2FOBA

Structure of porcine pancreatic elastase in 40/50/10 cyclohexane
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords elastase-1
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fobA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fobA01
1AN1E 1QB6A 3OY6U 1GJCB 2EI6A 1OWDA 2GV6A 1YCPH 1ZTJA 1X7AC 1KLIH 3PTNA 4HZHA 3RXPA 3URDA 4X6PA 4R8TB 1GJ4H 1QR3E 3KQDA 1THPB 3SJKA 2PSYA 4NIVA 3H7TA 1AFQB 3A7ZA 1BMMH 2RDLA 1MTWA 5FX6A 1HAIH 4BAOB 4F49A 1SGIB 2VIQA 2GMTB 2P3FH 3LH1A 1MTNB 1FAKH 2WYGA 3UUZA 1W0YH 1V2MT 1LTOA 1NN6A 4ISOA 4YZUA 3LT3A 1MZDA 1NRSH 1BTPA 1TX7A 1C2KA 2WUBA 3EA7A 4ABBA 1HFDA 3PO1C 4FUFA 2Y5HA 1TGBA 1MKWK 2WUCA 3LJOA 4B75A 1PPZA 5K0HA 1S5SA 1HXEH 1ABJH 2BVSH 4CRCA 1ZYOA 5LH8A 3PV4A 4INKA 1GHYH 2ODPA 1PYTC 2R2MB 1IQKA 5FCRA 3CS7A 4MNVA 3O8RA 1A4WH 3FVFB 1PPCE 4NWLA 1OS8A 3C27B 2GCHF 3BV9B 1HXFH 5EPYA 3RXBA 4Q7XA 2VH6A 1C5VA 1EX3A 3I77A 2BY5X 5CHAC 1SFIA 1O2WA 2QXJA 2ZDVH 1P2NA 2WPKS 1FLEE 2VU8E 2SGEE 3JZ1B 1FONA 4ABGA 2ULLA 2GT8A 3IWMA 2BDGA 2K1QA 4X2YA 3A80A 3UWJH 3GDUA 3K6YA 2FTLE 1C5PA 1YF4A 3UPEA 1DLKB 4FUEA 5BRRE 6GCHF 2ZKSA 1K21H 1Z8JB 1GMCG 1TNLA 3MMGA 3RXTA 3F1SB 1UO6A 4YESB 4A6LA 5K7RA 1BA8B 2BDCA 2SGDE 2ZU5A 4JYVH 1NPMA 2Y7XA 1YPHC 1ABIH 3KQBA 5A0AE 1SQAA 3GYMA 3U1IB 1W8BH 4NG9H 4Y71A 2SGPE 1OWHA 4SGBE 2BD3A 2OC1A 1ARCA 2FDAA 4MPWA 4JMYA 1THSH 5A8YA 1ZZZA 4WVPE 1DFPA 3UQVA 3SOSA 1MTSA 3NWUA 2TIOA 2W3IA 3QTOH 5FPSA 1O34A 2BQ6B 1P2JA 2D1JA 1BJUA 2NU2E 3MFJA 3GCHB 1SQOA 1S83A 1GJAB 1Q3XA 2FODA 1RGQA 3SNAA 3RXUA 4I8LA 1FV9A 4ZXYH 1DWDH 3M37A 2FOMB 2GCHG 3VXEH 4D7GA 5HXFA 3ZYDA 2DE9A 2ZGBH 3BTKE 3ZVEA 1IQGA 2AMQA 2Y6TA 3NXPA 4DG4A 3SUFA 1M9UA 1ZGIA 1ANCA 1TBZH 1TRNA 1V2NT 3SN8A 2V6NA 3P8FA 1LQEA 3TVJB 3BEFB 3EQ0H 4WMEA 1C5WB 3W94A 4ABEA 1P2IA 5C1XA 4FUJA 1ESTA 1VITH 1GDQA 3GCTG 1JXPA 1MBMA 1P2OA 3RXEA 1A5HA 5A09A 1H9IE 5DO4H 1L2EA 3OY5U 3P6ZB 1SLUB 3RM2H 3SV8A 1Y3YA 1V2ST 2UUFB 3MU5A 2PLXA 4XOJA 1MCTA 1GBMA 7GCHF 3V3MA 1A46H 1UVTH 2ILNA 3SJ8A 1AFQC 1ZRKA 2FPZA 1O3KA 1K9OE 2V3HH 1P01A 5GIBA 1ZPZA 3A7TA 3RXQA 1ELCA 1N1LA 3T5FH 4CBOA 5E2OA 2WPLS 1A5IA 1AB9B 2Q6FA 3LGYA 2BM2A 2R9PA 1MD7A 3SUEA 1RXPA 5C5NA 3PO1B 1ELBA 5F8XA 2OQ5A 3I78A 1UJ1A 2Z9GA 3GY3A 1J9CH 1AQ7A 3D62A 2ASUB 1Y8TA 1TFXA 2V3OH 3TU7H 2ZHDA 1QQ4A 2Y5FA 3BF6H 1W11U 1IOEA 2Z94A 1MU8B 1S85A 3A88A 3MHWU 8LPRA 2G55A 1AD8H 1XXDA 5HM9A 5GCHF 3TLOA 1O3NA 5AFZH 1UTMA 1KYNA 1BUIA 1DXPA 2ZHEH 4QT8C 1GHBF 2FXRA 4KGAA 1QJ6B 3S0NA 1C5NH 2HVXA 1C5MD 1SOTA 3JZ2B 3LGVA 1XUIA 3SGQE 3NCLA 3A8CA 2JH6D 1FAXA 3GISB 4FXGH 4Q2KA 3UNQA 2PKSC 4GUXA 5C3NA 1T4VH 5C1YA 1S81A 4THNH 2F9PA 3S9CA 1O38A 1GMDF 2FP7B 5L30H 3GICB 5F8TA 1GI8B 2FYQA 2A32A 1W2KH 4JZIA 1F2SE 3O8CA 3SZNA 1XMNB 3EAJA 3U69H 1W10U 1O2RA 3EYDA 5J4QA 1YC0A 1KXDA 2A5IA 1AIXH 3NK8A 3GDVA 2PWXA 1YPGH 4X2VA 1EXFA 3AASA 2PTCE 4UFFH 2YOLA 1GHAG 2PHBA 2LNCA 1TRYA 1YBWA 1TABE 1BZXE 1E0FD 1F5LA 1O3PB 4ZAEA 1DANH 4LK4A 2TRMA 4ZUHA 2ZGJA 1VGCB 1C1OA 1B0EA 1OXGA 3SU6A 2Q6GA 3MOCA 3CP7A 1HRTH 1SB1H 3SHCH 4Y8YA 5JBCS 1G9IE 2VGCC 1UTJA 4B1TA 4ABIA 5J4SA 1GHWH 1JBUH 3E91A 3LOXA 8GCHG 1LVBA 4LZ1H 3E16B 1KXCA 2TBSA 2GVFA 1IQFA 2JH0D 5EQRA 3BTDE 3ZZ7A 3OSYA 1AE5A 1O2YA 3RXSA 1CGHA 1O32A 4IC5A 1EQ9A 2LPRA 5HGGA 3ZYEA 1EJAA 5HYOA 3A8DA 1NRQH 1O36A 1AO5A 2VWNA 3BN9A 1XKBC 3UR6A 1ZRBA 2ZCHP 1GJ6A 1UVOA 3LIWA 4YLQH 5A0CA 1C2FA 1A7SA 1C9TA 2DUCA 2RCEA 1EAIA 1HV7A 1RIWB 2J9NA 3N7OA 2A4QA 2ODYB 5A8ZA 4A1XA 5C20A 1A61H 3HKIB 1V2LT 3E0NB 2GX4A 1QJ7B 1JIRA 1Q2WA 4TWYA 3RXRA 4XE4A 3T2NA 5TJXA 3BTGE 4MNYA 2WPJS 1EB1H 3QLPH 2PKAA 3F9FA 1D3QB 3RXMA 3M35A 4JZ1A 3SQEE 4Y11E 4GVUA 2OD3B 1GVKB 4FUCA 3NKKA 1C2IA 4NA7A 2ZU4A 4X1SU 3T26A 4FUBA 1V2PT 1GHZA 2PTNA 1BOQA 4BANB 1A3BH 3K2UA 1NC6A 2NU4E 1G3CA 1SGYE 3EA8A 1RTFB 3Q76A 5TCCA 4A7IB 1Y3VA 5A2MH 4GLYA 4I32A 1GG6C 1P9SA 2ZFFH 1OWIA 1WTGH 3HK3B 7KMEH 3LGTA 1YPJH 3RUOA 1DUAA 1F0RA 1WCZA 2CGAA 3VGCC 4Q80A 1UVPA 4NFFA 2ZF0H 1SPJA 1O3MA 1SGQE 2ZTYA 1GDNA 9ESTA 2A5AA 2ZFTA 2XRCA 4YO9A 1SGFG 1EOLA 1YM0A 3U8OH 5CMXH 2Y80A 5EG4A 1G3DA 3IG6B 4GPGA 3ZZAA 1EAUA 1GGDB 2F83A 1O5FH 4WXVA 3BEIB 3A83A 4NGAH 3E3TA 1AGJA 1O3CA 2GZ9A 1WUNH 1CA0C 3MYWA 1O3FA 1QJ1B 1Z71A 3GOVB 4DIHH 1O2PA 3S9AA 5EQSA 1BRAA 3F9EA 1HIAA 1ZHMA 1LPKB 1TGTA 5JBBS 3ZZBA 3BIUH 1VZQH 1EAWA 2AGEX 1LKAA 1SLWB 2BD2A 2P59A 4ZKSU 3SNEA 1DX5M 3BTTE 3DT0H 1HAHH 4ABAA 3RXOA 2PGBB 1G37A 1TBQH 1Y3XA 4ZKOU 3TJUA 2ZC9H 2BZ6H 1MAYA 3SHAH 1FPHH 1O3AA 3K9XB 1BBRK 2AERH 1EATA 1LO6A 1ELTA 2P16A 1A2CH 2BQWB 4AOQA 1HAVB 1ZJDA 4X6OA 1MH0A 1P03A 2KAIB 4Y7AA 2UWLA 3KIDU 2PKSB 5DP3A 2UUJB 2ZDNA 1WBGB 3TGKE 2BXTH 1G3BA 3TH4H 2G52A 4DGJA 4ZH8A 1ELVA 3ZV8A 2OP9A 1TNKA 1ANEA 1W3CA 5C5OA 1O2OA 1L4DA 5FPYA 1T4UH 2ZQ2A 4MDSA 1UVSH 1D6WA 3KL6A 1TGCA 2ANKH 2F9OA 3BTFE 1MKXH 1Y3UA 5FBIA 2ZNKH 1YKTA 4YT7H 2B0FA 2OQUA 3SJOA 1W14U 1GBHA 2F9NA 1NTPA 1UHBA 1DY8A 3RXDA 4DURA 1GJ5H 2O8MA 1FN6A 2VWOA 2ZI2H 5EU8A 1QFKH 2BVXH 2KAIA 1BBRH 2A2XH 4YT6H 1P0SH 3QTVH 2J38A 4WWYA 1TX8A 1V2OT 2CN0H 3AVZA 3EA9A 4TPIZ 2AH4X 4MTBA 4K69A 1IQNA 2G4UA 1NFUA 