2FOEA

Structure of porcine pancreatic elastase in 80% hexane
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2foeA01
3EYDA 2GMTB 1L0ZA 1LHFH 3FZDA 1TNIA 4ISNA 1ACBE 3A7WA 1ZTKA 3NUMA 3P92A 1W7GH 4A6LA 3NZIA 1MTVA 1MAXA 1PPZA 3I29A 1C5YB 1QL8A 2FMJA 4DT7B 4HI3A 2F9UA 2ZCHP 3BIUH 1RTFB 2NU0E 2OLGA 2XW9A 4OS5A 3EQ0H 1LVOA 5F6MA 2IN2A 4AFZA 2QY0B 4OS7A 3LT3A 1TMUH 2O8MA 1ZTJA 3SQEE 4MDSA 4X1NU 4ZXXH 1DX5M 4UFEH 2AGGX 1PQ5A 1ETTH 2WYJA 3HPTB 4HTCH 1FIZA 1AD8H 2VIDA 4U30A 2TGPZ 2XWAA 3DUXH 5E0JA 2P16A 1JXPA 4Y6DA 5C5OA 1P9SA 1V2JT 2ZGJA 2YOLA 4WY3A 1SLVB 1FPHH 4H4FA 2C8XB 1AKSA 3PTNA 3RC4A 2P59A 3VPKA 3ZZ7A 1SGYE 1DWEH 1BMAA 1KLJH 1HAXB 1XUKA 1P02A 1O35A 2AIQA 1GMDF 4AYYB 3F1SB 1GI5A 1P10A 1AMHA 1QIXB 3BEUA 4NFFA 5GJ4B 1YLCA 1WCZA 2YNBA 3NK8A 4JCNA 2FZZA 2BDCA 1N6XA 1P03A 4CR9A 2XTTB 1TNLA 3TH3H 4I8LA 1LDTT 1GBLA 2HRVA 2G51A 2OQ5A 1TNKA 4JK5A 4GAWA 2NU1E 1IQIA 1T32A 3LDXH 1EJAA 4NG9H 1FY8E 2VU8E 4WH6A 4FUDA 1P0SH 2PKSC 1NFWA 2FYQA 3SGBE 1C2LA 2BMGB 1A5GH 1TX7A 2BQ7B 1K21H 4KELA 1GI2A 3Q3XA 1AE8H 5FHTA 1SOTA 2A4GA 1O5FH 3RMOH 8LPRA 1FAXA 1FNIA 3BTKE 1KXBA 1IQJA 1ZMLA 1MQ6A 1O2WA 2B7DH 1ZZZA 4X2YA 1LPGB 1J14A 1GGDC 1YP9A 1P2NA 3S69A 2ZPQA 4D9QA 1C5VA 2ZHEH 2FOBA 3SO3A 1TGSZ 1C2GA 1VITF 1AI8H 3HK6B 2RDLA 1RJXB 2OC8A 4DG4A 1OP8A 2WV4A 4DGJA 4B1TA 1SHYA 1C5QA 1O0DH 4YLQH 1KLIH 1GDQA 3ZZAA 5JBBS 1GG6C 1WYKA 4GCHF 1TQ7B 4AGKA 2BD7A 1PYTC 2GVFA 4KTUA 5DP8A 1SGIB 2IJOB 3BG4C 3GISB 3U8RH 4ESTE 4CRAA 2TGTA 3H7TA 4AN7A 1FMGA 2P3UB 2ZI2H 4MVNA 1LVBA 1RIWB 3KNXA 1H9LB 1GI3A 5TCAA 1CE5A 4DW2U 1K28D 2BOKA 1C5SA 1QL9A 1NY22 1O3LA 5A0BA 2VH0A 2GCHF 1IHTH 5E0GA 4DOQA 3H5CB 2R3YA 2W7UA 1A0HB 2O8UA 1SGPE 4I8GA 3M5MA 5FPSA 8GCHG 1P3EA 2Q6GA 1O3EA 1HLTH 2QXGA 2ZWLH 3M5LA 1MAYA 3VEQB 3FP7E 3L33A 2Y5FA 2ODYB 1V2KT 2V3OH 5JBTA 1N8OB 1UO6A 4HZHA 5L30H 1ZMJA 1AFQC 1C2JA 1ZSJA 2ZHQH 4B2BA 2GTBA 1O2JA 1K1NA 2UWLA 1GDUA 1GBHA 1UCYK 1Z8GA 1QB1A 1A2CH 1LHEH 1QJ7B 2KAIB 4DVAU 1SGFA 2QF3A 3QUMP 1GHAF 2JH6D 1MCTA 1KXCA 4WF8A 3M35A 1LKBA 4X1PU 1HJ9A 4CR5A 3W94A 2BX3A 4X2WA 1S6FA 3SV9A 3I77A 1TE0A 1QB9A 4RSPA 1GBBA 2BX4A 3SGQE 3RXGA 1LQDB 2NWNA 3U69H 3TGIE 1G3BA 4TPIZ 5L2ZH 1TNJA 1GHBG 2ZGHA 1CBWC 4SGBE 1GHZA 1MH0A 5G4BA 5FCKA 1VR1H 2AMPA 3TK5A 1EKBB 1ORFA 2ANYA 3MU4A 4NIVA 2C4FH 1VZQH 1S81A 3MI4A 1SQAA 1AO5A 2WPLS 1S82A 3HGPA 4ZHLU 1QBVH 5EW1H 3V7TA 2BQ6B 5CHAC 5H4IB 3DA9B 3GCTG 4IMZA 3RXJA 3BTTE 1T8LA 1RGQA 2A7JA 1P9UA 2QN5T 1V2VT 4X8SH 2H6MA 1B0EA 4X0WU 3MFJA 2PKAA 1GCTC 1L4DA 1KXFA 3F68H 1UTQA 3TJUA 3E0PB 3PMBB 1V2RT 3UWJH 1D3TB 4K60A 2GGVB 1XKBC 1UTMA 5LGOA 3SV7A 1EJNA 1O2TA 1BBRH 1P09A 1A46H 1BRBE 1ZR0A 3M5NA 1FY5A 4NSVA 3QLPH 4Q7XA 4X8VH 3A88A 2ZHWH 2Z9KA 1XMNB 4J1YA 4JK6A 3VB4A 3UUZA 1WQSA 2BZ6H 1W0ZU 2ZKSA 2A31A 3BTDE 3PROA 1HAPH 1QRZA 2Z3EA 3OU0A 5GPIB 1C4U2 1GHXH 3RXOA 1IQNA 2A0QB 2QXIA 2BLWA 5JYIA 2JH5D 3M7QA 1UTLM 3AVZA 1O2KA 1O2RA 4AGJA 1GVKB 3ZZ5A 3ITIA 5EW2H 1SGNE 1YGCH 3QK1A 1ESTA 3UREA 1NRNH 3LC3A 5GXPA 2PGQB 3MOCA 3VB5A 1SI5H 3SNBA 1UVTH 5K0HA 3K65B 1HBTH 3TGKE 4CRBA 1FZZA 3A7ZA 4IW4E 1AB9C 2Q6DA 1HB0B 2V0BA 1HIAB 1GJ5H 4O9VA 2B5TB 4WWYA 3FP8E 4IC6A 4X1RU 1X7AC 1YF4A 1UVSH 2ASUB 2ZDLA 2H9TH 3B9FH 1DWBH 4QT8C 2F91A 1O3GA 1MTNC 1SL3A 1GVZA 1SPJA 1W7XH 1K1PA 4Q2KA 1A3EH 3MNBA 3BTME 1G2MA 2BVSH 4ZXYH 3E16B 3Q3KA 3IG6B 4B71A 1ZHPA 2NU3E 1QQUA 1ELFA 1DANH 3KL6A 3RXFA 1NROH 1ELEE 1J9CH 1SOZA 2Y7XA 1P57B 2A5KA 4UEHH 3ZVGA 4NWLA 4NSYA 6GCHG 2FWWA 3P6ZB 1GHYH 1WOFA 2R2WU 2THFB 4X8TH 3UTUH 1SB1H 1SC8U 3ZZ8A 3O8CA 3U8TH 2AGIX 1GJCB 3ENSB 5DP4A 3RC5A 2ZTZA 5EXLA 1QB6A 1MQ5A 4A1XA 4CHAC 1GDNA 1MKWH 3GY6A 1G3EA 3V12A 4IS5A 2ILNA 1DDJA 1VJ9U 3D65E 4ISHH 4BTTB 3RU4D 1QL7A 1BZXE 4JZEH 4U01A 1GL0E 2BDIA 4K8YA 4BAKB 1NRQH 2ZFPH 2ZQ1A 3RXKA 3ZV8A 1YCPK 1LHGH 1P12E 2VVCA 2RG3A 4TWYA 4VGCC 2F9PA 4INLA 1ARBA 1TOMH 4OS6A 1SMFE 2ZGBH 1INCA 4NIWA 1GBCA 1O5BB 1UK4A 1OKXA 4AG1A 1KYNA 1T8NA 4MLFB 1W2KH 3BTHE 1O3BA 4BXWA 1L1NA 3VB3A 4Y11E 2P94A 3SI4H 3A82A 3P70B 5LPRA 1VJAU 3S7HB 2A2XH 4INKA 1IQGA 2BD4A 2G4TA 2NU2E 3K9XB 