2FOBA

Structure of porcine pancreatic elastase in 40/50/10 cyclohexane
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords elastase-1
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fobA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fobA01
5TCAA 1PPBH 2TGAA 1FXYA 1C1UH 1C1MA 1OSSA 4WF8A 3KGPA 4MVNA 4K1SA 2V3HH 2QCYA 1WBGB 1EZXC 5FCKA 2LPRA 7ESTE 4K8YA 5FPSA 3HGPA 3FVFB 1ZHMA 1GI6A 2O8TA 5E2PA 4ZHLU 2PSYA 4X1RU 1BRUP 2QN5T 3P6ZB 1G36A 5E8EH 1YM0A 1O2JA 1ELEE 1TNKA 2WV4A 3NXPA 4FU8A 4E7NA 4CBOA 4XBBA 5FPYA 4ZXXH 3RXBA 3PLPA 1SGYE 3CS0A 1NESE 3U69H 2ALVA 1SGTA 1ELBA 3SHCH 1YPMH 4E05H 2ZNKH 1GGDC 1HNEE 4A6LA 2I6QA 4OGXA 3EA9A 2HRVA 1FY3A 1P02A 3GY3A 3STJA 1V3XA 2AMQA 4JZDH 2LNCA 3ZVDA 2JKHA 1F0TA 4AFQA 1GMCG 1KXAA 2FXRA 1HGTH 3GCTF 5DGJA 2J4IA 1AFQB 4CRDA 2A1DB 1ZZZA 4B71A 4MPXA 4K1EA 1G32B 2GKVE 2BDBA 1T31A 5F03A 1IQKA 1A3BH 3PMBB 1UTQA 2FTMA 2H1UA 3RXFA 2QXJA 1PPEE 2RA0A 1OOKB 5GCHG 3A7YA 2HNTC 3SV2H 3T28A 2J9NA 6CHAB 2TBSA 2VIVA 5LGOA 4IW4E 2G4UA 2PV9B 2M5TA 1HRTH 2PTCE 3AW1A 1FNIA 1FI8A 1LMWB 1UMAH 3Q3KA 4X0WU 5C20A 3UWIA 3LONA 1LVOA 1NY22 4YZUA 3SNAA 4AYVB 3E6PH 5CHAC 1TB6H 4YT6H 1NFWA 1EAUA 1SC8U 3QK1A 1JMOH 1KXEA 4RSPA 3ZVGA 1H4WA 4U30A 4Y11E 1CT2E 2ZGBH 2BQ7B 1GBAA 2FYQA 3O8BA 1SLWB 1IQMA 2QXGA 1ZSJA 1SGFA 1ELDE 4AYYB 1ZTLA 4KKDA 2CV3A 1G2MA 5A0BA 1O32A 1SGCA 1OYTH 4BAKB 3ZZDA 2CN0H 1O3IA 1HXEH 1LQDB 3BEUA 3VEQB 1J17T 5ESTE 3V13A 5LH8A 4SGAE 1GBIA 5FBEA 2ZEBA 2VINA 2ULLA 3ZVAA 5EODA 1O37A 2XW9A 2WPJS 1ZR0A 4FUIA 3T2NA 2Q1JA 2FX4A 2THFB 2Y5GA 4GPGA 4TYDA 1HJ9A 4X6PA 2FOFA 1NRRH 4YLUA 5FAHA 2ZA5A 1AKSA 2P95A 1ELVA 1SQAA 2BLVA 2ZU5A 1CGJE 1Z1IA 1O3PB 1C9TA 1LQEA 2XWBI 4CH2B 2XBXA 3E0NB 2ANYA 1A4WH 2JH0D 3FZDA 4OS4A 1EAIA 3RXTA 1XX9A 1XKAC 2ZU3A 3T27A 2ZFQH 4NFEA 5GDSH 1BQYA 2RA3A 4NWKA 3O8CA 1MTNC 1ACBE 4ZKNU 2OTVA 2FI3E 2AMPA 1CA0B 5IYTA 1AIXH 1KLIH 4AX9H 1SBWA 3MH6A 2A4QA 3SGAE 3SU5A 1TNGA 4AGJA 1E38B 3RMNH 3SI3H 2BY8X 1W11U 1YLCA 2FTLE 2FMJA 4YLQH 2BDHA 3MU5A 2Y6TA 3SV7A 2C4FH 1TA2A 4O3UA 1MTNB 1BBRH 2W5EA 4ABDA 3M7UA 4X6NA 4CHAC 4LZ4B 2FX6A 3D23A 3NPSA 3TNSA 1Y59T 1TX6A 2BOKA 3SU3A 1GBDA 1EUFA 1BRAA 2H9HA 1C5TA 1P11E 1MCTA 3AASA 1O5GH 5JBCS 1N6YA 1UK4A 2ZF0H 4MNYA 4UE7H 5J4SA 1O33A 1ESAA 2DUCA 4XE4A 9LPRA 2SFAA 1P2MA 4BTTB 4X2XA 1EPTB 1P3CA 1QBOA 1TGTA 1SQTA 2VGCB 3RXSA 2C8XB 1O3JA 3S0NA 1BTWA 5C1XA 2QF3A 4J1YA 1BRCE 1GJ7B 4A92A 1KXDA 2CGAA 4BXWA 4WVPE 3OTJE 1DSTA 1VITH 3ZZ5A 1K2I1 1PPCE 5T6DA 3SNBA 1QQUA 3GCOA 3UQOA 3RLYH 3RMMH 2BXUH 4DIHH 5E0JA 4MQAA 4OGYA 2PKSC 1BMAA 1ELTA 1VGCC 1FAKH 4JZFH 1DXWA 2QGRA 5A8YA 4GHTA 1FONA 3PLKA 5A2MH 3SNEA 5L6NH 1SFQB 1C5RA 1MU6B 2BLWA 1FY4A 1G3CA 2PW8H 1IQJA 1YPHE 4DG4A 1D3TB 1VITG 2WPMS 2B7DH 1O3CA 5A0AE 1JWTA 1MQ5A 1VCQA 5CHAB 1AB9B 3FP7E 1SGFG 1Y5BT 4ISHH 4DIIH 2GV6A 2XBVA 1HAYB 6GCHG 2HNTF 2G51A 2TIOA 3RXDA 1GPZA 1O5BB 1XUHA 4QT8C 3LC5A 5DP9A 1OKXA 1TPAE 4ZKRU 3EE0B 3BTKE 1EZSC 2BVRH 4R8TB 1LHGH 3KN2A 3TH3H 2ZKSA 2OQUA 2ZCLP 3O8RA 1DVAH 4Y0ZE 1TGBA 3QWCH 1O3BA 3P8NA 5GPIB 2BVXH 4MTBA 3ZVCA 2VVVA 4OS7A 1C2LA 4B1TA 4GCHF 2QXHA 3AAUA 2G00A 3L6PA 1V6DA 1C5MD 2VIOA 3VXEH 4ISIH 1V2RT 5FCRA 1O3LA 3F9GA 1W0YH 1WCZA 1GDUA 2G52A 4XFQA 1C5UA 2OQ5A 2SGEE 3RUOA 1O3NA 1DLEA 1K1MA 1MUEB 1XVMA 2TGDA 2F9VA 1KDQA 1MTVA 1HAIH 3A8AA 3FANA 2F9PA 2BY6X 4INHA 1PYTD 1Y8TA 1WQSA 1GHAG 2UUKB 3RP2A 1DITH 1C1PA 1C2FA 3LOXA 1CA0C 1GJ8B 1PPHE 3UWJH 3LKWA 2FOBA 3P8FA 5A8XA 2PFEA 1C2KA 1ZRKA 2OLGA 2AERH 1EOLA 1X7AC 5EW1H 1HXFH 4FUEA 4I7YH 4ZUHA 4JK6A 1ZOMA 2GP9B 2BB4A 2JH5D 1O5AB 1RGQA 1LKBA 1ID5H 2SGFE 4DT7B 1EZQA 3N7OA 1YPKH 1TYNA 3QN7A 4XSKU 1GHYH 4GSOA 4NSYA 1MD8A 1Y3WA 1ARCA 1O3HA 1BBRE 1HAGE 1K1LA 2H5DA 3LGTA 1AVXA 1EOJA 4CHAB 5JPMH 4H6SB 3BTWE 3RXMA 1SPJA 1BT7A 4INLA 4NG9H 3QLPH 3GY8A 4K2YA 4DW2U 1EB1H 3M5MA 3TJOA 2Z3DA 3UTUH 1GI2A 4K60A 1QY6A 1TGSZ 4NZLA 3ATIA 4DOQA 1ZGVA 1T4VH 1MU8B 1TGCA 4AFSA 1E37B 1C5QA 1ELCA 2C90B 3MO3A 5F8TA 3TH2H 1ZMNA 1GCDA 3SQHE 1W8BH 4M7GA 1AUJA 2Y82A 5FXLA 4IS5A 3M36A 3A7VA 1RIWC 1F0SA 3CENA 3EDXB 5AF9H 2NU2E 2UUFB 1C4V2 4RKOB 2H2ZA 1L4ZA 1GI4A 2HNTE 2VWLA 4IN2A 3QGJA 4X8TH 1H9HE 5LPRA 1O39A 3RXUA 2Z7FE 1O2UA 4ISNA 1LVYA 4ABGA 1K1NA 5EQQA 2GMTB 1AI8H 1CT0E 1YCPH 4B75A 3TITA 1WSSH 4Y0YE 2FS9A 3GY5A 1WUNH 1YYY1 2VB0A 4X8UH 1EQ9A 4YOJA 1O5EH 1G3EA 1E36B 2WUBA 1GG6C 2A7CA 1THSH 1HAHH 1C5SA 2VNTA 4YOIA 2AIPA 2OUAA 3LC3A 2FYRA 1QNJA 4YESB 2ZDLA 5FPTA 3ZZBA 1O3DA 1F5RA 4K8BA 1YCPK 1F0UA 2H5CA 1QJ7B 2I6SA 1IOEA 3MH7A 1P2KA 3BV9B 2R0KA 4ISLA 1SHHB 1O5CB 4INKA 4NCYA 2OBQA 4ZXYH 4AFZA 1MBMA 3A8CA 1OYQA 1B7XB 2XBWA 1TAWA 2OP9A 3VGCC 3OX7U 3V7TA 9ESTA 4DJZB 3D65E 2ZU2A 4I8HA 4U01A 3PV4A 1JRSA 3E3TA 4A5TS 2RG3A 1W7XH 3SBKA 3QUMP 1GJ4H 1NU7B 3LGUA 2SGAA 1HPGA 1J9CH 1ZSKA 5C67A 2FOMB 2NU3E 3RXOA 4BTIB 2F9BH 1B0EA 2ANWA 3ITIA 5I25A 1QL7A 1A46H 1P2QA 4Z0KA 2ZQ2A 1Z1JA 3ZZCA 1MQ6A 1QB6A 4YOGA 3RXEA 1S84A 1Z8GA 3TVJB 2QY0B 1J14A 4TY6A 2AMDA 3A7XA 2UWOA 2BD4A 4AG2A 3GY2A 1DE7H 1DM4B 3RXPA 2ZHDA 3ELAH 2OC0A 2YNAA 4FUJA 2TPIZ 1GHAF 3T62A 1ZTKA 4D7GA 3ZZ9A 