPIB 1L0ZA 1P3EA 3ZZ4A 4CR9A 1TRNA 1GDQA 2D1JA 2Z9IA 1RTKA 3Q00A 5FPYA 5CE1A 2C8YB 4FUFA 1GJDB 3BTKE 1XVMA 1O2RA 1AWFH 3PLBA 5E2OA 3PROA 1GBCA 1TOCB 3TVJB 1AUTC 3OU0A 5IK2D 1JRSA 1OWDA 3ELAH 2EY4C 2BDBA 4CREA 3KF2A 4HGCA 3M5LA 3RXPA 3SNBA 3F2FA 1ZJKA 2JJ2D 4FUJA 1HPGA 1O5DH 1Z6EA 2VINA 2D8WA 4D7GA 1GG6B 2FX6A 3RXGA 1GBFA 1JOUB 3A87A 4XRNA 3QWCH 2KM0A 3SQEE 1SMFE 3DCLA 1RIWC 1YCPH 1YY3A 1CHOG 4Q7YA 3MO6A 3VB7A 3I29A 4ABAA 1O3EA 2A2XH 4KELA 2VIDA 2G4TA 4MDSA 4YTAA 1BHXF 1Y8TA 1TAWA 2V35A 2WHXA 1NFWA 2BDYA 2OTVA 1O2HA 4CH8B 1L2EA 2Q1JA 2TIOA 1ESBA 3UOUA 1SGEE 5FPSA 1RXPA 1GGDC 1TYNA 2LELA 2W6JD 1SGQE 3N7DA 1GI7B 3S9BA 2F3CE 1V2TT 2NWNA 5HM9A 3SU6A 3A88A 2VWOA 2AEIH 2FOAA 1KXFA 3BTWE 4E7RG 3DHKH 4NWKA 1DUEA 5GNDA 1HAIH 3T2NA 1K0HA 3WY8A 1ELEE 3F9GA 3S9AA 1H8DH 3VG8A 1GJ5H 3URCA 4B6FA 1ELGA 1OX1A 1K1OA 3T27A 2ZTZA 1N6XA 3SU4A 2G51A 8LPRA 3MU5A 1O3NA 1SOTA 1WBGB 5C0UA 2BXUH 1D6WA 1UTLM 3RU4D 4DW2U 1BTWA 1EPTB 2FPZA 3ZVDA 4HI3A 4AFQA 5C67A 1GPZA 2ZI2H 3SHCH 4MPVA 4YT6H 1P10A 2JH6D 1GI2A 5ESBA 3RU4T 4FU9A 3A7YA 3A7ZA 4BOHA 1L4DA 2CXVA 3KYFA 1FY3A 1F0RA 3EE7A 2ZDAH 3VFEA 1EP5A 1O3KA 2BD9A 2XC5A 1Z8IB 3IG6B 5SGAE 2NU2E 4DT7B 5BRRE 1VCQA 2XWAA 5DGJA 2ZGCA 3TGIE 2IOTA 3BTFE 2W3KA 2BVRH 2FOFA 3M3VA 5EIYA 4B73A 2TGDA 4YLUA 2KCAA 4D9QA 2VVVA 1P9UA 3PM3A 2SGAA 2QF3A 1J17T 3QDZB 2FOMB 3LU9B 3PV5A 5L6NH 1TPSA 3GCTF 4FUGA 1Z7KA 1N6YA 3VB4A 2SGFE 1FXYA 1TNIA 5C94A 3OX7U 1C2EA 1D9IA 4IC5A 1NTPA 1QR3E 1AVGH 3EQ0H 3QTOH 1QL7A 3MYWA 1ZMNA 2ZHQH 1DY9A 1O2MA 1TGNA 2P8OC 2Z9JA 1A61H 4X1PU 1LHDH 3MOCA 1Y5AT 4CRAA 2GMTC 3EGKH 2FYQA 3RXEA 2ODYB 2WZQA 5A0CA 5J4SA 4ACBA 1EJMA 3ODFA 4E7NA 3E8LA 1HAZB 1ACBE 4NA9H 4Y7AA 2PP6A 5TCAA 3RXAA 1TPOA 2GP9B 1IOEA 1TPAE 3OTPA 4R0IA 4XBDA 2DE8A 1DXPA 1O3HA 3SU2A 4ZKNU 4BAQB 1BITA 2GKVE 1OP8A 5JB8S 2F9PA 4TY6A 2FS8A 1TGSZ 3LH1A 3QGJA 5PTPA 3LPRA 2ZGJA 1Y3WA 3DSPA 3O8CA 3GY2A 3GCTG 3W94A 2Q6FA 2YOLA 1G3EA 3C1KA 3M7UA 2FI4E 2GCHF 3FP8E 1NPMA 4FVBA 3SNDA 1C5WB 5C1UA 1C1SA 1W14U 2BD3A 2WPJS 1P8VC 5GDSH 2J94A 5EJZA 1T8MA 1HV7A 4TPYA 1BMNH 1XUKA 3ZVBA 1V2KT 1H9IE 1SVPA 3QGNB 3SU5A 4O3TA 1V2MT 1BIOA 1LO6A 4Q7XA 1YLDA 3T62A 5H4IB 2AGEX 1O2VA 3LGVA 4Y6DA 2HALA 4DURA 3SNEA 1ETSH 2J92A 1K28D 1K22H 2JETC 3UNRA 3S0NA 1V2NT 1DT2A 