2FOEA

Structure of porcine pancreatic elastase in 80% hexane
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foeA01
1W7GH 1ELTA 1GBJA 6ESTA 2ZEBA 1VGCB 2F9VA 4Q2KA 4U30A 1MTNB 2GD4B 5C2ZA 2BLOA 1YLDA 1HAHH 2A5AA 1UVPA 5FPYA 3A7TA 1C5WB 2XCNA 5FCRA 5ABWA 2VIOA 1Y3YA 4FUCA 1YYY1 1KDQA 3SGQE 1OWDA 1DE7H 1TMTH 1QJ7B 1TQ0B 3OSYA 4Q80A 1CT4E 3AW1A 2Y6TA 1G32B 3KCGH 2CXVA 4Q7YA 1Z7KA 4IN1A 2GVFA 4WH6A 4NZLA 2BDCA 1ABIH 1NN6A 1NFUA 4A1VA 1S6HA 1FONA 1Z6EA 1E36B 1W11U 3UOUA 4CRCA 3A89A 2BDBA 1TGCA 3URDA 2G52A 4Y6DA 5EODA 3ZVEA 1MMJN 1GHBF 1MD8A 1O30A 1NC6A 1PPHE 4INLA 5BPEA 4FUDA 3AAVA 4I8HA 4R8TB 4WMFA 3UUZA 1YP9A 2Y7ZA 3MNBA 3ODDA 1GI2A 1HAXB 2Q6FA 1EAIA 1P01A 2DE8A 2VWNA 1TRNA 1LPGB 5LH8A 2SGPE 1CA0B 1MBMA 3M7TA 3G01A 3F9EA 2A7CA 1Z1JA 5A8YA 3PV4A 1TX8A 2G5VA 5JBAS 3F68H 1CE5A 1YPKH 4ISIH 3ODFA 2W5EA 1KYNA 1XUJA 3GYLB 1TOCB 1KDQB 1EOLA 1S85A 1P09A 1GVLA 2UWOA 1XUIA 5EG4A 3KF2A 3RXSA 4D9QA 4XOJA 1DWEH 2GCTB 4WY3A 1HAIH 1V2WT 1F0TA 1SQAA 4O97A 1C1QA 2WINI 1KSNA 3UR9A 1CT0E 1DPOA 1TNKA 2B9LA 4YLQH 1AUTC 1HAZB 1F2SE 1BTYA 3RMLH 2FI5E 2OINA 2SFAA 3U9AH 1WQSA 2HLCA 4BANB 3QUMP 1BBRK 1AVXA 4X6MA 4O3UA 1LTOA 4D76A 4MLFB 4WWYA 4QT8C 1S84A 1GHWH 1WYKA 1NM6A 1Q31A 3PWCA 4I32A 2GCHF 4JYTA 2A1DB 3SQHE 3FAOA 1GDUA 3ELAH 1HV7A 1HRTH 2J9NA 1T31A 2G4TA 3U8TH 1OKXA 3GYMA 1C2LA 3L33A 3NKKA 4MPVA 3V0XA 1JIRA 2TGDA 1PPCE 4X2YA 2V0BA 1O5CB 2WYGA 1NZQH 1WTGH 4I33A 3OY5U 1EJMA 1G30B 2SGFE 2ZGHA 3SUFA 4AFUA 1FN8A 3E16B 2C8WB 4JYVH 3RXOA 2ZU4A 2Y81A 1FAKH 1GBMA 1GJ8B 1O2SA 3TJUA 4VGCC 3M5LA 2BLVA 2J95A 1GWAA 1O3JA 4ZMAH 2O8LA 1DUAA 1F0SA 4X6PA 1WV7H 5CHAC 4HFPB 1DM4B 1OWHA 3FP6E 2F9NA 3SU6A 3PLKA 2A7JA 2Z7FE 2PKSC 1V2OT 1J9CH 1O2UA 2ZTYA 3NXPA 4RKJB 4WJG2 2RA3A 1O3HA 3TJOA 2ANYA 4GUXA 4TWYA 1EATA 2J94A 2PUXB 3QGJA 2QCYA 3QZQA 4Z0KA 1MTSA 1BTWA 4KTCA 1TBQH 2XBVA 1C5SA 2F3CE 4A1XA 1P9SA 3ZV8A 4ISNA 4KGAA 4GHQA 1O3MA 1BHXF 2ZU5A 1C9PA 1W0YH 1O2OA 4GCHF 3SI4H 4MDSA 4X1RU 3ATKA 2A5KA 5AHGH 1E37B 1UTPA 1GBKA 4LXBH 1QJ1B 2J38A 1Q3XA 4AG1A 4THNH 4UFGH 1JBUH 1XX9A 1GGDC 1KXAA 1YCPM 3SV9A 1WQVH 4B74A 2BX4A 1ZTLA 1YCPH 2A5IA 3UFAA 2PR3A 4HZHA 1HIAA 2FI4E 1MKWH 4OS7A 8GCHF 3UNRA 3S0NA 2SGAA 1MCTA 1K22H 4AYYB 2NU3E 3RXLA 3F6UH 5GCHG 1KIGH 1OYTH 3ITIA 2TRMA 4B71A 4K8YA 4KELA 2ZG0H 2WV5A 3BEUA 2ZP0H 3AAUA 5SGAE 1GL1A 1GBCA 2BY8X 1DT2A 4ABGA 2XC5A 2VIDA 3RDZA 1TBRH 1YPJH 1CT2E 2FPZA 2VB0A 3TPIZ 1EJNA 5K0HA 5AFZH 1GMHF 1YPLH 4Q7ZA 3SNBA 1ZHPA 2ZNKH 2IJOB 3SORA 1INCA 4E05H 1L1JA 1SFQB 1UVTH 1VJ9U 1J17T 4HI3A 4VGCB 1ANEA 1FZZA 1ANDA 3BF6H 4K3JA 1THRH 2C93B 2XBWA 3UREA 1LVBA 1XMNB 3I77A 1TB6H 5T6DA 3F1SB 1P02A 2O8WA 5CHAB 3M5NA 2PHBA 1XXFA 4OS2A 3BSQA 1SGYE 1C4V2 2PKSB 1Y59T 2HNTF 1EX3A 4AX9H 5C5OA 1DSUA 3PMBB 4NIVA 3T28A 3TJNA 2Z9LA 1W7XH 1NFWA 1UVUH 1C5YB 1V3XA 1GJAB 1GBLA 2HRVA 2HNTC 1G9IE 1JMOH 1BTUA 2H5CA 5J4QA 1DY8A 4CR9A 5EGMA 1BIOA 3P6ZB 3BEFB 1ETRH 1FN6A 1G37A 2WPHS 1N1LA 4X6NA 2Z3EA 3M3SA 4CRAA 1T7CA 1KTSB 1GI1A 4A5TS 1P03A 4YOJA 3RU4D 3A86A 4OGXA 2F9PA 2EI6A 3ZZCA 1ZTJA 1BHXB 4ABBA 2BXUH 1O2JA 3A8DA 4O9VA 5FX6A 1CHOG 4J2YB 3M36A 2GZ9A 4GSOA 5FBEA 1GGDB 2FWWA 3SN8A 2GDEH 1RTFB 3HGPA 1A46H 1GMDG 2BQ6B 1TGSZ 2H9HA 1V2NT 1QNJA 5L2ZH 4Y71A 3BTWE 1H8DH 1PYTC 3RXKA 1UCYH 3I29A 1O2PA 3MYWA 5EXMA 1C2JA 5DKMA 1UCYE 4H42U 5EW2H 3TK9A 1ZPZA 2O8TA 4XDEA 2OC7A 2G4UA 5DP4A 1ID5H 2ZQ1A 3LJOA 2LNCA 1HLTH 3D49H 3SNDA 1H1BA 4X2WA 3S7HB 3ZZBA 1QURH 2FESH 2NU2E 4CREA 4NG9H 2XWBI 2FMJA 1BMMH 3A84A 3SBKA 1XVOA 4A92A 2C4FH 1C5PA 1D3TB 1BTZA 2ZCHP 3TGIE 3S9CA 3QX5H 1EB2A 1HPGA 2H9TH 3QDZB 3RXHA 3CS0A 4JZDH 1IQHA 2O8UA 1UHBA 4K60A 3GY2A 1LHCH 2A4RA 1KLJH 3DFLA 2A32A 1P2KA 4X8SH 2W7UA 3VB5A 3M7QA 5G4BA 3AASA 2B7DH 1OOKB 1VCWA 4D7GA 5IDKA 2PW8H 2AFQB 2UUKB 1QA7A 3IWMA 2PTNA 4ZROA 4Y10E 3VPKA 1QCPA 1LHFH 4UEHH 3FANA 2BXTH 2BD3A 2A0QB 3MO3A 4A6LA 3SO3A 3GY4A 3SNCA 1LPZB 1QRXA 2PGQB 2GV6A 4ABDA 2FOGA 7GCHF 2JH6D 5EW1H 4TY6A 2AS9A 2CMYA 2VU8E 1CGJE 2XRCA 3EDXB 2FOAA 6GCHG 1ZSLA 1E35B 1SGDE 1O38A 3T29A 1SLUB 2EEKA 1L0ZA 1TFXA 4U2WA 1A7SA 1BTPA 3SJ8A 1O2MA 1N8OC 1GVZA 4SGAE 1UK4A 3MH5A 1SB1H 3GDUA 1PQ7A 2JH0D 1K1NA 1C4U2 2OQUA 1QL7A 2FI3E 3HKJB 2ZDLA 3STIA 4U01A 5A8XA 1OX1A 1H4WA 3K6ZA 1KXDA 4AGJA 2DUCA 3U69H 4FUGA 1P2IA 5JPMH 4BAMB 2FIRH 1O3DA 3LONA 1GHVH 2FTLE 2KAIA 5TCCA 3TNSA 1PQ5A 2ODYB 4CRGA 1GJ7B 2OC1A 3KQDA 1G2MA 3RUOA 2XC0A 5BRRE 5GIBA 3RC4A 1QGFA 1O3EA 3MU8A 3Q00A 1BOQA 4Y7AA 1GBFA 1B0FA 4GPGA 2BB4A 4HTCH 1AGJA 5I46H 1A3BH 1AVGH 1BDAA 2G51A 3T5FH 1ZLRA 3P8OA 1SGEE 2GTBA 3SNAA 4AFZA 1BRCE 4E7RG 3M3TA 1ZHMA 1EUFA 3GY7A 1FPHH 1EXFA 3SGBE 1C5XB 4KKDA 3JZ2B 2RG3A 4GAWA 1C9TA 2GT7A 5LPEA 2QYIA 2F9UA 3A85A 5IYTA 2G55A 1C5MD 2FXRA 1C2GA 2TIOA 4YT6H 4FUIA 4X1NU 2BHGA 2ILNA 3T62A 1TRYA 2BY6X 2UWLA 3RXRA 1AQ7A 1O3OA 2BD8A 3GY5A 1KXEA 2GDDA 1SGIB 3ZVCA 3VB4A 4I7YH 1A5IA 1C5TA 2ASUB 1O31A 5L30H 5HGGA 2KAIB 2D26C 1EKBB 1J8AA 3ATMA 2F83A 4FUHA 4DOQA 4X2XA 2J2UA 1G3EA 1O5FH 1SLWB 1FQ3A 4I8LA 1ESBA 1FY8E 4TPYA 4AFSA 3B23B 4YT7H 4DJZB 1O3PB 4AYVB 2HNTE 1MAXA 