3RXAA 3Q3XA 1DDJA 3KL6A 3U9AH 4I33A 1AE8H 1OWDA 1C5NH 2H9TH 4JMYA 4FUHA 1P2OA 3SN8A 3PMJA 4KTSA 1W12U 2FO9A 1GCTB 1YPEH 3MWIU 1BOQA 1XUFA 4FU9A 1GBBA 2BZ6H 1TQ7B 2Y5HA 3VB3A 3QZQA 1QGFA 3TK9A 1IQEA 2ZHWH 3K9XB 3QX5H 2QA9E 2GX4A 1O2QA 1W14U 1GWAA 3ATKA 4BTUB 1G2LA 1NTPA 2BTCE 3VB6A 5C1UA 4I8JA 2Y5FA 1BMMH 1AQ7A 1AZZA 1TNHA 4A1VA 1MD7A 2NU1E 3JZ1B 1BCUH 1V2NT 4CRGA 3TJVA 3D62A 2EI7A 5GWZA 1GL0E 4OS2A 3M35A 1FIWA 2ZPQA 2VH6A 1AFEH 4TY7A 5G4BA 2ZHEH 5F8XA 2ILNA 5HMAA 1QBVH 2Z9LA 1QCPA 2Y81A 8ESTE 4FUBA 2KAIB 1F5LA 1QRWA 3E90B 2BMGB 2BVSH 3RU4E 1T8OA 2BD8A 2GD4B 3ATLA 1TRNA 2J38A 2XWAA 3RLWH 5EXLA 1KXCA 2NU0E 2GCHF 1IQIA 3BF6H 3LJOA 1SMFE 1SQOA 1DFPA 1GBEA 1P12E 2PUQH 5DJ7A 4B74A 4ABIA 2ZIQH 4JYTA 3TGIE 5AHGH 2BY5X 4CBNA 1EJMA 2BLQA 3VGCB 3OY5U 4BNRA 1NS3A 1TRMA 1GMCF 3GCTG 3TPIZ 4NA7A 4GVUA 1GJ9B 4FUDA 1ELFA 4Y8ZA 3URCA 1GJ6A 3VB7A 1TALA 2GMTC 2WINI 3F9FA 2PKAA 3S9CA 1W3CA 2C3SA 1W2KH 1D4PB 2PTNA 3TGJE 1GG6B 1FJSA 1YGCH 4MNXA 1UVUH 1V2MT 3U8TH 4D8NA 3SUEA 1E0FD 1NFXA 2Z3EA 5DO4H 1MMJN 1FUJA 1HCGA 1V2WT 3H7TA 1OP8A 2FI5E 1QIXB 1HIAB 3SOSA 1BRBE 1C1VH 1TQ0B 2P3FH 3MYWA 4Y10E 1P04A 1J15A 4UONA 1S6HA 1RIWB 3MH4A 1GI1A 3F1SB 1VR1H 1Z6JH 3U98H 2HWLB 2GVFA 3Q76A 3RXKA 1QRZA 1S0RA 2P93A 4HI3A 5DP3A 1C2JA 1O2XA 1TONA 2A2QH 1QBNA 1V2KT 3MOCA 2OC8A 1OP0A 1SGQE 2FOGA 1TPPA 2D2DA 4FUCA 5ETXA 1FDPA 3NCLA 1P9SA 1GMDG 1WAYB 5DG6A 2OC1A 4ABHA 5ESBA 2ODYB 2ESTE 2A5IA 3G01A 1P05A 1XKBC 3PMAB 2BX3A 6ESTA 4Q2KA 2BHGA 1NM6A 2JETC 1DUEA 1JRTA 1S85A 3AW0A 3HATH 2A31A 5JYIA 2BD3A 4MLFB 2ZTZA 1HB0B 7LPRA 1CQQA 1GBCA 1KDQB 2IPHA 4IMZA 1YC0A 2STBE 3QDZB 2Z9GA 4E06H 1G3DA 5SGAE 1O3AA 1FY1A 3TLOA 1BTXA 1RS0A 1TBZH 3MO6A 4CRBA 2UUJB 1K1IA 1S0QA 3JZ2B 1C2GA 4BXSA 1Y3VA 1F92A 4WXIA 1AMHA 1OS8A 1GJAB 4Q7ZA 2FEQH 4MNVA 1C2EA 2BDAA 1BMLA 3SJOA 1EB2A 4PROA 2XXLA 4HZHA 5F6MA 2XNIA 1TX7A 4BANB 1UTPA 1FAXA 1TABE 1NRQH 1O3OA 1UTJA 1SGRE 1W10U 1K1JA 3S9BA 1P2IA 3UOUA 1T8NA 1HAVA 1MKXK 5AFYH 2H6MA 1DWCH 2ALPA 1QJ1B 3LH1A 1GI8B 5L2ZH 3MFJA 1TBRH 1PFXC 2H9EH 5E0GA 1G9IE 2Z9IA 1NT1A 1HJAC 4UFFH 2EI8A 3ENSB 4Q7XA 4X1PU 1QRXA 2FZZA 1AE5A 1TRYA 3SNCA 1JIRA 1QA7A 3BG8A 5I46H 1O2SA 2F83A 2W26A 2HLCA 3BSQA 2BD5A 1CHOF 3BTDE 1CU1A 3SU1A 3NWUA 2P3TB 4D76A 3DUXH 4DGJA 1IQGA 2FI4E 1K21H 1XXDA 2BM2A 1OPHB 1GMHG 2Y7ZA 2ZC9H 3FFGA 1DWDH 1ETSH 3RM0H 1AY6H 1O3FA 3A82A 2GT7A 3QO6A 3U1JB 1VGCB 3OSYA 4Y7AA 2WUCA 2P8OC 2OCVB 1O3MA 2Z9KA 2IN2A 4SGBE 1LKAA 4YTAA 4FUFA 1RTLA 5C1YA 3ZZAA 2P3UB 4JYVH 1XXFA 1KYNA 2HOBA 5JB9S 3GDVA 1MTWA 1QA0A 1S5SA 2ZI2H 1FPCH 1VJAU 1BITA 2WYJA 1BIOA 4ZMAH 3BIUH 5EQRA 1WYKA 1DOJA 1YF4A 5CE1A 4A1XA 1XUJA 1H9LB 2R0LA 1IQLA 3PM3A 1SVPA 1ABJH 1O2GH 1C4U2 1QURH 2PHBA 1GVKB 5BPEA 1Y3YA 2DE9A 2FWWA 3GYLB 3KQEA 2ZPSA 2BDCA 5JDUB 4HGCA 2Z94A 3H5CB 3KNXA 1YP9A 1HBTH 1JXPA 2W7UA 1S83A 1KXBA 1FN6A 3GCHB 4ZAEA 3MO9A 1SGPE 1FMGA 1C2DA 4X2VA 1UTMA 1WTGH 2XCFA 3MMGA 1ABIH 1SGIB 1C1QA 2BD7A 1BHXB 2O8WA 5BRRE 1ANEA 1MTUA 3SU2A 1GBJA 1TOMH 3M5LA 4VGCC 2BDIA 4K3JA 2TGTA 2J95A 5JBTA 5L2YH 1HAOH 5FX6A 2ZQ1A 1UVPA 1GDQA 1M9UA 2A7HA 5FHTA 3RXQA 2W3IA 2ZTYA 5C3NA 2HALA 1C1WH 2A4OA 1C9PA 3QZRA 1AUTC 3C27B 3PTNA 3LGWA 3NKKA 3BEIB 1O36A 1C5VA 2XRCA 1D6RA 1KTSB 1SB1H 2P94A 1ZMJA 2PKSB 3GDSA 4WY3A 1UVTH 1GJCB 1ZPCA 2SGDE 1NRNH 3LH3A 4NZQA 3SU4A 3LDXH 1DPOA 2AS9A 1AWFH 1C1NA 1GJBB 1TMBH 2CF9H 1LHEH 3FP6E 1Y5UT 1ESBA 2Z6BD 4ZH8A 3FZZA 5EOKA 4DURA 1A2CH 1NZQH 1FY8E 1VZQH 2EEKA 1TNJA 3B9FH 4FXGH 4Y7BA 4X1SU 1GJDB 4IMQA 2WYGA 2GZ7A 1DS2E 3PYHA 2GV7A 2VJ1A 1SSXA 1Z71A 1MZAA 1ZHPA 2WPKS 3M7TA 3U8OH 4ABAA 4I8KA 1UVSH 3FP8E 2CXVA 3ZVBA 4Y79A 3UQVA 1N8OC 4UFDH 4Z6AH 3SU0A 2BYAX 3HK6B 3D49H 3TJNA 1H1BA 3ZZ3A 1NRPH 1A1RA 1F7ZA 4U2WA 2O8LA 2Q6GA 2OC7A 1ZLRA 4RKJB 1DX5M 1THRH 4IGDA 5DP6A 2FOCA 3TU7H 3GY4A 1ZRBA 1P09A 3ZZ4A 2WPIS 1OWEA 3TJUA 1FN8A 1O2VA 1AKSB 2ZFFH 3S7HB 1EJAA 4NSVA 3UOPA 1K22H 1GI0A 4Y6DA 3C1KA 1LTOA 4VGCB 4MPUA 1EPTC 1Z6EA 3MU1A 3ZVEA 1AWHB 3B8JA 1H8DH 4KELA 4H4FA 3SQEE 1EATA 1LPGB 1WOFA 1K1PA 1L4DA 2AGIX 1UTKA 5F8ZA 2AFQB 1MKXH 1EAWA 1HJAB 1DLKB 5HXFA 1ETTH 1SLVB 1Q3XA 2ZHQH 1UK2A 1RTKA 5JB8S 3PO1B 5C5NA 3EA8A 2ZCKP 1H8IH 1TNLA 3KIDU 1AB9C 3S69A 1F0RA 2UWLA 1OWHA 5DK1A 5FBIA 1FQ3A 3SNDA 1O2MA 2XBYA 4XBDA 2B5TB 3S9AA 1UO6A 7GCHF 2IOTA 2G81E 3SJKA 2EA3A 2O8MA 2VWMA 4IC5A 3BIVH 1SGNE 1WV7H 1WTHD 1CHGA 4UDWH 4ISOA 4MPWA 1HV7A 3A84A 1MKWK 1P2JA 1W13U 3VB4A 1DWEH 1IHTH 1UVOA 4GAWA 2ZFRH 3W95A 3ZZ8A 2VGCC 5HYOA 3ODDA 1NC6A 3GCNA 3UFAA 1KSNA 1P03A 3MU4A 2C93B 3LU9B 3SUGA 1GHBF 1E34B 1O5DH 4OS1A 2A45B 1KLJH 1YPHC 4TWYA 4A7IB 5TJXA 1CT4E 1GDNA 4CRAA 4OS5A 2GZ8A 1A0JA 3PB1E 2CJIA 2P59A 2R3YA 4H42U 3DT0H 1C2IA 1ZGIA 1ETRH 1CVWH 1A7SA 2BY7X 4CRFA 4D9QA 4BOHA 3BEFB 4R0IA 1G30B 1QQ4A 4WXVA 6LPRA 2VIPA 3TGKE 2O9QA 2W7SA 2B0FA 1INCA 4JZIA 3HGNA 3V3MA 3KQDA 1K9OE 4ABEA 1YCPM 1DANH 1ZJDA 1DUAA 1P10A 3SGQE 2STAE 1QB1A 3MNCA 3AVZA 2QXIA 2G55A 3I77A 2PGBB 2KAIA 4AB9A 2D26C 1PQ7A 3BG4B 3HPTB 1GCTC 3A83A 2HGTH 1YKTA 2CHAC 2ZGXH 1LPZB 1L2EA 3DFLA 1O0DH 1YPLH 8KME2 1PQ8A 2A4GA 4FU7A 4Y71A 