1EASA 2ZHWH 2QA9E 3SI4H 3VXFH 5EW2H 5DP5A 5DPAA 1DSUA 3RXKA 1UTKA 2GD4B 3O8DA 1MKWH 2A4OA 2H1UA 4KTUA 3U9AH 1SR5C 3F6UH 1DICA 2FOCA 3GY4A 1NFXA 4XSKU 1S84A 1PPFE 5B6OA 1JMOH 1KDQB 4X6MA 1BMNH 3KN2A 4Y0ZE 1UK3A 1CT4E 1ZHPA 1C5RA 1HJ8A 4GAWA 1ANBA 1IQJA 1PYTD 1SHYA 1C1SA 1T8OA 1CO7E 1Y5AT 2OCVB 1ANDA 4I31A 1ZR0A 3CENA 4MNXA 2ZDLA 2XCFA 4Z0KA 2H9EH 4O3UA 2Z7FE 2AYWA 2BHGA 2GT7A 2W26A 3DUXH 3GY7A 4K1TA 3T28A 3TGIE 2O9QA 3LU9B 1WV7H 1TA6A 2BDAA 2ODQA 3RLWH 5FPTA 3L6PA 1PQ5A 2GCTC 4SGAE 1L4ZA 1GBFA 1O2HA 2CHAC 1O3EA 3MU1A 1J15A 1GMHF 1C5QA 1A0LA 5E8EH 2PFEA 4ABDA 2R0LA 2EC9H 2A5KA 1H9HE 2VGCB 3PYHA 1ZSLA 1HAGE 3VB6A 4CRAA 2XTTB 4FU8A 4YOIA 2VIVA 1O2JA 1AWHB 3DD2H 1CHOF 1D9IA 1P09A 1JOUB 1NS3A 4E05H 4KP0A 4HFPB 4X1PU 4MLFB 1C5UA 3PWCA 3BG4C 4X8TH 4Y8XA 3K6ZA 3ZVGA 3V12A 1W0ZU 3SU3A 3HATH 1SGTA 1ELDE 1G2MA 4NZLA 4JYTA 1GI0A 1C2MA 2D2DA 2ZGXH 3ZZ5A 3SORA 1P3EA 1BRCE 1BRBE 5L2ZH 3GYLB 1OYQA 4RKOB 1ZMLA 3M3VA 1O3LA 1EAXA 1P06A 2M5TA 3MO9A 2ZU2A 2VH0A 1QB1A 3GDSA 1PPEE 1A1RA 1LPGB 4X2WA 2HGTH 2XXLA 2H5DA 3RP2A 2GMTC 3STJA 3OU0A 1ZMNA 5EXLA 1GBKA 2OINA 2Q6DA 2FTMA 1P8VC 3Q00A 4U32A 1O5DH 3ODFA 2XBYA 3PB1E 4CRGA 2UWOA 4TWWA 1DWCH 1FPCH 1SGFA 3QWCH 6CHAC 2PGQB 1HAZB 2XNIA 1CVWH 1GHXH 5JDUB 4IMQA 3LC3A 1QA0A 2CXVA 2ZG0H 1SGNE 1DS2E 1DY9A 4TY7A 5CHAB 2W7SA 1V2TT 1UCYH 1GJ9B 1HPGA 3M3TA 4XBDA 1RRKA 3ODDA 4WH6A 2DE8A 1DOJA 1RJXB 1OSSA 1HAOH 4H42U 1FJSA 1O2XA 4UONA 1IQIA 2H2ZA 2VIWA 1UK4A 3M5OA 1HNEE 1C2JA 4MPVA 1O2IA 4FU7A 4VGCC 3ZVCA 2AS9A 1TIOA 4JK5A 2VVUA 1N6XA 1QRZA 1DVAH 4XBCA 3A89A 1ZLRA 2QXIA 2OUAA 3SJ9A 4A1TA 5HM2A 1BQYA 3OYPA 3NZIA 3RXCA 1K22H 5H4IB 4ABJA 1O3GA 1QBVH 3D49H 4NWKA 4GCHG 1C2HA 4A5TS 4NSYA 1GL1A 4K60A 1CE5A 2FX4A 4Y8ZA 1G3EA 1KSNA 3A86A 1NT1A 1EPTB 2RG3A 1YPLH 2BD8A 4O3TA 3B23B 4YOJA 5FHTA 1GJDB 4OGXA 1LHCH 3RU4T 4LZ4B 1GHVH 1OWKA 4D7FA 2SNVA 1SLVB 2EI7A 3L33A 1DWBH 1QL9A 4A92A 1XUFA 1GBBA 1Z7KA 2AIQA 1O5EH 4GHTA 3RXHA 1HJAB 1O2SA 1PJPA 2NWNA 2H9HA 2ANMH 3M36A 1GJ7B 4ASHA 2O8TA 2UUYA 3GCNA 5AVDA 3AAUA 4R0IA 1FMGA 3H5CB 2P95A 1Z1IA 2PUQH 3V7TA 4AORA 2FESH 4AZ2B 4FUIA 3ZVBA 2VWMA 1PPGE 1OP8A 3MNXA 4UFGH 1C1VH 2Y5GA 1KXBA 1TGNA 4K8YA 4O9VA 4JCNA 6GCHG 2VINA 3GCTF 1ESAA 1MBQA 1DWEH 2FI5E 4FUDA 4INLA 5EPNA 1ZTKA 3L3TA 2P8OC 4UDWH 3ZVAA 1SBWA 3TGJE 1W13U 1K1PA 3E90B 1J8AA 4CHAC 1Z6EA 4Y10E 2F9BH 2P8OB 3UNSA 3KF2A 1BITA 1W7GH 2AGIX 2NU0E 1MTUA 1C9PA 3URCA 3RXJA 1P11E 5ETXA 3BSQA 3SU1A 1TX6A 4GHQA 1MKXK 3ATLA 2G5NA 4BAMB 3KNXA 3P70B 4WXIA 5C1UA 2FI4E 1GMHG 6LPRA 1SGEE 1TQ7B 1GCTC 1TPPA 3SV7A 1S6HA 1FUJA 1WOFA 3FANA 1EZSC 3T62A 1EZUC 1HAVA 2GV7A 1EOJA 1XUJA 5LGOA 1TPAE 2P3UB 3SV6A 1F0UA 2QCYA 1P2MA 1L1NA 1XUKA 1O33A 3LC5A 8GCHF 4BAKB 1UMAH 1TOMH 2ZDMA 2F9VA 3U8TH 1FY5A 2XC0A 1BTWA 2HWLB 1MMJN 3M5LA 3PLBA 1F5KU 1NROH 1O2VA 2ZEBA 2GDDA 2YNBA 1O2NA 3QZQA 1TYNA 2STBE 4Y0YE 3C1KA 2BX3A 3QUMP 2JETC 1GBJA 2VVCA 1N8OC 2C8XB 4B2AA 4Q7ZA 2O8LA 4O03A 1BTHH 1KY9A 3OTJE 4GSOA 2STAE 2TGAA 3GY8A 3KCGH 3PLKA 1BTUA 3ELAH 4UD9H 3RC4A 4AYVB 1KXAA 1BCUH 4ISHH 1MUEB 3TITA 2ZU3A 1EZQA 1OWJA 2BOHB 3ZVFA 2R3YA 5DP4A 3ZZ3A 4ZXXH 5EQQA 4MG3A 1AVXA 3K65B 2PW8H 4BTTB 5G4BA 3MNCA 1YPKH 1SQTA 5DP9A 3E1XB 2HPQH 3A85A 3GY6A 1MTVA 2R3UA 3P92A 1GI4A 2JETB 1YCPK 4F4OC 4ZHAA 4ISIH 5T6GA 1O5BB 1Y3WA 3U8RH 3QO6A 1DPOA 2Z3DA 1O3JA 1O0DH 1GPZA 4JZFH 1HJAC 5E0JA 3E8LA 4GCHF 1V2UT 1AVGH 3VGCB 4I33A 2THFB 2XBWA 2PKAB 4ZHMU 4BNRA 1SGPE 1SFQB 2BZAA 4ISNA 4AFUA 1VCQA 1ZTLA 2Z9JA 1DM4B 4TY6A 2BX4A 1GI9B 1QL7A 2AFQB 2GGVB 1YP9A 1EZXC 3TIUA 1CQQA 2GDEH 3U98H 4IGDA 1THRH 1EPTC 2CF9H 1C2GA 4K3JA 1K28D 1NFWA 3UWIA 1EJMA 1K1NA 1TQ0B 2V0BA 2Z9KA 3ZZ9A 1D3TB 2FWWA 1CSOE 3PM3A 3DA9B 1H8DH 2B8OH 3VFEA 3M5MA 5T3HA 4KKDA 5E0HA 1J14A 1ZPBA 1YPMH 5LPRA 2G8TA 4INHA 3VB5A 1O2GH 5TCAA 4JZDH 1UTLM 3FAOA 1FQ3A 1QNJA 1HB0B 1A3EH 2ZPSA 1GI1A 1QURH 1TGSZ 5PTPA 1GG6B 1O3HA 3PWBA 4IBLH 4AGJA 1O3OA 2P94A 4D9QA 1NRPH 2Y82A 3V0XA 1QTFA 2FM2A 3BTEE 2RA0A 1G32B 3R3GB 4WJG2 1NY22 3UIRA 4X0WU 3LGUA 3MH4A 3ENSB 1BJVA 1C1PA 3Q77A 1CBWC 3TH3H 4OS4A 5DP7A 5DK1A 2EI8A 2ALPA 1ZGVA 3PMJA 5GDSH 3MWIU 3BTQE 1NRRH 4B73A 2Z3EA 1TMTH 2Z3CA 3RXLA 1WYKA 4DJZB 6CHAB 1LQDB 4YLUA 3CS0A 3TJVA 1RTKA 1LVYA 3M7QA 5ESBA 4ZROA 4E06H 1WU1A 1LHFH 3LGWA 4LOYH 3MU0A 4Z6AH 1GJBB 3A7WA 1TONA 2GP9B 1P02A 4DT7B 5LPFA 1NO9H 4ISLA 4NZQA 1EKBB 2O8UA 4TPYA 1NZQH 2OC0A 5GXPA 2P3TB 2QAAA 2ZFQH 3SV2H 1ZJKA 2ZCKP 1O5AB 2ZPQA 3TPIZ 1PQ8A 4X1RU 1PPHE 3RMLH 5AFYH 1FXYA 1S6FA 2SGAA 2ZDAH 5GCHG 1Q31A 1C1TA 3GY5A 4WY3A 3TJOA 1Z8IB 1XVOA 3MNSA 5CE1A 2I6QA 2I6SA 3RC5A 3FP8E 5F6MA 1W7XH 3ZVDA 3SU5A 3S7HB 3ATMA 1AKSA 4AGKA 3PMAB 1ZSJA 1GMCF 1O3IA 3BTHE 1GBDA 1O35A 4M7GA 2XW9A 1AHTH 1OP0A 3NUMA 3S7KB 2ZGHA 1UCYK 3RMNH 3UFAA 5I46H 5BPEA 1SGRE 3KEEA 3KQCA 2A4RA 1GBLA 2C3SA 1DDJA 2J95A 1TAWA 1TE0A 2C4FH 1QA7A 4RN6A 1PQAA 2Y81A 1H8IH 5JB8S 1O5CB 1O2ZA 1O2MA 5IDKA 3TK5A 3TNTA 1T8MA 3DFJA 5FXLA 3SQHE 3SUDA 2G5VA 1ELEE 4U01A 1RFNA 1FNIA 1ETTH 1G36A 5EODA 4BAQB 3SNDA 1D3DB 2Q1JA 4AG1A 1C5YB 1LHDH 2H9TH 5EXNA 3E6PH 2FOGA 4TYDA 1LCYA 1Y5BT 