3PTNA 1S81A 2ZG0H 2O8MA 5DP7A 5DN6D 2Z3EA 4Z0KA 4GUXA 1MKXH 1BT7A 2WINI 1HIAB 2SGEE 1Q31A 3TH4H 1IQJA 4GCHF 4CR5A 3T26A 4B1TA 1C5NH 4ZH8A 2Y5FA 3GDUA 2WPKS 1O2UA 4BTTB 1Q3XA 2BD4A 3OEHD 4Q2KA 3T25A 1C5MD 2Y82A 4Y8XA 4NZLA 3O8DA 4WVPE 2VWMA 3M61U 1BTUA 3LC5A 3VGCC 4BAMB 2BD7A 5F8ZA 1EB2A 2GCHG 2BQ7B 2ZP0H 1GHXH 5JB9S 1FY5A 2Y5GA 1SFIA 2F9BH 3GY7A 4LOYH 3U9AH 1GDNA 1QZ8A 4DG4A 2ZU3A 2FODA 4HG6A 5EXNA 2BX4A 1C2KA 3IWMA 1F5RA 4AYYB 1GI4A 4B74A 4A1XA 3RXQA 2SNVA 2QXHA 2FOGA 4X2XA 4MPXA 2FLRH 3EE0B 4NFFA 1DE7H 4BTUB 1A5HA 4GCHG 1V2LT 2W5EA 4IW4E 1XUGA 3ZZ6A 3A8BA 3U98H 1YWUA 4BXWA 4WMDA 2QYIA 3PMHB 2Y5HA 3HATH 4CRFA 1K1MA 4NWLA 2PGBB 1KSNA 1O3IA 1QFKH 5DG6A 1ZGIA 2RA3A 3F2GA 1RS0A 4I7YH 2AMQA 5ESTE 1TBRH 4D8NA 2OBOA 2ZDKA 3LIWA 2F9UA 3PO1C 4JYUH 4B76A 1H8ED 2BTCE 5F53A 4XBBA 1D3DB 3SNAA 6CHAC 3L33A 5JBCS 1QTFA 1W2KH 5IDKA 1NESE 1O3BA 3DA9B 4D9RA 4ABHA 3M36A 3SJ8A 1WUNH 1QBNA 1GHYH 1SQTA 2GVFA 3N7EA 3AAUA 5E2PA 4RSPA 3A81A 4XDEA 3N99A 4YLQH 2BD2A 3SUGA 3F9EA 5B6LA 2VGCC 1AY6H 4D7FA 3SGAE 1MQ6A 4Y7BA 1XMNB 2HNTC 1Y5UT 3UREA 3QUMP 1YLNA 1FV9A 1H8IH 1KXCA 4CRBA 1HYLA 2KR7A 3TIUA 1CT0E 2VIOA 1GDUA 4YOJA 2H1UA 2H5DA 4X8VH 2QV1A 1A0LA 1MCVA 3UOPA 2F83A 1K1JA 1IQLA 2HGTH 1E34B 1QNJA 3AASA 1LHGH 3QX5H 1YKTA 4MTBA 2RDEA 3F0PA 2H9HA 2XW9A 3U8TH 3F68H 2BOHB 1UVOA 3SJIA 1MTNB 1BBRH 1C5SA 4GSOA 2OD3B 3ZYEA 4KTUA 1P02A 3P8NA 1ABJH 3EA9A 4Z1MD 1C2IA 1MKWH 2A7JA 4O97A 1QBVH 1C5QA 4HFPB 2ZFFH 4CRCA 3TITA 1MABB 4GHQA 3B23B 5EPNA 1GJ4H 1SQOA 1S84A 4K2YA 3HPTB 1P06A 5I25A 1UMAH 4I32A 4UD9H 1DWDH 3DD2H 4ABDA 3ZZ5A 4AGJA 2EI7A 2GCTC 2F9OA 1NU9A 1J9CH 1PPCE 1BRBE 9ESTA 3UAIC 2ZECA 2TBSA 3SV9A 2P95A 1BBRE 2XBWA 4ASHA 1NZQH 2VNTA 1PQ7A 3SV2H 1ZLRA 2ANMH 2OP9A 1XKAC 2KFWA 5LH8A 3ATKA 1ZJDA 3A80A 2I6QA 4YESB 2ILNA 4MLFB 4DIHH 1CGIE 2QF4A 3SUDA 3CS7A 1ANEA 1EP6A 1CU1A 5DP4A 2D26C 2QAAA 3S69A 3U8RH 4F49A 1CQQA 1J16A 1BRCE 4LZ1H 1A46H 1C5PA 3M7TA 1KXBA 1AI8H 1MTUA 2SGQE 4I8JA 4WWYA 1CA0B 2VB0A 5EW2H 3FN8A 4F48B 2NU3E 5C2ZA 2VWNA 2XWBI 3MMGA 1AFQC 1BTYA 1V2ST 4ISOA 1IQEA 5EJ1A 1MQ5A 5GJ4B 4FU7A 2BYAX 1CBWC 2A7CA 3UNQA 2FZZA 2RA0A 4Q80A 1MU8B 2WYJA 1FN8A 1F0TA 2ZIQH 1A3BH 3GY3A 2AMDA 1BTZA 1X7AC 3R0FA 2QN5T 3K9XB 5DKMA 3SU1A 1E38B 3RM2H 1FAXA 1Z6JH 1FUJA 1LTOA 