4AGKA 2CF8H 1A0LA 3KF2A 2Y80A 3UPEA 1C2HA 1SHYA 4AN7A 1D6WA 1IQFA 1GBKA 3LGVA 5DP5A 1DY8A 4D7FA 4GHQA 1SI5H 2D1JA 3P92A 3TNTA 3UREA 1GI5A 1NU9A 3MNBA 5DKMA 2AGGX 3SJ8A 6CHAC 3UNSA 4LZ1H 1TX8A 1IQHA 1GBLA 5IDKA 2ZG0H 3T5FH 4X8SH 4NIXA 4KTCA 4YO9A 1Q2WA 3O8DA 3K6YA 3KQBA 4GUXA 2GDDA 2HPPH 4UFEH 1C5LH 4IC6A 3GOVB 5T6GA 4Q7YA 5A0CA 4WMEA 1UTOA 1Z7KA 2BDYA 5HGGA 1PPGE 4NWLA 5GCHF 4WMFA 1T7CA 2VH0A 2R2MB 2GCHG 1FLEE 1V2PT 1UTLM 3RXLA 5K0HA 1MCVA 1J8AA 3QGNB 2FPZA 4YT7H 2XC0A 1RFNA 2TGPZ 1CA8B 1VCWA 3M3SA 1GGDB 3M61U 1FPHH 3RC4A 1EKBB 4WJG2 1CBWC 5JBAS 2RDLA 3BTGE 4K1TA 3TH4H 4AB8A 3MI4A 3SO3A 3BTME 3MU0A 1RTFB 2DE8A 5C2ZA 5C5OA 1Z8RA 1ZPZA 3F9EA 1NRSH 3F6UH 3RMOH 1HYLA 1O2NA 1C5PA 2A5AA 4JK5A 2FOHA 1LHFH 2ASUB 1O2TA 1SL3A 1HUTH 3PTBA 4ZHAA 2FM2A 3ZVFA 1VJ9U 1OWKA 4BAQB 4IN1A 2FESH 7GCHG 1G3BA 4NIYA 2VWOA 1G37A 3HKJB 1KTTB 1AU8A 3E1XB 4O97A 4H6TA 1MBQA 1PYTC 3BTHE 2WPHS 2RCEA 1SFIA 4JZEH 4DY7B 5B6OA 3LT3A 1O2LA 1W7GH 1QL9A 3BG4C 1BBRK 1C5OH 2Z3CA 4JCNA 3RC5A 3ZYDA 3GY6A 3RXVA 2QF0A 1O34A 3RXHA 1A5HA 4TWWA 1TNIA 2VVCA 1IQNA 5LPEA 1EP5A 1KXFA 4THNH 4AORA 1T8MA 3EGKH 2OINA 2PWXA 3RXGA 1GL1A 3QTVH 3SI4H 4I31A 4UEHH 4FVBA 1N1LA 1QJ6B 1V2OT 3UUZA 2F91A 3A86A 2ODPA 1F5KU 2ZDMA 3P8OA 3ZZ7A 2WPLS 1C1RA 1T4UH 1GHXH 1D9IA 2FDAA 3F68H 1VCPA 1EJNA 1S81A 2PUXB 4XDEA 3A88A 3A7TA 2PKAB 2TRMA 4MPVA 2Q6DA 2VIQA 1EXFA 1FZZA 1V2ST 5FX5A 1AGJA 1GBMA 4X8VH 1PJPA 2F9NA 2ZECA 3MHWU 2Z9JA 1MH0A 1V2JT 1GVLA 5A8ZA 1CGIE 1TA6A 2A5KA 2ZZUH 1E35B 2FLRH 2J2UA 1TFXA 1UK3A 3Q00A 1JOUB 1UTNA 3P70B 4ZKOU 3F9HA 1BDAA 2GZ9A 2HVXA 1K1OA 2UWPA 3EAJA 1C2MA 3KCGH 4KGAA 3P17H 1A5IA 2ANKH 3TIUA 1HIAA 1C1SA 1ARBA 1TWXB 2ZGCA 4BAHB 3RXCA 2QAAA 1AVWA 3CS7A 3DFJA 4B2BA 2AIQA 1UHBB 4ZHMU 4Y8YA 1GMDF 4FUGA 3ODFA 1L1NA 4WWYA 4MDSA 4U32A 3MTYA 1UJ1A 3E16B 2R2WU 1EP6A 3R3GB 4F4OC 1GHWH 1RD3B 1BB0B 3LGYA 4B73A 1HFDA 1AHTH 3B23B 1K28D 4GCHG 1LCYA 4DCDA 1GHBG 1BZXE 5JBBS 4TPIZ 3KEEA 1NFUA 4BAOB 4Q80A 1XMNB 2AEIH 1Z8IB 2G5NA 2ODQA 2BDGA 3BTTE 4UFGH 5E2OA 1O3EA 5HM2A 1BHXF 3PWBA 2A4RA 3M3TA 3MU8A 4I8GA 1V2TT 2BZAA 2ZPRA 2ZU4A 3A7WA 3MNSA 4TPYA 2G5VA 5EQSA 4JZ1A 3A87A 1TMUH 2FS8A 3UNRA 3W94A 2XTTB 1CBWB 1FY5A 1XM1A 2GCTC 1Z8JB 4YM9A 2SNVA 2IJOB 5TCCA 1TOCB 4CR5A 3A7ZA 1ANDA 1KIGH 5T6FA 1T32A 1L0ZA 1A3EH 1YPJH 3TK6A 2VIDA 1LHDH 2A32A 1DT2A 1O38A 3RDZA 1N8OB 3I78A 1SOZA 1YBWA 3RXIA 1JBUH 2C8WB 1BA8B 1TBQH 2JH6D 3ZYEA 3LPRA 2ZDAH 1LPKB 1TIOA 1IAUA 1HAVB 3U1IB 1LVBA 3L33A 1PPZA 1O30A 5GXPA 2NWNA 1BJVA 1O2ZA 3PMHB 1V2LT 5EG4A 2FODA 4J2YB 4GLYA 1MAXA 5EPNA 2ZGJA 3HKIB 2VIWA 1CE5A 2J94A 4X1NU 1P0SH 1TPOA 2FOAA 2J92A 2ZTXA 3SJIA 1AO5A 1GMHF 1S82A 3A8DA 7KMEH 2WV5A 2XC5A 1Y3XA 1PQ5A 3M7QA 5A09A 1GBTA 3RC6A 1BTPA 3EYDA 1O2YA 4MNWA 4CR9A 1N6XA 1W0ZU 1Y3UA 4FVDA 3VXFH 1QFKH 4B76A 2XYAA 2G8TA 2XCNA 4B2AA 3NZIA 3ESTA 4F49A 1C1OA 4KTUA 3PWCA 3PLBA 4MG3A 1BTHH 2QC2A 1C4Y2 8GCHF 5EXNA 1A0HB 1O2KA 1OP2A 3LGIA 1EZUC 3RU4D 4NA8A 1WQVH 3ZZ6A 4KP0A 1KY9A 1ZSLA 5EGMA 1WU1A 5DP4A 1ZTJA 2W3KA 1AVGH 2R3UA 3DA9B 5CMXH 3E8LA 2GDEH 4ESTE 3OYPA 1OX1A 2OBOA 1NN6A 1S6FA 1O35A 3ATMA 8LPRA 2J34A 4CH8B 3GCHC 1SGDE 3EQ0H 2ZDKA 1ELAA 3SUDA 1FV9A 2B9LA 2ZDNA 4UD9H 1EX3A 4X2WA 5EW2H 1AZ8A 2A2XH 5AVDA 3MNXA 2JETB 3A8BA 4ASHA 4CREA 1UCYK 1QB9A 1UCYH 1EAXA 1P3EA 5PTPA 4NIVA 5H4IB 4K5ZA 3RXJA 3SV8A 1C5WB 3V12A 3WY8A 4A1TA 2ZO3H 1JIMA 2P8OB 1QL8A 1O3GA 2VU8E 1ZPBA 2YOLA 2BD2A 3BN9A 1ZHRA 2FOEA 1T8LA 3H7OA 1DSUA 1D3QB 3RMLH 2AH4X 1KLTA 3SGBE 1DXPA 3BTQE 3DHKH 3PO1C 1O31A 1EPTA 3OU0A 2FIRH 5LPFA 1TMTH 3QTOH 1VITF 1ZYOA 1NROH 1V2QT 2NU4E 2CMYA 1ZMLA 3GY7A 4WH8A 3T25A 6GCHF 1C5XB 1GI7B 2D8WA 3GICB 1PQAA 4OS6A 2BY9X 3ATWA 1QR3E 4Y8XA 2AGEX 1A61H 2V3OH 1BTZA 2BQ6B 2EI6A 1CO7E 2PGQB 2VWNA 1V2VT 8GCHG 4AZ2B 2C8YB 1SOTA 4X2YA 1CSOE 3TK5A 4O9VA 4XOJA 5K7RA 2O8UA 4NA9H 2QV1A 2V35A 1BJUA 2V0BA 3L3TA 1HDTH 3K2UA 1NFYA 3RU4T 1ANCA 3OY6U 3RM2H 2AYWA 1A5GH 1GHZA 1Q31A 3IG6B 2F9UA 1MZDA 5DP8A 2OD3B 3STIA 1OWIA 2EC9H 3UR6A 3K65B 4I32A 1AN1E 1O3KA 2BLOA 3MH5A 4K69A 1YLDA 4O3TA 1RXPA 5EU8A 3IWMA 4ABFA 1XUKA 2B8OH 2BQWB 1EASA 1QTFA 3UY9A 3M37A 1SLUB 5L30H 1DICA 3DD2H 3IITA 4O03A 2A7JA 1P9UA 2ZWLH 1GBHA 1LDTT 3BTFE 1GHVH 4LXBH 1OWJA 1FIZA 1ORFA 3P8GA 1HLTH 1P57B 1B5GH 3K6ZA 1D3DB 2GT8A 1XVOA 2F3CE 3PROA 4Y76A 4ZKSU 1H9IE 4RN6A 1SR5C 3ZV9A 2ZP0H 3R0FA 1MTSA 3SW2B 3Q3YA 3RXRA 4B2CA 3VPKA 1HAPH 3S7KB 4ZROA 2F9OA 3SJ9A 3U8RH 2ZFTA 3A89A 4ABJA 2R9PA 3UIRA 5DPAA 1BUIA 2UUYA 3M5OA 4X6OA 2ZCHP 3I29A 1GI9B 4X1QU 3NK8A 1IHSH 3E0PB 4CRCA 1C5YB 2SNWA 1O2HA 1L1GA 1UHBA 2QIQA 1XUIA 2SGPE 1ANBA 2QYIA 4WMDA 4ABBA 2ZHFH 1O2RA 2ZFSA 4HFPB 5EXMA 3AAVA 1ESTA 5HM9A 3SZNA 2VVUA 4HTCH 4NIWA 1BTYA 1GBFA 4JYUH 1C1TA 4DVAU 2FLBH 1SLXB 5DP7A 4E7RG 2ZU1A 4NGAH 3A85A 1SGEE 3KQCA 4AOQA 3NUMA 2BXTH 1QHRB 2HPQH 1O2IA 3FAOA 1CGHA 3E91A 1XUGA 1V2UT 3KHVA 4XBCA 2GGVB 3SU6A 3HK3B 2Y7XA 4NFFA 3GYMA 1HAZB 1UCYE 1YPGH 1PPFE 3GISB 3LIWA 3SORA 1AD8H 1BMNH 2SGQE 1D3PB 3CP7A 1ELGA 1P2NA 1HJ8A 5AFZH 2ANMH 1MKWH 3SV6A 2PSXA 3LJJA 3V0XA 2BOHB 1DY9A 3GDUA 5J4QA 2PLXA 4IBLH 4D9RA 2A0QB 2BD9A 1TE0A 4WH6A 1ZJKA 1Y5AT 1HAXB 1RRKA 2K1QA 1P8VC 1B0FA 1LHCH 1F2SE 1O5FH 1GVZA 1C5ZB 2XC4A 3EA7A 1NPMA 3M3VA 1LO6A 2V6NA 2C8ZB 1RJXB 4I8LA 3VFEA 3ZV8A 3SV9A 1U6QA 5GIBA 2GCTB 2OXSA 1TPSA 5ABWA 1O2PA 1OXGA 2ZDVH 5EPYA 1DWBH 3P95A 3A81A 1TLDA 2G4TA 4AG1A 3UR9A 1GI3A 3UNQA 1O2OA 4X6MA 1P06A 1SG8B 3SHAH 2ZFPH 4LK4A 1NO9H 4AFUA 2CHAB 1P01A 3T29A 2ZGHA 1TGNA 3URDA 2BX4A 2FP7B 2YNBA 1THPB 3M5NA 1O2WA 3VB5A 3Q77A 5E0HA 3A80A 4LOYH 1BTUA 2GTBA 1L1JA 5GJ4B 4BAMB 1AFQC 2P16A 1GJ5H 2Q6FA 1LVMA 3T26A 5T3HA 2PR3A 1J16A 1MAYA 1CHOG 3SUFA 3BTEE