1Z8RA 1C4V2 2J94A 4K1EA 4AFZA 1ESBA 2H6MA 4CR9A 1E35B 2W5EA 1ETRH 2ANWA 2BTCE 1QBNA 3MTYA 2WPHS 3SO3A 5F03A 5A8XA 1MCVA 5ABWA 4DVAU 4JYUH 2QYIA 2C8ZB 1QCPA 3QN7A 4CBNA 1A0JA 3LKWA 2HPPH 3ZZ6A 3RXFA 1T31A 1F92A 1HAPH 1SC8U 4Q7YA 1KXEA 5L6NH 5JBAS 1VJAU 1B7XB 3QZRA 1HBTH 5FBEA 2C8WB 2XWBI 2ZPRA 3A7XA 2ZHQH 1Y5UT 1K2I1 3RXAA 1GMDG 1BIOA 1GCTB 2PUXB 1MQ5A 3SGAE 2QXGA 1O31A 2H5CA 1IQLA 1GVLA 1BHXB 1LVOA 1NESE 1P05A 4WMFA 4X2XA 1OYTH 3S9BA 4BXSA 1TNGA 1KLTA 3M7TA 2ZTXA 2FLBH 1TNHA 4O97A 3A8BA 1MQ6A 1AUTC 1EB2A 2VIOA 1Z8GA 1QB9A 5EGMA 1BBRE 3UREA 3FZDA 3I29A 4Y7BA 1NU7B 3SU0A 1F5RA 1C4U2 3SU4A 4ZHLU 1V2WT 1ARBA 3RXGA 1AU8A 2FIRH 1O2TA 3HGPA 4AB9A 4NIWA 1FZZA 3UY9A 3RU4E 1P57B 3VB4A 1C1UH 1AE8H 1U6QA 2VIPA 1HLTH 2D8WA 4FVDA 3P8GA 1JWTA 2HNTC 5T6FA 1TB6H 1SGCA 4RSPA 3A81A 1FY3A 1P04A 4OS1A 3EDXB 1IQEA 4OS2A 4DOQA 2BLQA 3H7OA 3ZZ4A 4D76A 2FOHA 4RKJB 2ZHFH 5C2ZA 4XFQA 2FLRH 3F9HA 5GJ4B 3SW2B 1UTPA 3PROA 1SG8B 4J2YB 3A87A 5A0BA 1JIMA 1UHBB 4PROA 1XKAC 1T8LA 1O39A 1BTXA 1YPHE 3HKJB 2C90B 4CRDA 2ESTE 2ZZUH 2Z9IA 1K1JA 4IS5A 4D9RA 1CU1A 1C4Y2 3BTME 5C67A 1ORFA 1P10A 1OOKB 3SBKA 5JPMH 3RMMH 4DIIH 2TGPZ 2AIPA 1TNJA 3UR9A 1VCWA 4B2CA 1LVMA 2FO9A 3PMBB 4FU9A 1FY1A 3BTWE 3W95A 1YLDA 1QGFA 1ID5H 2VIDA 1TA2A 1WAYB 2FYRA 2PV9B 4OS6A 4NIYA 1WQSA 2ZP0H 3A7VA 1VCPA 4DW2U 1GI3A 2PSXA 1K1LA 2HOBA 1CT0E 1DUEA 2ZDKA 3MH5A 1UVUH 4I8KA 1V2VT 3LJJA 4IW4E 3VPKA 3ATKA 2IPHA 3DHKH 2AEIH 2QF0A 1BMLA 1DLEA 1NM6A 1TRMA 4D8NA 1QIXB 2XCNA 2GTBA 1AVWA 3MO3A 3M61U 4ABHA 4DCDA 1QRWA 1P3CA 2OC7A 3MI4A 1D4PB 2B7DH 2TGTA 3Q3YA 1A0HB 3LH3A 2BYAX 1GI7B 4XDEA 3RM0H 3O8BA 3TH2H 1VITF 4K2YA 2J92A 3MH7A 5DP8A 2A0QB 1GBEA 2BLWA 3LPRA 5JB9S 2BY8X 2A2QH 1C1NA 1IQMA 4NA8A 4Y79A 1P9UA 4H6SB 1ZPCA 1GI6A 2ZFSA 1DXWA 1BHXF 1PFXC 3ATIA 2HALA 4J1YA 3DFLA 1EUFA 2WV4A 5SGAE 9LPRA 1AWFH 1XUGA 3T27A 3M3SA 4NSVA 3UQOA 4X8VH 1IAUA 1EP5A 1CA0B 5L2YH 1F0SA 1VR1H 4WF8A 5EOKA 1TPOA 1XM1A 3ATWA 4IC6A 3UNRA 3F68H 4X8SH 1AY6H 1KXFA 2G51A 1G2LA 1GBTA 4OS7A 2JKHA 3A7YA 1GBCA 2FS9A 1C1RA 2XWAA 4E7RG 2A4GA 4A1VA 3R0FA 4B2BA 2QN5T 4FVBA 1A5GH 2ANYA 1HAXB 1V3XA 2FOEA 7GCHG 3RC6A 4AX9H 2J34A 1FY8E 1D6RA 3G01A 2ZU1A 2A31A 4CH2B 1PPBH 1W12U 2W3KA 1O2QA 4K1SA 2UUKB 1V2RT 3EE0B 5DGJA 3IITA 1UCYE 4BTUB 2ZA5A 1F7ZA 4X8UH 3FP6E 1XXFA 4AN7A 1EP6A 4BOHA 3FFGA 1TPSA 3LONA 1QY6A 3ZV9A 1YPEH 4NIXA 4UEHH 5E0GA 1C5XB 1F0TA 1K1OA 1H4WA 2QC2A 4AB8A 1LMWB 3A8AA 1FY4A 1GWAA 2FMJA 2W7UA 4KTSA 1LHEH 1C2LA 2OXSA 4CH8B 2F3CE 1O3BA 1D3PB 1CHGA 5DJ7A 1SSXA 2SFAA 1SI5H 2AMPA 1J17T 3FZZA 3BG4B 1WSSH 1FN8A 3ITIA 1SGDE 3OX7U 3E0PB 2GZ8A 1UTNA 1ZOMA 2C8YB 4CREA 1GDUA 1MZAA 3QGNB 1O3DA 3P8NA 4U2WA 1OKXA 4VGCB 7LPRA 2ZECA 3MNBA 1LKBA 1Y59T 4U30A 1NRNH 4CRFA 1SMFE 5FAHA 5GWZA 4OGYA 4FUHA 1TNIA 4HI3A 1SHHB 2J2UA 2Y7ZA 4I8HA 1CGJE 1CBWB 4KTCA 1IHSH 2QIQA 3RXIA 1Z6JH 1DITH 3MU4A 1BB0B 4HGCA 5F8ZA 2WPIS 1XVMA 1AB9C 1V2QT 3HK6B 5FCKA 3AAVA 4B74A 4Y76A 1KTTB 1SOZA 4ABFA 2VVVA 1P12E 2XC4A 2BXUH 1YGCH 3PTBA 5HMAA 1NU9A 3AW1A 1EJNA 1OPHB 3F9GA 3TJNA 2P93A 4ZKNU 2YNAA 3SU2A 3SI3H 2EA3A 1GBAA 1OWEA 1O5GH 3RXVA 1GHAF 5LPEA 4MPUA 3QDZB 5E2PA 2Z9LA 1AZZA 4OS5A 1TLDA 4IN1A 5ESTE 1P2KA 2BQ7B 3B8JA 4YTAA 1JRSA 2BDHA 1QL8A 2BMGB 3SNBA 4H6TA 3LGIA 3A84A 4FUGA 1AFEH 2G00A 4UFEH 5DP6A 1Z1JA 2ZIQH 2FZZA 3PLPA 1YYY1 2CJIA 1E38B 3KGPA 2QXHA 2WV5A 3T25A 2VNTA 1S0RA 1GI2A 3KHVA 4BAHB 1O2LA 4AG2A 1C1QA 4AYYB 1C2DA 3RMOH 5FX5A 1HUTH 1C5LH 2A7JA 1C2EA 1AUJA 3KQEA 3TK9A 2ZCLP 1HJ9A 4CR5A 3QX5H 1V6DA 2SNWA 1KDQA 2B5TB 2HNTE 1ELAA 2AGGX 1V2KT 2QY0B 1TMBH 4K8BA 1YCPM 1SLXB 5AF9H 2G81E 2A7HA 3RDZA 2F91A 1MAXA 1BTZA 4WMDA 1PQ7A 3VEQB 2FEQH 3GCHC 3SUGA 1ACBE 1O30A 4UE7H 1O37A 1S0QA 3UTUH 1OP2A 1LPZB 4CHAB 1SVPA 1FIZA 4IN2A 3SNCA 2GZ7A 2IJOB 2SGFE 3BG8A 3GY2A 3U1JB 1C1MA 1TBRH 1C5OH 5DG6A 1IHTH 3P8OA 4X6NA 1N6YA 4YM9A 4YOGA 1KTSB 3STIA 2BD9A 2BY9X 2C93B 3VB3A 2A45B 2JH5D 2NU3E 4BTIB 2F9UA 2QGRA 1MD8A 2CMYA 1MTNC 1N8OB 1TALA 3NPSA 5T6DA 4DY7B 1QHRB 4E7NA 1ZHRA 4WH8A 2V35A 2J4IA 2WYJA 1ZSKA 2HRVA 2R2WU 1QRXA 1CHOG 3EGKH 4KELA 3GCOA 1AMHA 1TWXB 2BB4A 2ZFPH 5DKMA 2AMDA 3P95A 5GPIB 1UK2A 1C5ZB 1FI8A 4X1NU 3AW0A 3BIVH 1QBOA 1K1MA 4NA9H 1CT2E 5EW1H 4AFSA 2OC8A 3MH6A 3TNSA 1KLJH 1S82A 1VITG 5JYIA 1ELFA 2VWLA 1HDTH 3S69A 4MNWA 4ESTE 1DE7H 1C1WH 3SGBE 2OTVA 4K5ZA 2BLOA 2XBVA 1GI5A 2OBQA 1FIWA 3TK6A 3HGNA 1INCA 2ZWLH 1E37B 2IOTA 1GJ8B 4NFEA 5EXMA 1UTQA 3SJIA 3UOUA 1H1BA 2FOBA 4ZMAH 2OLGA 1HGTH 2BD4A 3D23A 3ESTA 3ZZCA 1RS0A 1UTOA 2FI3E 2XC5A 1GBIA 2FX6A 2XBXA 3SV9A 2BDBA 1XX9A 2NU1E 4UFDH 2IN2A 3BEUA 3UOPA 1ETSH 2PR3A 1RD3B 4MQAA 3QK1A 2D26C 1AI8H 2FS8A 1BRUP 3ZZ8A 1HIAB 2BOKA 1BTYA 4IMZA 3P17H 1O2UA 2B9LA 1G30B 3ZZDA 1GHBG 5IYTA 1OX1A 4B76A 2ALVA 1LHGH 2VB0A 3MO6A 1B0FA 1ELGA 2A7CA 1SL3A 2TPIZ 2O8WA 1RTLA 1E34B 1QQUA 2OBOA 4ZKRU 1C5SA 2XYAA 1K1IA 1NFYA 1DT2A 2Z6BD 1RIWC 1C5TA 3RLYH 1VGCC 6ESTA 2FOAA 1BMAA 1FDPA 2WINI 1L1JA 1T8NA 4LXBH 1GCDA 1HAYB 2UWPA 4I8JA 2ZFRH 1JRTA 4MVNA 3V13A 1T7CA 3T29A 2CF8H 3HPTB 5AHGH 4AFQA 1AKSB 2QV1A 4JZEH 2CV3A 3M5NA 4HTCH 1BT7A 1GGDC 3WY8A 1EPTA 3D65E 2BD5A 1H9LB 1IQHA 2G4TA 1XUHA 1WQVH 1GVZA 1V2JT 1L0ZA 3B9FH 1WTHD 2FOFA 3M7UA 2HNTF 4B71A 8KME2 2ZO3H 4H4FA 7ESTE 2QF3A 3FP7E 2A1DB 1YLCA 3MU8A 2SGQE 2ZGCA 2ZTZA 1B5GH 3QGJA 1GL0E 5I25A 1AZ8A 4CRBA 1TMUH 3VB7A 1CA8B 1BDAA 1O2KA 1J16A 1LDTT 2GKVE 4Y6DA 1ZMJA 5JBTA 2EEKA 2VJ1A 1T32A 4XBBA 1CGIE 8ESTE 1VJ9U 1DSTA 2ZQ1A 2BD7A 2BVRH 1L1GA 1MU6B 3PMHB 2R0KA 4X1QU 3RU4D 1HCGA 2BDYA 2WPMS 2TGDA 2CHAB 1E36B 2RA3A 4MPXA 1P2QA 1TOCB 1KIGH 2HLCA 4I8GA 2BY7X 2GCTB 2BLVA 4I7YH 4NCYA 1HYLA 3Q3KA 4JK6A 2BDIA 4BXWA 3A82A 2BY6X 3LDXH 3Q3XA