2A31A 1SFQB 2R2WU 3MWIU 1KDQB 2OQUA 3NWUA 2UUFB 2A4OA 2QXJA 2ZFTA 3PV2A 3O8RA 4AG2A 2FTLE 4RT0A 1A1RA 1HUTH 4TPIZ 1W0YH 1DWEH 4IBLH 2BZ6H 4WH8A 1K1PA 2OBQA 2C4FH 1XUIA 2PW8H 4B2AA 2RCEA 1GBLA 2J97A 5EQSA 2GJGA 2AGIX 4GVUA 1Z1IA 2G81E 2Q6GA 1QRWA 1XX9A 3EAJA 1AQ7A 3R3GB 3SV6A 1AB9B 3OTJE 3UPEA 1IQGA 1GHWH 3AW0A 3F0OA 1O2PA 4AOQA 1NS3A 5EU8A 1JRTA 3QK1A 2QCYA 1T7CA 2K1QA 4DIIH 1RFNA 4ABFA 2XRCA 4ABGA 1WTGH 5A0AE 1CE5A 5EQQA 4UFDH 1BBRK 2KAIA 1LDTT 2UWLA 2AHME 5K7RA 1SGPE 2BD8A 2IPQX 3SYJA 1EZUC 5T6DA 3GY8A 4AYVB 4E06H 3GCHC 2M5TA 3ZZBA 3UY9A 2ALVA 1RTFB 5HKKD 1LCYA 1BA8B 2KX4A 4X6NA 2FI3E 1BTPA 1O5CB 3F2HA 1AVXA 2FX4A 2C3SA 2FO9A 1RTLA 4WXIA 4DOQA 2V3HH 4X6PA 4MNVA 1DITH 1ZSLA 1FDPA 2STAE 4ZKSU 1UK3A 1MD8A 4OS2A 4UFEH 3RXKA 2PV9B 2K8IA 3GY5A 2ZQ2A 4RN6A 1GI5A 1YC0A 1S82A 2GZ7A 1C2GA 5L2YH 1O3AA 4NIXA 2LNCA 5E0JA 2Z9KA 2P3FH 2AFQB 4JZIA 1HAVA 2HVYB 5C5OA 2KCYA 5ABWA 2ZGXH 1O35A 3LJOA 2BY8X 5C3NA 3KHVA 5FAHA 1MBQA 3RXRA 1GMCF 1CVWH 2BXTH 2P93A 3KQDA 1EX3A 4OS6A 5EGMA 3H7TA 2ODPA 2ZEBA 3Q3XA 1TE0A 3BSQA 4O9VA 1O37A 3STJA 1CHGA 1O2LA 2XCFA 3TH3H 1MBMA 1UTNA 1GJ7B 4CH2B 5E8EH 2AIQA 4M9FA 5LPFA 1E79D 4AFSA 2C8ZB 4RI0A 1O3CA 1C2HA 2HPPH 1UVSH 4NG9H 4AB9A 1C1NA 1J8AA 1GBMA 4XD7D 1M9UA 1GBKA 4XE4A 3ODDA 4LZ4B 1HB0B 1ZHPA 1MZDA 4AN7A 1HCGA 1F0UA 1EOJA 2HNTF 2FWWA 1P12E 4UDWH 4XSKU 2FTMA 5C1YA 3VEQB 2ZU2A 3V7TA 1CGHA 4ZMAH 2PUXB 2OC7A 1D3PB 3GY4A 2ZU1A 4K69A 5A8XA 1GMHF 2XBYA 3OYPA 4OS4A 3P8GA 1FIZA 1TRYA 3I77A 2PLXA 3ZVAA 1BMAA 1AZ8A 1DPOA 2Z7FE 1GMCG 4X6OA 2YNAA 1C5RA 1AFEH 3A84A 3SGQE 1BQYA 1QJ1B 1O38A 2TGTA 3NPSA 3RMLH 2AMPA 1AKSB 1EAXA 1TPPA 3F3BA 1BUIA 1TQ0B 1C5XB 3LJJA 1DLKB 1ZSKA 5L2ZH 1H9LB 4GPGA 1GCTB 1MAXA 3QLPH 1WXRA 2WPIS 2HLDD 1EATA 2PKSB 4Y10E 2J98A 3KQBA 4CRDA 4X2YA 2NU1E 3AK5A 5CHBA 4SGBE 2PUQH 2BOKA 4IMQA 1C9TA 2CK3D 4ZXYH 1QHRB 1NC6A 1YPMH 2YNBA 2PR3A 2GMTB 4Y71A 1C1TA 3GYMA 3K2UA 1GMHG 4H6SB 1ELFA 2OUAA 1C5LH 3GCNA 2CHAC 1O31A 4GHTA 1P2KA 1VZQH 2BY9X 1ANCA 9LPRA 2FOEA 1P2JA 2Z3CA 1QCPA 1HRTH 1O5BB 1T8OA 2OC1A 1HJAB 3FOAA 3UFAA 1W3CA 1TABE 1HAPH 4FUBA 2HOBA 1TB6H 4FUCA 1AGJA 3P8OA 4VGCC 3FO8D 1LPGB 2GT7A 4YO9A 3ZYDA 1YPJH 3T5FH 2Z3DA 4MPUA 3MTYA 1YPHE 1OWIA 2OK5A 3DSOA 4X1RU 4BAOB 1HNEE 1SPJA 4ABBA 2CF8H 1OXGA 