chains in the Genus database with same CATH superfamily
4Z1MD 5TCAA 1PPBH 2TGAA 1FXYA 1C1UH 1C1MA 1OSSA 4WF8A 3KGPA 4MVNA 4K1SA 2V3HH 2QCYA 1WBGB 1EZXC 5FCKA 2LPRA 7ESTE 4K8YA 5FPSA 3HGPA 3FVFB 1ZHMA 1GI6A 2O8TA 5E2PA 4ZHLU 2PSYA 4X1RU 4ASUD 1BRUP 2QN5T 3P6ZB 1G36A 5E8EH 1YM0A 1O2JA 1W0KD 1ELEE 1TNKA 2WV4A 3NXPA 4FU8A 4E7NA 4CBOA 4XBBA 2KX4A 5FPYA 4ZXXH 3RXBA 3CNRA 3PLPA 1SGYE 3CS0A 1NESE 3U69H 2ALVA 3UAIC 1SGTA 1ELBA 3SHCH 3N99A 1YPMH 4E05H 2ZNKH 1GGDC 1HNEE 4A6LA 5GNDA 2I6QA 4OGXA 3EA9A 2HRVA 1FY3A 1P02A 3GY3A 3F0PA 1S6LA 3STJA 1V3XA 2AMQA 4JZDH 2LNCA 3ZVDA 2JKHA 1F0TA 5KGOA 1GMCG 1KXAA 2FXRA 1HGTH 3GCTF 5DGJA 4AFQA 2QF5A 2J4IA 1AFQB 4CRDA 2A1DB 4P02A 1ZZZA 4B71A 4MPXA 1E1RD 4K1EA 1G32B 2GKVE 2BDBA 1T31A 5F03A 1IQKA 1A3BH 3PMBB 1UTQA 2OK5A 2FTMA 2H1UA 3RXFA 2QXJA 1PPEE 2RA0A 1OOKB 5GCHG 3A7YA 2HNTC 3SV2H 3T28A 2J9NA 6CHAB 2TBSA 2VIVA 5LGOA 4IW4E 2G4UA 2PV9B 2WZQA 2M5TA 1HRTH 2PTCE 3AW1A 1FNIA 1FI8A 1LMWB 1UMAH 2AHME 3Q3KA 4X0WU 3UWIA 5C20A 3LONA 1LVOA 1NY22 4YZUA 3SNAA 4AYVB 3E6PH 5CHAC 1TB6H 4YT6H 1NFWA 1EAUA 1SC8U 3QK1A 1JMOH 1KXEA 4RSPA 3ZVGA 1H4WA 4U30A 4Y11E 1CT2E 2ZGBH 2BQ7B 1GBAA 2FYQA 3O8BA 1SLWB 1IQMA 2QXGA 1ZSJA 1SGFA 1ELDE 4AYYB 1ZTLA 4KKDA 2CV3A 1G2MA 5A0BA 1O32A 1SGCA 1OYTH 4BAKB 3ZZDA 2CN0H 1O3IA 1HXEH 1LQDB 3BEUA 3VEQB 1J17T 5ESTE 3V13A 5LH8A 5KECA 4SGAE 1GBIA 5C17A 5FBEA 2ZEBA 2VINA 2ULLA 3ZVAA 5EODA 1O37A 2XW9A 2WPJS 1ZR0A 4FUIA 3T2NA 2Q1JA 2FX4A 2THFB 2Y5GA 4GPGA 4TYDA 1HJ9A 4X6PA 2FOFA 1NRRH 4YLUA 5FAHA 2ZA5A 1AKSA 2P95A 1ELVA 1SQAA 2BLVA 2ZU5A 1CGJE 1Z1IA 1O3PB 1C9TA 1LQEA 2XWBI 4CH2B 2XBXA 3E0NB 2ANYA 3UB0A 1A4WH 2JH0D 3FZDA 4OS4A 1EAIA 3RXTA 4M9FA 1XX9A 1XKAC 2ZU3A 2QF4A 2ZFQH 3T27A 4NFEA 5GDSH 1BQYA 2RA3A 4NWKA 3O8CA 1MTNC 1ACBE 4ZKNU 2OTVA 2FI3E 5IK2D 2AMPA 1CA0B 5IYTA 1AIXH 1KLIH 4AX9H 1SBWA 2IPQX 3MH6A 2A4QA 3SGAE 3SU5A 1TNGA 4AGJA 1E38B 3RMNH 3SI3H 2BY8X 1W11U 3OAAD 5FL7D 1YLCA 2FTLE 2FMJA 4YLQH 2BDHA 3MU5A 2Y6TA 3SV7A 2C4FH 1TA2A 4O3UA 1MTNB 1BBRH 2W5EA 4ABDA 3M7UA 4X6NA 4CHAC 4LZ4B 2FX6A 3D23A 3NPSA 3TNSA 1Y59T 4AC9A 1TX6A 2BOKA 3SU3A 1GBDA 3H09A 1EUFA 1BRAA 2H9HA 1C5TA 1P11E 1MCTA 3AASA 1O5GH 5JBCS 1N6YA 1UK4A 2ZF0H 4MNYA 4UE7H 5J4SA 1O33A 1ESAA 2DUCA 4XE4A 9LPRA 2SFAA 5HIZA 1P2MA 4BTTB 5HIYA 4X2XA 1EPTB 1P3CA 1QBOA 1TGTA 1SQTA 2VGCB 3RXSA 2C8XB 1O3JA 3S0NA 1BTWA 5C1XA 2QF3A 4J1YA 1BRCE 1GJ7B 4A92A 1KXDA 2CGAA 4RT1A 4BXWA 4XRNA 4WVPE 3OTJE 1DSTA 1VITH 3ZZ5A 1K2I1 1PPCE 5T6DA 3SNBA 1QQUA 3GCOA 3UQOA 3RLYH 1H8ED 3RMMH 2BXUH 4DIHH 5E0JA 4MQAA 4OGYA 2PKSC 1BMAA 1ELTA 1VGCC 1FAKH 4JZFH 1DXWA 2QGRA 5A8YA 4GHTA 1FONA 3PLKA 5A2MH 3SNEA 5L6NH 1SFQB 4RI0A 1C5RA 1MU6B 2BLWA 1FY4A 1G3CA 2PW8H 4P00A 1IQJA 1YPHE 4DG4A 1D3TB 1VITG 2WPMS 2B7DH 1O3CA 5A0AE 1JWTA 1MQ5A 1VCQA 2WPDD 5CHAB 1AB9B 3FP7E 1SGFG 1Y5BT 4ISHH 4DIIH 2GV6A 2XBVA 1HAYB 6GCHG 2HNTF 2G51A 2V7QD 2TIOA 3RXDA 1GPZA 1O5BB 1XUHA 4QT8C 3LC5A 4FOUC 5DP9A 1OKXA 1TPAE 4ZKRU 3EE0B 3BTKE 1EZSC 2BVRH 1H8HD 4R8TB 1LHGH 3KN2A 3TH3H 2ZKSA 2OQUA 2ZCLP 3O8RA 1DVAH 4Y0ZE 1TGBA 3QWCH 1O3BA 3P8NA 2EQNA 5GPIB 2BVXH 4MTBA 3ZVCA 2VVVA 4OS7A 1C2LA 4B1TA 4GCHF 2QXHA 3AAUA 2G00A 3L6PA 1V6DA 1C5MD 2VIOA 3VXEH 4ISIH 1V2RT 5FCRA 1O3LA 3F9GA 1W0JD 1W0YH 1WCZA 1GDUA 2G52A 2J97A 4XFQA 1C5UA 2OQ5A 2SGEE 3RUOA 1O3NA 1DLEA 1K1MA 1MUEB 1XVMA 2TGDA 2F9VA 1KDQA 1MTVA 1HAIH 2YMSC 3A8AA 2F9PA 3FANA 2BY6X 4INHA 1PYTD 1Y8TA 1WQSA 1GHAG 2UUKB 3EE7A 1DITH 3RP2A 1C1PA 1C2FA 3LOXA 1CA0C 1GJ8B 1PPHE 3UWJH 3LKWA 2FOBA 3P8FA 5A8XA 2PFEA 1C2KA 1ZRKA 2JJ2D 2OLGA 2AERH 1EOLA 1X7AC 5EW1H 1HXFH 4FUEA 4I7YH 4ZUHA 4JK6A 1ZOMA 2GP9B 2BB4A 2JH5D 1O5AB 1RGQA 1LKBA 1OHHD 1QZ8A 1ID5H 2SGFE 4DT7B 1EZQA 3N7OA 1YPKH 1TYNA 3QN7A 4XSKU 1GHYH 4GSOA 4NSYA 1MD8A 1Y3WA 1ARCA 1O3HA 1BBRE 1HAGE 1K1LA 2H5DA 3LGTA 1AVXA 1EOJA 4CHAB 5JPMH 4H6SB 3BTWE 3RXMA 1SPJA 1BT7A 4INLA 4NG9H 3QLPH 3GY8A 4K2YA 4DW2U 1EB1H 3M5MA 3TJOA 2Z3DA 3UTUH 1GI2A 4K60A 1QY6A 1TGSZ 4NZLA 3ATIA 4DOQA 1ZGVA 1T4VH 1MU8B 1TGCA 4AFSA 1E37B 1C5QA 1ELCA 2C90B 3MO3A 5F8TA 3TH2H 3F2FA 5EJLA 1ZMNA 1GCDA 3SQHE 4Q63A 1W8BH 4M7GA 1AUJA 2Y82A 5FXLA 4IS5A 3M36A 3GS9A 3A7VA 1RIWC 1F0SA 3CENA 3EDXB 5AF9H 2NU2E 2UUFB 1C4V2 4RKOB 2H2ZA 1L4ZA 1GI4A 2HNTE 2VWLA 4FETA 2CK3D 3QGJA 4IN2A 4X8TH 1H9HE 5LPRA 4I86A 1O39A 3RXUA 1YWUA 1O2UA 2Z7FE 1LVYA 4ISNA 4ABGA 1K1NA 5EQQA 2GMTB 1AI8H 1CT0E 1YCPH 4B75A 3TITA 1WSSH 4Y0YE 2FS9A 3GY5A 1WUNH 1YYY1 2VB0A 5CDFE 4X8UH 1EQ9A 4YOJA 1O5EH 1G3EA 1E36B 2WUBA 1GG6C 