chains in the Genus database with same CATH superfamily
1AN1E 1QB6A 3OY6U 1GJCB 3OE7D 2EI6A 1OWDA 2GV6A 1YCPH 1ZTJA 1X7AC 1KLIH 3PTNA 4HZHA 3RXPA 3URDA 4X6PA 4R8TB 1GJ4H 2CK3D 1QR3E 3KQDA 1THPB 3SJKA 2PSYA 4NIVA 3H7TA 5EJ1A 1AFQB 3A7ZA 1BMMH 2RDLA 1MTWA 5FX6A 1HAIH 4BAOB 5DN6D 4F49A 1SGIB 2VIQA 2GMTB 2P3FH 3LH1A 1MTNB 1FAKH 2WYGA 3UUZA 1W0YH 1V2MT 1LTOA 1NN6A 4ISOA 4YZUA 3LT3A 1MZDA 1NRSH 1BTPA 1TX7A 1C2KA 2WUBA 3EA7A 4ABBA 1HFDA 3PO1C 4FUFA 5CHBA 2Y5HA 3KYFA 1TGBA 1MKWK 2WUCA 3LJOA 4B75A 1PPZA 5K0HA 1S5SA 1HXEH 1ABJH 2BVSH 4CRCA 5CDFE 1ZYOA 5LH8A 3PV4A 4INKA 1GHYH 2R2MB 1PYTC 2ODPA 1IQKA 5FCRA 3CS7A 4MNVA 3O8RA 1A4WH 3FVFB 1PPCE 4NWLA 1OS8A 3C27B 2GCHF 3BV9B 1HXFH 5EPYA 3RXBA 4Q7XA 2VH6A 1C5VA 1EX3A 3I77A 2BY5X 5CHAC 1SFIA 5KECA 1O2WA 2QXJA 2ZDVH 1P2NA 2WPKS 1FLEE 2VU8E 2SGEE 3JZ1B 1FONA 4ABGA 2ULLA 2GT8A 3IWMA 2BDGA 2K1QA 5C0UA 4X2YA 3A80A 3UWJH 3GDUA 3K6YA 2FTLE 1C5PA 2JJ2D 1YF4A 3UPEA 1DLKB 4FUEA 5EJLA 5BRRE 6GCHF 2ZKSA 1K21H 1Z8JB 1GMCG 1TNLA 3MMGA 3RXTA 3F1SB 1UO6A 4YESB 4A6LA 5K7RA 1BA8B 2BDCA 2SGDE 2ZU5A 4JYVH 1NPMA 2Y7XA 1YPHC 1ABIH 3KQBA 5A0AE 1SQAA 3GYMA 3U1IB 1W8BH 4NG9H 4Y71A 2SGPE 1OWHA 4SGBE 2BD3A 2OC1A 1ARCA 2FDAA 4MPWA 4JMYA 1THSH 5A8YA 1ZZZA 4WVPE 1E1RD 1DFPA 3UQVA 3SOSA 1MTSA 3NWUA 2TIOA 2W3IA 3QTOH 5FPSA 1O34A 2BQ6B 1P2JA 2D1JA 1BJUA 2NU2E 3MFJA 3GCHB 1SQOA 1S83A 1GJAB 1Q3XA 2FODA 1RGQA 3SNAA 3RXUA 4I8LA 1FV9A 4ZXYH 1DWDH 3M37A 2FOMB 2GCHG 3VXEH 4D7GA 5HXFA 3ZYDA 2DE9A 2ZGBH 3BTKE 3ZVEA 1IQGA 2AMQA 2Y6TA 3NXPA 4DG4A 3SUFA 1M9UA 1ZGIA 1ANCA 1TBZH 1TRNA 1V2NT 3SN8A 2V6NA 3P8FA 1LQEA 3OEHD 3TVJB 3BEFB 3EQ0H 4WMEA 1C5WB 3W94A 4ABEA 1P2IA 5C1XA 4FUJA 1ESTA 1VITH 1GDQA 3GCTG 1JXPA 1MBMA 1P2OA 3RXEA 1A5HA 5A09A 1H9IE 5DO4H 1L2EA 3OY5U 3P6ZB 1SLUB 3RM2H 3SV8A 1Y3YA 1V2ST 2UUFB 3MU5A 2PLXA 4XOJA 1MCTA 2W6ID 1GBMA 7GCHF 3V3MA 3UAIC 1A46H 2YMSC 1UVTH 2ILNA 3SJ8A 1MABB 3WW7A 1AFQC 1ZRKA 2FPZA 1O3KA 1K9OE 2V3HH 1P01A 5GIBA 1ZPZA 3A7TA 3RXQA 1ELCA 1N1LA 3T5FH 1E1QD 4CBOA 5E2OA 2WPLS 1A5IA 1AB9B 2Q6FA 3LGYA 2BM2A 2R9PA 1MD7A 3SUEA 1RXPA 5C5NA 3PO1B 2WHXA 1ELBA 5F8XA 2OQ5A 3I78A 1UJ1A 2Z9GA 2EQNA 3GY3A 1J9CH 1AQ7A 3D62A 2ASUB 1Y8TA 1TFXA 2V3OH 3TU7H 2ZHDA 1QQ4A 2Y5FA 3BF6H 1W11U 1IOEA 2Z94A 1MU8B 1S85A 3FOAA 3A88A 3MHWU 8LPRA 2G55A 1AD8H 1XXDA 2AHME 5HM9A 5GCHF 2KX4A 3TLOA 1O3NA 5AFZH 1UTMA 1KYNA 3N7DA 1BUIA 1DXPA 2ZHEH 4QT8C 1GHBF 2FXRA 4KGAA 1QJ6B 3S0NA 1C5NH 2HVXA 1C5MD 1SOTA 3JZ2B 3LGVA 1YWUA 1XUIA 3SGQE 3NCLA 3A8CA 2RFKC 2JH6D 1FAXA 3GISB 4FXGH 4Q2KA 3UNQA 2PKSC 4GUXA 5C3NA 1T4VH 5C1YA 1S81A 4THNH 2F9PA 3S9CA 1O38A 1GMDF 2FP7B 3ZIAD 5L30H 3GICB 5F8TA 1GI8B 2FYQA 2A32A 1W2KH 4JZIA 1F2SE 4XD7D 3O8CA 3SZNA 1XMNB 3EAJA 3U69H 1W10U 1O2RA 3EYDA 5J4QA 1YC0A 1KXDA 2A5IA 1AIXH 3NK8A 3GDVA 2PWXA 1YPGH 4X2VA 1EXFA 4FOUC 3AASA 2PTCE 4UFFH 2YOLA 1GHAG 2PHBA 2LNCA 1TRYA 1YBWA 1TABE 1BZXE 1E0FD 1F5LA 1O3PB 4ZAEA 1DANH 4LK4A 2TRMA 4ZUHA 2ZGJA 1VGCB 1C1OA 1B0EA 1OXGA 3SU6A 2Q6GA 3MOCA 3CP7A 1HRTH 1SB1H 3SHCH 4Y8YA 5JBCS 4AC9A 1G9IE 2VGCC 1UTJA 4B1TA 4ABIA 5J4SA 1GHWH 1JBUH 3E91A 3LOXA 8GCHG 1LVBA 4LZ1H 2OK5A 3E16B 1KXCA 2TBSA 2GVFA 1IQFA 2JH0D 5EQRA 3BTDE 3ZZ7A 3OSYA 1AE5A 1O2YA 3RXSA 1CGHA 1O32A 4IC5A 1EQ9A 2HLDD 2LPRA 5HGGA 3ZYEA 1EJAA 4ASUD 3A8DA 5HYOA 1NRQH 1O36A 1AO5A 2VWNA 3BN9A 1XKBC 3UR6A 1ZRBA 2ZCHP 1GJ6A 1UVOA 3LIWA 4YLQH 5A0CA 1C2FA 1A7SA 1C9TA 2QF5A 2DUCA 2RCEA 1EAIA 1HV7A 1RIWB 2J9NA 3N7OA 2A4QA 2ODYB 5A8ZA 4A1XA 5C20A 1A61H 3HKIB 1V2LT 3E0NB 2GX4A 1QJ7B 1JIRA 1Q2WA 4TWYA 3RXRA 3DSPA 4XE4A 3T2NA 5TJXA 3BTGE 4MNYA 2WPJS 1EB1H 3QLPH 2PKAA 3F9FA 1D3QB 3RXMA 3M35A 4JZ1A 3SQEE 4Y11E 4GVUA 2OD3B 1GVKB 4FUCA 3NKKA 1C2IA 4NA7A 2ZU4A 4X1SU 3T26A 4FUBA 1V2PT 1GHZA 2PTNA 1BOQA 4BANB 1A3BH 3K2UA 1NC6A 2NU4E 1G3CA 1SGYE 3EA8A 1RTFB 3Q76A 5TCCA 4A7IB 1Y3VA 5A2MH 4GLYA 4I32A 2RDEA 1GG6C 1P9SA 2ZFFH 1OWIA 1WTGH 4P00A 3HK3B 7KMEH 3LGTA 1YPJH 3RUOA 1COWD 1DUAA 1F0RA 1BMFD 3CNRA 1WCZA 2CGAA 3VGCC 4Q80A 1UVPA 4NFFA 2ZF0H 1SPJA 1O3MA 1SGQE 2ZTYA 2JIZD 1GDNA 9ESTA 2A5AA 2ZFTA 2XRCA 4YO9A 1SGFG 1EOLA 1YM0A 3U8OH 5CMXH 2Y80A 5EG4A 1G3DA 3IG6B 4GPGA 3ZZAA 1EAUA 1GGDB 3VG8A 2F83A 1O5FH 5GNDA 4WXVA 3BEIB 3A83A 4NGAH 3E3TA 1AGJA 1O3CA 2GZ9A 1WUNH 1CA0C 3MYWA 1O3FA 1QJ1B 1Z71A 3GOVB 4DIHH 1O2PA 3S9AA 5EQSA 1BRAA 3F9EA 1HIAA 1ZHMA 1LPKB 4FETA 1TGTA 5JBBS 3ZZBA 3BIUH 1VZQH 1EAWA 2AGEX 1LKAA 1SLWB 2BD2A 2P59A 4ZKSU 3SNEA 1DX5M 3BTTE 3DT0H 1HAHH 4ABAA 3RXOA 2PGBB 1G37A 1TBQH 1Y3XA 4ZKOU 