1BIOA 4A5TS 3SU3A 3SGAE 1GG6B 2HOBA 5C1UA 2AH4X 4D8NA 2C8WB 2SGAA 3SN8A 4GVUA 3BG4B 2ZO3H 4RKOB 4RN6A 3TH2H 1HAVA 3ZZ4A 1KXAA 1N1LA 4KP0A 1G37A 1EZSC 1Z6JH 2BDYA 1GMCG 3LJOA 5JB9S 2P93A 1OWIA 3ZYDA 4ZUHA 1S0QA 1SGTA 1ZGIA 3RXUA 1CA0B 3A89A 1EP5A 3GY5A 1NT1A 5EU8A 3A84A 1BTXA 1DUAA 4DURA 3VGCC 1O39A 2AMDA 3RU4E 4D7FA 2BD8A 1THSH 2QXJA 1JMOH 3M5OA 1CU1A 1G2LA 1SG8B 4MPWA 1O33A 1TGNA 1GJ4H 3KQCA 1YPMH 4GLYA 3A85A 1W14U 1AZZA 2C3SA 2VIVA 2WPMS 1DFPA 1TBZH 4HGCA 3PO1C 5EQRA 2BXUH 1YPKH 1DPOA 1MU6B 1GI4A 1XX9A 3P17H 4XOJA 1K9OE 1F5LA 3SU6A 3K6YA 5EQQA 2ZU2A 3QTOH 1C4V2 4I31A 3A7XA 3SJ9A 2PFEA 4FUGA 4O03A 4MPXA 1A5HA 1D3QB 1PQ8A 4YOIA 2ZGXH 2ZGCA 4B75A 4CREA 1C1OA 1ZYOA 1L1GA 4UFDH 4Y71A 1IQMA 4MQAA 2VIOA 1WQVH 1EPTC 1MKXK 2XCNA 1ZSKA 3BG8A 2AYWA 3NPSA 2LNCA 1MU8B 4I8HA 5IDKA 4X6NA 1CBWB 4TWWA 1HUTH 1GI0A 4TYDA 1UHBA 2R2MB 4JZFH 2BLVA 4JZ1A 4FU8A 5DP6A 1TABE 1TNGA 2OQUA 2C8ZB 2RA3A 3SHCH 2G52A 3LGWA 2VVVA 2Z7FE 4K1SA 4HFPB 1O2ZA 5CHAB 2HNTE 1UVOA 2BY8X 2VVUA 3TJVA 1RFNA 3KHVA 1LQEA 2A1DB 1DOJA 2Z9IA 2FPZA 1OOKB 1PQ7A 4FU9A 3DFLA 3F9EA 3ZVDA 2A4RA 4TY6A 2RA0A 1HXFH 4ASHA 1HJAB 2XYAA 1P8VC 1ZPZA 2VGCC 3TIUA 1DVAH 1HAGE 2D26C 1XUFA 1GCTB 4ZH8A 4UFGH 3SBKA 1NZQH 3RXTA 2J2UA 1GHAG 5EGMA 5HYOA 4DY7B 5JDUB 3E8LA 3KQDA 5FBIA 3SUDA 1T7CA 1V2MT 3SUFA 1ID5H 4IN1A 3BEFB 1P2KA 4H42U 3RXHA 3TH4H 5ABWA 4ZMAH 3E90B 1BJVA 1PFXC 2OINA 4ISLA 1PQAA 3A81A 4K1TA 4Z0KA 3RXDA 4PROA 2FO9A 3AW0A 5DP7A 2F9BH 2FIRH 4Y8ZA 1HFDA 1UK2A 8ESTE 5E8EH 2PTNA 4B76A 1JIRA 3BTFE 1NM6A 1C5TA 3RXSA 3UNSA 2Y5HA 3Q3YA 3CENA 3C27B 4FUEA 2HGTH 4CBNA 1GJ6A 3EA9A 3MU1A 4YLUA 1NFXA 4A92A 4YESB 1YPGH 1BMMH 4Y76A 1Y8TA 1F0UA 3SOSA 4BTIB 1C1WH 3MNCA 1DS2E 2BYAX 3KIDU 2CXVA 4K1EA 1VCPA 2AS9A 3TJOA 4YT6H 4BOHA 3FP6E 1TPOA 2J95A 2J94A 5AVDA 3GY8A 3RMMH 1ELDE 4DJZB 2P8OC 2ZTYA 4AOQA 4Y8YA 5HGGA 4CRCA 4AFSA 1AB9B 3GDVA 4ZKSU 1U6QA 3BN9A 3A7TA 1GBIA 1O37A 3M7TA 1SGDE 1LPKB 1V6DA 3CP7A 4Z6AH 3WY8A 4IMQA 1Z7KA 3ZZ3A 1GL1A 1CVWH 2W7SA 1BTUA 1DUEA 3M37A 1HYLA 4FUCA 4Y0YE 1CHGA 3SJIA 3T27A 2R0KA 1E36B 1G9IE 2GP9B 1B7XB 3VXEH 2ANMH 2CMYA 4Q7YA 1B0FA 3M3SA 3MO3A 2VNTA 1VGCC 1C2FA 4I33A 3AASA 4LK4A 2A4QA 7ESTE 2Q6FA 3ATLA 3OYPA 2ODQA 1HCGA 1MUEB 1BTHH 2SGEE 4OGXA 1Z8IB 2ZHFH 1DSUA 2FOAA 2ZHDA 1C1MA 1W8BH 2HLCA 1DY8A 1D9IA 1EAWA 1KDQB 3BTWE 5A2MH 3T62A 6CHAC 1QRXA 3RDZA 3E6PH 3PWCA 1O2UA 2FLBH 5DGJA 1ZHRA 2FTLE 1CT0E 3PMAB 5F8XA 3MH7A 5A09A 2GCTC 1BUIA 2EC9H 1IOEA 1TOCB 5HXFA 4DIIH 1HAYB 4DIHH 3T5FH 1GI8B 2G5VA 2VH6A 2HALA 2W3IA 4XDEA 2FP7B 1NRSH 3LOXA 3GY2A 4XBDA 1P2JA 3GCHB 2O9QA 1CHOF 1VCQA 2ZFFH 4ABBA 1IQLA 3GY3A 3UQOA 5LPFA 3A87A 1H1BA 1VITH 2HNTC 2ZQ2A 1SLUB 3SW2B 4E06H 1ETSH 4D76A 3O8DA 1TX6A 2QA9E 1TAWA 1C2HA 3SNEA 1LHCH 3GY4A 2OCVB 1TA6A 1G3DA 3A83A 1EB1H 3LC5A 3SHAH 3I78A 1UTKA 2ZG0H 1C2KA 4ZAEA 1XM1A 4I32A 5L6NH 2Q1JA 2BDHA 1AQ7A 1H9IE 2XC0A 1H8IH 4WH8A 1BA8B 3BF6H 3M7UA 4DCDA 1EB2A 4FVDA 2Y7ZA 3LKWA 4FUFA 3EA7A 1GI7B 1GMHF 3RXLA 1V2LT 3QTVH 1SLWB 1G36A 2VIQA 1Z6EA 1GJDB 4AORA 1SFQB 3MTYA 2FOFA 1RD3B 1W12U 1TRMA 1QY6A 3A8DA 2QGRA 3OTJE 3VGCB 2JETC 1JIMA 3T25A 1O5EH 3GY7A 3PTBA 2JH0D 2ZU1A 1GVLA 4X6OA 3SU5A 1TNHA 1M9UA 1HAZB 5DJ7A 5PTPA 2EI7A 1W10U 2ZCLP 3VXFH 2PV9B 2GZ9A 4CRGA 1MKXH 4UONA 1UVUH 1CT2E 1XKAC 4ABHA 1ZGVA 4BNRA 5EG4A 3TK9A 2J4IA 3PO1B 4X8UH 2HVXA 2PKAB 5DKMA 3O8BA 1QGFA 1Z71A 3KQBA 1K22H 3MU5A 3ATMA 3N7OA 3UNRA 1QQ4A 1THRH 1O5GH 1ZSLA 1EAUA 1O2IA 2FOCA 1DICA 2H5DA 3GYLB 3LGYA 1G32B 1P05A 3UFAA 1O2YA 1A5IA 5E0HA 2XXLA 1EPTB 2V35A 3MHWU 4GPGA 2ZNKH 1K1MA 5GCHG 4ISOA 1T4UH 2ZFTA 1DE7H 1DT2A 1BB0B 2BVRH 2H2ZA 3RLWH 1D6WA 1OP2A 1C2MA 1ABJH 1YPLH 3URDA 4Y7AA 4TY7A 2ZECA 1FV9A 1UJ1A 3MH6A 1KTSB 1BITA 2KAIA 3QWCH 3DHKH 5DPAA 1Y59T 1NPMA 5BPEA 4FUIA 2ULLA 1E0FD 1KTTB 1NU9A 4Y10E 2OTVA 2XC5A 3UOUA 3PM3A 3QO6A 2SNVA 4NZQA 2F9OA 1JOUB 1DLKB 1DXPA 4Y79A 1QFKH 2GMTC 5DG6A 3LH1A 1W11U 1C4Y2 1G30B 4U32A 2FOEA 3Q00A 3MO9A 1UMAH 3FZZA 5FBEA 3ZZ6A 3SV6A 2FI3E 2CJIA 5FXLA 2C93B 2FX4A 2XNIA 3BTQE 1GBFA 1DWCH 2CF8H 1UK3A 3ELAH 3QX5H 1XUHA 3VB6A 