2A7CA 1THSH 1HAHH 1C5SA 2VNTA 4YOIA 2AIPA 2OUAA 3LC3A 2FYRA 1QNJA 4YESB 2ZDLA 5FPTA 3ZZBA 1O3DA 1F5RA 4K8BA 1YCPK 1F0UA 2H5CA 1QJ7B 2I6SA 1IOEA 3MH7A 1P2KA 3BV9B 2R0KA 4ISLA 1SHHB 1O5CB 4INKA 4NCYA 2OBQA 4ZXYH 4AFZA 1MBMA 3A8CA 1OYQA 1B7XB 3U28C 2XBWA 1TAWA 2OP9A 3VGCC 3OX7U 3V7TA 9ESTA 4DJZB 3D65E 2ZU2A 4I8HA 4U01A 3PV4A 1JRSA 3E3TA 4A5TS 2RG3A 1W7XH 3SBKA 3QUMP 1GJ4H 1NU7B 3LGUA 2SGAA 1HPGA 1J9CH 3SUFA 1ZSKA 5C67A 2FOMB 2NU3E 3RXOA 4BTIB 2F9BH 1B0EA 2ANWA 5DN6D 3ITIA 5I25A 1QL7A 1A46H 1P2QA 4Z0KA 2ZQ2A 1Z1JA 3ZZCA 1MQ6A 1QB6A 4YOGA 3RXEA 1S84A 1Z8GA 3TVJB 2QY0B 1J14A 4TY6A 2AMDA 3A7XA 2UWOA 2BD4A 4AG2A 3GY2A 1DE7H 1DM4B 3RXPA 2ZHDA 3ELAH 2OC0A 2YNAA 4FUJA 2TPIZ 1GHAF 3T62A 1ZTKA 4D7GA 3ZZ9A 3RXAA 1YY3A 3Q3XA 1DDJA 3KL6A 3U9AH 4I33A 2K8IA 1AE8H 1OWDA 1C5NH 2H9TH 4JMYA 4FUHA 1P2OA 3SN8A 3PMJA 4KTSA 1W12U 2FO9A 1GCTB 1YPEH 2KCAA 3MWIU 1BOQA 1XUFA 4FU9A 1GBBA 2BZ6H 1TQ7B 5HKKD 2Y5HA 3VB3A 3QZQA 1QGFA 3TK9A 1IQEA 2ZHWH 3K9XB 3QX5H 2QA9E 2GX4A 1O2QA 1W14U 1GWAA 3ATKA 4BTUB 1G2LA 1NTPA 2BTCE 3VB6A 5C1UA 4I8JA 2Y5FA 1BMMH 4B6FA 1AQ7A 1AZZA 1TNHA 4A1VA 1MD7A 2NU1E 3JZ1B 1BCUH 1V2NT 4CRGA 3TJVA 3D62A 2EI7A 5GWZA 1GL0E 4OS2A 2W6ID 3M35A 1FIWA 2ZPQA 2VH6A 1AFEH 4TY7A 5G4BA 2ZHEH 5F8XA 2ILNA 5HMAA 1QBVH 2Z9LA 1QCPA 2Y81A 8ESTE 4FUBA 2KAIB 1F5LA 1QRWA 3E90B 2BMGB 2BVSH 3RU4E 1T8OA 3AK5A 2BD8A 2GD4B 3ATLA 1TRNA 2J38A 2WV9A 2XWAA 3PRBA 3RLWH 4ACAA 5EXLA 1KXCA 2NU0E 2GCHF 1IQIA 3BF6H 3LJOA 1SMFE 1SQOA 1DFPA 1GBEA 1P12E 2PUQH 5DJ7A 4B74A 4ABIA 2ZIQH 4JYTA 3TGIE 5AHGH 2BY5X 4CBNA 1EJMA 2KZ4A 2BLQA 3VGCB 3OY5U 4BNRA 1NS3A 1TRMA 1GMCF 3GCTG 3TPIZ 4NA7A 5EJ1A 4GVUA 1GJ9B 4FUDA 1ELFA 4Y8ZA 3URCA 1GJ6A 3VB7A 5DSFA 1TALA 2GMTC 2WINI 3F9FA 2JDID 2PKAA 3OTPA 3S9CA 1W3CA 2C3SA 1W2KH 1D4PB 2PTNA 3TGJE 1GG6B 1FJSA 1YGCH 4MNXA 1UVUH 1V2MT 3U8TH 4D8NA 3SUEA 4XD7D 1E0FD 1NFXA 2Z3EA 5DO4H 1MMJN 1FUJA 1HCGA 1V2WT 3H7TA 1OP8A 2FI5E 1QIXB 1HIAB 3SOSA 1BRBE 1C1VH 1TQ0B 2P3FH 3MYWA 4Y10E 1P04A 1J15A 4UONA 1S6HA 1RIWB 3MH4A 1GI1A 3F1SB 1VR1H 1Z6JH 3DSGA 3U98H 2HWLB 2GVFA 3Q76A 3RXKA 1QRZA 1S0RA 2P93A 4HI3A 5DP3A 1C2JA 1O2XA 1TONA 2A2QH 1QBNA 1V2KT 3MOCA 2OC8A 1OP0A 1SGQE 2FOGA 1TPPA 2D2DA 4FUCA 5ETXA 1FDPA 3DSOA 3DSPA 3NCLA 1P9SA 1GMDG 1WAYB 1MABB 5DG6A 2OC1A 4ABHA 5ESBA 2ODYB 2ESTE 2A5IA 1E79D 3G01A 1P05A 1XKBC 2J98A 3PMAB 2BX3A 6ESTA 4Q2KA 2BHGA 1NM6A 2JETC 1DUEA 1JRTA 1S85A 3AW0A 3HATH 2A31A 5JYIA 2BD3A 4MLFB 2ZTZA 1HB0B 7LPRA 1CQQA 1GBCA 1KDQB 2IPHA 2M2AA 1SKYE 4IMZA 1YC0A 2STBE 3QDZB 2Z9GA 4E06H 1G3DA 5SGAE 1O3AA 3KYGA 1FY1A 2VBCA 2YMSB 3TLOA 1BTXA 1RS0A 1TBZH 3MO6A 4CRBA 2UUJB 1K1IA 1S0QA 3JZ2B 1C2GA 4BXSA 1Y3VA 1F92A 4WXIA 1AMHA 1OS8A 1GJAB 4Q7ZA 3F2HA 2FEQH 4MNVA 1C2EA 2BDAA 1BMLA 3SJOA 1EB2A 4PROA 2XXLA 4HZHA 5F6MA 2XNIA 1TX7A 4BANB 1UTPA 1FAXA 1TABE 1NRQH 1O3OA 1UTJA 1SGRE 1W10U 1K1JA 3S9BA 1P2IA 3UOUA 1T8NA 1HAVA 1MKXK 5AFYH 2H6MA 1DWCH 2ALPA 1QJ1B 3LH1A 1GI8B 5L2ZH 3MFJA 1TBRH 1PFXC 2H9EH 5E0GA 1G9IE 2Z9IA 1NT1A 1HJAC 4UFFH 2EI8A 3ENSB 4Q7XA 4X1PU 1QRXA 2FZZA 1AE5A 1TRYA 3SNCA 1JIRA 1QA7A 3BG8A 5I46H 1O2SA 2F83A 2W26A 2HLCA 3BSQA 2BD5A 1CHOF 3BTDE 1CU1A 3SU1A 3NWUA 2P3TB 4D76A 3DUXH 4DGJA 1IQGA 2FI4E 1K21H 1XXDA 2BM2A 1OPHB 1GMHG 2KM0A 2Y7ZA 2ZC9H 3FFGA 1DWDH 1ETSH 3RM0H 1AY6H 1O3FA 4B6EA 3A82A 2GT7A 2YMSD 3QO6A 3U1JB 1VGCB 3OSYA 4Y7AA 2WUCA 2P8OC 2OCVB 1O3MA 2Z9KA 2IN2A 4SGBE 1LKAA 4YTAA 4FUFA 1RTLA 5C1YA 3ZZAA 2P3UB 4JYVH 1XXFA 1KYNA 2HOBA 5JB9S 3GDVA 1MTWA 1QA0A 1S5SA 2ZI2H 1FPCH 1VJAU 1BITA 2WYJA 1BIOA 4ZMAH 3BIUH 5EQRA 1WYKA 1DOJA 1YF4A 5CE1A 4A1XA 1XUJA 1H9LB 2R0LA 1IQLA 3PM3A 1SVPA 1ABJH 1O2GH 3FO8D 1C4U2 1QURH 2PHBA 1GVKB 5BPEA 1Y3YA 2DE9A 1NBME 2FWWA 2KCYA 3GYLB 2ZPSA 3KQEA 2BDCA 5JDUB 4HGCA 2Z94A 3H5CB 3KNXA 1YP9A 1HBTH 1JXPA 2W7UA 1S83A 1KXBA 1FN6A 3GCHB 4ZAEA 3MO9A 1SGPE 1FMGA 1C2DA 2F4LA 4X2VA 1UTMA 1WTGH 2EY4C 2XCFA 3MMGA 1ABIH 1SGIB 1C1QA 2BD7A 1BHXB 2O8WA 5BRRE 1ANEA 1MTUA 3SU2A 1GBJA 1TOMH 3M5LA 4VGCC 2BDIA 4K3JA 2TGTA 2J95A 5JBTA 5L2YH 1HAOH 5FX6A 2ZQ1A 1UVPA 1GDQA 1M9UA 2A7HA 5FHTA 3RXQA 2W3IA 2ZTYA 5C3NA 2HALA 1C1WH 2A4OA 1C9PA 3QZRA 1AUTC 3C27B 3PTNA 3LGWA 3NKKA 3BEIB 1O36A 1C5VA 2XRCA 1D6RA 1KTSB 1SB1H 2P94A 1ZMJA 2PKSB 3GDSA 4WY3A 1UVTH 1GJCB 1ZPCA 2SGDE 1NRNH 3LH3A 4NZQA 3SU4A 3LDXH 1DPOA 2AS9A 1AWFH 1C1NA 1GJBB 1TMBH 2CF9H 1LHEH 3FP6E 1Y5UT 1ESBA 2Z6BD 4ZH8A 3FZZA 5EOKA 4DURA 1A2CH 1NZQH 1FY8E 1VZQH 2EEKA 1TNJA 3B9FH 4FXGH 4Y7BA 4X1SU 4DT4A 1GJDB 4IMQA 2QE7D 2WYGA 2GZ7A 1DS2E 3PYHA 2GV7A 5CHBA 2VJ1A 1SSXA 1Z71A 2LP6A 1MZAA 1ZHPA 2WPKS 3OEHD 3M7TA 3U8OH 4ABAA 4I8KA 1UVSH 2WHXA 3FP8E 3DCLA 2CXVA 3ZVBA 4Y79A 3UQVA 1N8OC 4UFDH 4Z6AH 3SU0A 2BYAX 3HK6B 3D49H 3TJNA 1H1BA 3ZZ3A 1NRPH 1A1RA 1F7ZA 4U2WA 2O8LA 2Q6GA 2OC7A 1ZLRA 4RKJB 1DX5M 1THRH 4IGDA 5DP6A 2FOCA 3TU7H 3KYFA 3GY4A 1ZRBA 1KMHB 3OE7D 1P09A 3KQ5A 3ZZ4A 3VG8A 2WPIS 1OWEA 3TJUA 1FN8A 1O2VA 1AKSB 2ZFFH 3S7HB 1EJAA 4NSVA 3UOPA 1K22H 1GI0A 4Y6DA 3C1KA 1LTOA 4VGCB 4MPUA 1EPTC 1Z6EA 3MU1A 3ZVEA 1AWHB 3B8JA 1H8DH 4KELA 4H4FA 3SQEE 1EATA 1LPGB 1WOFA 4YXWD 