3TJUA 2ZC9H 2BZ6H 1MAYA 3SHAH 1FPHH 1O3AA 3K9XB 1BBRK 2AERH 1EATA 1LO6A 1ELTA 2P16A 1A2CH 2BQWB 4AOQA 1HAVB 1ZJDA 4X6OA 1MH0A 1P03A 2KAIB 4Y7AA 2UWLA 3KIDU 3DSOA 2PKSB 5DP3A 2UUJB 2ZDNA 1WBGB 3TGKE 2BXTH 1G3BA 3TH4H 2G52A 4DGJA 4ZH8A 1ELVA 3ZV8A 2OP9A 1TNKA 1ANEA 1W3CA 5C5OA 1O2OA 1L4DA 5FPYA 1H8ED 1T4UH 2ZQ2A 4MDSA 1UVSH 1D6WA 3KL6A 1TGCA 2ANKH 2F9OA 3BTFE 1MKXH 1Y3UA 5FBIA 2ZNKH 1YKTA 4YT7H 2B0FA 2OQUA 3SJOA 1W14U 1GBHA 2F9NA 1NTPA 1UHBA 1DY8A 3RXDA 4DURA 1GJ5H 2O8MA 1FN6A 2VWOA 2ZI2H 5EU8A 1QFKH 2BVXH 2KAIA 4TT3D 1BBRH 2A2XH 4YT6H 1P0SH 3QTVH 2J38A 4WWYA 1TX8A 1V2OT 2CN0H 3AVZA 3EA9A 4TPIZ 2AH4X 5DSFA 4MTBA 4K69A 2QE7D 1IQNA 2G4UA 2LP6A 1NFUA 1EASA 2ZHWH 2QA9E 3SI4H 1UW7A 3VXFH 5EW2H 5DP5A 5DPAA 1DSUA 3RXKA 1UTKA 2GD4B 3O8DA 1MKWH 2A4OA 2H1UA 4KTUA 3U9AH 2J98B 1SR5C 4XRNA 3F6UH 1DICA 2FOCA 3GY4A 1NFXA 4XSKU 1S84A 1PPFE 5B6OA 1JMOH 1KDQB 4X6MA 3PRBA 1BMNH 3KN2A 3SYJA 4Y0ZE 1UK3A 1CT4E 1ZHPA 1C5RA 1HJ8A 4GAWA 1ANBA 1IQJA 1PYTD 1SHYA 1C1SA 1T8OA 1CO7E 1Y5AT 2OCVB 1ANDA 4I31A 1ZR0A 3CENA 4MNXA 2ZDLA 2XCFA 4Z0KA 2H9EH 4O3UA 2Z7FE 2AYWA 2BHGA 2GT7A 2W26A 3DUXH 3GY7A 4K1TA 3T28A 3TGIE 2O9QA 3LU9B 1WV7H 1TA6A 2BDAA 2ODQA 3RLWH 5FPTA 3DSGA 3L6PA 1PQ5A 2GCTC 4SGAE 1L4ZA 1GBFA 1O2HA 2CHAC 1O3EA 3MU1A 1J15A 1GMHF 1C5QA 1A0LA 5E8EH 2PFEA 4ABDA 2R0LA 2EC9H 2A5KA 1H9HE 2VGCB 3PYHA 1ZSLA 1HAGE 3VB6A 4CRAA 2XTTB 4FU8A 4YOIA 2VIVA 1O2JA 1AWHB 2M2AA 3DD2H 1CHOF 1D9IA 1P09A 1JOUB 1NS3A 4E05H 4KP0A 4HFPB 3WWBA 4X1PU 4MLFB 1C5UA 3PWCA 3BG4C 4X8TH 4Y8XA 3K6ZA 3ZVGA 3V12A 1W0ZU 3SU3A 3HATH 1SGTA 1ELDE 1G2MA 4NZLA 4JYTA 1GI0A 1E79D 5HIZA 1C2MA 2D2DA 2ZGXH 3ZZ5A 3SORA 1P3EA 1BRCE 1BRBE 5L2ZH 3GYLB 1OYQA 4RKOB 1ZMLA 4OM9A 5F53A 3M3VA 1O3LA 1EAXA 1P06A 2M5TA 3MO9A 2ZU2A 2VH0A 1QB1A 3GDSA 1PPEE 1A1RA 1LPGB 4X2WA 2HGTH 2XXLA 2H5DA 3RP2A 2GMTC 3STJA 3OU0A 1ZMNA 5EXLA 1GBKA 2OINA 2Q6DA 2FTMA 1P8VC 3Q00A 4U32A 1O5DH 3ODFA 2XBYA 3PB1E 4CRGA 2UWOA 4TWWA 1NBME 1DWCH 1FPCH 1SGFA 3QWCH 6CHAC 1FX0B 2PGQB 1HAZB 2XNIA 1CVWH 1GHXH 5JDUB 4IMQA 3LC3A 1QA0A 2CXVA 2ZG0H 1SGNE 1DS2E 1DY9A 4TY7A 5CHAB 2W7SA 1V2TT 1UCYH 1GJ9B 1HPGA 3M3TA 4XBDA 1RRKA 3ODDA 4WH6A 2DE8A 1DOJA 1RJXB 1OSSA 1HAOH 4B6FA 4H42U 1FJSA 1O2XA 4UONA 1IQIA 2H2ZA 2VIWA 5KEDA 1UK4A 3M5OA 1HNEE 1C2JA 4MPVA 3AK5A 1O2IA 4FU7A 4VGCC 3W1EA 3ZVCA 2AS9A 1TIOA 4JK5A 2VVUA 1N6XA 1QRZA 1DVAH 4XBCA 3A89A 1ZLRA 2QXIA 2OUAA 3SJ9A 4A1TA 5HM2A 1BQYA 3OYPA 3NZIA 3RXCA 1K22H 5H4IB 4ABJA 1O3GA 1QBVH 3D49H 4NWKA 4GCHG 4DT4A 1C2HA 4A5TS 4NSYA 1GL1A 4K60A 1CE5A 2FX4A 4Y8ZA 1G3EA 1KSNA 3A86A 1NT1A 1EPTB 2RG3A 1YPLH 2BD8A 4O3TA 3B23B 4YOJA 4P02A 5FHTA 5FL7D 1GJDB 4OGXA 1LHCH 3RU4T 4LZ4B 3U28C 1GHVH 4RI0A 1OWKA 4D7FA 2SNVA 1SLVB 2EI7A 3L33A 1DWBH 1QL9A 4A92A 5C94A 1XUFA 1GBBA 1Z7KA 2AIQA 1O5EH 4GHTA 3RXHA 1HJAB 1O2SA 1PJPA 2NWNA 2H9HA 2ANMH 3M36A 1GJ7B 4ASHA 2L74A 2O8TA 2UUYA 3GCNA 5AVDA 3AAUA 4R0IA 1FMGA 3H5CB 2P95A 1Z1IA 4RT1A 2PUQH 3V7TA 4AORA 2FESH 4AZ2B 4FUIA 3ZVBA 2VWMA 1PPGE 1OP8A 3F3BA 3MNXA 4UFGH 1C1VH 2Y5GA 1KXBA 1TGNA 4K8YA 4O9VA 4JCNA 6GCHG 2VINA 3GCTF 1ESAA 1MBQA 1DWEH 2FI5E 4FUDA 4INLA 5EPNA 1ZTKA 3L3TA 2P8OC 4UDWH 3ZVAA 1SBWA 3TGJE 1W13U 1K1PA 3E90B 1J8AA 4CHAC 1Z6EA 4Y10E 2F9BH 2P8OB 3UNSA 3KF2A 1BITA 1W7GH 2AGIX 2NU0E 1MTUA 1C9PA 4M9FA 3RXJA 3URCA 1P11E 2YMSB 5ETXA 3BSQA 3SU1A 1TX6A 4GHQA 1MKXK 3ATLA 2G5NA 4BAMB 3KNXA 3P70B 4WXIA 5C1UA 2FI4E 1GMHG 6LPRA 1SGEE 1TQ7B 1GCTC 1TPPA 3SV7A 1S6HA 1FUJA 1WOFA 3FANA 1EZSC 3T62A 1EZUC 1HAVA 2GV7A 1EOJA 1XUJA 5LGOA 1TPAE 2P3UB 3SV6A 1F0UA 2QCYA 1P2MA 1L1NA 1XUKA 1O33A 3LC5A 8GCHF 4BAKB 1UMAH 1TOMH 2ZDMA 2F9VA 3U8TH 1FY5A 2XC0A 1BTWA 2HWLB 1MMJN 3M5LA 3PLBA 1F5KU 1NROH 1O2VA 2ZEBA 2GDDA 2YNBA 1O2NA 3QZQA 1TYNA 2STBE 4Y0YE 3C1KA 2BX3A 3QUMP 2JETC 1GBJA 2VVCA 1N8OC 2C8XB 4B2AA 4Q7ZA 2O8LA 4RT0A 4O03A 1BTHH 1KY9A 3OTJE 4GSOA 2STAE 2TGAA 3GY8A 3KCGH 5HIYA 3PLKA 1BTUA 3ELAH 4UD9H 5KGOA 2F43B 3RC4A 4AYVB 1KXAA 1BCUH 4ISHH 1MUEB 3TITA 1EFRD 2ZU3A 1EZQA 1OWJA 2BOHB 3ZVFA 2R3YA 5DP4A 3ZZ3A 4ZXXH 5EQQA 4MG3A 1AVXA 3K65B 2PW8H 4BTTB 5G4BA 3MNCA 1YPKH 1SQTA 5DP9A 3E1XB 2HPQH 3A85A 3GY6A 1MTVA 2R3UA 3MQKC 3P92A 1GI4A 2JETB 1YCPK 4F4OC 4ZHAA 4ISIH 5T6GA 1O5BB 1Y3WA 3U8RH 3QO6A 1DPOA 2Z3DA 1O3JA 1O0DH 1GPZA 4YXWD 4JZFH 1HJAC 5E0JA 3E8LA 4GCHF 1V2UT 1AVGH 3VGCB 4I33A 2THFB 2XBWA 5B6LA 2PKAB 4ZHMU 4BNRA 1SGPE 1SFQB 2BZAA 4ISNA 4AFUA 1VCQA 1ZTLA 2Z9JA 1DM4B 4TY6A 2BX4A 1GI9B 1QL7A 2KCAA 2AFQB 2GGVB 1K0HA 1YP9A 1EZXC 3TIUA 1WXRA 1CQQA 2GDEH 3U98H 4IGDA 1THRH 1EPTC 2QF4A 2CF9H 1C2GA 4K3JA 1K28D 5HKKD 1NFWA 3UWIA 1EJMA 1K1NA 1TQ0B 2V0BA 2Z9KA 3ZZ9A 1D3TB 2FWWA 1CSOE 3UB0A 3PM3A 3DA9B 1H8DH 2B8OH 3VFEA 3M5MA 5T3HA 4KKDA 1YY3A 1J14A 5E0HA 1ZPBA 3N99A 1YPMH 5LPRA 2G8TA 4INHA 3VB5A 4Q63A 1O2GH 5TCAA 4JZDH 2GJGA 1UTLM 3FAOA 1FQ3A 1QNJA 1HB0B 1A3EH 3N7EA 2ZPSA 1GI1A 1QURH 1TGSZ 5PTPA 1GG6B 1O3HA 5EJZA 3PWBA 4IBLH 2JJ1D 4AGJA 1O3OA 2P94A 4D9QA 1NRPH 2Y82A 3V0XA 1QTFA 2FM2A 3BTEE 2RA0A 1G32B 3OFND 3R3GB 4WJG2 1NY22 3UIRA 4X0WU 3LGUA 3MH4A 3ENSB 1BJVA 1C1PA 3Q77A 1CBWC 3TH3H 