2EEKA 1GI3A 5HGGA 3MFJA 5FX5A 3L3TA 1O39A 1EPTC 1AE8H 1SGCA 1TBZH 1P0SH 2KAIB 4O03A 1E1RD 8ESTE 3TNSA 1EFRD 3CNRA 1NY22 2ZGBH 1FIWA 1ZPBA 4M7GA 5I46H 1KY9A 4X1QU 3BN9A 2CGAA 2PSXA 1MTVA 1QBOA 1HDTH 2Z94A 6LPRA 3GICB 4X2WA 3EDXB 2ZGHA 2JDID 1SHHB 4KP0A 1EASA 6ESTA 4DJZB 1C5YB 3PMAB 1BOQA 3ZZ8A 3RM0H 5CHAC 1ELVA 1GBHA 3TGJE 1SI5H 1DUAA 3SJ9A 3PLKA 2V0BA 2XBXA 4U01A 4X8UH 1FI8A 4LXBH 3TJOA 1ZYOA 3MU1A 3FKSD 3A7VA 1Y59T 2G5NA 3B8JA 1GJCB 1O32A 5A2MH 2SGDE 2ZC9H 4IGDA 1JMOH 3G01A 4MNYA 1YCPM 3DFJA 4FUIA 3P8FA 5AFYH 2O9QA 3RC5A 1C5TA 3FP6E 3D65E 2XXLA 4TYDA 5EPYA 2ZA5A 4H4FA 2PKAA 5FXLA 4DGJA 3PTBA 4NIVA 2FMJA 3VXEH 4OGXA 4ZHLU 2FEQH 1A5GH 4I8KA 1PQAA 2XBVA 2ZF0H 2HPQH 2RFKC 4Y8ZA 3BV9B 4WJG2 3SZNA 1HXEH 3GS9A 1L4ZA 1MD7A 1PQ5A 4I31A 1BJUA 2L74A 4K1SA 1SGYE 4ASUD 1NU7B 2W7SA 4YOIA 1GI8B 1O2GH 2ODQA 3A7TA 1W12U 2HRVA 2C8WB 3ZV8A 1B0EA 4ZAEA 4ISIH 3KGPA 2XOKD 1DXWA 2XCNA 4JZDH 3LC3A 1DS2E 4NA7A 2Z6BD 3A82A 1RGQA 1Q2WA 1IQMA 1W0ZU 5CDFE 4KTCA 1XM1A 3M7QA 5AVDA 4A1VA 3E90B 5DPAA 1C2DA 3L6PA 1WYKA 1SKYE 2A7HA 8KME2 4X1NU 1LMWB 3BTGE 4Y76A 1K1IA 3LGTA 4YOGA 3URDA 3QZRA 5F8TA 3PWBA 4U30A 4YXWD 4B2CA 3MNBA 1EAUA 3RXBA 3Q3YA 2V6NA 1C5VA 1DY8A 1NT1A 2GTBA 4ESTE 2JJ1D 1TNLA 3RUOA 1AVWA 3P70B 4Y11E 1XKBC 2ZHWH 4MVNA 3RXFA 1HLTH 1RJXB 1GI6A 2FOCA 1KXAA 3PYHA 3OEED 1THPB 2VGCB 1BHXB 2PFEA 4B75A 4WXVA 1IHTH 1ELCA 1JIRA 3KQEA 3UIRA 3UQOA 1WOFA 4YZUA 2ZU4A 4JYTA 2ULLA 1UTKA 4AFZA 1HAXB 1RRKA 3PMBB 1K2I1 3RXIA 3FAOA 4TT3D 3KQCA 2UWOA 1FN6A 1C5UA 1L1NA 1GBBA 3A83A 2AIPA 1GI1A 2JKHA 1A5IA 1GHAF 1VGCB 2B8OH 4JCNA 4CRGA 1F0SA 3SZEA 3ZZ7A 2V7QD 1VITH 1LKAA 1OWJA 3F9HA 2J95A 2EI6A 2P3UB 3ZZDA 3V0XA 3RXLA 1QQ4A 3F6UH 3SUFA 1SGDE 2TRMA 1P2OA 2AH4X 2DUCA 3WWBA 1V2RT 4I86A 4XFQA 5TCCA 2GX4A 1G2LA 1GCDA 4NIYA 1G3BA 3A85A 5T6FA 4WH6A 4UONA 2QY0B 1EQ9A 1ZTLA 2W3IA 4NCYA 4X8SH 2GCTB 3UWIA 1G30B 4CHAC 1HJ8A 3SJOA 3UR9A 1ANBA 4RT1A 4NSYA 3ZIAD 3GISB 1EZXC 1NRSH 1TNGA 2BM2A 3MH4A 2OLGA 3HGNA 1A7SA 1LHCH 4JYVH 3C27B 3QN7A 4BNRA 1VJAU 1OYTH 1H4WA 1P2MA 4B71A 3H5CB 2L6OA 2TGPZ 2LP6A 4ZKOU 2BY6X 1GHAG 4FETA 1HAOH 4GAWA 1XUJA 3P92A 1F5LA 2A4RA 3P95A 4J2YB 2OC0A 1F2SE 3BTHE 3PB1E 1C1UH 1SSXA 3ZZCA 2KCOA 3EA7A 4D76A 4H6TA 3TK6A 3DUXH 1NRRH 2JH5D 1O34A 2YMSB 1ETRH 1LPZB 