1K1PA 1L4DA 2AGIX 1UTKA 5F8ZA 2AFQB 1MKXH 1EAWA 1HJAB 1DLKB 3OFND 5HXFA 1ETTH 1SLVB 1Q3XA 2ZHQH 1UK2A 1RTKA 5JB8S 3PO1B 5C5NA 3EA8A 2ZCKP 4HG6A 1H8IH 1TNLA 3KIDU 1AB9C 3S69A 1F0RA 2UWLA 1OWHA 5DK1A 5FBIA 2J5UA 1FQ3A 3SNDA 1O2MA 2XBYA 4XBDA 2B5TB 3S9AA 1UO6A 7GCHF 2IOTA 2G81E 3SJKA 2EA3A 2O8MA 2VWMA 4IC5A 3BIVH 1SGNE 1WV7H 1WTHD 1CHGA 4UDWH 4ISOA 4MPWA 5C0TA 1HV7A 3A84A 1MKWK 1P2JA 1W13U 3VB4A 1DWEH 1IHTH 1UVOA 4GAWA 2ZFRH 3W95A 3ZZ8A 2VGCC 5HYOA 3ODDA 1NC6A 2JIZD 3GCNA 3UFAA 1KSNA 1P03A 1E1QD 3MU4A 2C93B 3LU9B 3SUGA 1GHBF 1E34B 1O5DH 4OS1A 2A45B 1KLJH 1YPHC 4TWYA 4A7IB 5TJXA 1CT4E 1GDNA 4CRAA 4OS5A 2GZ8A 1A0JA 3PB1E 2CJIA 2P59A 2R3YA 4H42U 3DT0H 1C2IA 1ZGIA 1ETRH 1CVWH 1A7SA 2BY7X 4CRFA 4D9QA 4BOHA 2JJ1D 3BEFB 4R0IA 1G30B 1QQ4A 4WXVA 4ZCNA 3W1EA 6LPRA 2VIPA 3TGKE 2O9QA 2W7SA 2B0FA 1INCA 4JZIA 3HGNA 3V3MA 3KQDA 1K9OE 4ABEA 1YCPM 1DANH 1ZJDA 1DUAA 1P10A 3SGQE 2STAE 1QB1A 3MNCA 3AVZA 2QXIA 2G55A 3I77A 2PGBB 2KAIA 4AB9A 2D26C 1PQ7A 3BG4B 3HPTB 1GCTC 3A83A 2HGTH 1YKTA 2CHAC 2ZGXH 1LPZB 1L2EA 3DFLA 1O0DH 1YPLH 8KME2 1PQ8A 2A4GA 4FU7A 3PV5A 4Y71A 4AGKA 2CF8H 1A0LA 3KF2A 2Y80A 3UPEA 1C2HA 1SHYA 4AN7A 1D6WA 1IQFA 1UW7A 1GBKA 3LGVA 5DP5A 1DY8A 4D7FA 4GHQA 5F53A 1SI5H 2D1JA 3P92A 3TNTA 3UREA 1GI5A 1NU9A 3MNBA 5DKMA 2AGGX 3SJ8A 6CHAC 2L6OA 3UNSA 4LZ1H 1TX8A 1IQHA 1GBLA 5IDKA 2ZG0H 3T5FH 4X8SH 4NIXA 4KTCA 4YO9A 1Q2WA 3O8DA 3K6YA 3KQBA 4GUXA 2GDDA 2HPPH 4UFEH 1C5LH 4IC6A 3GOVB 5T6GA 4Q7YA 5A0CA 4WMEA 2J98B 1UTOA 1Z7KA 2BDYA 5HGGA 1PPGE 4NWLA 5GCHF 4WMFA 1T7CA 2VH0A 2R2MB 2GCHG 1FLEE 1V2PT 1UTLM 3N7EA 3RXLA 5K0HA 1MCVA 1J8AA 3QGNB 2FPZA 4YT7H 2XC0A 1RFNA 2TGPZ 1CA8B 1VCWA 3M3SA 1GGDB 3M61U 1FPHH 3RC4A 1EKBB 4WJG2 5C94A 1CBWC 5JBAS 2RDLA 3BTGE 4K1TA 3TH4H 4AB8A 3MI4A 3SO3A 3BTME 3MU0A 1RTFB 2DE8A 5C2ZA 5C5OA 1Z8RA 1ZPZA 3F9EA 1NRSH 3F6UH 3RMOH 1HYLA 3SYJA 1O2NA 1C5PA 2A5AA 4JK5A 2FOHA 1LHFH 2ASUB 1O2TA 1SL3A 1HUTH 3PTBA 4ZHAA 2FM2A 3ZVFA 2RDEA 1VJ9U 1OWKA 4BAQB 4IN1A 2FESH 7GCHG 1G3BA 4NIYA 2VWOA 1G37A 3HKJB 1KTTB 1AU8A 3E1XB 4O97A 4H6TA 1MBQA 1PYTC 3BTHE 2WPHS 2RCEA 1SFIA 4JZEH 4DY7B 5B6OA 3LT3A 1O2LA 5KEDA 1W7GH 1QL9A 3BG4C 1BBRK 1C5OH 2Z3CA 4JCNA 3RC5A 3ZYDA 3GY6A 3RXVA 2QF0A 1O34A 3RXHA 1A5HA 4TWWA 3MQKC 1VKYA 1TNIA 2VVCA 1IQNA 5LPEA 1EP5A 1KXFA 4THNH 4AORA 1T8MA 3EGKH 2OINA 2PWXA 3RXGA 1GL1A 3QTVH 3SI4H 4I31A 4UEHH 4FVBA 1N1LA 1QJ6B 1V2OT 3UUZA 2F91A 3ZIAD 3A86A 2ODPA 1F5KU 2ZDMA 3P8OA 3ZZ7A 2WPLS 1C1RA 1T4UH 2K0QA 3F0OA 4OM9A 1GHXH 1D9IA 2FDAA 3F68H 1VCPA 4F55A 1EJNA 1S81A 2PUXB 4XDEA 3A88A 3A7TA 2PKAB 2TRMA 4MPVA 2Q6DA 2VIQA 1EXFA 1FZZA 1V2ST 5FX5A 2XNDD 1AGJA 1GBMA 4X8VH 1PJPA 2F9NA 1SQRA 2ZECA 3MHWU 2Z9JA 1MH0A 1V2JT 1GVLA 1BMFD 5A8ZA 1CGIE 1TA6A 2A5KA 2ZZUH 1E35B 2FLRH 2J2UA 1TFXA 1UK3A 3Q00A 1JOUB 1UTNA 3P70B 4ZKOU 3F9HA 3WWBA 1BDAA 2GZ9A 2HVXA 1K1OA 2UWPA 3EAJA 1C2MA 3KCGH 4KGAA 3P17H 1A5IA 2ANKH 3TIUA 1HIAA 1C1SA 1ARBA 1TWXB 2ZGCA 4BAHB 3RXCA 2QAAA 1AVWA 3CS7A 3DFJA 4B2BA 2AIQA 1UHBB 4ZHMU 4Y8YA 1GMDF 4FUGA 3ODFA 1L1NA 4WWYA 4MDSA 4U32A 3MTYA 1UJ1A 3E16B 2R2WU 1EP6A 3R3GB 4F4OC 1GHWH 1RD3B 1BB0B 3LGYA 4B73A 1HFDA 1AHTH 3B23B 1K28D 4GCHG 1LCYA 4DCDA 1GHBG 1BZXE 5JBBS 2GJGA 3KEEA 4TPIZ 1NFUA 4BAOB 4Q80A 1XMNB 2AEIH 1Z8IB 2G5NA 2ODQA 2BDGA 3BTTE 3WWFA 4UFGH 5E2OA 1O3EA 5HM2A 1BHXF 3PWBA 2A4RA 2XOKD 3M3TA 3MU8A 4F48B 4I8GA 1V2TT 2BZAA 2ZPRA 2ZU4A 3A7WA 3MNSA 4TPYA 2G5VA 5EQSA 4TT3D 4JZ1A 3A87A 1TMUH 2FS8A 3UNRA 3W94A 3NRLA 3PRDA 1CBWB 2XTTB 1FY5A 1XM1A 2GCTC 1Z8JB 4YM9A 4TSFD 2SNVA 2IJOB 5TCCA 1TOCB 4CR5A 3A7ZA 3F2GA 1ANDA 1KIGH 5T6FA 1T32A 1L0ZA 1A3EH 1YPJH 3TK6A 1FX0B 2VIDA 2HVYB 1LHDH 2A32A 1DT2A 1O38A 3RDZA 1N8OB 3I78A 1SOZA 1YBWA 3RXIA 1JBUH 2C8WB 3SZEA 1BA8B 1TBQH 2JH6D 3ZYEA 3LPRA 2ZDAH 1LPKB 4Q4LA 1TIOA 1IAUA 1HAVB 3U1IB 1LVBA 3L33A 1PPZA 1O30A 5GXPA 2NWNA 1BJVA 1O2ZA 3PMHB 1V2LT 5EG4A 2FODA 4J2YB 4GLYA 1MAXA 5EPNA 2ZGJA 3HKIB 2VIWA 1CE5A 2J94A 4X1NU 1P0SH 2V3MA 1TPOA 3WW7A 2FOAA 2J92A 2ZTXA 3SJIA 1AO5A 1GMHF 1S82A 3A8DA 7KMEH 2WV5A 2XC5A 1Y3XA 1PQ5A 3M7QA 5A09A 1GBTA 4RT0A 3RC6A 1BTPA 3EYDA 1O2YA 4MNWA 4CR9A 1N6XA 1W0ZU 1Y3UA 4FVDA 3VXFH 1QFKH 4B76A 2XYAA 2G8TA 2XCNA 3FKSD 4B2AA 3NZIA 3ESTA 4F49A 1C1OA 4KTUA 3PWCA 3PLBA 4MG3A 1BTHH 2QC2A 1C4Y2 8GCHF 5EXNA 1A0HB 1O2KA 2KFWA 1OP2A 3LGIA 1EZUC 3RU4D 4NA8A 1WQVH 3ZZ6A 4KP0A 1KY9A 1ZSLA 5EGMA 1WU1A 3OEED 5DP4A 1ZTJA 5EJZA 2W3KA 1AVGH 2R3UA 3DA9B 5CMXH 3E8LA 2GDEH 4ESTE 3OYPA 1OX1A 4ACBA 2OBOA 1NN6A 1S6FA 1O35A 3ATMA 8LPRA 2J34A 4CH8B 3GCHC 1SGDE 3PV2A 3EQ0H 2ZDKA 1ELAA 3SUDA 1FV9A 2B9LA 2ZDNA 4UD9H 1EX3A 4X2WA 5EW2H 1AZ8A 2A2XH 5AVDA 3MNXA 2JETB 3A8BA 4ASHA 4CREA 1UCYK 1QB9A 1UCYH 1EAXA 1P3EA 5PTPA 1YLNA 4NIVA 5H4IB 1EFRD 4K5ZA 3RXJA 3SV8A 1C5WB 1WXRA 3V12A 3WY8A 4A1TA 2ZO3H 1JIMA 2P8OB 1QL8A 1O3GA 2VU8E 1ZPBA 2YOLA 2BD2A 3BN9A 1ZHRA 2FOEA 1T8LA 3H7OA 2KCOA 1DSUA 1D3QB 3RMLH 2AH4X 1KLTA 3SGBE 1DXPA 3BTQE 3DHKH 3PO1C 1O31A 1EPTA 3OU0A 2FIRH 5LPFA 1TMTH 3QTOH 1VITF 1ZYOA 1NROH 5T1VA 1V2QT 2NU4E 2CMYA 1ZMLA 3GY7A 4WH8A 3T25A 6GCHF 1C5XB 1GI7B 2D8WA 3GICB 