5LPRA 2WUBA 1IQFA 2CHAC 1P05A 1HAYB 2ZWLH 4GHTA 4IMZA 3TVJB 4X8UH 3RXMA 3LGIA 4X8VH 1XKBC 2YOLA 1C2KA 3BEIB 4WF8A 2FEQH 5K7RA 1CO7E 2WPMS 1TAWA 1FPCH 1O36A 1YCPK 1HJ9A 3MH4A 5DP7A 2PSYA 1UVOA 1TRMA 1MKWK 2AERH 3KNXA 1AFEH 1RTKA 3M37A 4IBLH 1P11E 3SUDA 5JBCS 3TIUA 3GCTF 1BTXA 3PLPA 3PWBA 2P94A 1H8IH 2ZHFH 4AORA 3IITA 1ETTH 1TMUH 4ZXXH 1AO5A 1K1IA 3ZZ5A 1CVWH 4X8TH 2FO9A 4H4FA 3PLBA 3BTTE 1N8OB 1HFDA 3MO9A 1C1NA 3A82A 2Z9GA 3NCLA 4I31A 4Y8ZA 3PTNA 1WOFA 2J34A 4BXSA 3VFEA 1HJAC 3SV6A 5ETXA 1GMCF 1SL3A 3TK6A 5TJXA 1TYNA 2W3KA 3U8OH 1NROH 2O8MA 1C1TA 2Y7XA 1BCUH 4SGBE 1RS0A 1FAXA 5E2PA 2C90B 1YPHC 2QA9E 1EAXA 4WMDA 1O3CA 2PUQH 1GHBG 1XUGA 4WXVA 2ZDAH 1C5ZB 2O9QA 3WY8A 1OS8A 1V2QT 2VWMA 3SV7A 1Z8RA 3T2NA 5E2OA 1TIOA 5DG6A 4AOQA 4ASHA 1YF4A 1BT7A 1ZRKA 3MMGA 1O2WA 1SOTA 2ZI2H 3D23A 1FI8A 5EOKA 1GCDA 2BM2A 1YLCA 1UTKA 2VIVA 2BLWA 3SU4A 3QWCH 2QF3A 1DUEA 2ALPA 3S69A 2ZQ2A 1CSOE 1TBZH 3KQCA 5A8ZA 1BJVA 2R0KA 2ZTZA 3ZZ6A 1CBWC 1QB6A 1FY4A 1TA6A 1GHAF 2AMPA 4UFDH 1ZR0A 1O37A 3PMJA 2ESTE 4DIIH 1GI6A 1TNIA 1L1GA 4X1PU 1UTMA 5T6FA 5EPYA 2VINA 1O3LA 3GY6A 1MQ5A 2GMTC 1FJSA 2AEIH 1EZUC 3QK1A 1XKAC 3MNXA 1P3EA 1H9HE 1N6YA 2R9PA 3LGYA 4CH8B 4BNRA 2GCHG 2A2QH 3TU7H 4NA7A 1GBHA 1SBWA 3M5MA 1MCVA 5FXLA 3QGNB 2ZDVH 2CHAB 1AFQC 5DP6A 1XXDA 1DY9A 3P92A 1JRSA 1Y3VA 2QV1A 2ZCKP 3VB6A 4ABIA 3EGKH 2QXHA 1SMFE 1LO6A 5JYIA 1GI5A 1AZZA 1MU6B 1ZRBA 1VJAU 1JXPA 2B8OH 2CF9H 4NSYA 3LC3A 1P57B 1K28D 1TGBA 2TBSA 3MOCA 2PWXA 4Y8XA 1YC0A 5F6MA 1X7AC 2R3YA 3ZZDA 2D1JA 3TGJE 3H7OA 1TX7A 4MNWA 3EA8A 3RXDA 2HPQH 4ZKSU 1V2ST 2ZU2A 3BTQE 1V2VT 4LZ1H 3W94A 1PQAA 2NU0E 3A80A 3QLPH 2ZDMA 1JOUB 3LU9B 1BTHH 1CQQA 1C4Y2 4GVUA 2GV7A 1NS3A 1HJAB 1PPFE 3UWJH 1B5GH 2ODQA 1T4UH 2EI8A 5FPTA 4DW2U 1V2TT 1WAYB 3IG6B 2G8TA 2SGQE 5GJ4B 1O2GH 2VNTA 2Q1JA 1GHZA 3BN9A 3ZVAA 1GHXH 3MI4A 2ZHEH 3R0FA 4X2VA 1VCQA 1D3DB 1GDNA 1VITF 3A8CA 3QTVH 1OWIA 2D8WA 2VIQA 2WUCA 1LVYA 1P0SH 2BVRH 1OSSA 1GI7B 1T8LA 1QL9A 1A4WH 1NU7B 4WMEA 1AE5A 1W12U 4GCHG 3A81A 2NU1E 2BD5A 1S0QA 1UTLM 2XBXA 4DG4A 1O2QA 3ZYDA 4FUJA 3LC5A 1K1PA 1K2I1 4TY7A 1BMAA 1S5SA 4X1QU 4GLYA 1MKXH 1LMWB 1HNEE 3SJOA 3H5CB 4F4OC 2XTTB 2GKVE 5F8XA 1F7ZA 1XUFA 1Q2WA 1CBWB 1QL8A 1SGPE 2TGTA 2BZAA 2VH0A 1NY22 1QRWA 1WTHD 4ZXYH 1PPBH 3O8BA 2Z3DA 1TOMH 1W13U 1ZGVA 8GCHG 1GG6C 3PMAB 5H4IB 2P16A 6LPRA 4DURA 2GMTB 4R0IA 4Y76A 2BTCE 4J1YA 2ZGBH 2A4OA 2W26A 1MU8B 3HGNA 1SGNE 3SUGA 2FX6A 3V7TA 3VB7A 3TGKE 3OYPA 1AVWA 2XC4A 3GDSA 2ZFTA 2ODPA 3RLWH 3K9XB 3OX7U 8ESTE 1P04A 1WBGB 4XSKU 1AFQB 2OQ5A 3RXVA 1MBQA 1GHYH 1BITA 4M7GA 3D62A 1RJXB 2JH5D 1S6FA 2CGAA 1IQIA 3FVFB 2FLRH 1BRBE 2B5TB 1W0ZU 4LOYH 5C20A 2BY7X 3UPEA 1ELGA 1ZMLA 1HUTH 2BDGA 4B2BA 3KIDU 1VCPA 5FX5A 1EZQA 1GMHG 2ZZUH 1J14A 1SLVB 4INKA 4OGYA 1C5UA 3U1JB 3R3GB 1IQMA 1F5RA 3E90B 3KGPA 3SUEA 1ARCA 4FUBA 4NFEA 4UD9H 1TWXB 1YPHE 1SLXB 1G3BA 3AW0A 4ZHAA 1QBVH 1O5AB 2QGRA 2BDYA 2Y5HA 4B76A 2FLBH 1ZJDA 3SQEE 3ZVFA 1D3QB 1OWJA 2BQ7B 2ZA5A 4I8GA 2AGGX 1LVOA 4ZH8A 2FTMA 4JCNA 3BTEE 4RKOB 1IQJA 1BUIA 2H9EH 1C5QA 1SGTA 3CP7A 5CE1A 1AWHB 1A2CH 2A31A 1T8MA 2QF0A 8LPRA 1SVPA 1NRPH 2FOFA 1O2TA 4HGCA 4CRFA 3NZIA 1EAWA 2FYRA 2GX4A 1RD3B 4NA8A 3EA7A 4RSPA 3GDVA 5E0JA 1TQ7B 1T8OA 1IQNA 2JETC 4YOGA 5GDSH 3T25A 2FODA 4UFFH 1SHHB 4MPUA 4WVPE 3RXIA 2ZDKA 1SGRE 1V2PT 3PO1C 1GJ4H 5EPNA 1A61H 2V3HH 1YPMH 1GJ5H 1IAUA 3SW2B 1GPZA 2STBE 3E91A 3I78A 3RXGA 4ZKOU 2BDIA 1BBRE 5JB8S 2PTCE 1DWCH 2XW9A 2ZFFH 6CHAC 2FS8A 3MNCA 4MNVA 4RN6A 2PKAA 2ZGJA 3AVZA 4TPIZ 3RMNH 3LIWA 1O2HA 2GGVB 4NCYA 3HATH 4E06H 1YPGH 3A7WA 1ETSH 4ABHA 1GG6B 4MVNA 4FUEA 1O2IA 1MZAA 1G3CA 5LGOA 1DICA 1P06A 4FVBA 3EE0B 2THFB 1UO6A 2V3OH 2ZKSA 5TCAA 3UR6A 3NUMA 1LKAA 1C1MA 1OP8A 1Y8TA 5C3NA 1FV9A 2BVXH 4DT7B 3LOXA 4NFFA 2P59A 4YLUA 3SU5A 1MUEB 4XBBA 3ATIA 4K8BA 1DOJA 2Y5GA 2ZDNA 2F9BH 2ZHQH 2XCFA 5GPIB 1L2EA 2ZGCA 4AB8A 2UUFB 2SNWA 3ZVBA 4ABAA 3RC5A 3ATLA 3E8LA 1DWBH 1GBBA 4D9RA 1E0FD 3TITA 2WPJS 1C1PA 3F9GA 1SPJA 1V2KT 1OP0A 2PKAB 3ZZ9A 1SGFA 1GI0A 2A45B 1B0EA 1Z8JB 4B1TA 1DXPA 4CRDA 3BTDE 1O2RA 4H6TA 2FOMB 5FPSA 1O5GH 2Z9KA 2P3FH 3U8RH 5AF9H 1IOEA 2NWNA 4XE4A 1RXPA 1KTTB 1O3BA 1GBIA 1QR3E 1O34A 1XUKA 3RMMH 4IMQA 2QIQA 2P3UB 4MTBA 1ABJH 1ESTA 2WPKS 7GCHG 1ELEE 4K1TA 2QN5T 2YNBA 1MAYA 2A4QA 2ZHDA 3FZDA 4MNYA 1NPMA 5F8ZA 2VVVA 1Z8IB 1SOZA 1PPZA 1L1NA 1GJBB 1ORFA 3STJA 2HOBA 1A0LA 1QQUA 2UUYA 3ZVDA 1P2QA 2PGBB 3QN7A 4ISOA 2JETB 1EB1H 1ZTKA 4TWWA 1C2MA 2HGTH 1EP6A 1V2UT 3E0PB 1TGTA 3L3TA 3PO1B 1Z8GA 4KTSA 1C2HA 3EYDA 3MFJA 3VXEH 2ZF0H 2FP7B 1V2RT 2JKHA 3P70B 3UNSA 1D3PB 2BY5X 1HAVB 4MNXA 1CHGA 2FZZA 2ZFQH 4BAHB 2Z3CA 4IS5A 6CHAB 1RIWC 2M5TA 3KN2A 3SV2H 3RXPA 1HXEH 1PQ8A 5JBBS 2K1QA 1J16A 2Z94A 7KMEH 2AYWA 3DHKH 5FAHA 3C27B 1SFIA 1UTJA 1HB0B 1LHDH 4K1EA 1ARBA 1F5KU 2VVCA 1W8BH 1GCTC 2CJIA 3M3VA 1BMNH 3LJJA 4FU8A 3LGUA 4F49A 1LHEH 5CMXH 4YOIA 4BXWA 5DPAA 3Q76A 1GJ9B 1EP5A 1O3GA 5A0BA 1FNIA 2P95A 1O0DH 1SQOA 1WU1A 3NPSA 4BAKB 2ZECA 1AN1E 3TNTA 3RXJA 3SHAH 1W10U 3SNEA 5HXFA 2RCEA 3M35A 1HAOH 1DANH 3UNQA 3Q3YA 3M7UA 1O2LA 