3ZZBA 1AHTH 4XE4A 3KEEA 3UR9A 5C1XA 4K8BA 3LGUA 1BRUP 5EQSA 3SUEA 5GWZA 1P2MA 1J15A 1BCUH 5FPYA 1D6RA 3TLOA 1XVMA 3PWBA 1SHHB 4R0IA 1LCYA 4IGDA 2VWOA 3S9CA 4YOJA 1BJUA 1W0YH 1NO9H 2QXHA 3ATKA 4AB8A 1TBQH 3MH4A 1V2PT 1XXFA 3TK6A 1QBNA 2BDBA 3RXBA 2XBYA 1MBMA 4WMDA 2O8TA 1GBJA 2BLQA 1ZHMA 1SVPA 3NWUA 3M61U 3PMHB 1AVWA 1BTPA 1YC0A 1ANEA 3W95A 1ZTLA 4SGAE 4MPUA 2AGEX 2W26A 3T26A 3TGJE 2XWBI 2J92A 2VIPA 1OWKA 2G00A 1C1NA 2CF9H 3EE0B 2UWOA 5ESTE 5C2ZA 3LGIA 2EA3A 1ZOMA 5F03A 3VB7A 2PHBA 3RU4T 3UPEA 4X6MA 3KCGH 2ZDKA 1H9HE 2PKSB 2ALVA 1FDPA 3ZYEA 4WMEA 4FUBA 3RXCA 3ZZCA 2WUBA 4X6PA 1SFIA 1NS3A 2ZFSA 1P01A 4XBBA 1Q31A 2BD3A 3SJOA 1HJ8A 1CSOE 4MTBA 1AUTC 3FFGA 8GCHF 2FS8A 2PWXA 1O2NA 1ZRKA 1Y5BT 1KY9A 2Z3CA 1GBTA 2BLOA 4K3JA 2PUQH 4ZKNU 1GGDB 1S84A 2WPJS 5T6GA 2BY9X 1F2SE 2BD5A 1TA2A 1KXDA 1BOQA 1W13U 2J38A 1T4VH 3QZQA 1CGIE 4E05H 1O38A 1FAKH 1ANDA 1TYNA 3OSYA 3SV8A 1GMDG 1C5LH 1TBRH 1Y3VA 1NTPA 1F92A 2XRCA 4B2CA 2AIPA 1Y3XA 1C9TA 1HRTH 2V6NA 1GI9B 1S83A 3M3VA 1C5ZB 3C1KA 2SGFE 4MG3A 1GJAB 3LGVA 5FX5A 1J17T 1GBKA 2TGDA 1AVXA 1QHRB 1YPEH 2SFAA 3F6UH 1OPHB 1PPCE 1C2IA 1PPHE 2Z6BD 3PMJA 5F8ZA 1S85A 2OC7A 1RIWC 3F9GA 3BSQA 1GJ8B 5DP3A 3MU0A 2EI6A 3E91A 1HAOH 1GBAA 4X2VA 4H6SB 1C5WB 1UCYH 3R0FA 1O3IA 1S5SA 1A1RA 2R9PA 1OP0A 3EDXB 4A7IB 1UTNA 1GWAA 2A2QH 1TGBA 2PSYA 2ZFRH 4ABFA 1YYY1 1P04A 2ZA5A 3KF2A 2LPRA 4H6TA 1FQ3A 1O3AA 4F4OC 2YNAA 1C5XB 3GICB 3GYMA 2A32A 1AUJA 1OWHA 3TITA 1LO6A 3RXEA 4MPVA 3GDSA 2FOGA 1EP6A 4BAOB 1V2OT 2HNTF 5A8XA 1C1VH 3UQVA 3DD2H 4XSKU 3P8GA 1AFQB 3CS7A 4O97A 1ELAA 2GV7A 1BQYA 1NFUA 2FXRA 1MD8A 1J16A 2BDAA 2TRMA 1VITG 3KGPA 4ABJA 1MCVA 3TJNA 4AX9H 2JETB 2ZPSA 3UY9A 1O3DA 5LPEA 1D3PB 2GZ7A 4WVPE 5C67A 3JZ1B 2ZU3A 1ELGA 4KGAA 4INHA 3BIVH 4FUHA 3O8RA 5GDSH 2PR3A 1ABIH 4CBOA 3DT0H 4GCHG 1BTYA 1MTUA 4KTCA 1C2DA 1O3JA 3UIRA 4YTAA 1EXFA 4NZLA 3U8OH 1WV7H 2H1UA 4BAHB 1O3NA 2PSXA 2GX4A 2ZP0H 1BT7A 2CHAC 2R3UA 1AVGH 1O2OA 2ZCKP 3ZVBA 2B0FA 2STBE 3LONA 3OY6U 5A8YA 3UR6A 4ZKOU 1O3CA 4JYTA 1TFXA 1O2XA 1K2I1 1IQFA 4GHQA 1P06A 1TMTH 2GCHG 4A1VA 3QN7A 4Y0ZE 4WXIA 5EXMA 1TLDA 2QYIA 3SNCA 4FVBA 3ODFA 1SGQE 1GJ9B 2WYGA 1O2PA 3BEIB 4K69A 5TJXA 1GBDA 2ZU4A 5E2OA 2F3CE 4B73A 1QTFA 1A0LA 5F8TA 7GCHF 1GMHG 1OYTH 1SQOA 1PPEE 1XUIA 1CO7E 1Z1IA 1OSSA 1L2EA 1NU7B 4MNXA 1V2QT 1V2TT 2ZF0H 2UUYA 1NRPH 3PLBA 1O31A 2CV3A 1PPGE 4MNVA 3ZVFA 9ESTA 3D23A 2I6QA 3RM2H 1AWHB 5T3HA 2WV5A 4ABAA 1IQEA 1VCWA 1AKSB 2ZDMA 1N6YA 1SSXA 1KXEA 3IWMA 4JYUH 4Q7ZA 2OD3B 2XC4A 2A5IA 5FAHA 1QJ1B 2J34A 2UWPA 1QR3E 1LVMA 2GDDA 1PPFE 1FUJA 5J4SA 1EZQA 2P95A 1EZXC 4NIXA 3E0NB 2TGAA 2J9NA 1C1RA 1TRNA 3A8AA 4I8JA 4KTSA 1JBUH 2VWLA 3FANA 1SGEE 3HGNA 2D1JA 1V3XA 6GCHF 2UUFB 1AWFH 1GI6A 1A4WH 1A0JA 1ZJKA 2FTMA 1ESBA 3SORA 3A7VA 2D2DA 1MTSA 5J4QA 9LPRA 1EASA 3B23B 1XUGA 1BBRK 2PUXB 4JZDH 3BV9B 4K2YA 3AAVA 1C1TA 1ANBA 1E37B 2WUCA 3CS0A 2FX6A 1E38B 4NA7A 2BVXH 1OXGA 1AY6H 3UWIA 1C5RA 2ZFQH 3SNDA 2ZDNA 1GBMA 1WBGB 2ZEBA 4J2YB 4KKDA 2DUCA 3A86A 1OWDA 1LVYA 4E7NA 2UUKB 1O30A 1UTOA 3KQEA 2DE9A 4ZHMU 1C1QA 1E34B 3URCA 1MTNB 3RXMA 1GHWH 1QJ6B 1A3BH 1DWDH 1W3CA 1TPSA 1FY4A 1MMJN 3QDZB 2FEQH 1EX3A 2FDAA 5EPYA 3RXIA 2FESH 1YCPH 2TBSA 2B9LA 1ELCA 2OC1A 2G55A 2QF0A 4NIYA 1FN6A 3EAJA 4YT7H 4LZ1H 6LPRA 1CQQA 3K2UA 3RXQA 3SUGA 1DXWA 1O2LA 2A7HA 2K1QA 3SU1A 3IITA 4JZIA 1OWJA 1GHVH 1GMCF 2AEIH 5FCRA 3VFEA 3SU4A 3LPRA 2F9VA 3M36A 4IBLH 3B8JA 4CH8B 4CHAB 1ETRH 1TRYA 3MMGA 1V2ST 2XBWA 1GI1A 1XXDA 3LU9B 1MZDA 2VINA 1CGHA 2Z9GA 4ZHAA 4NCYA 3T2NA 1AFEH 4JMYA 2GKVE 1FY1A 5HMAA 4XFQA 2G81E 2H9EH 4VGCB 1YPHE 1TALA 1T8MA 1V2UT 1YLDA 4AG2A 1SGCA 5JB8S 2FM2A 2NU4E 3ZVCA 4ZROA 2QAAA 1GCDA 1IHSH 4YOGA 3OX7U 4O3UA 2FYRA 5C1YA 1TQ0B 1J8AA 3GCNA 1HXEH 1MKWK 3RLYH 1HNEE 4JYVH 1TPAE 4ABGA 4RKJB 7KMEH 2HWLB 3L3TA 4ZKRU 4NWKA 3ATWA 5JBAS 1MBQA 4XBCA 2G8TA 1L1JA 1L4ZA 3PV4A 2SNWA 3QZRA 1O3PB 1QA7A 1FPCH 1SQTA 2GD4B 4AFUA 4ABIA 1OWEA 3P95A 1YBWA 2PLXA 1JWTA 1P3CA 2FOHA 2OP9A 2QC2A 2Z94A 5DP5A 2IPHA 1DLEA 2ZDVH 2SGPE 3TNTA 1NESE 1UVPA 4Y7BA 1HPGA 1KDQA 2BB4A 1BTWA 1CA0C 