1UK4A 1ZTJA 4IMZA 4DT4A 1V3XA 2AS9A 2ZDLA 3PMJA 5E0HA 1D3TB 2ZDMA 2OINA 3BG4C 1ZR0A 1AFQB 5TJXA 4I8HA 1TNJA 3M35A 1ESAA 1AZZA 1AWHB 2XNDD 2VU8E 3P17H 1GL1A 2UUKB 1MCTA 2THFB 3GYLB 1CBWB 4JMYA 2ANKH 5DP6A 1V2QT 2I6SA 3MHWU 1S83A 1C1OA 1LPKB 1OOKB 4AC9A 5JBAS 1UCYE 2EI8A 1DLEA 1L1JA 1TX8A 1TWXB 2PKAB 4UEHH 1ZZZA 1VCPA 1WCZA 2VBCA 5T6GA 1MTNC 2JIZD 1YM0A 1FY8E 1N8OB 4AG1A 1QB9A 3E0NB 2GDDA 4FUDA 3E3TA 1O2IA 1S0RA 2PTNA 5JBTA 4ACAA 1WU1A 1O2TA 3RP2A 3LH3A 3M37A 1GBAA 3FFGA 3P6ZB 1GHVH 1A4WH 1ID5H 5E0GA 5FL7D 5FBEA 2O8TA 1AIXH 3K6ZA 1BDAA 1UW7A 1SG8B 1V2OT 3VB5A 1GBJA 1EPTA 1QIXB 4OS1A 4BXSA 2WV9A 1EOLA 2J9NA 4THNH 2FOHA 2R0LA 1FY4A 2IPHA 2J34A 1NBME 5T3HA 7LPRA 1S6LA 1KTTB 3GCHB 1KYNA 3HK6B 1YBWA 3UUZA 3S9CA 2FI5E 4FOUC 5IYTA 3CP7A 1P2NA 1QL9A 1BTXA 4NZQA 1FJSA 4P02A 2V3OH 2BLWA 1SR5C 4OGYA 3JZ2B 1ZTKA 2FP7B 1GVKB 4Y79A 2BB4A 4ZCNA 5LPRA 3O8BA 2Y6TA 3MO3A 5HXFA 4U32A 2QXGA 1T8LA 3FZDA 1FY1A 1T4UH 1W7XH 5FBIA 1CA0C 5L30H 2C8XB 5EXMA 1GMDF 5KECA 3BEIB 1IQIA 1DSUA 4FUHA 2PHBA 1GVLA 1SQAA 1TONA 1SC8U 2ZFQH 4O3UA 5AF9H 3FANA 1SGNE 2GZ9A 3MNXA 3OFND 1QA0A 4B2BA 5EODA
chains in the Genus database with same CATH topology
1NFYA 3TU7H 3SQHE 2Q6DA 3A8AA 4MNWA 2BDIA 3D62A 2AERH 1DDJA 1SL3A 3QTVH 1UCYK 1JIMA 4TWWA 3A7WA 4HTCH 1C1MA 4DY7B 1G36A 3MNSA 2SGPE 1B5GH 4R8TB 4FU8A 2ESTE 3E6PH 2HVXA 1HAHH 2IJOB 1ELTA 1O3FA 3OSYA 1OYQA 3LGWA 1RIWB 3RMNH 5EG4A 4I33A 1O5EH 3RXHA 1NM6A 4NA8A 4DVAU 1PYTD 1PPGE 1TOMH 1F7ZA 1Y3YA 2ZTYA 4NIWA 4MQAA 3D49H 2QF0A 2OC8A 2BMGB 2WPHS 1OKXA 1ELDE 5A8YA 1AB9C 1S6HA 1T31A 3V13A 1DM4B 1GMDG 4OS5A 1RD3B 2OQ5A 1QB1A 1GGDB 2BDCA 2Y7XA 1Z71A 2SFAA 2UUYA 1G2MA 2BQWB 1ZMLA 1V2JT 3A89A 2PWXA 1OS8A 1CGJE 1TLDA 1JBUH 3SU0A 2O8WA 2JH0D 1P2IA 2Y7ZA 3MH7A 1FZZA 1INCA 1AU8A 2A1DB 1IHSH 1IQKA 1AD8H 1O2KA 1XUHA 3LONA 1P57B 3BTQE 2R3UA 2ZTXA 1BRUP 4K1TA 3U69H 1V2PT 1AN1E 1GJBB 2HNTE 2ZWLH 3HKIB 1MU6B 2R9PA 1AO5A 1THRH 3SORA 1PPBH 5J4QA 1P09A 1VJ9U 5EOKA 4ABJA 1ZSJA 2ZDVH 1HIAA 5B6OA 1KTSB 1TX7A 2R3YA 1WQVH 3OY6U 4A92A 3V3MA 3ENSB 5GXPA 1GJ8B 6GCHF 2FM2A 3SOSA 5GCHF 2WYGA 4J1YA 2BY7X 3TK9A 4CBOA 2Z9LA 3SI3H 1GBDA 1V2UT 2R2MB 4RKJB 2GZ8A 1FPHH 1IQNA 1LVYA 3RXMA 1C1RA 1E36B 1FONA 1O2YA 1TA2A 1TRMA 1WQSA 2VH0A 1O3PB 3M5NA 1ANDA 2BY5X 