4OS4A 5DP7A 5DK1A 2EI8A 2ALPA 3FN8A 1ZGVA 3PMJA 5GDSH 3MWIU 3BTQE 1NRRH 4B73A 2Z3EA 1TMTH 2Z3CA 3RXLA 1WYKA 4DJZB 6CHAB 1LQDB 4YLUA 4Q4LA 3CS0A 3TJVA 1RTKA 1LVYA 3M7QA 1KMHB 5ESBA 3OEED 4ZROA 4E06H 1WU1A 1LHFH 3LGWA 4LOYH 3MU0A 4Z6AH 1GJBB 3A7WA 1TONA 2GP9B 1P02A 4DT7B 5LPFA 1NO9H 4ISLA 4NZQA 1EKBB 2O8UA 4TPYA 1NZQH 2OC0A 5GXPA 2P3TB 2QAAA 2ZFQH 2KR7A 3SV2H 1ZJKA 2ZCKP 1O5AB 2ZPQA 3TPIZ 1PQ8A 4X1RU 1PPHE 3RMLH 5AFYH 1FXYA 2K0QA 1S6FA 2SGAA 2ZDAH 5GCHG 1Q31A 1C1TA 3GY5A 4WY3A 3TJOA 1Z8IB 1XVOA 3MNSA 1S6LA 5CE1A 2I6QA 2I6SA 3RC5A 3FP8E 5F6MA 2J5UA 1W7XH 3ZVDA 3SU5A 3S7HB 3ATMA 1AKSA 4AGKA 3PMAB 1ZSJA 1GMCF 1O3IA 3BTHE 1GBDA 1O35A 4M7GA 2XW9A 1AHTH 1OP0A 3NUMA 3S7KB 2ZGHA 1UCYK 3RMNH 3UFAA 5I46H 5BPEA 1SGRE 3KEEA 3KQCA 2A4RA 1GBLA 2C3SA 3F2HA 1DDJA 2J95A 1TAWA 1TE0A 2C4FH 1QA7A 4RN6A 1PQAA 2Y81A 3PRDA 1H8IH 5JB8S 2V3MA 1O5CB 1O2ZA 1O2MA 5IDKA 3TK5A 3TNTA 1T8MA 3DFJA 5FXLA 3SQHE 3SUDA 2G5VA 1ELEE 4U01A 1RFNA 1FNIA 2L6OA 1ETTH 1G36A 5EODA 4BAQB 3SNDA 1D3DB 2Q1JA 4AG1A 1C5YB 1LHDH 2H9TH 5EXNA 3E6PH 2FOGA 4TYDA 1LCYA 1Y5BT 1Z8RA 1C4V2 2J94A 2XOKD 4K1EA 4AFZA 1ESBA 2H6MA 4CR9A 1E35B 2W5EA 1SQRA 1ETRH 2ANWA 2BTCE 1QBNA 3MTYA 2WPHS 3SO3A 5F03A 5A8XA 1MCVA 3GS9A 2WV9A 5ABWA 4DVAU 4JYUH 2QYIA 2C8ZB 1QCPA 3QN7A 4CBNA 1A0JA 3LKWA 2HPPH 3ZZ6A 3RXFA 1T31A 1F92A 1HAPH 1SC8U 4Q7YA 1KXEA 4HG6A 5JBAS 5L6NH 1VJAU 3OTPA 1B7XB 3QZRA 1HBTH 5FBEA 2C8WB 2XWBI 2ZPRA 3A7XA 2ZHQH 1Y5UT 1K2I1 3RXAA 1GMDG 1BIOA 1GCTB 2PUXB 2EY4C 1MQ5A 3SGAE 2QXGA 1O31A 2H5CA 1IQLA 1GVLA 1BHXB 1LVOA 1NESE 1P05A 4WMFA 4X2XA 1OYTH 3S9BA 4BXSA 1TNGA 1KLTA 3M7TA 2ZTXA 2KCOA 2FLBH 1TNHA 4O97A 3A8BA 1MQ6A 1AUTC 1EB2A 2VIOA 1Z8GA 1QB9A 5EGMA 1BBRE 3UREA 3FZDA 3I29A 4Y7BA 1NU7B 3SU0A 1F5RA 1C4U2 3SU4A 4ZHLU 1V2WT 3H09A 1ARBA 3RXGA 1AU8A 2FIRH 1O2TA 3HGPA 4AB9A 4NIWA 1FZZA 3UY9A 3RU4E 1P57B 4F48B 3VB4A 1C1UH 1AE8H 1U6QA 2VIPA 1HLTH 2D8WA 4FVDA 3P8GA 1JWTA 2HNTC 5T6FA 1TB6H 1SGCA 4RSPA 3A81A 1FY3A 4ACAA 1P04A 4OS1A 3EDXB 1IQEA 4OS2A 4DOQA 2BLQA 3H7OA 3SZEA 3ZZ4A 4D76A 2FOHA 4RKJB 2ZHFH 5C2ZA 4XFQA 2FLRH 4TSFD 3F9HA 5GJ4B 3SW2B 1UTPA 3PROA 1SG8B 4J2YB 3A87A 5A0BA 1JIMA 1UHBB 4PROA 1XKAC 1T8LA 1O39A 3FO8D 1BTXA 1YPHE 3HKJB 2C90B 4CRDA 2ESTE 2ZZUH 2Z9IA 1K1JA 4IS5A 4D9RA 1CU1A 1C4Y2 3BTME 5C67A 1ORFA 1P10A 1OOKB 3SBKA 5JPMH 3RMMH 4DIIH 2TGPZ 1YLNA 2AIPA 1TNJA 3DCLA 3UR9A 1VCWA 4B2CA 1LVMA 2FO9A 3PMBB 4FU9A 1FY1A 3BTWE 3W95A 1YLDA 1QGFA 1ID5H 2VIDA 1TA2A 1WAYB 2FYRA 2PV9B 4OS6A 4NIYA 1WQSA 2ZP0H 3A7VA 1VCPA 4DW2U 1GI3A 2PSXA 1K1LA 2HOBA 1CT0E 1DUEA 2ZDKA 3MH5A 1UVUH 4I8KA 1V2VT 2JDID 3LJJA 4IW4E 3VPKA 3ATKA 2IPHA 3DHKH 2AEIH 2QF0A 1BMLA 1DLEA 1NM6A 1TRMA 4D8NA 1QIXB 2XCNA 2GTBA 1AVWA 3MO3A 3M61U 4ABHA 4DCDA 1QRWA 1P3CA 2OC7A 3MI4A 1D4PB 4Z1MD 2B7DH 2TGTA 3Q3YA 1A0HB 3LH3A 2BYAX 1GI7B 4XDEA 3RM0H 4ACBA 3O8BA 3TH2H 1VITF 4K2YA 2J92A 3MH7A 5DP8A 2A0QB 1GBEA 2BLWA 2IPQX 3LPRA 5JB9S 2BY8X 2A2QH 1C1NA 1IQMA 4NA8A 4Y79A 1P9UA 2KFWA 1ZPCA 2KZ4A 4H6SB 1GI6A 2ZFSA 1DXWA 1BHXF 1PFXC 3ATIA 2HALA 2KM0A 4J1YA 3DFLA 1EUFA 2WV4A 5SGAE 9LPRA 1AWFH 1XUGA 3T27A 3M3SA 4NSVA 3UQOA 3PV5A 4X8VH 1IAUA 1EP5A 1CA0B 5L2YH 1F0SA 1NBMD 1VR1H 4WF8A 5EOKA 1TPOA 1XM1A 3ATWA 4IC6A 3UNRA 3F68H 4X8SH 1AY6H 1QZ8A 1KXFA 2G51A 1G2LA 1GBTA 4OS7A 2JKHA 3A7YA 1GBCA 2FS9A 1C1RA 2XWAA 4E7RG 2A4GA 3F0PA 4A1VA 3R0FA 4B2BA 2QN5T 4FVBA 1A5GH 2ANYA 1HAXB 1V3XA 2FOEA 7GCHG 3RC6A 4AX9H 2J34A 1FY8E 1D6RA 3G01A 2ZU1A 2A31A 4CH2B 1PPBH 1W12U 2W3KA 1O2QA 4K1SA 2UUKB 1V2RT 3EE0B 5DGJA 3IITA 1UCYE 4BTUB 2ZA5A 1F7ZA 4X8UH 3FP6E 1XXFA 4AN7A 1EP6A 2WZQA 4BOHA 3FFGA 3F2FA 1TPSA 3LONA 1QY6A 3ZV9A 1YPEH 4NIXA 4UEHH 5E0GA 1C5XB 1F0TA 1K1OA 1H4WA 2QC2A 4AB8A 3F2GA 1LMWB 2HVYB 3A8AA 1FY4A 1GWAA 2FMJA 2W7UA 4KTSA 3EE7A 2J97A 1LHEH 1C2LA 2OXSA 4CH8B 2F3CE 1O3BA 1D3PB 1CHGA 5DJ7A 1SSXA 2SFAA 1SI5H 2AMPA 1J17T 3FZZA 3BG4B 1WSSH 1FN8A 3ITIA 2J98A 1SGDE 3OX7U 3E0PB 2GZ8A 1UTNA 1ZOMA 2C8YB 4CREA 1GDUA 1MZAA 3QGNB 1O3DA 3P8NA 4U2WA 1OKXA 4VGCB 7LPRA 2ZECA 3MNBA 1LKBA 1Y59T 4U30A 1NRNH 4CRFA 1SMFE 5FAHA 5GWZA 4OGYA 4FUHA 1TNIA 4HI3A 1SHHB 2J2UA 2Y7ZA 4I8HA 2XNDD 1CGJE 1CBWB 4KTCA 1IHSH 2QIQA 3RXIA 1Z6JH 1DITH 3MU4A 1BB0B 3F0OA 4HGCA 5F8ZA 2WPIS 1XVMA 1AB9C 1V2QT 3HK6B 5FCKA 3AAVA 1H8HD 4B74A 4Y76A 1KTTB 1SOZA 4ABFA 2VVVA 1P12E 2XC4A 2BXUH 1YGCH 3PTBA 5HMAA 1NU9A 3AW1A 1EJNA 1OPHB 3F9GA 3TJNA 2P93A 4ZKNU 2YNAA 3SU2A 3SI3H 2EA3A 1GBAA 1OWEA 1O5GH 3RXVA 2F4LA 1GHAF 5LPEA 4MPUA 3QDZB 5E2PA 2KCYA 1AZZA 2Z9LA 3OAAD 4OS5A 1TLDA 4IN1A 5ESTE 1P2KA 2BQ7B 3B8JA 4YTAA 1JRSA 2BDHA 1QL8A 2BMGB 3SNBA 4H6TA 3LGIA 3A84A 4FUGA 1AFEH 2G00A 4UFEH 5DP6A 1Z1JA 2ZIQH 2FZZA 3PLPA 1YYY1 2CJIA 1E38B 3KGPA 2QXHA 2WV5A 3T25A 2VNTA 1S0RA 1GI2A 3KHVA 4BAHB 1O2LA 4AG2A 1C1QA 4AYYB 1C2DA 2KCPA 3RMOH 3WWFA 2LELA 5FX5A 1HUTH 1OHHD 1C5LH 2A7JA 1C2EA 1AUJA 3KQEA 3TK9A 2ZCLP 1HJ9A 4CR5A 2WPDD 3QX5H 1V6DA 2SNWA 1KDQA 2B5TB 2HNTE 1ELAA 2AGGX 5IK2D 1V2KT 2QY0B 1TMBH 4K8BA 1YCPM 1SLXB 5AF9H 2G81E 2A7HA 3RDZA 2F91A 1MAXA 1BTZA 4WMDA 1PQ7A 3VEQB 2FEQH 3GCHC 3SUGA 1ACBE 1O30A 