2Z9LA 3GDUA 3U1JB 5A0AE 1AE5A 1P2IA 1BRAA 2BHGA 1D3DB 1ZRBA 1RTKA 2ODPA 2Y6TA 2Z9JA 1WUNH 1O34A 1JRTA 3GCOA 4AB9A 4E7RG 4I7YH 3PLKA 5B6OA 1CA8B 3OY5U 1AZ8A 1ZMNA 4BAMB 2Z3DA 3JZ2B 2HPQH 3ZVEA 2PTCE 5ESBA 1P2OA 4NFEA 1FY3A 3R3GB 2WPIS 2EEKA 1O2GH 1IQHA 2VWMA 1SBWA 1KSNA 1BRCE 3H7OA 5CE1A 2R0LA 4GSOA 1Y3UA 1Z1JA 4LOYH 4X1SU 1NRRH 3PB1E 1QRWA 3SNAA 2FI4E 2BDGA 1V2NT 3QGJA 1LTOA 5AFZH 2CN0H 1HGTH 1LHDH 4OS4A 1EAIA 2H5CA 3U98H 5EXNA 1PJPA 1ZPBA 2ZTXA 4A1TA 1K1OA 5IYTA 1WAYB 1FONA 1GPZA 3T28A 3GOVB 3HKJB 2CHAB 3UNQA 4BANB 5EPNA 3ZV9A 1ELTA 2BY5X 4D7GA 3SV2H 2FOMB 1C2EA 5BRRE 1O3FA 2O8LA 3TNSA 3BTGE 1TGTA 1TB6H 1TGCA 2QV1A 1TONA 1WSSH 5AHGH 3ZZDA 3F9HA 3RXPA 3PLPA 4D9RA 1C1PA 2SGQE 3FAOA 1PPBH 2AERH 3P8OA 3KN2A 3NKKA 4NA9H 3U9AH 2G5NA 1O3HA 1C9PA 4UFFH 3NXPA 2Y80A 1O2HA 1QNJA 1HJAC 1ZLRA 4I8KA 4MNWA 1IAUA 2GDEH 2A5AA 2VGCB 5JPMH 1O36A 1O5CB 2OXSA 4OS2A 2C90B 3HKIB 2F83A 2W3KA 3S7KB 3K6ZA 1F7ZA 2BM2A 1JRSA 4ABEA 1T31A 4FUJA 3P8NA 1O2MA 5JBCS 4B74A 1YPHC 2PGBB 4UDWH 2A45B 2B8OH 2HPPH 1BMLA 4OS1A 5FPTA 1CGJE 2OBQA 1EPTA 1O3KA 3BTEE 2ANKH 1Q3XA 1Y3YA 4OGYA 3RUOA 1DSTA 1RTLA 1RXPA 1TX8A 1ARCA 5HM2A 4MNYA 3MWIU 1Z8RA 2STAE 1EOJA 1Y5AT 2D8WA 2WINI 3LGTA 3DFJA 4BTUB 4R8TB 2ZU5A 3SJ8A 1S6HA 3SQHE 2IOTA 1TPPA 4K5ZA 1FI8A 3G01A 4GUXA 1S0RA 3P8FA 1G3CA 2SGDE 7GCHG 1EOLA 1BBRE 2M5TA 1MD7A 1GBEA 2ZIQH 1FXYA 1C1SA 4CRFA 1AU8A 1NC6A 1SGRE 1QA0A 3TVJB 2P8OB 4M7GA 1OS8A 2V3HH 5ETXA 3D62A 1F0TA 5FX6A 2BTCE 3NCLA 3RM0H 1AGJA 3V13A 3Q76A 1V2WT 1ELVA 2VB0A 2GV6A 3RXAA 3UOPA 1BMNH 1C5NH 1DM4B 1ELBA 3A8CA 5C20A 3HK3B 3RXVA 3RXRA 2EI8A 1HDTH 3ATIA 5LH8A 2XBVA 1FIWA 1NN6A 1TMBH 2OC0A 1O5AB 1ZJDA 3D49H 4WMFA 4BAQB 3E3TA 1LPZB 3SJKA 2FS9A 4YM9A 1VGCB 2I6SA 3PYHA 2Y81A 4B2AA 2ZZUH 3S9AA 1K1IA 1CT4E 2JKHA 2ZDAH 3QGNB 5T6DA 2PW8H 2GZ8A 1DITH 2VIWA 1Z8JB 1E35B 1YPJH 1HAVB 1F5RA 1Q2WA 2F9NA 3ZZ9A 1RRKA 1EAXA 2AMQA 5CMXH 3Q77A 2ANWA 1HIAA 2Y5GA 6CHAB 1AIXH 5A8ZA 1FLEE 5K7RA 1EUFA 1SLXB 1SR5C 4IN2A 3MNXA 3AW1A 4U2WA 2BXTH 4F49A 2FODA 2QIQA 4NA8A 3E1XB 1UTJA 1KIGH 1F0SA 1FN8A 4FU7A 1T8OA 2GCTB 3TPIZ 1OX1A 1FJSA 5T6FA 2OBOA 3SZNA 1AN1E 2WPKS 1C5PA 6ESTA 5E2PA 5C5NA 8KME2 1QCPA 2BQWB 1XVOA 3GCHC 1XUJA 4AFQA 5A0CA 3RMNH 5DO4H 1BHXB 3M3TA 2BOHB 1LKAA 3RMLH 3ZVAA 1EATA 3HATH 1C1UH 2VJ1A 1F5KU 1LMWB 1WTGH 1C5OH 1O2VA 5AFYH 1B5GH 2TPIZ 1Y3WA 1HAIH 1ESAA 2ZPRA 5DK1A 1GHBF 1QURH 3A7YA 1O3MA 2OUAA 2AFQB 1WTHD 1WU1A 5DP9A 3LH3A 3LIWA 1K1LA 1GJBB 3RC6A 1RS0A 1BDAA 5EOKA 1EJMA 5AF9H 3MH5A 5HM9A 3ESTA 4X2XA 1TWXB 1ANCA 4WXVA 3T29A 1YCPM 4WJG2 3AAUA 4YO9A 1UTPA 1YKTA 1O32A 1QBOA 1MTWA 3A80A 3MYWA 5GCHF 1BHXF 4YZUA 1P11E 3LJJA 3GCTF 1P2QA 2RCEA 1HAHH 1UHBB 1N8OC 1PYTD 3ODDA 1F0RA 4Q80A 2A4OA 3EA8A 5L2YH 3STIA 4AZ2B 2O8WA 4LZ4B 4Y8XA 3STJA 2VWNA 1O3OA 2BY7X 2GT7A 2DE8A 4THNH 3F9FA 1K1JA 2XCFA 2C8YB 3MU8A 1H8DH 4CH2B 2FLRH 2BY6X 2GT8A 4TPYA 1YM0A 2A7CA 1CHOG 1HV7A 1MZAA 1H4WA 1ZPCA 2BD2A 2CGAA 3S0NA 2P3FH 1UCYE 5EODA 4CRDA 1IQKA 3L6PA 3A8BA 1C5UA 4X1QU 1A61H 3FVFB 7LPRA 1O5DH 1BTZA 4UD9H 4ISIH 3V0XA 3U1IB 3TU7H 3SI3H 2QCYA 2ALPA 1GJ7B 1EZUC 4LXBH 4AYVB 3SU0A 4O3TA 1A7SA 5GIBA 1KLTA 5I46H 1DY9A 3RP2A 2BZAA 2G4UA 2TIOA 4NGAH 2UUJB 2W5EA 4UE7H 3V3MA 1SGFG 1Y5UT 2Y82A 2XBXA 1O2SA 5I25A 4IC5A 1THPB 4BXSA 1C5MD 2FI5E 1O2QA 5TCCA 4GHTA 5C3NA 1NFYA 2ZC9H 2BD9A 4ABDA 1EQ9A 3S9BA 1OYQA 3EGKH 4FXGH 2ESTE 1D4PB 3MNSA 5SGAE 1TIOA 2P3TB 3MO6A 3SU2A 2WPHS 2H9HA
chains in the Genus database with same CATH superfamily