1DANH 1NROH 4GLYA 1O33A 1UHBA 2B9LA 5GWZA 2CHAB 4MG3A 1O5GH 3DFLA 1Z8RA 1YGCH 1T8NA 1WTHD 1O3GA 4ZKRU 1WV7H 1EJNA 1PPFE 1T32A 2H6MA 2QC2A 3ZVCA 4X2VA 3RXTA 1OPHB 3QO6A 1SHYA 1W13U 3U1IB 4VGCB 5LPEA 1GG6C 5JYIA 2LPRA 4LK4A 4K60A 3MO9A 1IQFA 3MU0A 3QZQA 3BEUA 1U6QA 2QGRA 1H1BA 2B5TB 3Q76A 4U2WA 4UFGH 2DE9A 4BAHB 1O5AB 2ZNKH 4K8BA 3AW1A 3LGYA 1DWBH 4XOJA 2P8OB 3BTTE 3NCLA 2BQ6B 2QXIA 3KEEA 6GCHG 1QGFA 4ZHMU 4DIIH 1AHTH 1CA8B 5GCHG 3A8CA 2BDAA 5DP9A 5DP5A 1GHZA 3GDSA 2FDAA 3VPKA 3TGKE 2ALPA 2BLVA 5FCKA 4WY3A 1NRQH 1NO9H 4BANB 3MI4A 3BF6H 3S7HB 2B7DH 2W26A 3U1JB 1V2WT 1TQ7B 1PQ8A 1J14A 3EYDA 1THSH 1OWKA 4BTIB 1YPEH 2G5VA 2VJ1A 2ZKSA 3F1SB 4F4OC 3HGPA 3M3SA 7ESTE 5FCRA 5CHAB 2ZHEH 5F8XA 3GY6A 2ZU5A 1CT4E 1WSSH 1VCWA 2A32A 3LGIA 3B9FH 2FESH 5K0HA 2QA9E 3FZZA 1QURH 3I78A 1QJ6B 1BCUH 1GCTC 1BB0B 1G3CA 2GV6A 1JWTA 5DJ7A 2PKSC 3RLYH 2RDLA 1UTJA 2P3TB 4K8YA 1N1LA 3V12A 1JXPA 3SHAH 1O30A 1DVAH 4K5ZA 3ZZAA 1SB1H 4KTSA 2WPLS 1TGBA 3TJNA 1ZOMA 4ABEA 1YPLH 4ABIA 1A0HB 2ZCKP 1O3LA 4K1EA 2VVUA 5HYOA 2JETB 4Y0ZE 3BTDE 1C1PA 1UVTH 5DO4H 5JBBS 1QRZA 3TNTA 1EZSC 3LOXA 3RLWH 1C4V2 1C4Y2 5FX6A 1Z8JB 1UVUH 3LDXH 1HJAC 1YPGH 5A09A 2J4IA 3E0PB 3ATLA 1O3OA 2XYAA 2CN0H 3BEFB 3A7XA 2C93B 5BPEA 3NXPA 1DFPA 3LGUA 1YCPK 5DK1A 1QJ7B 1WAYB 4AB8A 3FP7E 1H9HE 5GIBA 3SV8A 1QQUA 1EKBB 5DP3A 3VGCB 2P59A 2VVCA 1K1LA 2BDGA 1NFXA 3RMOH 1DWCH 1O5FH 1HAVB 1SLWB 4AZ2B 1Z8GA 1Y3VA 3CS0A 4ZHAA 1P3CA 1QL8A 1ZHRA 3ZVGA 3ATIA 1EB1H 3KIDU 4ISHH 1O2QA 3E16B 3FVFB 2AYWA 1PFXC 1DOJA 2J2UA 1NFUA 5C1XA 4E05H 2C90B 2FYRA 2GT8A 5C20A 3GDVA 1FMGA 5HM2A 1KLIH 4JK6A 5EW1H 2GD4B 1P11E 3T28A 1D6RA 3Q3KA 1G32B 1XXDA 2PGQB 1V6DA 3A86A 3GCOA 3KNXA 1P04A 1W8BH 1UTOA 1Y3UA 2VIVA 4KKDA 4FXGH 3ZZ3A 2ZCHP 3E1XB 1C1QA 1HFDA 1C2LA 2GGVB 4SGAE 1MTSA 4FUEA 4CBNA 1QRXA 1OSSA 2BHGA 1HAGE 2B0FA 3PO1B 3SN8A 2BDHA 2ANWA 1EUFA 4QT8C 5HMAA 3RC4A 6CHAB 1F92A 1SLXB 4IN2A 3PV4A 4WF8A 4YT7H 3ATMA 3DT0H 4IC6A 1EJAA 1ZPCA 3ZVEA 1UHBB 5EQRA 1KDQA 3ZVFA 2XNIA 1J15A 3BIUH 1HBTH 3RU4E 3M5OA 1ESTA 5C5NA 1ARCA 1E35B 1O2XA 1YP9A 3SW2B 2R0KA 1MH0A 4BAKB 1GJ6A 2PSYA 2J38A 1P03A 2F9VA 2FLBH 3ZV9A 4JZEH 1MTWA 1KIGH 1ETTH 1MUEB 4A5TS 4JZ1A 2A5AA 1GJAB 1LVMA 2ZFRH 1SGIB 4NSVA 1D4PB 1TMBH 4ZXXH 4CHAB 3AAVA 1GBIA 2STBE 