4UE7H 1O37A 1S0QA 3UTUH 1OP2A 1LPZB 4CHAB 1SVPA 5C17A 1FIZA 4IN2A 3SNCA 2GZ7A 2IJOB 2SGFE 3BG8A 3GY2A 3U1JB 2K8IA 1C1MA 1TBRH 1C5OH 5DG6A 1IHTH 3P8OA 4X6NA 1N6YA 4YM9A 4YOGA 1KTSB 2IJD1 2BD9A 3STIA 2BY9X 2C93B 3VB3A 2A45B 2JH5D 2NU3E 4BTIB 2F9UA 2QGRA 1MD8A 2CMYA 1MTNC 1N8OB 1TALA 3NPSA 5T6DA 4DY7B 1QHRB 4E7NA 1ZHRA 4WH8A 2V35A 2J4IA 2WYJA 1ZSKA 2HRVA 2R2WU 1QRXA 1CHOG 3EGKH 4KELA 3GCOA 1AMHA 1TWXB 2BB4A 2ZFPH 2VBCA 5DKMA 2AMDA 3P95A 5GPIB 1UK2A 1W0KD 1C5ZB 1FI8A 4X1NU 3AW0A 3BIVH 1QBOA 1K1MA 2YMSD 4NA9H 1CT2E 5EW1H 5T1VA 4AFSA 2OC8A 3MH6A 3TNSA 1KLJH 1S82A 1VITG 5JYIA 1ELFA 2VWLA 3KYGA 1HDTH 3S69A 4MNWA 4ESTE 2PP6A 2W6JD 1DE7H 1C1WH 3SGBE 2OTVA 4K5ZA 2BLOA 1GI5A 2OBQA 2XBVA 3FKSD 1FIWA 2WSSD 3TK6A 3HGNA 1INCA 2ZWLH 1E37B 2IOTA 1GJ8B 4NFEA 5EXMA 1UTQA 3SJIA 3UOUA 1H1BA 2FOBA 4ZMAH 2OLGA 1HGTH 2BD4A 3D23A 3ESTA 4F55A 3ZZCA 1RS0A 1UTOA 2FI3E 2XC5A 1GBIA 2FX6A 2XBXA 3SV9A 2BDBA 1XX9A 2NU1E 4UFDH 2IN2A 3BEUA 3UOPA 1ETSH 2PR3A 1RD3B 4MQAA 3QK1A 2D26C 1AI8H 2FS8A 1BRUP 3ZZ8A 1HIAB 2BOKA 1BTYA 4IMZA 3P17H 1O2UA 2B9LA 1G30B 3ZZDA 1GHBG 5IYTA 5EIYA 1OX1A 4B76A 2ALVA 4B6EA 1LHGH 2VB0A 3MO6A 1B0FA 1ELGA 2A7CA 3PV2A 1SL3A 2TPIZ 2O8WA 1VKYA 1RTLA 1E34B 1QQUA 2OBOA 4ZKRU 1C5SA 2XYAA 1K1IA 1NFYA 3NRLA 1DT2A 2Z6BD 1RIWC 1C5TA 3RLYH 1VGCC 6ESTA 2FOAA 1BMAA 1FDPA 2WINI 1W0JD 1L1JA 1T8NA 4LXBH 1GCDA 1HAYB 2UWPA 4I8JA 2ZFRH 1JRTA 4MVNA 3V13A 1T7CA 3T29A 2CF8H 3HPTB 5AHGH 2V7QD 1AKSB 2QV1A 4JZEH 4AFQA 2CV3A 3M5NA 4HTCH 1BT7A 1GGDC 3WY8A 1EPTA 3D65E 2BD5A 1H9LB 2G4TA 1IQHA 1XUHA 1WQVH 1GVZA 1V2JT 1L0ZA 3B9FH 4ZCNA 1WTHD 2FOFA 3M7UA 2HNTF 4B71A 8KME2 2ZO3H 4H4FA 7ESTE 2QF3A 3FP7E 2A1DB 1YLCA 3MU8A 2SGQE 2ZGCA 2ZTZA 1B5GH 3QGJA 1GL0E 5I25A 1AZ8A 4CRBA 1TMUH 3VB7A 5C0TA 1CA8B 1BDAA 1O2KA 1J16A 1LDTT 2GKVE 1WDIA 4Y6DA 1ZMJA 5JBTA 2EEKA 2VJ1A 1SKYE 1T32A 4XBBA 1CGIE 8ESTE 1VJ9U 1DSTA 2ZQ1A 2BD7A 4I86A 2BVRH 1L1GA 1MU6B 3PMHB 2R0KA 4X1QU 3RU4D 1HCGA 2BDYA 2WPMS 2TGDA 2CHAB 1E36B 2RA3A 4MPXA 1P2QA 1TOCB 1KIGH 2HLCA 4I8GA 2BY7X 2GCTB 2BLVA 4I7YH 4NCYA 1HYLA 3Q3KA 4JK6A 2BDIA 3KQ5A 4BXWA 3A82A 2BY6X 3LDXH 3Q3XA
chains in the Genus database with same CATH topology
1AN1E 1QB6A 3OY6U 1GJCB 2EI6A 1OWDA 2GV6A 1YCPH 1ZTJA 1X7AC 1KLIH 3PTNA 4HZHA 3RXPA 3URDA 4X6PA 4R8TB 1GJ4H 1QR3E 3KQDA 1THPB 3SJKA 2PSYA 4NIVA 3H7TA 1AFQB 3A7ZA 1BMMH 2RDLA 1MTWA 5FX6A 1HAIH 4BAOB 4F49A 1SGIB 2VIQA 2GMTB 2P3FH 3LH1A 1MTNB 1FAKH 2WYGA 3UUZA 1W0YH 1V2MT 1LTOA 1NN6A 4ISOA 4YZUA 3LT3A 1MZDA 1NRSH 1BTPA 1TX7A 1C2KA 2WUBA 3EA7A 4ABBA 1HFDA 3PO1C 4FUFA 2Y5HA 1TGBA 1MKWK 2WUCA 3LJOA 4B75A 1PPZA 5K0HA 1S5SA 1HXEH 1ABJH 2BVSH 4CRCA 1ZYOA 5LH8A 3PV4A 4INKA 1GHYH 2ODPA 1PYTC 2R2MB 1IQKA 5FCRA 3CS7A 4MNVA 3O8RA 1A4WH 3FVFB 1PPCE 4NWLA 1OS8A 3C27B 2GCHF 3BV9B 1HXFH 5EPYA 3RXBA 4Q7XA 2VH6A 1C5VA 1EX3A 3I77A 2BY5X 5CHAC 1SFIA 1O2WA 2QXJA 2ZDVH 1P2NA 2WPKS 1FLEE 2VU8E 2SGEE 3JZ1B 1FONA 4ABGA 2ULLA 2GT8A 3IWMA 2BDGA 2K1QA 4X2YA 3A80A 3UWJH 3GDUA 3K6YA 2FTLE 1C5PA 1YF4A 3UPEA 1DLKB 4FUEA 5BRRE 6GCHF 2ZKSA 1K21H 1Z8JB 1GMCG 1TNLA 3MMGA 3RXTA 3F1SB 1UO6A 4YESB 4A6LA 5K7RA 1BA8B 2BDCA 2SGDE 2ZU5A 4JYVH 1NPMA 2Y7XA 1YPHC 1ABIH 3KQBA 5A0AE 1SQAA 3GYMA 3U1IB 1W8BH 4NG9H 4Y71A 2SGPE 1OWHA 4SGBE 2BD3A 2OC1A 1ARCA 2FDAA 4MPWA 4JMYA 1THSH 5A8YA 1ZZZA 4WVPE 1DFPA 3UQVA 3SOSA 1MTSA 3NWUA 2TIOA 2W3IA 3QTOH 5FPSA 1O34A 2BQ6B 1P2JA 2D1JA 1BJUA 2NU2E 3MFJA 3GCHB 1SQOA 1S83A 1GJAB 1Q3XA 2FODA 1RGQA 3SNAA 3RXUA 4I8LA 1FV9A 4ZXYH 1DWDH 3M37A 2FOMB 2GCHG 3VXEH 4D7GA 5HXFA 3ZYDA 2DE9A 2ZGBH 3BTKE 3ZVEA 1IQGA 2AMQA 2Y6TA 3NXPA 4DG4A 3SUFA 1M9UA 1ZGIA 1ANCA 1TBZH 1TRNA 1V2NT 3SN8A 2V6NA 3P8FA 1LQEA 3TVJB 3BEFB 3EQ0H 4WMEA 1C5WB 3W94A 4ABEA 1P2IA 5C1XA 4FUJA 1ESTA 1VITH 1GDQA 3GCTG 1JXPA 1MBMA 1P2OA 3RXEA 1A5HA 5A09A 1H9IE 5DO4H 1L2EA 3OY5U 3P6ZB 1SLUB 3RM2H 3SV8A 1Y3YA 1V2ST 2UUFB 3MU5A 2PLXA 4XOJA 1MCTA 1GBMA 7GCHF 3V3MA 1A46H 1UVTH 2ILNA 3SJ8A 1AFQC 1ZRKA 2FPZA 1O3KA 1K9OE 2V3HH 1P01A 5GIBA 1ZPZA 3A7TA 3RXQA 1ELCA 1N1LA 3T5FH 4CBOA 5E2OA 2WPLS 1A5IA 1AB9B 2Q6FA 3LGYA 2BM2A 2R9PA 1MD7A 3SUEA 1RXPA 5C5NA 3PO1B 1ELBA 5F8XA 2OQ5A 3I78A 1UJ1A 2Z9GA 3GY3A 1J9CH 1AQ7A 3D62A 2ASUB 1Y8TA 1TFXA 2V3OH 3TU7H 2ZHDA 1QQ4A 2Y5FA 3BF6H 1W11U 1IOEA 2Z94A 1MU8B 1S85A 3A88A 3MHWU 8LPRA 2G55A 1AD8H 1XXDA 5HM9A 5GCHF 3TLOA 1O3NA 5AFZH 1UTMA 1KYNA 1BUIA 1DXPA 2ZHEH 4QT8C 1GHBF 2FXRA 4KGAA 1QJ6B 3S0NA 1C5NH 2HVXA 1C5MD 1SOTA 3JZ2B 3LGVA 1XUIA 3SGQE 3NCLA 3A8CA 2JH6D 1FAXA 3GISB 4FXGH 4Q2KA 3UNQA 2PKSC 4GUXA 5C3NA 1T4VH 5C1YA 1S81A 4THNH 2F9PA 3S9CA 1O38A 1GMDF 2FP7B 5L30H 3GICB 5F8TA 1GI8B 2FYQA 2A32A 1W2KH 4JZIA 1F2SE 3O8CA 3SZNA 1XMNB 3EAJA 3U69H 1W10U 1O2RA 3EYDA 5J4QA 1YC0A 1KXDA 2A5IA 1AIXH 3NK8A 3GDVA 2PWXA 1YPGH 4X2VA 1EXFA 3AASA 2PTCE 4UFFH 2YOLA 1GHAG 2PHBA 2LNCA 1TRYA 1YBWA 1TABE 1BZXE 1E0FD 1F5LA 1O3PB 4ZAEA 1DANH 4LK4A 2TRMA 4ZUHA 2ZGJA 1VGCB 1C1OA 1B0EA 1OXGA 3SU6A 2Q6GA 3MOCA 3CP7A 1HRTH 1SB1H 3SHCH 4Y8YA 5JBCS 1G9IE 2VGCC 1UTJA 4B1TA 4ABIA 5J4SA 1GHWH 1JBUH 3E91A 3LOXA 8GCHG 1LVBA 4LZ1H 3E16B 1KXCA 