3EYDA 2GMTB 1L0ZA 1LHFH 3FZDA 1TNIA 4ISNA 1ACBE 3A7WA 1ZTKA 3NUMA 3P92A 1W7GH 4A6LA 3NZIA 1MTVA 1MAXA 1PPZA 3I29A 1C5YB 1QL8A 2FMJA 4DT7B 4HI3A 2F9UA 2ZCHP 3BIUH 1RTFB 2NU0E 2OLGA 2XW9A 4OS5A 3EQ0H 1LVOA 5F6MA 2IN2A 4AFZA 2QY0B 4OS7A 3LT3A 1TMUH 2O8MA 1ZTJA 3SQEE 5EJZA 4MDSA 4X1NU 4ZXXH 1DX5M 4UFEH 2QF5A 2AGGX 1PQ5A 1ETTH 2WYJA 3HPTB 4HTCH 1FIZA 1AD8H 3PV5A 2VIDA 4U30A 2TGPZ 2XWAA 3DUXH 5E0JA 2P16A 1JXPA 4Y6DA 5C5OA 1P9SA 1V2JT 2ZGJA 2YOLA 4WY3A 2RDEA 1SLVB 1FPHH 4H4FA 2C8XB 1AKSA 3PTNA 3RC4A 2P59A 3VPKA 3ZZ7A 1SGYE 1DWEH 1BMAA 1KLJH 1HAXB 1XUKA 1P02A 1O35A 2AIQA 1GMDF 4AYYB 3F1SB 1GI5A 3SYJA 1P10A 1AMHA 1QIXB 3BEUA 4NFFA 2YMSC 5GJ4B 1YLCA 1WCZA 2YNBA 3NK8A 4JCNA 2FZZA 2BDCA 1N6XA 1P03A 4CR9A 2XTTB 1TNLA 3TH3H 2VBCA 4I8LA 1LDTT 1GBLA 2HRVA 2G51A 2OQ5A 1TNKA 4JK5A 4GAWA 2NU1E 1IQIA 1T32A 3LDXH 1EJAA 4NG9H 1FY8E 2VU8E 4WH6A 4FUDA 1P0SH 2PKSC 1NFWA 2FYQA 3SGBE 1C2LA 2BMGB 1A5GH 1TX7A 2BQ7B 1K21H 4RT1A 4KELA 1GI2A 2J98A 3Q3XA 1AE8H 5FHTA 1SOTA 2A4GA 1O5FH 3RMOH 8LPRA 1FAXA 1FNIA 3BTKE 1KXBA 1IQJA 1ZMLA 1MQ6A 1O2WA 2B7DH 1ZZZA 4X2YA 1LPGB 1J14A 1GGDC 1YP9A 1P2NA 3S69A 2ZPQA 4D9QA 1C5VA 2ZHEH 2FOBA 3SO3A 1TGSZ 1C2GA 1VITF 1AI8H 3HK6B 2RDLA 1RJXB 2OC8A 4DG4A 1OP8A 2WV4A 4DGJA 4B1TA 1SHYA 1C5QA 1O0DH 4YLQH 1KLIH 1GDQA 3ZZAA 5JBBS 1GG6C 1WYKA 4GCHF 1TQ7B 4AGKA 2BD7A 1PYTC 2GVFA 4KTUA 5DP8A 1SGIB 2IJOB 3BG4C 2JJ2D 3GISB 2KX4A 3U8RH 4ESTE 4CRAA 2TGTA 3H7TA 4AN7A 1FMGA 2P3UB 2ZI2H 4MVNA 1LVBA 1RIWB 3KNXA 1H9LB 2V3MA 1GI3A 5TCAA 1CE5A 4DW2U 1K28D 2BOKA 1C5SA 1QL9A 1NY22 1O3LA 5A0BA 2VH0A 2GCHF 1IHTH 5E0GA 4DOQA 3H5CB 2R3YA 2W7UA 1A0HB 2O8UA 1SGPE 4I8GA 3M5MA 5FPSA 8GCHG 1P3EA 2Q6GA 1O3EA 1HLTH 2QXGA 2ZWLH 3M5LA 1MAYA 3VEQB 3FP7E 3L33A 2Y5FA 2ODYB 1V2KT 2V3OH 5JBTA 1N8OB 1UO6A 4HZHA 5L30H 1ZMJA 1AFQC 1C2JA 1ZSJA 2ZHQH 4B2BA 2GTBA 1O2JA 1K1NA 2UWLA 1GDUA 1GBHA 1UCYK 1Z8GA 1QB1A 1A2CH 1LHEH 1QJ7B 2KAIB 5B6LA 4DVAU 1SGFA 2QF3A 3QUMP 1GHAF 2JH6D 1MCTA 1KXCA 4WF8A 3DSOA 3M35A 1LKBA 4X1PU 1HJ9A 4CR5A 3W94A 2BX3A 4X2WA 1S6FA 1SQRA 3OEHD 3I77A 3SV9A 1TE0A 1QB9A 4RSPA 2W6JD 1GBBA 2BX4A 3SGQE 3RXGA 1LQDB 2NWNA 3U69H 3TGIE 1G3BA 4TPIZ 4ASUD 5L2ZH 1TNJA 1GHBG 2ZGHA 1CBWC 4SGBE 1GHZA 1MH0A 5G4BA 5FCKA 1VR1H 2AMPA 3TK5A 1EKBB 3U28C 1ORFA 2ANYA 3MU4A 4NIVA 2C4FH 1VZQH 1S81A 3MI4A 1SQAA 1AO5A 2WPLS 1S82A 3HGPA 4ZHLU 1QBVH 5EW1H 3V7TA 2BQ6B 5CHAC 5H4IB 3DA9B 3GCTG 4IMZA 3RXJA 3BTTE 1T8LA 1RGQA 2A7JA 1P9UA 2QN5T 1V2VT 4X8SH 2H6MA 1B0EA 4X0WU 3MFJA 3FOAA 2PKAA 3SZEA 1GCTC 1L4DA 1KXFA 3F68H 1UTQA 3TJUA 3E0PB 3PMBB 1V2RT 3UWJH 1D3TB 4K60A 2GGVB 1XKBC 1UTMA 5LGOA 3SV7A 1EJNA 1O2TA 1BBRH 1P09A 1A46H 1BRBE 1ZR0A 3M5NA 1FY5A 4NSVA 3QLPH 4Q7XA 4X8VH 3A88A 2ZHWH 2Z9KA 1XMNB 4J1YA 4JK6A 3VB4A 3UUZA 1WQSA 2BZ6H 1W0ZU 2ZKSA 2A31A 3BTDE 3PROA 1HAPH 1QRZA 2Z3EA 3OU0A 5GPIB 1C4U2 1GHXH 3RXOA 1IQNA 2A0QB 2QXIA 2BLWA 5JYIA 2JH5D 4I86A 3M7QA 1UTLM 3AVZA 1O2KA 1O2RA 4AGJA 1GVKB 3ZZ5A 3ITIA 4FOUC 5EW2H 2OK5A 1SGNE 1YGCH 3QK1A 1ESTA 3UREA 1NRNH 3LC3A 5GXPA 1MABB 2PGQB 3MOCA 2JJ1D 3VB5A 1SI5H 3SNBA 1UVTH 5K0HA 3K65B 4FETA 1HBTH 3TGKE 4CRBA 1FZZA 3A7ZA 4IW4E 2XOKD 1AB9C 2Q6DA 1HB0B 2V0BA 1HIAB 1GJ5H 4O9VA 2B5TB 4WWYA 3FP8E 4IC6A 4X1RU 1X7AC 1YF4A 1UVSH 2ASUB 2ZDLA 2H9TH 3B9FH 1DWBH 4QT8C 2F91A 1O3GA 1MTNC 1SL3A 1GVZA 1SPJA 1W7XH 1K1PA 4Q2KA 2KM0A 1A3EH 3MNBA 1WDIA 3BTME 1G2MA 2BVSH 4ZXYH 3E16B 3Q3KA 3IG6B 2YMSB 4B71A 1ZHPA 2NU3E 1QQUA 1ELFA 3MQKC 1DANH 3KL6A 3RXFA 1NROH 1ELEE 1J9CH 1SOZA 2Y7XA 1P57B 2A5KA 4UEHH 1UW7A 3ZVGA 4NWLA 4NSYA 6GCHG 2KZ4A 2FWWA 3P6ZB 1GHYH 1WOFA 2R2WU 2THFB 4X8TH 3UTUH 1SB1H 1SC8U 3ZZ8A 3O8CA 3U8TH 2AGIX 1GJCB 3ENSB 5DP4A 3RC5A 2ZTZA 5EXLA 1QB6A 1MQ5A 4A1XA 4CHAC 1GDNA 1MKWH 3GY6A 1G3EA 3V12A 4IS5A 2ILNA 3WW7A 1DDJA 1VJ9U 3D65E 4ISHH 4BTTB 3RU4D 1QL7A 1BZXE 4JZEH 4U01A 1GL0E 2BDIA 4K8YA 4BAKB 1NRQH 2ZFPH 2ZQ1A 3RXKA 3ZV8A 1YCPK 1LHGH 1P12E 2VVCA 2RG3A 4AC9A 4TWYA 4VGCC 2F9PA 4INLA 1ARBA 1TOMH 4OS6A 1SMFE 2ZGBH 1INCA 4NIWA 1GBCA 1O5BB 1UK4A 1OKXA 4AG1A 1KYNA 1T8NA 4MLFB 1W2KH 3BTHE 1O3BA 4BXWA 1L1NA 3VB3A 4Y11E 2P94A 3SI4H 2HVYB 3A82A 3P70B 5LPRA 1VJAU 3WWFA 3F0PA 3S7HB 2A2XH 4INKA 1IQGA 2BD4A 2G4TA 2NU2E 3K9XB 1BIOA 4A5TS 3SU3A 3SGAE 1GG6B 2HOBA 5C1UA 2AH4X 4D8NA 2C8WB 2SGAA 3SN8A 5FL7D 4GVUA 3BG4B 2ZO3H 4RKOB 4RN6A 3TH2H 1HAVA 3ZZ4A 1KXAA 1N1LA 4KP0A 1G37A 1EZSC 4F48B 1Z6JH 2BDYA 1GMCG 3LJOA 5JB9S 2P93A 1OWIA 3ZYDA 4ZUHA 1S0QA 1SGTA 3OTPA 1ZGIA 3RXUA 1CA0B 3A89A 1EP5A 3GY5A 1NT1A 5EU8A 3ZIAD 4B6FA 3A84A 1BTXA 1DUAA 4DURA 3VGCC 1O39A 2AMDA 3RU4E 4D7FA 2BD8A 1THSH 2QXJA 1JMOH 3M5OA 1CU1A 1G2LA 1SG8B 4MPWA 1O33A 1TGNA 1GJ4H 3KQCA 1YPMH 