1BMLA 3GY3A 1KXBA 1ELFA 1MZDA 2FDAA 1UTQA 1XVMA 3A8BA 5L6NH 1O2YA 4O3TA 1NRSH 1K21H 2STAE 1JRTA 3MU1A 1AHTH 2A7HA 1CA8B 1Y3XA 5JBTA 1L4DA 2W7SA 2QXGA 4FVDA 1TNLA 3SJIA 1QRZA 3QZRA 1C1VH 3P8FA 3W95A 4IGDA 1QY6A 1MKXK 3RXQA 1ANCA 1IQLA 1PFXC 1QJ6B 4TYDA 1PPGE 1C2DA 1F92A 1IQEA 2XBYA 3ZZAA 1FXYA 1C5LH 2W3IA 5T3HA 3UQVA 1EQ9A 5EQQA 2R3UA 1GJCB 2QXIA 3SI3H 1SSXA 3RU4E 2OC8A 2BYAX 3VXFH 2VGCB 5EU8A 3GCTG 1F0UA 1M9UA 1O5DH 3ZZ4A 1OWKA 2GZ8A 4K2YA 1OWEA 3CS7A 4JYUH 1AD8H 3RP2A 1EPTC 3SJ9A 4NIXA 1H9LB 3U98H 3ZZ3A 3RC6A 4CR5A 1AY6H 1ZPCA 3BG4B 4D8NA 1RFNA 2AGIX 1LQEA 3O8RA 4A7IB 2XWAA 9LPRA 1GMCG 3SV8A 1G36A 4BTUB 3MWIU 3SZNA 1P8VC 4H6SB 3NK8A 2OBOA 2BDAA 3TJVA 4BAOB 2HWLB 3MNSA 2P3TB 5HMAA 5EQRA 1UK3A 4X0WU 4LZ4B 1A5GH 2RDLA 1J15A 1UK2A 2FOBA 2P93A 1GBTA 3A8AA 1RIWB 5A0CA 2BDHA 5C5NA 1LHGH 4MQAA 1S82A 1C1UH 4X6OA 3KEEA 1ZJKA 2EA3A 1EZSC 3ZV9A 4WXIA 1ZSJA 1AMHA 3V3MA 1FIZA 4B75A 1BRAA 1CGHA 2BY9X 2ZFRH 3DA9B 3Q3KA 3B8JA 1GCTB 3HK3B 1FY5A 1ZYOA 4YO9A 1IQKA 1O2NA 2ZHWH 1ZSKA 3F9HA 4NIWA 1P2NA 1BJUA 2AIQA 1ELVA 3MU5A 2CF8H 1Z6JH 1OP2A 5DP8A 1ELDE 1NRRH 2BD2A 4BOHA 3S9AA 2ZO3H 1GHAG 4O03A 2BX3A 1FY3A 1NFXA 4XBDA 7LPRA 3QO6A 1SC8U 4JK5A 2OXSA 1P2OA 2ZPRA 1EPTA 2HALA 4D7FA 1F0RA 1O33A 2XNIA 1MTVA 1GI3A 2C8ZB 3BTGE 4NWLA 1QHRB 2SNVA 3VEQB 1ZOMA 2LPRA 1WUNH 1TNHA 4U32A 2Y82A 4ZAEA 1LCYA 1AUJA 2WYJA 1V6DA 2ZIQH 4MPWA 4I8KA 5FBIA 3SOSA 5F8TA 4YTAA 1AB9C 1GI8B 1O5EH 4IN2A 2A2XH 3RXFA 3BTFE 5DO4H 1NRNH 1O2ZA 1CGIE 1HAGE 1K1MA 1P2JA 1C2EA 3PTBA 2Z6BD 5JDUB 1D9IA 1D6RA 2VJ1A 4NIYA 3GY8A 1UCYK 3UIRA 2OP9A 5HM2A 1C1SA 3ATWA 3UOPA 3E3TA 4B2AA 4DGJA 1P10A 1GBEA 2ZU3A 3RXBA 4AZ2B 4KTUA 4Q7XA 2QY0B 1BZXE 1TX6A 2TGAA 2RA0A 1KXCA 1LQDB 3HKIB 4AB9A 1C1WH 2PLXA 1DFPA 4MPXA 1EPTB 5B6OA 3TH2H 4Y0YE 2Q6DA 1NT1A 2G00A 1W14U 2ANWA 3RXAA 3LKWA 5F03A 2AMDA 5JB9S 1TPSA 5ESBA 3VGCC 1FIWA 1TONA 2FS9A 4PROA 2VH6A 2XXLA 5L2YH 1GJDB 4ABFA 1THSH 4BTIB 1A1RA 1ACBE 1U6QA 2I6QA 4AFQA 1QFKH 1O2KA 2GT8A 4K69A 1UVSH 3GOVB 3FZZA 1F5LA 3RXUA 1TMBH 1DSTA 4CRBA 3A7ZA 3S9BA 2Y80A 1TGNA 4X1SU 1HAPH 4UE7H 1Z1IA 1NO9H 1VITG 5A0AE 4Y79A 3DD2H 4XBCA 2B0FA 1D6WA 2PFEA 1ZZZA 1GDQA 4K5ZA 5HM9A 4BAQB 3UTUH 4JZIA 1YBWA 3ZYEA 5HYOA 1NU9A 3BIVH 1ESAA 2QXJA 1MTWA 5FHTA 4OS4A 1XM1A 2FOEA 4ISLA 1P9UA 2HVXA 3GCNA 3EAJA 4NWKA 1TE0A 5EXLA 2P8OC 3E6PH 4NGAH 1OXGA 3SU2A 1HDTH 3A83A 2WV4A 3JZ1B 1IHSH 1P3CA 1QA0A 2R2WU 2VWOA 3LPRA 3P17H 1Z71A 2H5DA 2ZC9H 5E0HA 2BZ6H 5LPFA 2IN2A 1MH0A 3PYHA 3CENA 1ELAA 1C5RA 3K65B 3A7VA 1SR5C 1V2MT 3V13A 4JZ1A 3GCOA 4JZFH 3BIUH 1TNJA 3FP7E 1TALA 2AIPA 3RU4T 1IQGA 1QTFA 1OYQA 1T32A 5GCHF 2BOKA 2FM2A 1A0HB 1BRUP 3T26A 3U1IB 4ESTE 1W3CA 3GCHC 1UTNA 4CHAC 1K9OE 1AB9B 2ZFSA 3Q3XA 1NFYA 1TPOA 1HBTH 3LGWA 3TK5A 2PSXA 1YM0A 3MO6A 3M5OA 4ZKNU 1SGQE 1KY9A 1HGTH 2BMGB 4OS6A 3UQOA 3BV9B 3K6YA 1KLTA 2BD7A 5DP5A 4UDWH 2QC2A 2OCVB 4OS5A 3HPTB 3KQBA 3LDXH 1HXFH 2H6MA 1TA2A 1S0RA 4JZEH 3UWIA 5GXPA 4B2CA 4NA9H 4JK6A 4IC6A 3PROA 4I8JA 3K2UA 4INHA 3DUXH 1GI9B 1QBNA 4UFEH 5DK1A 1AE8H 1HIAB 2BVSH 3VGCB 4BTTB 4ABJA 2F9OA 3SU0A 4YM9A 5E8EH 1QQ4A 1A0JA 1FDPA 5DP9A 2TGPZ 1O3AA 3H7TA 2AMQA 2NU4E 5ESTE 1S81A 2ZTXA 1IHTH 3RXEA 2ZFPH 1CU1A 1C5OH 1B7XB 1C5VA 1RRKA 2GP9B 1SGFG 2H2ZA 1SGCA 3OTJE 3N7OA 2OC0A 1EOJA 1GVKB 1C1OA 2ANMH 1FMGA 1Y3WA 1ANBA 2A4GA 5I25A 1TPAE 2ZCLP 3SHCH 5A2MH 3QTOH 3ZZ8A 1ELBA 1C1RA 1XUHA 3A88A 4ZUHA 1BQYA 1BBRH 2D2DA 5J4SA 2H1UA 1E38B 3TH3H 3NWUA 1K1LA 2P8OB 1AWFH 2VIWA 1AZ8A 1T4VH 3RM0H 1DLKB 1O39A 1OPHB 1NTPA 4NSVA 4JMYA 1CHOF 5AVDA 2ULLA 1FUJA 2AGEX 3B9FH 4ABEA 1C2FA 1THPB 2IOTA 5EXNA 1SHYA 1TPPA 3E0NB 1GMDF 1V2LT 3V12A 3MHWU 5FCKA 2Q6GA 1MQ6A 3A7YA 1YPEH 4OS1A 3MH6A 4FXGH 1H9IE 1LKBA 1ZGIA 1K1JA 1L4ZA 4AG2A 2I6SA 1PYTD 1EZXC 1UTOA 4Y0ZE 3KQEA 4E7NA 3RXCA 1DS2E 2G5NA 1C2IA 2OD3B 2OTVA 2PV9B 4FU7A 1O5BB 3RLYH 1UMAH 2EI7A 4CBNA 3Q77A 4CBOA 3LH1A 1Y5AT 1O35A 4DCDA 1O3IA 3DT0H 2CN0H 1Y5BT 1QB1A 1AU8A 2YNAA 2BOHB 2F91A 3GCHB 3F9FA 4CHAB 5GWZA 1DX5M 1MD7A 1GJ6A 5E0GA 3S7KB 2R2MB 4WH8A 3C1KA 4MG3A 5DGJA 4CH2B 4FU9A 1GBDA 1O3FA 3O8DA 3LH3A 3D65E 4K1SA 1A3EH 3P8NA 3DFJA 2HPPH 2TPIZ 2IPHA 2OLGA 1SG8B 2VIPA 3P8GA 1NRQH 3SJKA 1RTLA 1WSSH 4YESB 1HAVA 5A09A 3PB1E 2C8YB 3M61U 1VITH 1DITH 1AI8H 3SU1A 2FOHA 2VGCC 3VB3A 4ZKRU 2C8XB 1O3KA 3LT3A 1EJAA 3BG8A 5C1YA 4ZHLU 2GZ7A 5DJ7A 3O8CA 2ZU1A 4Y11E 1VGCC 4YZUA 1PPEE 2ZPSA 3RMOH 1MTNC 3LGVA 6GCHF 3MH7A 1P12E 1T8NA 2Y5FA 2J4IA 3BG4C 1QBOA 2V6NA 4ZHMU 4A1TA 1WCZA 4B73A 2XYAA 2VWLA 3EA9A 1ZHRA 1V2JT 1DDJA 1UHBB 1O3NA 3SU3A 3BTME 1EASA 1FY1A 2FYQA 3KHVA 4DIHH 1E34B 2BQWB 1AKSA 1K1OA 3P95A 1LPKB 3KL6A 1O32A 1ZMJA 2C3SA 3ZVGA 2SGEE 1GI4A 1DWDH 1QIXB 3ENSB 2WPIS 3A87A 5AFYH 2SGDE 4XFQA 1LVMA 1S83A 1NESE 5C1UA 1D4PB 1JWTA 1N6XA 3EQ0H 4ISHH 1RGQA 1LDTT 4Y7BA 1TABE 1TLDA 1HJ8A 3FP8E 2BD9A 2BLQA 2UWPA 1UJ1A 8KME2 4AGKA 1DVAH 2OUAA 1CA0C 5EQSA 1W2KH 1SQTA 3SGAE 5T6GA 1KLIH 2ALVA 3BTHE 3E1XB 1HYLA 2UUJB 4DVAU 1VR1H 3GICB 3MU0A 3MU4A 2OBQA 4LK4A 1G3DA 2GCTC 1BB0B 3HK6B 1O2XA 1BA8B 3TLOA 1KXFA 4IC5A 4UONA 1YGCH 1ELCA 1YKTA 1O2VA 2CV3A 3LGTA 4AN7A 4NZQA 1Y3UA 2Z9JA 1AKSB 3OU0A 1HCGA 1VZQH 5C1XA 2R0LA 1GL0E 3OY6U 4Z6AH 2WPLS 3RXTA 2FX4A 1PJPA 3ZZ7A 3PMHB 1AIXH 4Y8YA 1SI5H 2V35A 5C67A 1JIMA 3BTKE 2ZPQA 1A5HA 2J92A 3URCA 2Z9IA 1Y5UT 2ZGXH 1DXWA 1ZMNA 3ESTA 1GBAA 1MTUA 2G81E 1P2MA 1C5NH 2VVUA 5DP3A 1FLEE 2EC9H 1TNGA 4DY7B 2DE9A 3T27A 1ZPBA 2AH4X 1QB9A 3UY9A 3MTYA 3TH4H 2ANKH 3A7XA 3L6PA 5PTPA 2QAAA 1DLEA 3GISB 1G2LA 4IW4E 4FUFA 7ESTE 9ESTA 1EAUA 3RM2H 2BD4A 3FFGA 2FOCA 4KP0A 3PM3A