3RC6A 1FLEE 1E37B 2CMYA 3SV7A 1GL0E 3RMMH 1GBTA 4JK5A 1TALA 1V2VT 1BJVA 8GCHF 3SJKA 3MH6A 1IAUA 1UTMA 4I8GA 1EAIA 4Z6AH 4KGAA 2FXRA 2WV5A 1XXFA 2NU0E 1TX6A 1C5OH 4INKA 4X8TH 1LVOA 1PPZA 1S0QA 4UFFH 3UQVA 1SLVB 2P16A 2EA3A 3U8OH 2A0QB 1TGTA 1O3JA 3K65B 5F6MA 1HJ9A 3BTME 1TGCA 3UTUH 1BZXE 4RKOB 2H9TH 1C2MA 3HK3B 3IITA 3HKJB 4X1SU 1KXEA 4AGKA 2H5CA 3S7KB 1UK2A 1UTQA 2RG3A 4H42U 3SU3A 3VB3A 2FIRH 3EA8A 3SNCA 2NU4E 1C2FA 1TBQH 1TMUH 3BG4B 3SI4H 2G52A 1NRNH 3M5MA 1S5SA 1Y3XA 1TMTH 1T4VH 4FVDA 1G9IE 2GDEH 1OP2A 3RXVA 2ZPSA 2VH6A 2XC0A 3UNSA 7KMEH 3VB6A 2HWLB 4JZFH 1ZPZA 2ZCLP 3NK8A 1ARBA 1Y5BT 1YYY1 8GCHG 1P01A 3E91A 3Q77A 4NGAH 2ZFPH 2G4UA 2ZPQA 3M3TA 2BX3A 4INLA 4WMFA 2ZHFH 1VGCC 3STIA 1UCYH 1QB6A 3K6YA 2WPMS 3JZ1B 3RXCA 2O8LA 1O3DA 1D3QB 4UE7H 2BVXH 1HAYB 2A5KA 1HGTH 7GCHF 1VITF 1TA6A 1MZAA 3PWCA 1YPKH 1CO7E 2EC9H 1OWEA 4OS7A 1MKXK 2F9NA 1S85A 1EXFA 4MNXA 3MU4A 3NZIA 4MPWA 2WUBA 1L1GA 3SUEA 1SGRE 4Y0YE 1SOZA 2IN2A 2ZDNA 1K21H 1C4U2 3SO3A 1C1VH 2VIWA 4HZHA 2H2ZA 2TPIZ 4DCDA 2FS9A 4X0WU 1TNKA 2H9EH 4Y8YA 1ZRKA 1IQHA 1SGFA 1SGTA 1AE5A 1ZMJA 2ZFSA 4XBCA 1GBEA 3ITIA 4NFEA 1GI0A 1UO6A 2A2QH 5CMXH 2XC4A 5A8ZA 1BMLA 1GVZA 1KXDA 4X6MA 1O2ZA 3OY5U 1Z1JA 1E0FD 4ZUHA 3RXUA 1C2JA 1P2QA 2CJIA 1MMJN 2SNWA 1SGFG 3GOVB 1ZGVA 1YLCA 1W7GH 1ELBA 1B7XB 2ZPRA 2O8UA 1AKSA 1GI9B 2Z9GA 7GCHG 1G3DA 1VITG 4ZROA 2BVSH 5FHTA 1CSOE 1P05A 1DICA 1O0DH 3ZZ9A 4WMEA 3RXSA 1GJ9B 1GHBF 1TIOA 4Q7ZA 3BTEE 2ZO3H 4YM9A 5EXLA 3SGBE 3RXJA 3NUMA 3TJUA 1O2JA 3MNCA 1LKBA 1FAKH 1XVOA 1ZRBA 2VIPA 2TGAA 1PPEE 1YPHC 2BLQA 2VIQA 4A6LA 4INHA 1FQ3A 2GV7A 3UWJH 5JDUB 2BZAA 1A0JA 1F5KU 3ATWA 1BMMH 1SLUB 3ESTA 2A4GA 2A5IA 2ZZUH 3VXFH 4AFUA 2PTCE 1O36A 2HLCA 1LHEH 2QIQA 3SBKA 1O2SA 2ANYA 2W7UA 1ZHMA 2ZQ1A 3F9FA 3LT3A 4TY7A 1W10U 5A0BA 1C1WH 1PYTC 3A8DA 3AVZA 1O2OA 3LKWA 1N8OC 3BIVH 2VWLA 4AORA 2WUCA 3MH5A 1C5ZB 3NKKA 4K3JA 2ZHDA 3TH2H 1FPCH 2BLOA 5F03A 3W95A 1ELAA 1AMHA 1K9OE 2A45B 2OXSA 1O2WA 4AX9H 1B0FA 1GHBG 3TK5A 1ABIH 1O2NA 5DP8A 1W11U 1QY6A 3KCGH 4ISLA 1UVPA 1LQDB 3MU8A 2Y81A 2UUJB 5JPMH 2D2DA 1P9SA 2G55A 1NN6A 2AGGX 3RXDA 3TJVA 1A2CH 1LHFH 1AUJA 1LQEA 1OP0A 1VR1H 1GWAA 1NRPH 2F91A 3CENA 3PLPA 1A3EH 1PJPA 1EAWA 5AFZH 1QA7A 1UJ1A 3RDZA 2CV3A 1TFXA 4I8LA 1MKWK 4PROA 5LGOA 1ORFA 