4GLYA 3A85A 1W14U 1AZZA 2C3SA 2VIVA 2WPMS 1DFPA 1TBZH 4HGCA 3PO1C 5EQRA 5C0UA 2BXUH 1YPKH 1DPOA 1MU6B 1GI4A 1XX9A 3P17H 4XOJA 1K9OE 1F5LA 3SU6A 3K6YA 3KYFA 5EQQA 2ZU2A 3QTOH 1C4V2 4ZCNA 4I31A 3A7XA 2WPDD 3SJ9A 2PFEA 4FUGA 2EY4C 5EJ1A 4O03A 4MPXA 1A5HA 1D3QB 1PQ8A 4YOIA 2ZGXH 2K8IA 2ZGCA 4B75A 4CREA 5KECA 1C1OA 1ZYOA 1L1GA 4UFDH 4Y71A 1IQMA 4MQAA 2VIOA 1WQVH 1EPTC 1MKXK 2XCNA 1ZSKA 2PP6A 3BG8A 2AYWA 3NPSA 2LNCA 1MU8B 4I8HA 5IDKA 4X6NA 1CBWB 4TWWA 3KQ5A 1HUTH 1GI0A 4TYDA 1UHBA 2R2MB 4JZFH 2BLVA 4JZ1A 4FU8A 5DP6A 1TABE 1TNGA 2OQUA 2C8ZB 2RA3A 3SHCH 2G52A 3OFND 3LGWA 2VVVA 2Z7FE 4K1SA 4HFPB 1O2ZA 2KCPA 5CHAB 2HNTE 1UVOA 2BY8X 2VVUA 3TJVA 1RFNA 3KHVA 5T1VA 1LQEA 2A1DB 1DOJA 2Z9IA 2FPZA 1OOKB 1PQ7A 4FU9A 3DFLA 3F9EA 3ZVDA 2A4RA 4TY6A 2RA0A 1HXFH 4ASHA 1HJAB 2XYAA 1P8VC 1ZPZA 2VGCC 3TIUA 1DVAH 2LP6A 1HAGE 2D26C 1XUFA 1GCTB 4ZH8A 4UFGH 3SBKA 1NZQH 3RXTA 2J2UA 1GHAG 5EGMA 5HYOA 4DY7B 5JDUB 3E8LA 3KQDA 5FBIA 3SUDA 1T7CA 1V2MT 3SUFA 1ID5H 4IN1A 3BEFB 1P2KA 4H42U 3RXHA 3TH4H 5ABWA 4ZMAH 3E90B 1BJVA 1PFXC 2OINA 4ISLA 1PQAA 3A81A 4K1TA 4Z0KA 3RXDA 4PROA 2FO9A 3AW0A 5DP7A 2F9BH 2FIRH 4Y8ZA 3VG8A 1HFDA 1UK2A 8ESTE 5E8EH 2PTNA 4B76A 1JIRA 3BTFE 1NM6A 1C5TA 3RXSA 3UNSA 2Y5HA 3Q3YA 2V7QD 3C27B 3CENA 4FUEA 2HGTH 4CBNA 1GJ6A 3EA9A 3MU1A 4YLUA 1NFXA 4A92A 4YESB 1YPGH 1BMMH 4Y76A 1Y8TA 1F0UA 3SOSA 4BTIB 1C1WH 3MNCA 5KGOA 1DS2E 2BYAX 3KIDU 2CXVA 4K1EA 1EFRD 2KR7A 1VCPA 3FN8A 2AS9A 3TJOA 4YT6H 4BOHA 3FP6E 1TPOA 2J95A 2J94A 5AVDA 3GY8A 3RMMH 1ELDE 4DJZB 2P8OC 2ZTYA 4AOQA 4Y8YA 5HGGA 4CRCA 4AFSA 1AB9B 3GDVA 4ZKSU 1U6QA 3BN9A 3A7TA 1GBIA 1O37A 3M7TA 1SGDE 1LPKB 1V6DA 3CP7A 4Z6AH 3WY8A 4IMQA 1Z7KA 3F2GA 3ZZ3A 1GL1A 1CVWH 2W7SA 1BTUA 1DUEA 3M37A 1HYLA 4FUCA 4Y0YE 1CHGA 3SJIA 3UAIC 3T27A 2R0KA 1E36B 1G9IE 2GP9B 3KYGA 1B7XB 3VXEH 2ANMH 2CMYA 4Q7YA 1B0FA 3M3SA 3MO3A 2VNTA 1VGCC 1C2FA 4I33A 3AASA 4LK4A 2A4QA 7ESTE 2Q6FA 3ATLA 3OYPA 2ODQA 1HCGA 1MUEB 1BTHH 2EQNA 2SGEE 4OGXA 1Z8IB 2ZHFH 1DSUA 2FOAA 4RI0A 2ZHDA 1C1MA 1W8BH 5EIYA 2HLCA 1DY8A 1D9IA 1EAWA 1KDQB 3BTWE 2WHXA 4OM9A 3T62A 5A2MH 6CHAC 1QRXA 3RDZA 3E6PH 3PWCA 1O2UA 2FLBH 5DGJA 1ZHRA 5C0TA 2FTLE 1CT0E 3PMAB 5F8XA 3MH7A 5A09A 2GCTC 1YLNA 1BUIA 2EC9H 1IOEA 1TOCB 5HXFA 4DIIH 1HAYB 4DIHH 3T5FH 1GI8B 2G5VA 2VH6A 2HALA 2W3IA 4XDEA 2FP7B 1NRSH 3LOXA 3GY2A 4XBDA 1P2JA 3GCHB 2O9QA 1CHOF 1VCQA 2ZFFH 4ABBA 1IQLA 3GY3A 3UQOA 5C94A 3A87A 5LPFA 1H1BA 1VITH 2HNTC 2ZQ2A 1SLUB 3SW2B 4E06H 1ETSH 4D76A 3O8DA 1TX6A 2QA9E 1TAWA 4ACAA 1C2HA 3SNEA 1LHCH 3GY4A 3F0OA 2OCVB 1TA6A 1G3DA 3A83A 1EB1H 3LC5A 3SHAH 5HIYA 3I78A 1UTKA 2ZG0H 1C2KA 4ZAEA 1XM1A 4I32A 5L6NH 2Q1JA 2BDHA 1AQ7A 1H9IE 2XC0A 1H8IH 4WH8A 1BA8B 3BF6H 3M7UA 4DCDA 1EB2A 4FVDA 3UB0A 2Y7ZA 3LKWA 4FUFA 3EA7A 1GI7B 1GMHF 3RXLA 1V2LT 3QTVH 1SLWB 1G36A 5HKKD 2VIQA 1Z6EA 1GJDB 4AORA 1SFQB 3MTYA 2FOFA 1RD3B 1W12U 1TRMA 3PV2A 1QY6A 3A8DA 2QGRA 3OTJE 3VGCB 2JETC 1JIMA 3T25A 1O5EH 3GY7A 3PTBA 2JH0D 2ZU1A 1GVLA 4X6OA 3SU5A 1TNHA 1M9UA 1HAZB 5DJ7A 5PTPA 2EI7A 1W10U 2ZCLP 5DSFA 3VXFH 2PV9B 2GZ9A 4CRGA 1MKXH 4UONA 1UVUH 1CT2E 1XKAC 4Q63A 4ABHA 1ZGVA 4BNRA 5EG4A 3OE7D 3TK9A 2J4IA 3PO1B 4X8UH 5GNDA 2HVXA 2PKAB 5DKMA 3O8BA 1QGFA 1Z71A 3KQBA 1K22H 3MU5A 4XRNA 3ATMA 3N7OA 4P00A 3UNRA 1QQ4A 1THRH 1O5GH 1ZSLA 1EAUA 1O2IA 2FOCA 1DICA 2H5DA 3GYLB 3LGYA 1G32B 1P05A 3UFAA 1O2YA 1A5IA 5E0HA 2XXLA 1EPTB 2V35A 3MHWU 4GPGA 2ZNKH 1K1MA 5GCHG 4ISOA 1T4UH 2ZFTA 1DE7H 1DT2A 1BB0B 2BVRH 2H2ZA 3RLWH 1D6WA 1OP2A 1C2MA 1ABJH 1YPLH 3URDA 4Y7AA 4TY7A 5HIZA 2ZECA 1FV9A 1UJ1A 3MH6A 1KTSB 1BITA 2KAIA 3QWCH 3DHKH 5DPAA 1Y59T 1NPMA 5BPEA 4FUIA 2ULLA 1E0FD 1KTTB 1NU9A 4Y10E 2OTVA 2XC5A 3UOUA 3PM3A 3QO6A 2SNVA 4NZQA 2F9OA 1JOUB 3W1EA 1DLKB 1DXPA 3WWBA 4Y79A 1QFKH 2GMTC 3DCLA 2GJGA 5KEDA 5DG6A 3LH1A 1W11U 1C4Y2 1G30B 4U32A 2FOEA 3Q00A 3MO9A 1UMAH 3FZZA 5FBEA 3ZZ6A 3SV6A 2FI3E 2CJIA 5FXLA 2C93B 2FX4A 2XNIA 3BTQE 1GBFA 1DWCH 2CF8H 1UK3A 3ELAH 3QX5H 1XUHA 3VB6A 3ZZBA 1AHTH 4XE4A 3F3BA 3KEEA 3UR9A 5C1XA 4K8BA 3LGUA 1BRUP 5EQSA 3SUEA 5GWZA 1P2MA 1J15A 1BCUH 5FPYA 