chains in the Genus database with same CATH superfamily
1W7GH 1ELTA 1GBJA 3F2HA 2ZEBA 6ESTA 4FETA 1VGCB 2F9VA 4Q2KA 4U30A 1MTNB 2GD4B 5C2ZA 2BLOA 1YLDA 1HAHH 2A5AA 1UVPA 5FPYA 3A7TA 1C5WB 2XCNA 5FCRA 5ABWA 2VIOA 3H09A 1Y3YA 4FUCA 1YYY1 1KDQA 3SGQE 2RDEA 1OWDA 1DE7H 1TMTH 1QJ7B 1TQ0B 3OSYA 4Q80A 1CT4E 3AW1A 2Y6TA 1G32B 3KCGH 4I86A 2CXVA 4Q7YA 1Z7KA 4IN1A 2GVFA 4WH6A 4NZLA 3OFND 2BDCA 1ABIH 1NN6A 1NFUA 4A1VA 1S6HA 1FONA 1Z6EA 1E36B 1W11U 3UOUA 4CRCA 3A89A 2BDBA 1TGCA 3URDA 2G52A 4Y6DA 5EODA 3ZVEA 1MMJN 1GHBF 1MD8A 1O30A 1NC6A 1PPHE 4INLA 5BPEA 4FUDA 3AAVA 4I8HA 4R8TB 4WMFA 3UUZA 1YP9A 2Y7ZA 3MNBA 1W0JD 3ODDA 1GI2A 1HAXB 2Q6FA 1EAIA 1P01A 2DE8A 2VWNA 1TRNA 1LPGB 5LH8A 2SGPE 1CA0B 1MBMA 3M7TA 3G01A 3F9EA 2A7CA 1Z1JA 5A8YA 3PV4A 1TX8A 2G5VA 5JBAS 5C17A 3F68H 1CE5A 1YPKH 4ISIH 3ODFA 2W5EA 1KYNA 1XUJA 3GYLB 1TOCB 1KDQB 1EOLA 1S85A 1P09A 1GVLA 2UWOA 1XUIA 5EG4A 3KF2A 3RXSA 4D9QA 4XOJA 1DWEH 2GCTB 4WY3A 1HAIH 1V2WT 1F0TA 1SQAA 4O97A 4XD7D 1C1QA 2WINI 1KSNA 3UR9A 1CT0E 1DPOA 1TNKA 2B9LA 4YLQH 1AUTC 1HAZB 1F2SE 1BTYA 3RMLH 2FI5E 2OINA 2SFAA 3U9AH 1WQSA 2HLCA 4BANB 1EFRD 3QUMP 1BBRK 1AVXA 4X6MA 4O3UA 1LTOA 4D76A 4MLFB 4WWYA 4QT8C 1S84A 1GHWH 1WYKA 1NM6A 1Q31A 3PWCA 4I32A 2GCHF 4JYTA 2A1DB 3SQHE 3FAOA 1GDUA 3ELAH 1HV7A 1HRTH 2J9NA 1T31A 1BMFD 2G4TA 3U8TH 1OKXA 3GYMA 1C2LA 3L33A 3NKKA 4MPVA 3V0XA 1JIRA 2TGDA 1PPCE 4X2YA 2V0BA 1O5CB 2WYGA 1NZQH 1WTGH 4I33A 3OY5U 1EJMA 1G30B 2SGFE 2ZGHA 3SUFA 4AFUA 1FN8A 3E16B 2C8WB 4JYVH 3RXOA 2ZU4A 2Y81A 1FAKH 1GBMA 1GJ8B 1O2SA 3TJUA 4VGCC 3M5LA 2BLVA 2J95A 1GWAA 1O3JA 4ZMAH 2O8LA 1DUAA 1F0SA 4X6PA 1WV7H 5CHAC 4HFPB 1DM4B 1OWHA 3FP6E 2F9NA 3SU6A 3PLKA 2A7JA 2CK3D 2Z7FE 1SKYE 2PKSC 1V2OT 1J9CH 4TT3D 1O2UA 2ZTYA 3NXPA 4RKJB 4WJG2 2RA3A 1O3HA 5T1VA 3TJOA 2ANYA 4GUXA 4TWYA 1EATA 2J94A 2PUXB 3F3BA 3QGJA 2QCYA 3QZQA 4Z0KA 1MTSA 1BTWA 4KTCA 5IK2D 1TBQH 2XBVA 1C5SA 2F3CE 3OTPA 4A1XA 1P9SA 3ZV8A 4ISNA 4KGAA 4ASUD 4GHQA 1O3MA 1BHXF 2ZU5A 1C9PA 1W0YH 1O2OA 4GCHF 3SI4H 4MDSA 4X1RU 3WWBA 3ATKA 2A5KA 5AHGH 1E37B 1UTPA 1GBKA 4LXBH 1QJ1B 2J38A 1Q3XA 4AG1A 4THNH 4UFGH 1JBUH 5FL7D 1XX9A 1GGDC 1KXAA 1YCPM 3SV9A 1WQVH 4B74A 2BX4A 1E1RD 1ZTLA 1YCPH 2A5IA 3UFAA 2PR3A 4HZHA 1HIAA 2FI4E 2M2AA 1MKWH 4OS7A 8GCHF 3UNRA 3S0NA 2SGAA 1MCTA 1K22H 4AYYB 2NU3E 3RXLA 3F6UH 5GCHG 1KIGH 1OYTH 3ITIA 2TRMA 4B71A 4K8YA 4KELA 2ZG0H 1OHHD 2WV5A 3BEUA 2ZP0H 3AAUA 5SGAE 1GL1A 1GBCA 2BY8X 1DT2A 4ABGA 2XC5A 2VIDA 3RDZA 1TBRH 2J97A 1YPJH 1CT2E 2FPZA 2VB0A 5EJLA 3TPIZ 1EJNA 5K0HA 5AFZH 1GMHF 1YPLH 4Q7ZA 3SNBA 1ZHPA 2ZNKH 2IJOB 3SORA 1INCA 4E05H 5HIZA 1L1JA 1SFQB 1UVTH 1VJ9U 1J17T 4HI3A 4VGCB 1ANEA 1FZZA 1ANDA 3BF6H 4K3JA 1THRH 2C93B 2XBWA 3UREA 1LVBA 1XMNB 3I77A 1TB6H 5EIYA 5T6DA 3F1SB 1P02A 2O8WA 3PRDA 5CHAB 3M5NA 2PHBA 1XXFA 4OS2A 3BSQA 1SGYE 1C4V2 2PKSB 1Y59T 2HNTF 1EX3A 4AX9H 5C5OA 1DSUA 3PMBB 4NIVA 3T28A 3TJNA 2Z9LA 1W7XH 1NFWA 1UVUH 1C5YB 1V3XA 1GJAB 1GBLA 2HRVA 2HNTC 1G9IE 1JMOH 1BTUA 2H5CA 5J4QA 1DY8A 4CR9A 5EGMA 5C0UA 1BIOA 1COWD 3P6ZB 3BEFB 1ETRH 1FN6A 3WWFA 1G37A 2WPHS 1N1LA 4X6NA 2Z3EA 3M3SA 4CRAA 1T7CA 1KTSB 1GI1A 4A5TS 1P03A 4YOJA 3RU4D 3A86A 4OGXA 2F9PA 3N99A 2EI6A 3ZZCA 1ZTJA 1BHXB 4ABBA 2BXUH 1O2JA 3A8DA 4O9VA 5FX6A 1CHOG 4J2YB 3M36A 2GZ9A 4GSOA 5FBEA 1GGDB 2FWWA 3SN8A 2GDEH 1RTFB 2YMSC 3HGPA 1A46H 1GMDG 2BQ6B 1TGSZ 2H9HA 2OK5A 1V2NT 1QNJA 5L2ZH 4Y71A 3BTWE 1H8DH 1PYTC 3RXKA 1UCYH 3I29A 1O2PA 3MYWA 5EXMA 1C2JA 5DKMA 1UCYE 4H42U 5EW2H 3TK9A 1ZPZA 2O8TA 4XDEA 2OC7A 2G4UA 5DP4A 1ID5H 2ZQ1A 3LJOA 2LNCA 1HLTH 3D49H 3SNDA 1H1BA 4X2WA 3S7HB 3ZZBA 1QURH 5EJZA 5HKKD 2FESH 2NU2E 4CREA 4NG9H 2XWBI 2FMJA 1BMMH 3A84A 3SBKA 1XVOA 4A92A 2C4FH 1C5PA 1D3TB 1BTZA 2ZCHP 3TGIE 3S9CA 3QX5H 1EB2A 1HPGA 2H9TH 3QDZB 3RXHA 3CS0A 4JZDH 1VKYA 1IQHA 2O8UA 1UHBA 4K60A 3GY2A 1LHCH 2A4RA 1KLJH 3DFLA 2A32A 1P2KA 4X8SH 2W7UA 3VB5A 3M7QA 5G4BA 3AASA 4P00A 2B7DH 1OOKB 1VCWA 4D7GA 3AK5A 5IDKA 2PW8H 2AFQB 2UUKB 1QA7A 3IWMA 2PTNA 4ZROA 4Y10E 3VPKA 1QCPA 1LHFH 4UEHH 3FANA 2BXTH 2BD3A 2A0QB 3MO3A 4A6LA 3SO3A 3GY4A 3SNCA 1LPZB 1QRXA 2PGQB 2GV6A 1NBMD 4ABDA 2FOGA 7GCHF 2JH6D 5EW1H 4TY6A 2AS9A 2CMYA 2VU8E 1CGJE 2XRCA 3EDXB 2FOAA 2RFKC 6GCHG 1ZSLA 1E35B 1SGDE 1O38A 3T29A 1SLUB 2EEKA 1L0ZA 5CHBA 4RT0A 1TFXA 4U2WA 1A7SA 1BTPA 3SJ8A 2JJ2D 1O2MA 1N8OC 1GVZA 4SGAE 1UK4A 3MH5A 2VBCA 1SB1H 3GDUA 1PQ7A 2JH0D 1K1NA 1C4U2 2OQUA 1QL7A 2FI3E 3HKJB 2ZDLA 3STIA 4U01A 5A8XA 1OX1A 1H4WA 2XNDD 3K6ZA 1KXDA 4AGJA 2DUCA 3U69H 4FUGA 4M9FA 1P2IA 5JPMH 4BAMB 2FIRH 1O3DA 3LONA 3FOAA 1GHVH 2FTLE 2KAIA 