2TBSA 2GVFA 1IQFA 2JH0D 5EQRA 3BTDE 3ZZ7A 3OSYA 1AE5A 1O2YA 3RXSA 1CGHA 1O32A 4IC5A 1EQ9A 2LPRA 5HGGA 3ZYEA 1EJAA 5HYOA 3A8DA 1NRQH 1O36A 1AO5A 2VWNA 3BN9A 1XKBC 3UR6A 1ZRBA 2ZCHP 1GJ6A 1UVOA 3LIWA 4YLQH 5A0CA 1C2FA 1A7SA 1C9TA 2DUCA 2RCEA 1EAIA 1HV7A 1RIWB 2J9NA 3N7OA 2A4QA 2ODYB 5A8ZA 4A1XA 5C20A 1A61H 3HKIB 1V2LT 3E0NB 2GX4A 1QJ7B 1JIRA 1Q2WA 4TWYA 3RXRA 4XE4A 3T2NA 5TJXA 3BTGE 4MNYA 2WPJS 1EB1H 3QLPH 2PKAA 3F9FA 1D3QB 3RXMA 3M35A 4JZ1A 3SQEE 4Y11E 4GVUA 2OD3B 1GVKB 4FUCA 3NKKA 1C2IA 4NA7A 2ZU4A 4X1SU 3T26A 4FUBA 1V2PT 1GHZA 2PTNA 1BOQA 4BANB 1A3BH 3K2UA 1NC6A 2NU4E 1G3CA 1SGYE 3EA8A 1RTFB 3Q76A 5TCCA 4A7IB 1Y3VA 5A2MH 4GLYA 4I32A 1GG6C 1P9SA 2ZFFH 1OWIA 1WTGH 3HK3B 7KMEH 3LGTA 1YPJH 3RUOA 1DUAA 1F0RA 1WCZA 2CGAA 3VGCC 4Q80A 1UVPA 4NFFA 2ZF0H 1SPJA 1O3MA 1SGQE 2ZTYA 1GDNA 9ESTA 2A5AA 2ZFTA 2XRCA 4YO9A 1SGFG 1EOLA 1YM0A 3U8OH 5CMXH 2Y80A 5EG4A 1G3DA 3IG6B 4GPGA 3ZZAA 1EAUA 1GGDB 2F83A 1O5FH 4WXVA 3BEIB 3A83A 4NGAH 3E3TA 1AGJA 1O3CA 2GZ9A 1WUNH 1CA0C 3MYWA 1O3FA 1QJ1B 1Z71A 3GOVB 4DIHH 1O2PA 3S9AA 5EQSA 1BRAA 3F9EA 1HIAA 1ZHMA 1LPKB 1TGTA 5JBBS 3ZZBA 3BIUH 1VZQH 1EAWA 2AGEX 1LKAA 1SLWB 2BD2A 2P59A 4ZKSU 3SNEA 1DX5M 3BTTE 3DT0H 1HAHH 4ABAA 3RXOA 2PGBB 1G37A 1TBQH 1Y3XA 4ZKOU 3TJUA 2ZC9H 2BZ6H 1MAYA 3SHAH 1FPHH 1O3AA 3K9XB 1BBRK 2AERH 1EATA 1LO6A 1ELTA 2P16A 1A2CH 2BQWB 4AOQA 1HAVB 1ZJDA 4X6OA 1MH0A 1P03A 2KAIB 4Y7AA 2UWLA 3KIDU 2PKSB 5DP3A 2UUJB 2ZDNA 1WBGB 3TGKE 2BXTH 1G3BA 3TH4H 2G52A 4DGJA 4ZH8A 1ELVA 3ZV8A 2OP9A 1TNKA 1ANEA 1W3CA 5C5OA 1O2OA 1L4DA 5FPYA 1T4UH 2ZQ2A 4MDSA 1UVSH 1D6WA 3KL6A 1TGCA 2ANKH 2F9OA 3BTFE 1MKXH 1Y3UA 5FBIA 2ZNKH 1YKTA 4YT7H 2B0FA 2OQUA 3SJOA 1W14U 1GBHA 2F9NA 1NTPA 1UHBA 1DY8A 3RXDA 4DURA 1GJ5H 2O8MA 1FN6A 2VWOA 2ZI2H 5EU8A 1QFKH 2BVXH 2KAIA 1BBRH 2A2XH 4YT6H 1P0SH 3QTVH 2J38A 4WWYA 1TX8A 1V2OT 2CN0H 3AVZA 3EA9A 4TPIZ 2AH4X 4MTBA 4K69A 1IQNA 2G4UA 1NFUA 1EASA 2ZHWH 2QA9E 3SI4H 3VXFH 5EW2H 5DP5A 5DPAA 1DSUA 3RXKA 1UTKA 2GD4B 3O8DA 1MKWH 2A4OA 2H1UA 4KTUA 3U9AH 1SR5C 3F6UH 1DICA 2FOCA 3GY4A 1NFXA 4XSKU 1S84A 1PPFE 5B6OA 1JMOH 1KDQB 4X6MA 1BMNH 3KN2A 4Y0ZE 1UK3A 1CT4E 1ZHPA 1C5RA 1HJ8A 4GAWA 1ANBA 1IQJA 1PYTD 1SHYA 1C1SA 1T8OA 1CO7E 1Y5AT 2OCVB 1ANDA 4I31A 1ZR0A 3CENA 4MNXA 2ZDLA 2XCFA 4Z0KA 2H9EH 4O3UA 2Z7FE 2AYWA 2BHGA 2GT7A 2W26A 3DUXH 3GY7A 4K1TA 3T28A 3TGIE 2O9QA 3LU9B 1WV7H 1TA6A 2BDAA 2ODQA 3RLWH 5FPTA 3L6PA 1PQ5A 2GCTC 4SGAE 1L4ZA 1GBFA 1O2HA 2CHAC 1O3EA 3MU1A 1J15A 1GMHF 1C5QA 1A0LA 5E8EH 2PFEA 4ABDA 2R0LA 2EC9H 2A5KA 1H9HE 2VGCB 3PYHA 1ZSLA 1HAGE 3VB6A 4CRAA 2XTTB 4FU8A 4YOIA 2VIVA 1O2JA 1AWHB 3DD2H 1CHOF 1D9IA 1P09A 1JOUB 1NS3A 4E05H 4KP0A 4HFPB 4X1PU 4MLFB 1C5UA 3PWCA 3BG4C 4X8TH 4Y8XA 3K6ZA 3ZVGA 3V12A 1W0ZU 3SU3A 3HATH 1SGTA 1ELDE 1G2MA 4NZLA 4JYTA 1GI0A 1C2MA 2D2DA 2ZGXH 3ZZ5A 3SORA 1P3EA 1BRCE 1BRBE 5L2ZH 3GYLB 1OYQA 4RKOB 1ZMLA 3M3VA 1O3LA 1EAXA 1P06A 2M5TA 3MO9A 2ZU2A 2VH0A 1QB1A 3GDSA 1PPEE 1A1RA 1LPGB 4X2WA 2HGTH 2XXLA 2H5DA 3RP2A 2GMTC 3STJA 3OU0A 1ZMNA 5EXLA 1GBKA 2OINA 2Q6DA 2FTMA 1P8VC 3Q00A 4U32A 1O5DH 3ODFA 2XBYA 3PB1E 4CRGA 2UWOA 4TWWA 1DWCH 1FPCH 1SGFA 3QWCH 6CHAC 2PGQB 1HAZB 2XNIA 1CVWH 1GHXH 5JDUB 4IMQA 3LC3A 1QA0A 2CXVA 2ZG0H 1SGNE 1DS2E 1DY9A 4TY7A 5CHAB 2W7SA 1V2TT 1UCYH 1GJ9B 1HPGA 3M3TA 4XBDA 1RRKA 3ODDA 4WH6A 2DE8A 1DOJA 1RJXB 1OSSA 1HAOH 4H42U 1FJSA 1O2XA 4UONA 1IQIA 2H2ZA 2VIWA 1UK4A 3M5OA 1HNEE 1C2JA 4MPVA 1O2IA 4FU7A 4VGCC 3ZVCA 2AS9A 1TIOA 4JK5A 2VVUA 1N6XA 1QRZA 1DVAH 4XBCA 3A89A 1ZLRA 2QXIA 2OUAA 3SJ9A 4A1TA 5HM2A 1BQYA 3OYPA 3NZIA 3RXCA 1K22H 5H4IB 4ABJA 1O3GA 1QBVH 3D49H 4NWKA 4GCHG 1C2HA 4A5TS 4NSYA 1GL1A 4K60A 1CE5A 2FX4A 4Y8ZA 1G3EA 1KSNA 3A86A 1NT1A 1EPTB 2RG3A 1YPLH 2BD8A 4O3TA 3B23B 4YOJA 5FHTA 1GJDB 4OGXA 1LHCH 3RU4T 4LZ4B 1GHVH 1OWKA 4D7FA 2SNVA 1SLVB 2EI7A 3L33A 1DWBH 1QL9A 4A92A 1XUFA 1GBBA 1Z7KA 2AIQA 1O5EH 4GHTA 3RXHA 1HJAB 1O2SA 1PJPA 2NWNA 2H9HA 2ANMH 3M36A 1GJ7B 4ASHA 2O8TA 2UUYA 3GCNA 5AVDA 3AAUA 4R0IA 1FMGA 3H5CB 2P95A 1Z1IA 2PUQH 3V7TA 4AORA 2FESH 4AZ2B 4FUIA 3ZVBA 2VWMA 1PPGE 1OP8A 3MNXA 4UFGH 1C1VH 2Y5GA 1KXBA 1TGNA 4K8YA 4O9VA 4JCNA 6GCHG 2VINA 3GCTF 1ESAA 1MBQA 1DWEH 2FI5E 4FUDA 4INLA 5EPNA 1ZTKA 3L3TA 2P8OC 4UDWH 3ZVAA 1SBWA 3TGJE 1W13U 1K1PA 3E90B 1J8AA 4CHAC 1Z6EA 4Y10E 2F9BH 2P8OB 3UNSA 3KF2A 1BITA 1W7GH 2AGIX 2NU0E 1MTUA 1C9PA 3URCA 3RXJA 1P11E 5ETXA 3BSQA 3SU1A 1TX6A 4GHQA 1MKXK 3ATLA 2G5NA 4BAMB 3KNXA 3P70B 4WXIA 5C1UA 2FI4E 1GMHG 6LPRA 1SGEE 1TQ7B 1GCTC 1TPPA 3SV7A 1S6HA 1FUJA 1WOFA 3FANA 1EZSC 3T62A 1EZUC 1HAVA 2GV7A 1EOJA 1XUJA 5LGOA 1TPAE 2P3UB 3SV6A 1F0UA 2QCYA 1P2MA 1L1NA 1XUKA 1O33A 3LC5A 8GCHF 4BAKB 1UMAH 1TOMH 2ZDMA 2F9VA 3U8TH 1FY5A 2XC0A 1BTWA 2HWLB 1MMJN 3M5LA 3PLBA 1F5KU 1NROH 1O2VA 2ZEBA 2GDDA 2YNBA 1O2NA 3QZQA 1TYNA 2STBE 4Y0YE 3C1KA 2BX3A 3QUMP 2JETC 1GBJA 2VVCA 1N8OC 2C8XB 4B2AA 4Q7ZA 2O8LA 4O03A 1BTHH 1KY9A 3OTJE 4GSOA 2STAE 2TGAA 3GY8A 3KCGH 3PLKA 1BTUA 3ELAH 4UD9H 3RC4A 4AYVB 1KXAA 1BCUH 4ISHH 1MUEB 3TITA 2ZU3A 1EZQA 1OWJA 2BOHB 3ZVFA 2R3YA 5DP4A 3ZZ3A 4ZXXH 5EQQA 4MG3A 1AVXA 3K65B