1D6RA 3TLOA 4Z1MD 1XVMA 3PWBA 1SHHB 4R0IA 1LCYA 4IGDA 2VWOA 3S9CA 4YOJA 1BJUA 1W0YH 1NO9H 2QXHA 3ATKA 4AB8A 1TBQH 3MH4A 1V2PT 1XXFA 3TK6A 1QBNA 2BDBA 3RXBA 2XBYA 1MBMA 4WMDA 2O8TA 1GBJA 2BLQA 1ZHMA 1SVPA 3NWUA 3M61U 3PMHB 1AVWA 1BTPA 2L74A 1YC0A 1ANEA 2CK3D 3W95A 1ZTLA 4SGAE 4MPUA 2AGEX 2W26A 3T26A 3TGJE 2XWBI 2J92A 2VIPA 1W0KD 1OWKA 2G00A 1C1NA 2CF9H 3EE0B 2UWOA 5ESTE 5C2ZA 3LGIA 2EA3A 1ZOMA 5F03A 3VB7A 2PHBA 3RU4T 3UPEA 4X6MA 3KCGH 2ZDKA 1H9HE 2KCYA 2PKSB 2ALVA 1FDPA 3ZYEA 5C17A 4WMEA 4FUBA 3RXCA 3ZZCA 2WUBA 4X6PA 1FX0B 1SFIA 2KCOA 1NS3A 2ZFSA 1P01A 4XBBA 1Q31A 2BD3A 3SJOA 1HJ8A 1CSOE 4MTBA 1AUTC 3FFGA 8GCHF 2FS8A 2PWXA 1O2NA 1ZRKA 1Y5BT 1KY9A 2Z3CA 1GBTA 2BLOA 4K3JA 2PUQH 4ZKNU 1GGDB 1S84A 2WPJS 5T6GA 2BY9X 1F2SE 2BD5A 1TA2A 1KXDA 2HLDD 1BOQA 1W13U 2J38A 1T4VH 3QZQA 1CGIE 4E05H 1O38A 1FAKH 1ANDA 1TYNA 3OSYA 3SV8A 1GMDG 1C5LH 1TBRH 1Y3VA 1NTPA 1F92A 1QZ8A 2XRCA 4B2CA 5EJLA 2AIPA 2XNDD 1Y3XA 1C9TA 1HRTH 2V6NA 1GI9B 1S83A 3M3VA 1C5ZB 3C1KA 2SGFE 4MG3A 1GJAB 3LGVA 5FX5A 1J17T 1GBKA 2TGDA 1AVXA 1QHRB 1YPEH 2SFAA 3F6UH 1OPHB 1PPCE 3N99A 1C2IA 4Q4LA 1PPHE 2Z6BD 3PMJA 5F8ZA 1S85A 2OC7A 1RIWC 3F9GA 3BSQA 1GJ8B 1S6LA 3MU0A 2EI6A 3E91A 5DP3A 1GBAA 1HAOH 4X2VA 4H6SB 1C5WB 1UCYH 3R0FA 1O3IA 1S5SA 1A1RA 2R9PA 1OP0A 3EDXB 4A7IB 1UTNA 1GWAA 2A2QH 3PRBA 1TGBA 2PSYA 2L6OA 2ZFRH 4ABFA 1YYY1 1P04A 1E1RD 2ZA5A 3KF2A 2LPRA 4H6TA 1FQ3A 1O3AA 4F4OC 3FO8D 2YNAA 1C5XB 3GICB 3GYMA 2A32A 1AUJA 1OWHA 3TITA 1LO6A 3RXEA 4MPVA 3GDSA 2FOGA 1EP6A 4BAOB 1V2OT 2HNTF 5A8XA 1C1VH 2LELA 3GS9A 3UQVA 3DD2H 4XSKU 3P8GA 1AFQB 4DT4A 3CS7A 4O97A 1ELAA 2GV7A 1BQYA 1NFUA 2FXRA 1MD8A 1J16A 2BDAA 2TRMA 1VITG 3KGPA 4ABJA 1MCVA 3TJNA 4AX9H 2JETB 2QF4A 1YWUA 2ZPSA 3UY9A 1O3DA 5LPEA 1D3PB 2GZ7A 4WVPE 5C67A 3JZ1B 2ZU3A 1ELGA 4KGAA 4INHA 2K0QA 3BIVH 4FUHA 3O8RA 5GDSH 2PR3A 1ABIH 1COWD 4CBOA 3DT0H 4GCHG 1BTYA 2AHME 1MTUA 4KTCA 1C2DA 1O3JA 3UIRA 4YTAA 1EXFA 4NZLA 3U8OH 1WV7H 2H1UA 4BAHB 1O3NA 2PSXA 2GX4A 2ZP0H 1BT7A 2CHAC 2R3UA 1AVGH 1O2OA 2ZCKP 3ZVBA 2B0FA 2STBE 3LONA 3OY6U 5A8YA 3UR6A 4ZKOU 1O3CA 4JYTA 1TFXA 1O2XA 1K2I1 1IQFA 4GHQA 1P06A 1TMTH 2GCHG 4A1VA 3QN7A 4Y0ZE 4WXIA 5EXMA 1TLDA 2QYIA 3SNCA 4FVBA 3ODFA 1SGQE 1GJ9B 2RFKC 2WYGA 1O2PA 3BEIB 4K69A 5TJXA 1GBDA 2ZU4A 5E2OA 2F3CE 4B73A 1QTFA 1A0LA 5F8TA 7GCHF 1GMHG 1OYTH 1SQOA 1PPEE 1XUIA 1CO7E 1Z1IA 1OSSA 1L2EA 1NU7B 4MNXA 1V2QT 1V2TT 2ZF0H 2UUYA 1NRPH 3PLBA 1O31A 2CV3A 3N7EA 1PPGE 4MNVA 3ZVFA 9ESTA 3D23A 2I6QA 3RM2H 1AWHB 5T3HA 2WV5A 4ABAA 1IQEA 1VCWA 1AKSB 2ZDMA 1N6YA 1SSXA 1KXEA 3IWMA 4JYUH 4Q7ZA 2OD3B 2XC4A 2A5IA 3OAAD 5FAHA 1VKYA 2JDID 1QJ1B 2J34A 2UWPA 1QR3E 1LVMA 2GDDA 1PPFE 1FUJA 5J4SA 1EZQA 2P95A 1EZXC 4NIXA 3E0NB 2TGAA 2J9NA 1C1RA 1TRNA 3A8AA 4I8JA 4KTSA 1JBUH 2VWLA 3FANA 1SGEE 3HGNA 2D1JA 1V3XA 6GCHF 2UUFB 1AWFH 1GI6A 1A4WH 1A0JA 1ZJKA 4P02A 2FTMA 1ESBA 3SORA 3A7VA 2D2DA 1MTSA 5J4QA 9LPRA 1EASA 3B23B 1XUGA 1BBRK 2PUXB 2WV9A 4JZDH 3BV9B 2F43B 4K2YA 3AAVA 1C1TA 2J98B 1ANBA 1E37B 2WUCA 3CS0A 2FX6A 1E38B 4NA7A 2BVXH 1OXGA 1AY6H 3UWIA 1C5RA 2ZFQH 2IJD1 2ZDNA 3H09A 3SNDA 1GBMA 1WBGB 2ZEBA 4J2YB 4KKDA 2DUCA 3A86A 1OWDA 1LVYA 4E7NA 2UUKB 1O30A 1UTOA 3KQEA 2DE9A 4ZHMU 1C1QA 1E34B 3URCA 1MTNB 3RXMA 1GHWH 1QJ6B 1A3BH 1DWDH 1W3CA 1TPSA 1FY4A 1MMJN 2J5UA 5F53A 3QDZB 2FEQH 1EX3A 3FKSD 2FDAA 5EPYA 3RXIA 2FESH 1YCPH 2TBSA 2B9LA 1ELCA 5CHBA 2OC1A 2G55A 2QF0A 3CNRA 4NIYA 1FN6A 3EAJA 4YT7H 4LZ1H 6LPRA 1CQQA 3K2UA 3RXQA 3SUGA 1DXWA 1O2LA 2A7HA 2K1QA 3SU1A 3IITA 4JZIA 1OWJA 1GHVH 1GMCF 2AEIH 5FCRA 3VFEA 3SU4A 3LPRA 2F9VA 3M36A 4IBLH 3B8JA 4CH8B 4CHAB 1ETRH 1TRYA 3MMGA 1V2ST 2XBWA 1GI1A 1XXDA 3LU9B 1MZDA 2VINA 1CGHA 2Z9GA 4ZHAA 4NCYA 3T2NA 1AFEH 4JMYA 2GKVE 1FY1A 5HMAA 4XFQA 2G81E 2H9EH 4VGCB 1YPHE 1TALA 1T8MA 1V2UT 1YLDA 3AK5A 4AG2A 1SGCA 5JB8S 2FM2A 2NU4E 3ZVCA 4ZROA 2QAAA 1GCDA 1IHSH 4YOGA 3OX7U 4O3UA 2FYRA 5C1YA 1TQ0B 1J8AA 3GCNA 1HXEH 1MKWK 1SKYE 3RLYH 1HNEE 4JYVH 1TPAE 4ABGA 4RKJB 7KMEH 2HWLB 3L3TA 4ZKRU 4NWKA 3ATWA 5JBAS 1MBQA 4XBCA 2G8TA 1L1JA 1L4ZA 3PV4A 2SNWA 2KFWA 3QZRA 1O3PB 