5TCCA 3TNSA 1PQ5A 2ODYB 1UW7A 1GJ7B 1KMHB 2OC1A 3KQDA 1G2MA 4CRGA 3RUOA 2XC0A 5BRRE 5GIBA 3RC4A 2YMSB 1QGFA 1O3EA 4DT4A 3MU8A 3Q00A 1BOQA 4Y7AA 1GBFA 1B0FA 4GPGA 2BB4A 4HTCH 1AGJA 5I46H 1A3BH 1AVGH 1BDAA 2G51A 3T5FH 5HIYA 1ZLRA 3P8OA 1SGEE 2GTBA 3SNAA 4AFZA 2W6ID 1BRCE 4E7RG 3M3TA 1ZHMA 1EUFA 3GY7A 1FPHH 1EXFA 3SGBE 1C5XB 4KKDA 3JZ2B 2RG3A 4GAWA 1C9TA 2GT7A 5LPEA 2QYIA 2F9UA 3A85A 5IYTA 2G55A 1C5MD 2FXRA 1C2GA 2TIOA 4YT6H 4FUIA 4X1NU 2BHGA 2ILNA 3T62A 1TRYA 2BY6X 2UWLA 3RXRA 1AQ7A 1O3OA 2BD8A 3GY5A 1KXEA 2GDDA 1SGIB 3ZVCA 3VB4A 4I7YH 1A5IA 1C5TA 2ASUB 1O31A 5L30H 5HGGA 2KAIB 2D26C 1EKBB 1J8AA 4HG6A 3ATMA 2F83A 4FUHA 3PRBA 4DOQA 2K0QA 2WSSD 4X2XA 2J2UA 1G3EA 1O5FH 1SLWB 1FQ3A 4I8LA 1ESBA 1FY8E 4TPYA 4AFSA 3B23B 4YT7H 4DJZB 1O3PB 4AYVB 2HNTE 1MAXA 5LPRA 2WUBA 1IQFA 2CHAC 1P05A 1HAYB 2ZWLH 4GHTA 4IMZA 3TVJB 4X8UH 3RXMA 3LGIA 4X8VH 1XKBC 2YOLA 1C2KA 3BEIB 4WF8A 2FEQH 5K7RA 1CO7E 2WPMS 1TAWA 1FPCH 1O36A 1YCPK 1HJ9A 3MH4A 5DP7A 2PSYA 1UVOA 1TRMA 1MKWK 2AERH 3KNXA 5CDFE 1AFEH 1RTKA 3M37A 4IBLH 1P11E 3SUDA 5JBCS 3TIUA 3GCTF 1BTXA 3PLPA 3PWBA 2P94A 1H8IH 2ZHFH 4AORA 3IITA 1ETTH 1TMUH 4ZXXH 1AO5A 1K1IA 3ZZ5A 1CVWH 4X8TH 2FO9A 4H4FA 3PLBA 3BTTE 1N8OB 1HFDA 3MO9A 1C1NA 3A82A 2Z9GA 3NCLA 4I31A 4Y8ZA 3PTNA 1WOFA 2J34A 4BXSA 3VFEA 1HJAC 3SV6A 5ETXA 1GMCF 1SL3A 3TK6A 5TJXA 2AHME 1TYNA 2W3KA 3U8OH 1NROH 2O8MA 1C1TA 2Y7XA 1BCUH 2V3MA 4SGBE 1RS0A 1FAXA 4Z1MD 5E2PA 2C90B 1YPHC 2QA9E 1EAXA 4WMDA 1O3CA 2PUQH 1GHBG 1XUGA 4WXVA 2ZDAH 4ZCNA 1C5ZB 2O9QA 3WY8A 1OS8A 1V2QT 2VWMA 3SV7A 4ACBA 1Z8RA 3T2NA 5E2OA 1TIOA 5DG6A 4AOQA 4ASHA 1YF4A 1BT7A 1ZRKA 3MMGA 1O2WA 3UAIC 1SOTA 2ZI2H 3D23A 1FI8A 5EOKA 1GCDA 2BM2A 1YLCA 1UTKA 2VIVA 5KGOA 2BLWA 3SU4A 3QWCH 2QF3A 1DUEA 2ALPA 3S69A 2ZQ2A 1CSOE 1TBZH 3KQCA 5A8ZA 1BJVA 2R0KA 2ZTZA 3ZZ6A 1CBWC 1QB6A 1FY4A 1TA6A 1GHAF 2AMPA 4UFDH 1ZR0A 1O37A 3PMJA 3F0OA 2ESTE 2KCPA 4DIIH 1GI6A 1TNIA 1L1GA 4X1PU 1UTMA 5T6FA 5EPYA 2VINA 1O3LA 3GY6A 1MQ5A 2GMTC 1FJSA 2AEIH 1EZUC 3QK1A 1XKAC 3GS9A 3MNXA 1P3EA 1H9HE 1N6YA 2R9PA 3LGYA 4CH8B 4BNRA 2GCHG 2A2QH 3TU7H 4NA7A 1GBHA 1SBWA 3M5MA 1MCVA 5FXLA 3QGNB 2ZDVH 2CHAB 3UB0A 1AFQC 5DP6A 1XXDA 1DY9A 3P92A 1JRSA 1Y3VA 2QV1A 2ZCKP 3VB6A 4ABIA 3EGKH 2QXHA 1SMFE 1LO6A 5JYIA 1GI5A 1AZZA 1MU6B 1ZRBA 1VJAU 1JXPA 2B8OH 2CF9H 4NSYA 3LC3A 1P57B 1K28D 1TGBA 2TBSA 3MOCA 2PWXA 4Y8XA 1YC0A 5F6MA 1X7AC 2R3YA 4F55A 3ZZDA 2D1JA 3TGJE 4Q63A 3H7OA 1TX7A 4MNWA 4FOUC 3EA8A 3RXDA 2HPQH 1YLNA 4ZKSU 1V2ST 2ZU2A 3BTQE 1V2VT 4LZ1H 3W94A 1PQAA 2NU0E 3A80A 3QLPH 2ZDMA 1JOUB 3LU9B 1BTHH 1CQQA 1C4Y2 4GVUA 2GV7A 1NS3A 1HJAB 1PPFE 3UWJH 1B5GH 2ODQA 1T4UH 2EI8A 5FPTA 4DW2U 1V2TT 1WAYB 3IG6B 2G8TA 2SGQE 5GJ4B 1O2GH 2VNTA 2Q1JA 1GHZA 3BN9A 3ZVAA 1GHXH 3MI4A 2ZHEH 3R0FA 4X2VA 1VCQA 1D3DB 1GDNA 1VITF 3A8CA 3QTVH 1OWIA 2D8WA 2VIQA 2WUCA 1LVYA 1P0SH 2BVRH 1OSSA 1GI7B 1T8LA 1QL9A 1A4WH 1NU7B 4WMEA 1AE5A 1W12U 4GCHG 3A81A 2NU1E 2BD5A 1S0QA 1UTLM 2XBXA 4DG4A 1O2QA 3ZYDA 4FUJA 1E79D 3LC5A 1K1PA 1K2I1 4TY7A 1BMAA 1S5SA 4X1QU 4GLYA 1MKXH 1LMWB 1HNEE 3SJOA 3H5CB 4F4OC 2XTTB 2GKVE 5F8XA 1F7ZA 1XUFA 1Q2WA 3FKSD 1CBWB 1QL8A 1SGPE 2TGTA 2BZAA 2VH0A 2WZQA 1NY22 1QRWA 1WTHD 4ZXYH 1PPBH 3O8BA 2Z3DA 1TOMH 1W13U 1ZGVA 8GCHG 1GG6C 3U28C 3PMAB 3DSOA 5H4IB 2P16A 2JJ1D 6LPRA 4DURA 2GMTB 4R0IA 4Y76A 2BTCE 4J1YA 2ZGBH 2A4OA 2W26A 1MU8B 3HGNA 1SGNE 3OAAD 2FX6A 3SUGA 3V7TA 3VB7A 3OYPA 3TGKE 1AVWA 2XC4A 3GDSA 2QF4A 2ZFTA 2ODPA 3KYFA 3K9XB 3OX7U 3RLWH 8ESTE 1P04A 1WBGB 4XSKU 1AFQB 2OQ5A 3RXVA 1MABB 1MBQA 1GHYH 1BITA 4M7GA 3D62A 1RJXB 2JH5D 1S6FA 2CGAA 1IQIA 3FVFB 2FLRH 1BRBE 2B5TB 1W0ZU 4LOYH 5C20A 2BY7X 3UPEA 4OM9A 1ELGA 1ZMLA 1HUTH 2BDGA 4B2BA 3KIDU 1VCPA 5FX5A 1EZQA 1GMHG 2ZZUH 1J14A 1SLVB 4INKA 4OGYA 1C5UA 3U1JB 3R3GB 1IQMA 1F5RA 3E90B 3KGPA 3SUEA 1ARCA 4FUBA 4NFEA 4UD9H 3WW7A 5KEDA 1TWXB 1YPHE 3SZEA 1SLXB 1G3BA 3AW0A 4ZHAA 1QBVH 1O5AB 2QGRA 2BDYA 2Y5HA 4B76A 2FLBH 1ZJDA 3SQEE 3ZVFA 1D3QB 1OWJA 2BQ7B 2ZA5A 4I8GA 2AGGX 1LVOA 4ZH8A 2FTMA 4JCNA 3BTEE 4RKOB 1IQJA 3PV5A 1BUIA 2H9EH 1C5QA 1SGTA 3CP7A 5CE1A 1AWHB 1A2CH 2A31A 1T8MA 2QF0A 8LPRA 3FN8A 1SVPA 1NRPH 2FOFA 1O2TA 4HGCA 4CRFA 3NZIA 2F43B 1EAWA 2FYRA 2GX4A 1RD3B 4NA8A 3EA7A 4RSPA 3GDVA 5E0JA 1TQ7B 1T8OA 1IQNA 2JETC 4YOGA 5GDSH 3T25A 2FODA 4UFFH 1SHHB 4MPUA 4WVPE 3RXIA 2ZDKA 1SGRE 1V2PT 3PO1C 1GJ4H 5EPNA 1A61H 2V3HH 1YPMH 1GJ5H 1IAUA 3SW2B 1GPZA 2STBE 3E91A 3I78A 3RXGA 4ZKOU 2EY4C 2BDIA 1BBRE 5JB8S 2PTCE 1DWCH 2XW9A 2ZFFH 6CHAC 2FS8A 3MNCA 4MNVA 4RN6A 2PKAA 2ZGJA 3AVZA 4TPIZ 3RMNH 3LIWA 1O2HA 2GGVB 3FO8D 4NCYA 3HATH 4E06H 1YPGH 3A7WA 1ETSH 4ABHA 1GG6B 2PP6A 4MVNA 4FUEA 1O2IA 1MZAA 1G3CA 5LGOA 1DICA 1P06A 4FVBA 3EE0B 2THFB 1UO6A 2V3OH 2ZKSA 5TCAA 3UR6A 3NUMA 1LKAA 1C1MA 1OP8A 1Y8TA 5C3NA 1FV9A 2BVXH 4DT7B 3LOXA 4NFFA 2P59A 4YLUA 3SU5A 1MUEB 4XBBA 3ATIA 4K8BA 1DOJA 2Y5GA 2ZDNA 2F9BH 2ZHQH 2XCFA 5GPIB 1L2EA 2ZGCA 4AB8A 2UUFB 2SNWA 3ZVBA 2LELA 4ABAA 3RC5A 3ATLA 3E8LA 1DWBH 1GBBA 4D9RA 1E0FD 3TITA 2WPJS 1C1PA 3F9GA 1SPJA 1V2KT 1OP0A 2PKAB 2J98B 1SGFA 3ZZ9A 1GI0A 