1DX5M 1S6FA 4A7IB 3T29A 2FOBA 5ETXA 2ASUB 1PPHE 1C9PA 2Y80A 3UR6A 5G4BA 4IS5A 1O3MA 3TLOA 1YF4A 2UWPA 1HXFH 2BD5A 1EZQA 1FNIA 1LVBA 4IN1A 3N7OA 5AHGH 1TNHA 1MAYA 2G8TA 3KL6A 3TPIZ 3KN2A 1UTPA 1CHOF 2P94A 3H7OA 2WV4A 3BG8A 4ISNA 5FPTA 1G37A 1CT2E 2OCVB 1BRAA 1K1NA 2A4QA 1BTHH 4TWYA 1KLJH 1SBWA 2CF9H 2XTTB 4A1TA 1DSTA 1XUFA 3RXOA 2G00A 1KLTA 3D23A 1OWHA 5GPIB 1L0ZA 1P3EA 3ZZ4A 4CR9A 1TRNA 1GDQA 2D1JA 2Z9IA 1RTKA 3Q00A 5FPYA 5CE1A 2C8YB 4FUFA 1GJDB 3BTKE 1XVMA 1O2RA 1AWFH 3PLBA 5E2OA 3PROA 1GBCA 1TOCB 3TVJB 1AUTC 3OU0A 1JRSA 1OWDA 3ELAH 2BDBA 4CREA 3KF2A 4HGCA 3M5LA 3RXPA 3SNBA 1ZJKA 4FUJA 1HPGA 1O5DH 1Z6EA 2VINA 2D8WA 4D7GA 1GG6B 2FX6A 3RXGA 1GBFA 1JOUB 3A87A 3QWCH 3SQEE 1SMFE 1RIWC 1YCPH 1CHOG 4Q7YA 3MO6A 3VB7A 3I29A 4ABAA 1O3EA 2A2XH 4KELA 2VIDA 2G4TA 4MDSA 4YTAA 1BHXF 1Y8TA 1TAWA 2V35A 1NFWA 2BDYA 2OTVA 1O2HA 4CH8B 1L2EA 2Q1JA 2TIOA 1ESBA 3UOUA 1SGEE 5FPSA 1RXPA 1GGDC 1TYNA 1SGQE 1GI7B 3S9BA 2F3CE 1V2TT 2NWNA 5HM9A 3SU6A 3A88A 2VWOA 2AEIH 2FOAA 1KXFA 3BTWE 4E7RG 3DHKH 4NWKA 1DUEA 1HAIH 3T2NA 3WY8A 1ELEE 3F9GA 3S9AA 1H8DH 1GJ5H 3URCA 1ELGA 1OX1A 1K1OA 3T27A 2ZTZA 1N6XA 3SU4A 2G51A 8LPRA 3MU5A 1O3NA 1SOTA 1WBGB 2BXUH 1D6WA 1UTLM 3RU4D 4DW2U 1BTWA 1EPTB 2FPZA 3ZVDA 4HI3A 4AFQA 5C67A 1GPZA 2ZI2H 3SHCH 4MPVA 4YT6H 1P10A 2JH6D 1GI2A 5ESBA 3RU4T 4FU9A 3A7YA 3A7ZA 4BOHA 1L4DA 2CXVA 1FY3A 1F0RA 2ZDAH 3VFEA 1EP5A 1O3KA 2BD9A 2XC5A 1Z8IB 3IG6B 5SGAE 2NU2E 4DT7B 5BRRE 1VCQA 2XWAA 5DGJA 2ZGCA 3TGIE 2IOTA 3BTFE 2W3KA 2BVRH 2FOFA 3M3VA 4B73A 2TGDA 4YLUA 4D9QA 2VVVA 1P9UA 3PM3A 2SGAA 2QF3A 1J17T 3QDZB 2FOMB 3LU9B 5L6NH 1TPSA 3GCTF 4FUGA 1Z7KA 1N6YA 3VB4A 2SGFE 1FXYA 1TNIA 3OX7U 1C2EA 1D9IA 4IC5A 1NTPA 1QR3E 1AVGH 3EQ0H 3QTOH 1QL7A 3MYWA 1ZMNA 2ZHQH 1DY9A 1O2MA 1TGNA 2P8OC 2Z9JA 1A61H 4X1PU 1LHDH 3MOCA 1Y5AT 4CRAA 2GMTC 3EGKH 2FYQA 3RXEA 2ODYB 5A0CA 5J4SA 1EJMA 3ODFA 4E7NA 3E8LA 1HAZB 1ACBE 4NA9H 4Y7AA 5TCAA 3RXAA 1TPOA 2GP9B 1IOEA 1TPAE 4R0IA 4XBDA 2DE8A 1DXPA 1O3HA 3SU2A 4ZKNU 4BAQB 1BITA 2GKVE 1OP8A 5JB8S 2F9PA 4TY6A 2FS8A 1TGSZ 3LH1A 3QGJA 5PTPA 3LPRA 2ZGJA 1Y3WA 3O8CA 3GY2A 3GCTG 3W94A 2Q6FA 2YOLA 1G3EA 3C1KA 3M7UA 2FI4E 2GCHF 3FP8E 1NPMA 4FVBA 3SNDA 1C5WB 5C1UA 1C1SA 1W14U 2BD3A 2WPJS 1P8VC 5GDSH 2J94A 1T8MA 1HV7A 4TPYA 1BMNH 1XUKA