1PQAA 4OS6A 2BY9X 3ATWA 1QR3E 4Y8XA 2AGEX 1A61H 1BTZA 2V3OH 2BQ6B 2EI6A 1CO7E 2PGQB 2VWNA 1V2VT 8GCHG 4AZ2B 2C8YB 1SOTA 4X2YA 1CSOE 3TK5A 2L74A 4O9VA 4XOJA 5K7RA 2O8UA 4NA9H 2QV1A 2V35A 1BJUA 2V0BA 3L3TA 1HDTH 3K2UA 1NFYA 3RU4T 1ANCA 3OY6U 3RM2H 2AYWA 1A5GH 1GHZA 1Q31A 3IG6B 2F9UA 1MZDA 5DP8A 2OD3B 3STIA 2KR7A 1OWIA 2EC9H 3UR6A 3K65B 4I32A 1AN1E 1O3KA 2BLOA 3MH5A 4K69A 1YLDA 4O3TA 1RXPA 5EU8A 3IWMA 4ABFA 1XUKA 2B8OH 2BQWB 5C0UA 1EASA 1QTFA 3UY9A 3M37A 1SLUB 5L30H 1DICA 3DD2H 3IITA 4O03A 2A7JA 1P9UA 2ZWLH 1GBHA 1LDTT 1NBMD 1GHVH 3BTFE 4LXBH 1OWJA 1FIZA 1ORFA 2PP6A 3P8GA 1HLTH 1P57B 1B5GH 3K6ZA 1D3DB 2GT8A 1XVOA 2F3CE 3PROA 4Y76A 4ZKSU 2LELA 2WSSD 1H9IE 5B6LA 4RN6A 1SR5C 3ZV9A 2ZP0H 1COWD 3R0FA 1MTSA 5EIYA 3SW2B 3Q3YA 3RXRA 4B2CA 3VPKA 1HAPH 2RFKC 3S7KB 4ZROA 2F9OA 3SJ9A 3U8RH 2ZFTA 3A89A 4ABJA 2R9PA 3UIRA 5DPAA 1BUIA 2UUYA 3M5OA 4X6OA 2ZCHP 3I29A 1GI9B 3FN8A 4X1QU 2KCPA 3NK8A 1IHSH 3E0PB 4CRCA 1C5YB 2SNWA 1O2HA 1L1GA 1K0HA 1UHBA 2QIQA 1XUIA 2SGPE 1ANBA 2HLDD 2QYIA 4WMDA 4ABBA 2ZHFH 1O2RA 2ZFSA 4HFPB 5EXMA 3AAVA 1ESTA 5HM9A 3SZNA 2VVUA 4HTCH 4NIWA 1BTYA 1GBFA 4JYUH 1C1TA 4DVAU 2FLBH 1SLXB 5DP7A 4E7RG 2ZU1A 4NGAH 3F3BA 3A85A 1SGEE 3KQCA 1WDIA 4AOQA 3NUMA 2BXTH 1QHRB 2HPQH 1O2IA 3FAOA 1CGHA 3E91A 1XUGA 1V2UT 3KHVA 4XBCA 2GGVB 3SU6A 3HK3B 2Y7XA 4NFFA 3GYMA 1HAZB 1UCYE 1YPGH 1PPFE 3N7DA 3GISB 3LIWA 3SORA 1AD8H 1BMNH 2SGQE 1D3PB 3CP7A 1ELGA 1P2NA 1HJ8A 5AFZH 2ANMH 1MKWH 3SV6A 2PSXA 3LJJA 3V0XA 2BOHB 1DY9A 2IJD1 3GDUA 5J4QA 2PLXA 4IBLH 4D9RA 2A0QB 2BD9A 1TE0A 4WH6A 1ZJKA 2F43B 1Y5AT 1HAXB 1RRKA 2K1QA 1P8VC 1B0FA 1LHCH 1F2SE 1O5FH 1GVZA 1C5ZB 2XC4A 3EA7A 1NPMA 3M3VA 1LO6A 2V6NA 2C8ZB 1RJXB 4I8LA 3VFEA 3ZV8A 3SV9A 1U6QA 5GIBA 2GCTB 2OXSA 1TPSA 5ABWA 1O2PA 1OXGA 2ZDVH 5EPYA 1DWBH 3P95A 3A81A 1TLDA 2G4TA 4AG1A 3UR9A 1GI3A 3UNQA 1O2OA 4X6MA 1P06A 1SG8B 3FOAA 3SHAH 2ZFPH 4LK4A 1NO9H 4AFUA 2CHAB 1P01A 3T29A 2ZGHA 1TGNA 3URDA 2BX4A 2FP7B 2YNBA 1THPB 3M5NA 1O2WA 3VB5A 3Q77A 5E0HA 3A80A 4LOYH 1BTUA 2GTBA 1L1JA 5GJ4B 4BAMB 1AFQC 2P16A 1GJ5H 2Q6FA 1LVMA 3T26A 5T3HA 2PR3A 1J16A 1MAYA 1CHOG 2W6JD 3BTEE
chains in the Genus database with same CATH topology
5TCAA 1PPBH 2TGAA 1FXYA 1C1UH 1C1MA 1OSSA 4WF8A 3KGPA 4MVNA 4K1SA 2V3HH 2QCYA 1WBGB 1EZXC 5FCKA 2LPRA 7ESTE 4K8YA 5FPSA 3HGPA 3FVFB 1ZHMA 1GI6A 2O8TA 5E2PA 4ZHLU 2PSYA 4X1RU 1BRUP 2QN5T 3P6ZB 1G36A 5E8EH 1YM0A 1O2JA 1ELEE 1TNKA 2WV4A 3NXPA 4FU8A 4E7NA 4CBOA 4XBBA 5FPYA 4ZXXH 3RXBA 3PLPA 1SGYE 3CS0A 1NESE 3U69H 2ALVA 1SGTA 1ELBA 3SHCH 1YPMH 4E05H 2ZNKH 1GGDC 1HNEE 4A6LA 2I6QA 4OGXA 3EA9A 2HRVA 1FY3A 1P02A 3GY3A 3STJA 1V3XA 2AMQA 4JZDH 2LNCA 3ZVDA 2JKHA 1F0TA 4AFQA 1GMCG 1KXAA 2FXRA 1HGTH 3GCTF 5DGJA 2J4IA 1AFQB 4CRDA 2A1DB 1ZZZA 4B71A 4MPXA 4K1EA 1G32B 2GKVE 2BDBA 1T31A 5F03A 1IQKA 1A3BH 3PMBB 1UTQA 2FTMA 2H1UA 3RXFA 2QXJA 1PPEE 2RA0A 1OOKB 5GCHG 3A7YA 2HNTC 3SV2H 3T28A 2J9NA 6CHAB 2TBSA 2VIVA 5LGOA 4IW4E 2G4UA 2PV9B 2M5TA 1HRTH 2PTCE 3AW1A 1FNIA 1FI8A 1LMWB 1UMAH 3Q3KA 4X0WU 5C20A 3UWIA 3LONA 1LVOA 1NY22 4YZUA 3SNAA 4AYVB 3E6PH 5CHAC 1TB6H 4YT6H 1NFWA 1EAUA 1SC8U 3QK1A 1JMOH 1KXEA 4RSPA 3ZVGA 1H4WA 4U30A 4Y11E 1CT2E 2ZGBH 2BQ7B 1GBAA 2FYQA 3O8BA 1SLWB 1IQMA 2QXGA 1ZSJA 1SGFA 1ELDE 4AYYB 1ZTLA 4KKDA 2CV3A 1G2MA 5A0BA 1O32A 1SGCA 1OYTH 4BAKB 3ZZDA 2CN0H 1O3IA 1HXEH 1LQDB 3BEUA 3VEQB 1J17T 5ESTE 3V13A 5LH8A 4SGAE 1GBIA 5FBEA 2ZEBA 2VINA 2ULLA 3ZVAA 5EODA 1O37A 2XW9A 2WPJS 1ZR0A 4FUIA 3T2NA 2Q1JA 2FX4A 2THFB 2Y5GA 4GPGA 4TYDA 1HJ9A 4X6PA 2FOFA 1NRRH 4YLUA 5FAHA 2ZA5A 1AKSA 2P95A 1ELVA 1SQAA 2BLVA 2ZU5A 1CGJE 1Z1IA 1O3PB 1C9TA 1LQEA 2XWBI 4CH2B 2XBXA 3E0NB 2ANYA 1A4WH 2JH0D 3FZDA 4OS4A 1EAIA 3RXTA 1XX9A 1XKAC 2ZU3A 3T27A 2ZFQH 4NFEA 5GDSH 1BQYA 2RA3A 4NWKA 3O8CA 1MTNC 1ACBE 4ZKNU 2OTVA 2FI3E 2AMPA 1CA0B 5IYTA 1AIXH 1KLIH 4AX9H 1SBWA 3MH6A 2A4QA 3SGAE 3SU5A 1TNGA 4AGJA 1E38B 3RMNH 3SI3H 2BY8X 1W11U 1YLCA 2FTLE 2FMJA 4YLQH 2BDHA 3MU5A 2Y6TA 3SV7A 2C4FH 1TA2A 4O3UA 1MTNB 1BBRH 2W5EA 4ABDA 3M7UA 4X6NA 4CHAC 4LZ4B 2FX6A 3D23A 3NPSA 3TNSA 1Y59T 1TX6A 2BOKA 3SU3A 1GBDA 1EUFA 1BRAA 2H9HA 1C5TA 1P11E 1MCTA 3AASA 1O5GH 5JBCS 1N6YA 1UK4A 2ZF0H 4MNYA 4UE7H 5J4SA 1O33A 1ESAA 2DUCA 4XE4A 9LPRA 2SFAA 1P2MA 4BTTB 4X2XA 1EPTB 1P3CA 1QBOA 1TGTA 1SQTA 2VGCB 3RXSA 2C8XB 1O3JA 3S0NA 1BTWA 5C1XA 2QF3A 4J1YA 1BRCE 1GJ7B 4A92A 1KXDA 2CGAA 4BXWA 4WVPE 3OTJE 1DSTA 1VITH 3ZZ5A 1K2I1 1PPCE 5T6DA 3SNBA 1QQUA 3GCOA 3UQOA 3RLYH 3RMMH 2BXUH 4DIHH 5E0JA 4MQAA 4OGYA 2PKSC 1BMAA 1ELTA 1VGCC 1FAKH 4JZFH 1DXWA 2QGRA 5A8YA 4GHTA 1FONA 3PLKA 5A2MH 3SNEA 5L6NH 1SFQB 1C5RA 1MU6B 2BLWA 1FY4A 1G3CA 2PW8H 1IQJA 1YPHE 4DG4A 1D3TB 1VITG 2WPMS 2B7DH 1O3CA 5A0AE 1JWTA 1MQ5A 1VCQA 5CHAB 1AB9B 3FP7E 1SGFG 1Y5BT 4ISHH 4DIIH 2GV6A 2XBVA 1HAYB 6GCHG 2HNTF 2G51A 2TIOA 3RXDA 1GPZA 1O5BB 1XUHA 4QT8C 3LC5A 5DP9A 1OKXA 1TPAE 4ZKRU 3EE0B 3BTKE 1EZSC 2BVRH 4R8TB 1LHGH 3KN2A 3TH3H 2ZKSA 2OQUA 2ZCLP 3O8RA 1DVAH 4Y0ZE 1TGBA 3QWCH 1O3BA 3P8NA 5GPIB 2BVXH 4MTBA 3ZVCA 2VVVA 4OS7A 1C2LA 4B1TA 4GCHF 2QXHA 3AAUA 2G00A 3L6PA 1V6DA 1C5MD 2VIOA 