2A45B 1B0EA 1Z8JB 4B1TA 1DXPA 4CRDA 3BTDE 1O2RA 2WHXA 4H6TA 2FOMB 5FPSA 1O5GH 2Z9KA 2P3FH 3U8RH 5AF9H 1IOEA 2NWNA 4XE4A 1RXPA 1KTTB 1O3BA 1GBIA 1QR3E 5DSFA 1O34A 1XUKA 3RMMH 4IMQA 2QIQA 2P3UB 4MTBA 1ABJH 1ESTA 2WPKS 7GCHG 1ELEE 2KR7A 4K1TA 2KX4A 2QN5T 2YNBA 1MAYA 1S6LA 2A4QA 2ZHDA 3FZDA 4MNYA 1NPMA 5F8ZA 2VVVA 1Z8IB 1SOZA 1PPZA 1L1NA 1GJBB 1ORFA 3STJA 2HOBA 1A0LA 1QQUA 2UUYA 3ZVDA 1P2QA 2PGBB 3QN7A 4ISOA 2JETB 1EB1H 3KQ5A 1ZTKA 4TWWA 4XRNA 1C2MA 2HGTH 1EP6A 1V2UT 3E0PB 1TGTA 3L3TA 3PO1B 1Z8GA 4KTSA 1C2HA 3EYDA 3MFJA 3VXEH 2ZF0H 2FP7B 1V2RT 2JKHA 3P70B 3UNSA 1D3PB 2BY5X 1HAVB 4MNXA 1CHGA 2FZZA 2ZFQH 4BAHB 2Z3CA 4IS5A 6CHAB 1RIWC 2M5TA 3KN2A 3OEHD 3SV2H 3RXPA 1HXEH 1PQ8A 5JBBS 2K1QA 1J16A 2Z94A 7KMEH 2AYWA 3DHKH 5FAHA 3C27B 1SFIA 1UTJA 1HB0B 1LHDH 4K1EA 1ARBA 1F5KU 2VVCA 3VG8A 1W8BH 1GCTC 2CJIA 3M3VA 1BMNH 3LJJA 4FU8A 3LGUA 1QZ8A 4F49A 1LHEH 5CMXH 4YOIA 4BXWA 5DPAA 1WDIA 4RI0A 3Q76A 1GJ9B 1EP5A 1O3GA 5A0BA 1FNIA 2P95A 1O0DH 1SQOA 1WU1A 3NPSA 4BAKB 2ZECA 1AN1E 3TNTA 3RXJA 3SHAH 1W10U 3SNEA 5HXFA 2RCEA 3M35A 1HAOH 3N7EA 1H8HD 1DANH 3UNQA 3F0PA 3Q3YA 3M7UA 1O2LA 1BMLA 3GY3A 1KXBA 1ELFA 1MZDA 2FDAA 1UTQA 1XVMA 3A8BA 5L6NH 1O2YA 4O3TA 1NRSH 1K21H 2STAE 1JRTA 3MU1A 1AHTH 2A7HA 1CA8B 1Y3XA 5JBTA 1L4DA 2W7SA 2QXGA 4FVDA 1TNLA 3SJIA 1QRZA 3QZRA 1C1VH 3P8FA 3W95A 4IGDA 2J5UA 1QY6A 1MKXK 3RXQA 1ANCA 1IQLA 2V7QD 1PFXC 1QJ6B 4TYDA 1PPGE 1C2DA 1F92A 3DSGA 1IQEA 2XBYA 3ZZAA 1FXYA 1C5LH 2W3IA 5T3HA 3UQVA 1EQ9A 5EQQA 2R3UA 1GJCB 2QE7D 2QXIA 3SI3H 1SSXA 3RU4E 2OC8A 2BYAX 3VXFH 2VGCB 5EU8A 3GCTG 1F0UA 1M9UA 1O5DH 3ZZ4A 1OWKA 2GZ8A 4K2YA 1OWEA 3CS7A 4JYUH 1AD8H 3KYGA 3RP2A 1EPTC 3SJ9A 4NIXA 1H9LB 3U98H 2KZ4A 3ZZ3A 3RC6A 4CR5A 1AY6H 1ZPCA 3BG4B 4D8NA 1RFNA 2AGIX 1YWUA 1LQEA 3O8RA 4A7IB 2XWAA 9LPRA 1GMCG 3SV8A 1G36A 4BTUB 3MWIU 3SZNA 1P8VC 4H6SB 3NK8A 2OBOA 2BDAA 3TJVA 4BAOB 2HWLB 3MNSA 2P3TB 5HMAA 5EQRA 1UK3A 4X0WU 4LZ4B 1A5GH 2RDLA 1J15A 1UK2A 2FOBA 4B6FA 2P93A 5DN6D 1GBTA 3A8AA 1RIWB 5A0CA 2BDHA 5C5NA 1LHGH 4MQAA 1S82A 1C1UH 4X6OA 3KEEA 1ZJKA 2EA3A 1EZSC 3ZV9A 4WXIA 1ZSJA 1AMHA 2KCYA 3V3MA 1FIZA 4B75A 4F48B 1BRAA 1CGHA 2BY9X 2ZFRH 3DA9B 3Q3KA 3B8JA 1GCTB 3HK3B 1FY5A 1ZYOA 4YO9A 1IQKA 1O2NA 2ZHWH 1ZSKA 3F9HA 4NIWA 1P2NA 1BJUA 2AIQA 1ELVA 3MU5A 2CF8H 1Z6JH 1OP2A 5DP8A 1ELDE 1NRRH 2BD2A 4BOHA 3S9AA 2ZO3H 1GHAG 4O03A 2BX3A 1FY3A 1NFXA 2KCAA 4XBDA 7LPRA 3QO6A 1SC8U 4JK5A 2OXSA 1P2OA 2ZPRA 1EPTA 2HALA 4D7FA 1F0RA 1O33A 2XNIA 1MTVA 1NBME 1GI3A 2C8ZB 3BTGE 4NWLA 1QHRB 2SNVA 3VEQB 1ZOMA 2LPRA 1WUNH 1TNHA 4U32A 2Y82A 4ZAEA 1LCYA 1AUJA 2WYJA 4B6EA 1K0HA 1V6DA 2ZIQH 4MPWA 4I8KA 5FBIA 3SOSA 5F8TA 4YTAA 1AB9C 1GI8B 1O5EH 4IN2A 2A2XH 3RXFA 3BTFE 5DO4H 1NRNH 1O2ZA 1CGIE 1HAGE 1K1MA 1P2JA 1C2EA 3PTBA 2Z6BD 5JDUB 1D9IA 1D6RA 2VJ1A 4NIYA 3GY8A 1UCYK 3UIRA 2OP9A 5HM2A 1C1SA 3ATWA 3UOPA 3E3TA 4B2AA 4DGJA 1P10A 1GBEA 2ZU3A 3RXBA 4AZ2B 4KTUA 4Q7XA 2QY0B 1BZXE 1TX6A 2JIZD 2TGAA 2RA0A 1KXCA 1LQDB 3HKIB 4AB9A 1C1WH 2PLXA 1DFPA 4MPXA 1EPTB 5B6OA 3TH2H 4Y0YE 2Q6DA 1NT1A 2G00A 1W14U 2ANWA 2WPDD 3RXAA 3LKWA 5F03A 2AMDA 5JB9S 1TPSA 5ESBA 3VGCC 5EJ1A 1FIWA 1TONA 2FS9A 4PROA 2VH6A 2XXLA 5L2YH 1GJDB 4ABFA 1THSH 4BTIB 1A1RA 1ACBE 1U6QA 2I6QA 4AFQA 1QFKH 1O2KA 2GT8A 4K69A 1UVSH 3GOVB 3FZZA 1E1QD 1F5LA 3RXUA 1TMBH 1DSTA 3W1EA 4CRBA 3A7ZA 3S9BA 2Y80A 1TGNA 4X1SU 1HAPH 4UE7H 1Z1IA 1NO9H 1VITG 5A0AE 4Y79A 3DD2H 4XBCA 2B0FA 1D6WA 2PFEA 1ZZZA 1GDQA 4K5ZA 5HM9A 4BAQB 3UTUH 4JZIA 1YBWA 3ZYEA 3DSPA 5HYOA 1NU9A 3BIVH 1ESAA 2QXJA 1MTWA 5FHTA 4ACAA 4OS4A 1XM1A 2FOEA 4ISLA 1P9UA 2HVXA 3GCNA 3EAJA 4NWKA 2IPQX 1TE0A 5EXLA 2P8OC 3E6PH 4NGAH 1OXGA 3SU2A 1HDTH 3A83A 2WV4A 3JZ1B 1IHSH 1P3CA 1QA0A 4AC9A 2R2WU 2VWOA 3LPRA 3P17H 2LP6A 2W6JD 1Z71A 2H5DA 2ZC9H 5E0HA 2BZ6H 5LPFA 2IN2A 5F53A 1MH0A 3PYHA 3CENA 1ELAA 1C5RA 3K65B 3A7VA 1SR5C 1V2MT 3V13A 4JZ1A 3GCOA 4JZFH 3BIUH 1TNJA 3FP7E 1TALA 2AIPA 3RU4T 1IQGA 1QTFA 1OYQA 4Q4LA 3N7DA 1T32A 2L74A 5GCHF 2BOKA 2FM2A 1A0HB 1BRUP 3T26A 3U1IB 4ESTE 1W3CA 3GCHC 1UTNA 4CHAC 1K9OE 1AB9B 2ZFSA 3Q3XA 1NFYA 1TPOA 1HBTH 3LGWA 3TK5A 2PSXA 1YM0A 3MO6A 1H8ED 3M5OA 4ZKNU 1SGQE 1KY9A 1HGTH 2BMGB 4OS6A 3UQOA 3BV9B 3K6YA 1KLTA 2BD7A 5DP5A 4UDWH 2QC2A 2OCVB 4OS5A 5B6LA 3HPTB 3KQBA 3LDXH 2L6OA 1HXFH 2H6MA 1TA2A 1S0RA 4JZEH 3UWIA 5GXPA 4B2CA 4NA9H 2QF5A 4IC6A 4JK6A 3PROA 5C94A 2K8IA 1YY3A 4I8JA 3K2UA 3OEED 3DUXH 1GI9B 1QBNA 4INHA 4UFEH 5DK1A 1AE8H 1HIAB 2BVSH 3VGCB 4BTTB 4ABJA 2F9OA 3SU0A 2WV9A 4YM9A 5E8EH 2F4LA 1QQ4A 1A0JA 1FDPA 5DP9A 2TGPZ 1O3AA 3H7TA 2AMQA 2NU4E 5ESTE 3EE7A 1S81A 2ZTXA 1IHTH 3RXEA 2ZFPH 1CU1A 1C5OH 1B7XB 1C5VA 1RRKA 2GP9B 1SGFG 2H2ZA 1SGCA 3OTJE 3N7OA 2OC0A 1EOJA 2EQNA 1GVKB 2KM0A 1C1OA 2ANMH 1FMGA 1Y3WA 1ANBA 2A4GA 5I25A 1TPAE 2ZCLP 3SHCH 5A2MH 3QTOH 3ZZ8A 1ELBA 2HVYB 1C1RA 1XUHA 3A88A 4ZUHA 1BQYA 1BBRH 2D2DA 3F2GA 2H1UA 5J4SA 1E38B 5GNDA 3TH3H 3NWUA 1K1LA 2P8OB 1AWFH 2VIWA 1AZ8A 5C0TA 1T4VH 3RM0H 1DLKB 1O39A 1OPHB 1SQRA 1NTPA 4NSVA 2J98A 4JMYA 1CHOF 5AVDA 2ULLA 1FUJA 2AGEX 3B9FH 4ABEA 1C2FA 1THPB 2IOTA 5EXNA 1SHYA 