3VXEH 4ISIH 1V2RT 5FCRA 1O3LA 3F9GA 1W0YH 1WCZA 1GDUA 2G52A 4XFQA 1C5UA 2OQ5A 2SGEE 3RUOA 1O3NA 1DLEA 1K1MA 1MUEB 1XVMA 2TGDA 2F9VA 1KDQA 1MTVA 1HAIH 3A8AA 3FANA 2F9PA 2BY6X 4INHA 1PYTD 1Y8TA 1WQSA 1GHAG 2UUKB 3RP2A 1DITH 1C1PA 1C2FA 3LOXA 1CA0C 1GJ8B 1PPHE 3UWJH 3LKWA 2FOBA 3P8FA 5A8XA 2PFEA 1C2KA 1ZRKA 2OLGA 2AERH 1EOLA 1X7AC 5EW1H 1HXFH 4FUEA 4I7YH 4ZUHA 4JK6A 1ZOMA 2GP9B 2BB4A 2JH5D 1O5AB 1RGQA 1LKBA 1ID5H 2SGFE 4DT7B 1EZQA 3N7OA 1YPKH 1TYNA 3QN7A 4XSKU 1GHYH 4GSOA 4NSYA 1MD8A 1Y3WA 1ARCA 1O3HA 1BBRE 1HAGE 1K1LA 2H5DA 3LGTA 1AVXA 1EOJA 4CHAB 5JPMH 4H6SB 3BTWE 3RXMA 1SPJA 1BT7A 4INLA 4NG9H 3QLPH 3GY8A 4K2YA 4DW2U 1EB1H 3M5MA 3TJOA 2Z3DA 3UTUH 1GI2A 4K60A 1QY6A 1TGSZ 4NZLA 3ATIA 4DOQA 1ZGVA 1T4VH 1MU8B 1TGCA 4AFSA 1E37B 1C5QA 1ELCA 2C90B 3MO3A 5F8TA 3TH2H 1ZMNA 1GCDA 3SQHE 1W8BH 4M7GA 1AUJA 2Y82A 5FXLA 4IS5A 3M36A 3A7VA 1RIWC 1F0SA 3CENA 3EDXB 5AF9H 2NU2E 2UUFB 1C4V2 4RKOB 2H2ZA 1L4ZA 1GI4A 2HNTE 2VWLA 4IN2A 3QGJA 4X8TH 1H9HE 5LPRA 1O39A 3RXUA 2Z7FE 1O2UA 4ISNA 1LVYA 4ABGA 1K1NA 5EQQA 2GMTB 1AI8H 1CT0E 1YCPH 4B75A 3TITA 1WSSH 4Y0YE 2FS9A 3GY5A 1WUNH 1YYY1 2VB0A 4X8UH 1EQ9A 4YOJA 1O5EH 1G3EA 1E36B 2WUBA 1GG6C 2A7CA 1THSH 1HAHH 1C5SA 2VNTA 4YOIA 2AIPA 2OUAA 3LC3A 2FYRA 1QNJA 4YESB 2ZDLA 5FPTA 3ZZBA 1O3DA 1F5RA 4K8BA 1YCPK 1F0UA 2H5CA 1QJ7B 2I6SA 1IOEA 3MH7A 1P2KA 3BV9B 2R0KA 4ISLA 1SHHB 1O5CB 4INKA 4NCYA 2OBQA 4ZXYH 4AFZA 1MBMA 3A8CA 1OYQA 1B7XB 2XBWA 1TAWA 2OP9A 3VGCC 3OX7U 3V7TA 9ESTA 4DJZB 3D65E 2ZU2A 4I8HA 4U01A 3PV4A 1JRSA 3E3TA 4A5TS 2RG3A 1W7XH 3SBKA 3QUMP 1GJ4H 1NU7B 3LGUA 2SGAA 1HPGA 1J9CH 1ZSKA 5C67A 2FOMB 2NU3E 3RXOA 4BTIB 2F9BH 1B0EA 2ANWA 3ITIA 5I25A 1QL7A 1A46H 1P2QA 4Z0KA 2ZQ2A 1Z1JA 3ZZCA 1MQ6A 1QB6A 4YOGA 3RXEA 1S84A 1Z8GA 3TVJB 2QY0B 1J14A 4TY6A 2AMDA 3A7XA 2UWOA 2BD4A 4AG2A 3GY2A 1DE7H 1DM4B 3RXPA 2ZHDA 3ELAH 2OC0A 2YNAA 4FUJA 2TPIZ 1GHAF 3T62A 1ZTKA 4D7GA 3ZZ9A 3RXAA 3Q3XA 1DDJA 3KL6A 3U9AH 4I33A 1AE8H 1OWDA 1C5NH 2H9TH 4JMYA 4FUHA 1P2OA 3SN8A 3PMJA 4KTSA 1W12U 2FO9A 1GCTB 1YPEH 3MWIU 1BOQA 1XUFA 4FU9A 1GBBA 2BZ6H 1TQ7B 2Y5HA 3VB3A 3QZQA 1QGFA 3TK9A 1IQEA 2ZHWH 3K9XB 3QX5H 2QA9E 2GX4A 1O2QA 1W14U 1GWAA 3ATKA 4BTUB 1G2LA 1NTPA 2BTCE 3VB6A 5C1UA 4I8JA 2Y5FA 1BMMH 1AQ7A 1AZZA 1TNHA 4A1VA 1MD7A 2NU1E 3JZ1B 1BCUH 1V2NT 4CRGA 3TJVA 3D62A 2EI7A 5GWZA 1GL0E 4OS2A 3M35A 1FIWA 2ZPQA 2VH6A 1AFEH 4TY7A 5G4BA 2ZHEH 5F8XA 2ILNA 5HMAA 1QBVH 2Z9LA 1QCPA 2Y81A 8ESTE 4FUBA 2KAIB 1F5LA 1QRWA 3E90B 2BMGB 2BVSH 3RU4E 1T8OA 2BD8A 2GD4B 3ATLA 1TRNA 2J38A 2XWAA 3RLWH 5EXLA 1KXCA 2NU0E 2GCHF 1IQIA 3BF6H 3LJOA 1SMFE 1SQOA 1DFPA 1GBEA 1P12E 2PUQH 5DJ7A 4B74A 4ABIA 2ZIQH 4JYTA 3TGIE 5AHGH 2BY5X 4CBNA 1EJMA 2BLQA 3VGCB 3OY5U 4BNRA 1NS3A 1TRMA 1GMCF 3GCTG 3TPIZ 4NA7A 4GVUA 1GJ9B 4FUDA 1ELFA 4Y8ZA 3URCA 1GJ6A 3VB7A 1TALA 2GMTC 2WINI 3F9FA 2PKAA 3S9CA 1W3CA 2C3SA 1W2KH 1D4PB 2PTNA 3TGJE 1GG6B 1FJSA 1YGCH 4MNXA 1UVUH 1V2MT 3U8TH 4D8NA 3SUEA 1E0FD 1NFXA 2Z3EA 5DO4H 1MMJN 1FUJA 1HCGA 1V2WT 3H7TA 1OP8A 2FI5E 1QIXB 1HIAB 3SOSA 1BRBE 1C1VH 1TQ0B 2P3FH 3MYWA 4Y10E 1P04A 1J15A 4UONA 1S6HA 1RIWB 3MH4A 1GI1A 3F1SB 1VR1H 1Z6JH 3U98H 2HWLB 2GVFA 3Q76A 3RXKA 1QRZA 1S0RA 2P93A 4HI3A 5DP3A 1C2JA 1O2XA 1TONA 2A2QH 1QBNA 1V2KT 3MOCA 2OC8A 1OP0A 1SGQE 2FOGA 1TPPA 2D2DA 4FUCA 5ETXA 1FDPA 3NCLA 1P9SA 1GMDG 1WAYB 5DG6A 2OC1A 4ABHA 5ESBA 2ODYB 2ESTE 2A5IA 3G01A 1P05A 1XKBC 3PMAB 2BX3A 6ESTA 4Q2KA 2BHGA 1NM6A 2JETC 1DUEA 1JRTA 1S85A 3AW0A 3HATH 2A31A 5JYIA 2BD3A 4MLFB 2ZTZA 1HB0B 7LPRA 1CQQA 1GBCA 1KDQB 2IPHA 4IMZA 1YC0A 2STBE 3QDZB 2Z9GA 4E06H 1G3DA 5SGAE 1O3AA 1FY1A 3TLOA 1BTXA 1RS0A 1TBZH 3MO6A 4CRBA 2UUJB 1K1IA 1S0QA 3JZ2B 1C2GA 4BXSA 1Y3VA 1F92A 4WXIA 1AMHA 1OS8A 1GJAB 4Q7ZA 2FEQH 4MNVA 1C2EA 2BDAA 1BMLA 3SJOA 1EB2A 4PROA 2XXLA 4HZHA 5F6MA 2XNIA 1TX7A 4BANB 1UTPA 1FAXA 1TABE 1NRQH 1O3OA 1UTJA 1SGRE 1W10U 1K1JA 3S9BA 1P2IA 3UOUA 1T8NA 1HAVA 1MKXK 5AFYH 2H6MA 1DWCH 2ALPA 1QJ1B 3LH1A 1GI8B 5L2ZH 3MFJA 1TBRH 1PFXC 2H9EH 5E0GA 1G9IE 2Z9IA 1NT1A 1HJAC 4UFFH 2EI8A 3ENSB 4Q7XA 4X1PU 1QRXA 2FZZA 1AE5A 1TRYA 3SNCA 1JIRA 1QA7A 3BG8A 5I46H 1O2SA 2F83A 2W26A 2HLCA 3BSQA 2BD5A 1CHOF 3BTDE 1CU1A 3SU1A 3NWUA 2P3TB 4D76A 3DUXH 4DGJA 1IQGA 2FI4E 1K21H 1XXDA 2BM2A 1OPHB 1GMHG 2Y7ZA 2ZC9H 3FFGA 1DWDH 1ETSH 3RM0H 1AY6H 1O3FA 3A82A 2GT7A 3QO6A 3U1JB 1VGCB 3OSYA 4Y7AA 2WUCA 2P8OC 2OCVB 1O3MA 2Z9KA 2IN2A 4SGBE 1LKAA 4YTAA 4FUFA 1RTLA 5C1YA 3ZZAA 2P3UB 4JYVH 1XXFA 1KYNA 2HOBA 5JB9S 3GDVA 1MTWA 1QA0A 1S5SA 2ZI2H 1FPCH 1VJAU 1BITA 2WYJA 1BIOA 4ZMAH 3BIUH 5EQRA 1WYKA 1DOJA 1YF4A 5CE1A 4A1XA 1XUJA 1H9LB 2R0LA 1IQLA 3PM3A 1SVPA 1ABJH 1O2GH 1C4U2 1QURH 2PHBA 1GVKB 5BPEA 1Y3YA 2DE9A 2FWWA 3GYLB 3KQEA 2ZPSA 2BDCA 5JDUB 4HGCA 2Z94A 3H5CB 3KNXA 1YP9A 1HBTH 1JXPA 2W7UA 1S83A 1KXBA 1FN6A 3GCHB 4ZAEA 3MO9A 1SGPE 1FMGA 1C2DA 4X2VA 1UTMA 1WTGH 2XCFA 3MMGA 1ABIH 1SGIB 1C1QA 2BD7A 1BHXB 2O8WA 5BRRE 1ANEA 1MTUA 3SU2A 1GBJA 1TOMH 3M5LA 4VGCC 2BDIA 4K3JA 2TGTA 2J95A 5JBTA 5L2YH 1HAOH 5FX6A 2ZQ1A 1UVPA 1GDQA 1M9UA 2A7HA 5FHTA 3RXQA 2W3IA 2ZTYA 5C3NA 2HALA 1C1WH 2A4OA 1C9PA