1TPPA 2YMSD 3E0NB 1GMDF 1V2LT 3V12A 3MHWU 5FCKA 2Q6GA 1MQ6A 3A7YA 1YPEH 4OS1A 3SYJA 3MH6A 4FXGH 1H9IE 1LKBA 1ZGIA 1K1JA 1L4ZA 4AG2A 2I6SA 1PYTD 4YXWD 1EZXC 1UTOA 4Y0ZE 3KQEA 4E7NA 3RXCA 1DS2E 2G5NA 1C2IA 2OD3B 2OTVA 2PV9B 4FU7A 1O5BB 3RLYH 1UMAH 2EI7A 4CBNA 3Q77A 4CBOA 3LH1A 1Y5AT 1O35A 4TSFD 1O3IA 3DT0H 4DCDA 2CN0H 1Y5BT 1QB1A 1AU8A 2YNAA 2BOHB 2F91A 3GCHB 3F9FA 4CHAB 5GWZA 1DX5M 1MD7A 1GJ6A 5E0GA 3S7KB 2R2MB 4WH8A 3C1KA 4MG3A 5DGJA 2GJGA 4FU9A 4CH2B 1GBDA 1O3FA 3O8DA 3LH3A 3D65E 4K1SA 1A3EH 3P8NA 3DFJA 2HPPH 2TPIZ 2IPHA 2OLGA 1SG8B 2VIPA 3P8GA 1NRQH 3SJKA 1RTLA 1WSSH 4YESB 1HAVA 5A09A 3PB1E 2JDID 2C8YB 2HLDD 3M61U 1VITH 1DITH 1AI8H 3SU1A 2FOHA 2VGCC 3VB3A 4ZKRU 2C8XB 1O3KA 3LT3A 1EJAA 3BG8A 5C1YA 4ZHLU 2GZ7A 5DJ7A 3O8CA 2ZU1A 4Y11E 1VGCC 4YZUA 1PPEE 2ZPSA 3RMOH 1MTNC 3LGVA 6GCHF 3MH7A 1P12E 1T8NA 3OE7D 2Y5FA 2J4IA 3BG4C 1QBOA 2V6NA 4ZHMU 4A1TA 5KECA 1WCZA 4B73A 2XYAA 2VWLA 3EA9A 1ZHRA 1V2JT 1DDJA 1UHBB 1O3NA 3SU3A 3BTME 1EASA 1FY1A 2FYQA 3KHVA 4DIHH 1E34B 2BQWB 2KFWA 1AKSA 1K1OA 3P95A 1LPKB 3KL6A 1O32A 1ZMJA 2C3SA 3ZVGA 2SGEE 1GI4A 1DWDH 1QIXB 3ENSB 2WPIS 3A87A 5AFYH 2SGDE 4XFQA 1LVMA 1S83A 1NESE 5C1UA 1D4PB 1JWTA 1N6XA 3ZIAD 3EQ0H 4ISHH 1RGQA 1LDTT 4Y7BA 1TABE 1TLDA 3MQKC 3F2FA 1HJ8A 3FP8E 2BD9A 2BLQA 2UWPA 1UJ1A 8KME2 4AGKA 1DVAH 3CNRA 2OUAA 1CA0C 5EQSA 1W2KH 1SQTA 3SGAE 5T6GA 1KLIH 2ALVA 3BTHE 3E1XB 1HYLA 2UUJB 4DVAU 1VR1H 3GICB 3MU0A 3MU4A 2OBQA 4LK4A 1G3DA 3DCLA 2GCTC 1BB0B 3PV2A 3HK6B 2KCOA 1O2XA 1BA8B 3TLOA 1KXFA 4IC5A 4UONA 1YGCH 1ELCA 1YKTA 1O2VA 2CV3A 3LGTA 4AN7A 4NZQA 1Y3UA 2Z9JA 1AKSB 3OU0A 1HCGA 1FX0B 1VZQH 5C1XA 2R0LA 1GL0E 3OY6U 4RT1A 2WPLS 4Z6AH 3RXTA 2FX4A 1PJPA 3ZZ7A 3PMHB 1AIXH 4Y8YA 1SI5H 2V35A 5C67A 1JIMA 3BTKE 2ZPQA 1A5HA 2J92A 3URCA 2Z9IA 1Y5UT 2XOKD 2ZGXH 4P02A 1DXWA 1ZMNA 3ESTA 1GBAA 1MTUA 2G81E 1P2MA 1C5NH 3NRLA 1WXRA 1W0KD 2VVUA 5DP3A 1FLEE 2EC9H 1TNGA 4DY7B 2DE9A 3T27A 1ZPBA 2AH4X 1QB9A 3UY9A 3MTYA 3TH4H 2ANKH 3A7XA 3L6PA 5PTPA 2QAAA 1DLEA 2IJD1 3GISB 1G2LA 4IW4E 4FUFA 7ESTE 9ESTA 1EAUA 3RM2H 2BD4A 3FFGA 2FOCA 4KP0A 3PM3A
chains in the Genus database with same CATH topology
1W7GH 1ELTA 1GBJA 6ESTA 2ZEBA 1VGCB 2F9VA 4Q2KA 4U30A 1MTNB 2GD4B 5C2ZA 2BLOA 1YLDA 1HAHH 2A5AA 1UVPA 5FPYA 3A7TA 1C5WB 2XCNA 5FCRA 5ABWA 2VIOA 1Y3YA 4FUCA 1YYY1 1KDQA 3SGQE 1OWDA 1DE7H 1TMTH 1QJ7B 1TQ0B 3OSYA 4Q80A 1CT4E 3AW1A 2Y6TA 1G32B 3KCGH 2CXVA 4Q7YA 1Z7KA 4IN1A 2GVFA 4WH6A 4NZLA 2BDCA 1ABIH 1NN6A 1NFUA 4A1VA 1S6HA 1FONA 1Z6EA 1E36B 1W11U 3UOUA 4CRCA 3A89A 2BDBA 1TGCA 3URDA 2G52A 4Y6DA 5EODA 3ZVEA 1MMJN 1GHBF 1MD8A 1O30A 1NC6A 1PPHE 4INLA 5BPEA 4FUDA 3AAVA 4I8HA 4R8TB 4WMFA 3UUZA 1YP9A 2Y7ZA 3MNBA 3ODDA 1GI2A 1HAXB 2Q6FA 1EAIA 1P01A 2DE8A 2VWNA 1TRNA 1LPGB 5LH8A 2SGPE 1CA0B 1MBMA 3M7TA 3G01A 3F9EA 2A7CA 1Z1JA 5A8YA 3PV4A 1TX8A 2G5VA 5JBAS 3F68H 1CE5A 1YPKH 4ISIH 3ODFA 2W5EA 1KYNA 1XUJA 3GYLB 1TOCB 1KDQB 1EOLA 1S85A 1P09A 1GVLA 2UWOA 1XUIA 5EG4A 3KF2A 3RXSA 4D9QA 4XOJA 1DWEH 2GCTB 4WY3A 1HAIH 1V2WT 1F0TA 1SQAA 4O97A 1C1QA 2WINI 1KSNA 3UR9A 1CT0E 1DPOA 1TNKA 2B9LA 4YLQH 1AUTC 1HAZB 1F2SE 1BTYA 3RMLH 2FI5E 2OINA 2SFAA 3U9AH 1WQSA 2HLCA 4BANB 3QUMP 1BBRK 1AVXA 4X6MA 4O3UA 1LTOA 4D76A 4MLFB 4WWYA 4QT8C 1S84A 1GHWH 1WYKA 1NM6A 1Q31A 3PWCA 4I32A 2GCHF 4JYTA 2A1DB 3SQHE 3FAOA 1GDUA 3ELAH 1HV7A 1HRTH 2J9NA 1T31A 2G4TA 3U8TH 1OKXA 3GYMA 1C2LA 3L33A 3NKKA 4MPVA 3V0XA 1JIRA 2TGDA 1PPCE 4X2YA 2V0BA 1O5CB 2WYGA 1NZQH 1WTGH 4I33A 3OY5U 1EJMA 1G30B 2SGFE 2ZGHA 3SUFA 4AFUA 1FN8A 3E16B 2C8WB 4JYVH 3RXOA 2ZU4A 2Y81A 1FAKH 1GBMA 1GJ8B 1O2SA 3TJUA 4VGCC 3M5LA 2BLVA 2J95A 1GWAA 1O3JA 4ZMAH 2O8LA 1DUAA 1F0SA 4X6PA 1WV7H 5CHAC 4HFPB 1DM4B 1OWHA 3FP6E 2F9NA 3SU6A 3PLKA 2A7JA 2Z7FE 2PKSC 1V2OT 1J9CH 1O2UA 2ZTYA 3NXPA 4RKJB 4WJG2 2RA3A 1O3HA 3TJOA 2ANYA 4GUXA 4TWYA 1EATA 2J94A 2PUXB 3QGJA 2QCYA 3QZQA 4Z0KA 1MTSA 1BTWA 4KTCA 1TBQH 2XBVA 1C5SA 2F3CE 4A1XA 1P9SA 3ZV8A 4ISNA 4KGAA 4GHQA 1O3MA 1BHXF 2ZU5A 1C9PA 1W0YH 1O2OA 4GCHF 3SI4H 4MDSA 4X1RU 3ATKA 2A5KA 5AHGH 1E37B 1UTPA 1GBKA 4LXBH 1QJ1B 2J38A 1Q3XA 4AG1A 4THNH 4UFGH 1JBUH 1XX9A 1GGDC 1KXAA 1YCPM 3SV9A 1WQVH 4B74A 2BX4A 1ZTLA 1YCPH 2A5IA 3UFAA 2PR3A 4HZHA 1HIAA 2FI4E 1MKWH 4OS7A 8GCHF 3UNRA 3S0NA 2SGAA 1MCTA 1K22H 4AYYB 2NU3E 3RXLA 3F6UH 5GCHG 1KIGH 1OYTH 3ITIA 2TRMA 4B71A 4K8YA 4KELA 2ZG0H 2WV5A 3BEUA 2ZP0H 3AAUA 5SGAE 1GL1A 1GBCA 2BY8X 1DT2A 4ABGA 2XC5A 2VIDA 3RDZA 1TBRH 1YPJH 1CT2E 2FPZA 2VB0A 3TPIZ 1EJNA 5K0HA 5AFZH 1GMHF 1YPLH 4Q7ZA 3SNBA 1ZHPA 2ZNKH 2IJOB 3SORA 1INCA 4E05H 1L1JA 1SFQB 1UVTH 1VJ9U 1J17T 4HI3A 4VGCB 1ANEA 1FZZA 1ANDA 3BF6H 4K3JA 1THRH 2C93B 2XBWA 3UREA 1LVBA 1XMNB 3I77A 1TB6H 5T6DA 3F1SB 1P02A 2O8WA 5CHAB 3M5NA 2PHBA 1XXFA 4OS2A 3BSQA 1SGYE 1C4V2 2PKSB 1Y59T 2HNTF 1EX3A 4AX9H 5C5OA 1DSUA 3PMBB 4NIVA 3T28A 3TJNA 2Z9LA 1W7XH 1NFWA 1UVUH 1C5YB 1V3XA 1GJAB 1GBLA 2HRVA 2HNTC 1G9IE 1JMOH 1BTUA 2H5CA 5J4QA 1DY8A 4CR9A 5EGMA 1BIOA 3P6ZB 3BEFB 1ETRH 1FN6A 1G37A 2WPHS 1N1LA 4X6NA 2Z3EA 3M3SA 4CRAA 1T7CA 1KTSB 1GI1A 4A5TS 1P03A 4YOJA 3RU4D 3A86A 4OGXA 2F9PA 2EI6A 3ZZCA 1ZTJA 1BHXB 4ABBA 2BXUH 1O2JA 3A8DA 4O9VA 5FX6A 1CHOG 4J2YB 3M36A 2GZ9A 4GSOA 5FBEA 1GGDB 2FWWA 3SN8A 2GDEH 1RTFB 3HGPA 1A46H 1GMDG 2BQ6B 1TGSZ 2H9HA 1V2NT 1QNJA 5L2ZH 4Y71A 3BTWE 1H8DH 1PYTC 3RXKA 1UCYH 3I29A 1O2PA 3MYWA 5EXMA 1C2JA 5DKMA 1UCYE 4H42U 5EW2H 3TK9A 1ZPZA 2O8TA 4XDEA 2OC7A 2G4UA 5DP4A 1ID5H 2ZQ1A 3LJOA 2LNCA 1HLTH 3D49H 3SNDA 1H1BA 4X2WA 3S7HB 3ZZBA 1QURH 2FESH 2NU2E 4CREA 4NG9H 2XWBI 2FMJA 1BMMH 3A84A 3SBKA 1XVOA 4A92A 2C4FH 1C5PA 1D3TB 1BTZA 2ZCHP 3TGIE 3S9CA 3QX5H 1EB2A 1HPGA 2H9TH 3QDZB 3RXHA 3CS0A 4JZDH 1IQHA 2O8UA 1UHBA 4K60A 3GY2A 1LHCH 2A4RA 1KLJH 3DFLA 2A32A 1P2KA 4X8SH 2W7UA 3VB5A 3M7QA 5G4BA 3AASA 2B7DH 1OOKB 1VCWA 4D7GA 5IDKA 2PW8H 2AFQB 2UUKB 1QA7A 3IWMA 2PTNA 4ZROA 4Y10E 3VPKA 1QCPA 1LHFH 4UEHH 3FANA 2BXTH 2BD3A 2A0QB 3MO3A 4A6LA 3SO3A 3GY4A 3SNCA 1LPZB 1QRXA 2PGQB 2GV6A 4ABDA 2FOGA 7GCHF 2JH6D 5EW1H 4TY6A 2AS9A 2CMYA 2VU8E 1CGJE 2XRCA 3EDXB 2FOAA 6GCHG 1ZSLA 1E35B 1SGDE 1O38A 3T29A 1SLUB 2EEKA 1L0ZA 1TFXA 4U2WA 1A7SA 1BTPA 3SJ8A 1O2MA 1N8OC 1GVZA 4SGAE 1UK4A 3MH5A 1SB1H 3GDUA 1PQ7A 2JH0D 1K1NA 1C4U2 2OQUA 1QL7A 2FI3E 3HKJB 2ZDLA 3STIA 4U01A 5A8XA 1OX1A 1H4WA 3K6ZA 1KXDA 4AGJA 2DUCA 3U69H 4FUGA 1P2IA 5JPMH 4BAMB 2FIRH 1O3DA 3LONA 1GHVH 2FTLE 2KAIA 5TCCA 3TNSA 1PQ5A 2ODYB 4CRGA 1GJ7B 2OC1A 3KQDA 1G2MA 3RUOA 2XC0A 5BRRE 5GIBA 3RC4A 1QGFA 1O3EA 3MU8A 3Q00A 1BOQA 4Y7AA 1GBFA 1B0FA 4GPGA 2BB4A 4HTCH 1AGJA 5I46H 1A3BH 1AVGH 1BDAA 2G51A 3T5FH 1ZLRA 3P8OA 1SGEE 2GTBA 3SNAA 4AFZA 1BRCE 4E7RG 3M3TA 1ZHMA 1EUFA 3GY7A 1FPHH 1EXFA 3SGBE 1C5XB 4KKDA 3JZ2B 2RG3A 4GAWA 1C9TA 2GT7A 5LPEA 2QYIA 2F9UA 3A85A 5IYTA 2G55A 1C5MD 2FXRA 1C2GA 2TIOA 4YT6H 4FUIA 4X1NU 2BHGA 2ILNA 3T62A 1TRYA 2BY6X 2UWLA 3RXRA 1AQ7A 1O3OA 2BD8A 3GY5A 1KXEA 2GDDA 1SGIB 3ZVCA 3VB4A 4I7YH 1A5IA 1C5TA 2ASUB 1O31A 5L30H 5HGGA 2KAIB 2D26C 1EKBB 1J8AA 3ATMA 2F83A 4FUHA 4DOQA 4X2XA 2J2UA 1G3EA 1O5FH 1SLWB 1FQ3A 4I8LA 1ESBA 1FY8E 4TPYA 4AFSA 3B23B 4YT7H 4DJZB 1O3PB 4AYVB 2HNTE 1MAXA 5LPRA 2WUBA 1IQFA 2CHAC 1P05A 1HAYB 2ZWLH 4GHTA 4IMZA 3TVJB 4X8UH 3RXMA 3LGIA 4X8VH 1XKBC 2YOLA 1C2KA 3BEIB 4WF8A 2FEQH 5K7RA 1CO7E 2WPMS 1TAWA 1FPCH 1O36A 1YCPK 1HJ9A 3MH4A 5DP7A 2PSYA 1UVOA 1TRMA 1MKWK 2AERH 3KNXA 1AFEH 1RTKA 3M37A 4IBLH 1P11E 3SUDA 5JBCS 3TIUA 3GCTF 1BTXA 3PLPA 3PWBA 2P94A 1H8IH 2ZHFH 4AORA 3IITA 1ETTH 1TMUH 4ZXXH 1AO5A 1K1IA 3ZZ5A 1CVWH 4X8TH 2FO9A 4H4FA 3PLBA 3BTTE 1N8OB 1HFDA 3MO9A 1C1NA 3A82A 2Z9GA 3NCLA 4I31A 4Y8ZA 3PTNA 1WOFA 2J34A 4BXSA 3VFEA 1HJAC 3SV6A 5ETXA 1GMCF 1SL3A 3TK6A 5TJXA 1TYNA 2W3KA 3U8OH 1NROH 2O8MA 1C1TA 2Y7XA 1BCUH 4SGBE 1RS0A 1FAXA 5E2PA 2C90B 1YPHC 2QA9E 1EAXA 4WMDA 1O3CA 2PUQH 1GHBG 1XUGA 4WXVA 2ZDAH 1C5ZB 2O9QA 3WY8A 1OS8A 1V2QT 2VWMA 3SV7A 1Z8RA 3T2NA 5E2OA 1TIOA 5DG6A 4AOQA 4ASHA 1YF4A 1BT7A 1ZRKA 3MMGA 1O2WA 1SOTA 2ZI2H 3D23A 1FI8A 5EOKA 1GCDA 2BM2A 1YLCA 1UTKA 2VIVA 2BLWA 3SU4A 3QWCH 2QF3A 1DUEA 2ALPA 3S69A 2ZQ2A 1CSOE 1TBZH 3KQCA 5A8ZA 1BJVA 2R0KA 2ZTZA 3ZZ6A 1CBWC 1QB6A 1FY4A 1TA6A 1GHAF 2AMPA 4UFDH 1ZR0A 1O37A 3PMJA 2ESTE 4DIIH 1GI6A 1TNIA 1L1GA 4X1PU 1UTMA 5T6FA 5EPYA 2VINA 1O3LA 3GY6A 1MQ5A 2GMTC 1FJSA 2AEIH 1EZUC 3QK1A 1XKAC 3MNXA 1P3EA 1H9HE 1N6YA 2R9PA 3LGYA 4CH8B 4BNRA 2GCHG 2A2QH 3TU7H 4NA7A 1GBHA 1SBWA 3M5MA 1MCVA 5FXLA 3QGNB 2ZDVH 2CHAB 1AFQC 5DP6A 1XXDA 1DY9A 3P92A 1JRSA 1Y3VA 2QV1A 2ZCKP 3VB6A 4ABIA 3EGKH 2QXHA 1SMFE 1LO6A 5JYIA 1GI5A 1AZZA 1MU6B 1ZRBA 1VJAU 1JXPA 2B8OH 2CF9H 4NSYA 3LC3A 1P57B 1K28D 1TGBA 2TBSA 3MOCA 2PWXA 4Y8XA 1YC0A 5F6MA 1X7AC 2R3YA 3ZZDA 2D1JA 3TGJE 3H7OA 1TX7A 4MNWA 3EA8A 3RXDA 2HPQH 4ZKSU 1V2ST 2ZU2A 3BTQE 1V2VT 4LZ1H 3W94A 1PQAA 2NU0E 3A80A 3QLPH 2ZDMA 1JOUB 3LU9B 1BTHH 1CQQA 1C4Y2 4GVUA 2GV7A 1NS3A 1HJAB 1PPFE 3UWJH 1B5GH 2ODQA 1T4UH 2EI8A 5FPTA 4DW2U 1V2TT 1WAYB 3IG6B 2G8TA 2SGQE 5GJ4B 1O2GH 2VNTA 2Q1JA 1GHZA 3BN9A 3ZVAA 1GHXH 3MI4A 2ZHEH 3R0FA 4X2VA 1VCQA 1D3DB 1GDNA 1VITF 3A8CA 3QTVH 1OWIA 2D8WA 2VIQA 2WUCA 1LVYA 1P0SH 2BVRH 1OSSA 1GI7B 1T8LA 1QL9A 1A4WH 1NU7B 4WMEA 1AE5A 1W12U 4GCHG 3A81A 2NU1E 2BD5A 1S0QA 1UTLM 2XBXA 4DG4A 1O2QA 3ZYDA 4FUJA 3LC5A 1K1PA 1K2I1 4TY7A 1BMAA 1S5SA 4X1QU 4GLYA 1MKXH 1LMWB 1HNEE 3SJOA 3H5CB 4F4OC 2XTTB 2GKVE 5F8XA 1F7ZA 1XUFA 1Q2WA 1CBWB 1QL8A 1SGPE 2TGTA 2BZAA 2VH0A 1NY22 1QRWA 1WTHD 4ZXYH 1PPBH 3O8BA 2Z3DA 1TOMH 1W13U 1ZGVA 8GCHG 1GG6C 3PMAB 5H4IB 2P16A 6LPRA 4DURA 2GMTB 4R0IA 4Y76A 2BTCE 4J1YA 2ZGBH 2A4OA 2W26A 1MU8B 3HGNA 1SGNE 3SUGA 2FX6A 3V7TA 3VB7A 3TGKE 3OYPA 1AVWA 2XC4A 3GDSA 2ZFTA 2ODPA 3RLWH 3K9XB 3OX7U 8ESTE 1P04A 1WBGB 4XSKU 1AFQB 2OQ5A 3RXVA 1MBQA 1GHYH 1BITA 4M7GA 3D62A 1RJXB 2JH5D 1S6FA 2CGAA 1IQIA 3FVFB 2FLRH 1BRBE 2B5TB 1W0ZU 4LOYH 5C20A 2BY7X 3UPEA 1ELGA 1ZMLA 1HUTH 2BDGA 4B2BA 3KIDU 1VCPA 5FX5A 1EZQA 1GMHG 2ZZUH 1J14A 1SLVB 4INKA 4OGYA 1C5UA 3U1JB 3R3GB 1IQMA 1F5RA 3E90B 3KGPA 3SUEA 1ARCA 4FUBA 4NFEA 4UD9H 1TWXB 1YPHE 1SLXB 1G3BA 3AW0A 4ZHAA 1QBVH 1O5AB 2QGRA 2BDYA 2Y5HA 4B76A 2FLBH 1ZJDA 3SQEE 3ZVFA 1D3QB 1OWJA 2BQ7B 2ZA5A 4I8GA 2AGGX 1LVOA 4ZH8A 2FTMA 4JCNA 3BTEE