1QA7A 1FPCH 1SQTA 2GD4B 4AFUA 4ABIA 3PRDA 3EE7A 1OWEA 3P95A 1YBWA 2PLXA 1JWTA 1P3CA 2FOHA 2OP9A 2QC2A 2Z94A 5DP5A 2IPHA 1DLEA 2ZDVH 2SGPE 3TNTA 1NESE 1UVPA 4Y7BA 1HPGA 1KDQA 1NBMD 2BB4A 1BTWA 3NRLA 1CA0C 2Z9LA 3GDUA 3U1JB 5A0AE 1AE5A 1P2IA 1BRAA 2BHGA 1D3DB 1ZRBA 1RTKA 2ODPA 2Y6TA 2Z9JA 1WUNH 1O34A 1JRTA 3DSGA 3GCOA 4AB9A 4E7RG 4I7YH 3PLKA 5B6OA 1CA8B 3OY5U 1AZ8A 1ZMNA 4BAMB 2Z3DA 3JZ2B 2WSSD 2HPQH 3ZVEA 2PTCE 5ESBA 1P2OA 4NFEA 1FY3A 3R3GB 2WPIS 2EEKA 1O2GH 1IQHA 2VWMA 1SBWA 1KSNA 1BRCE 3H7OA 5CE1A 2R0LA 4GSOA 1Y3UA 1Z1JA 4LOYH 4XD7D 4X1SU 1NRRH 3PB1E 1QRWA 3SNAA 2FI4E 2BDGA 1V2NT 3QGJA 1LTOA 5AFZH 2CN0H 1HGTH 1LHDH 4OS4A 1EAIA 2H5CA 1KMHB 2WZQA 3U98H 4TSFD 5EXNA 1PJPA 1ZPBA 2ZTXA 3N7DA 4A1TA 1K1OA 5IYTA 1WAYB 1FONA 3F2FA 1GPZA 3T28A 3GOVB 3HKJB 2CHAB 3UNQA 4BANB 5EPNA 3ZV9A 1ELTA 2BY5X 4D7GA 3SV2H 2FOMB 1C2EA 5BRRE 1O3FA 2O8LA 3TNSA 2W6ID 3BTGE 1TGTA 4YXWD 1NBME 4TT3D 1TB6H 1TGCA 2QV1A 1TONA 1WSSH 5AHGH 3ZZDA 3F9HA 3RXPA 3PLPA 4D9RA 1C1PA 2SGQE 3FAOA 1PPBH 2AERH 3P8OA 3KN2A 3NKKA 4NA9H 3U9AH 2G5NA 1O3HA 1C9PA 4UFFH 3NXPA 2Y80A 1O2HA 1QNJA 1HJAC 1W0JD 1ZLRA 4I8KA 4MNWA 1IAUA 2GDEH 2A5AA 2VGCB 5JPMH 1O36A 1O5CB 2OXSA 4OS2A 2C90B 3HKIB 5CDFE 2JIZD 2F83A 2W3KA 3S7KB 3K6ZA 1F7ZA 2BM2A 1JRSA 4ABEA 1T31A 4FUJA 3P8NA 1O2MA 5JBCS 4B74A 1YPHC 2PGBB 4UDWH 2A45B 2B8OH 2HPPH 1BMLA 4OS1A 5FPTA 1CGJE 2OBQA 1EPTA 1O3KA 3BTEE 2ANKH 1Q3XA 1Y3YA 4OGYA 3RUOA 1DSTA 1RTLA 1RXPA 1TX8A 1ARCA 5HM2A 4MNYA 3MWIU 1Z8RA 4B6EA 2STAE 1EOJA 1Y5AT 2D8WA 2WINI 3LGTA 3DFJA 4BTUB 4R8TB 2ZU5A 3SJ8A 1S6HA 2QE7D 3OEED 3SQHE 2IOTA 1TPPA 2KCAA 4K5ZA 1FI8A 3G01A 4GUXA 1H8ED 1S0RA 3P8FA 1G3CA 2SGDE 7GCHG 1EOLA 1BBRE 2M5TA 1MD7A 1GBEA 2ZIQH 1FXYA 1C1SA 4CRFA 1AU8A 1NC6A 1SGRE 1QA0A 3TVJB 2P8OB 4M7GA 1OS8A 2V3HH 5ETXA 3D62A 1F0TA 5FX6A 2BTCE 3NCLA 3RM0H 1AGJA 3V13A 3Q76A 1V2WT 1ELVA 2VB0A 2GV6A 3RXAA 3F2HA 1BMNH 1C5NH 1DM4B 1ELBA 3A8CA 2M2AA 3UOPA 5C20A 3HK3B 3RXVA 3RXRA 2EI8A 1HDTH 3ATIA 5LH8A 2XBVA 1FIWA 1NN6A 1TMBH 2OC0A 1O5AB 1ZJDA 3D49H 4WMFA 4BAQB 3E3TA 1LPZB 3SJKA 2FS9A 1BMFD 1VGCB 2I6SA 3PYHA 2Y81A 4YM9A 4B2AA 2ZZUH 3S9AA 1K1IA 1CT4E 2JKHA 2ZDAH 3QGNB 5T6DA 2PW8H 2GZ8A 1DITH 2VIWA 1Z8JB 1E35B 1YPJH 1HAVB 1F5RA 1Q2WA 2F9NA 3ZZ9A 1RRKA 1EAXA 2AMQA 5CMXH 3Q77A 2ANWA 1HIAA 2YMSD 2Y5GA 6CHAB 1AIXH 5A8ZA 1FLEE 1YY3A 5K7RA 1EUFA 1SLXB 1SR5C 4IN2A 3MNXA 3AW1A 4U2WA 2BXTH 4F49A 2FODA 2QIQA 4NA8A 3E1XB 1UTJA 1KIGH 1F0SA 1FN8A 4FU7A 1T8OA 2GCTB 3TPIZ 1OX1A 1FJSA 5T6FA 2OBOA 3SZNA 1AN1E 2WPKS 1C5PA 6ESTA 5E2PA 4ACBA 5C5NA 8KME2 1QCPA 4M9FA 2BQWB 1XVOA 3GCHC 1XUJA 1OHHD 4AFQA 4F55A 5A0CA 3RMNH 5DO4H 1BHXB 3M3TA 2BOHB 1LKAA 3RMLH 3ZVAA 1EATA 3HATH 1C1UH 2VJ1A 1F5KU 1LMWB 1WTGH 1C5OH 1O2VA 5AFYH 1B5GH 2TPIZ 1Y3WA 1HAIH 1ESAA 2ZPRA 5DK1A 1GHBF 1QURH 3A7YA 1O3MA 2OUAA 2AFQB 1WTHD 1WU1A 5DP9A 3LH3A 3LIWA 1K1LA 1GJBB 3RC6A 2F4LA 1RS0A 1BDAA 5EOKA 1EJMA 5AF9H 3MH5A 5HM9A 3ESTA 4X2XA 1TWXB 1ANCA 4WXVA 3T29A 1YCPM 4WJG2 3AAUA 4YO9A 1UTPA 1YKTA 1O32A 1QBOA 1MTWA 3A80A 3MYWA 5GCHF 1BHXF 4YZUA 3DSPA 1P11E 1WXRA 3LJJA 3GCTF 1P2QA 2RCEA 1HAHH 1UHBB 1N8OC 1PYTD 3ODDA 1F0RA 4Q80A 2A4OA 3EA8A 5L2YH 3STIA 4AZ2B 2O8WA 4LZ4B 4Y8XA 3STJA 2VWNA 1O3OA 1E1QD 2BY7X 2GT7A 2DE8A 4THNH 3F9FA 1K1JA 2XCFA 2C8YB 3MU8A 1H8DH 4CH2B 2FLRH 2BY6X 2GT8A 4TPYA 1YM0A 2A7CA 1CHOG 1HV7A 1MZAA 1H4WA 1ZPCA 2BD2A 2CGAA 3S0NA 2P3FH 1UCYE 5EODA 4CRDA 1IQKA 3L6PA 3A8BA 1C5UA 4X1QU 1A61H 3FVFB 7LPRA 1O5DH 1BTZA 4UD9H 4ISIH 3V0XA 3U1IB 3TU7H 3SI3H 2QCYA 2ALPA 1GJ7B 1EZUC 4LXBH 4AYVB 1H8HD 3SU0A 4O3TA 1A7SA 5GIBA 1KLTA 5I46H 1DY9A 3RP2A 1E79D 5DN6D 1K0HA 2BZAA 2G4UA 2TIOA 4NGAH 2UUJB 2W5EA 4UE7H 3V3MA 1SGFG 1Y5UT 2Y82A 2XBXA 1O2SA 5I25A 2J97A 4IC5A 1THPB 4BXSA 1C5MD 2FI5E 1O2QA 5TCCA 4GHTA 5C3NA 1NFYA 2ZC9H 2BD9A 4ABDA 1EQ9A 3S9BA 4HG6A 1OYQA 4RT0A 3EGKH 4FXGH 2ESTE 1D4PB 3MNSA 5SGAE 1TIOA 2P3TB 2IPQX 3MO6A 3SU2A 2WPHS 5IK2D 2H9HA
chains in the Genus database with same CATH topology
3EYDA 2GMTB 1L0ZA 1LHFH 3FZDA 1TNIA 4ISNA 1ACBE 3A7WA 1ZTKA 3NUMA 3P92A 1W7GH 4A6LA 3NZIA 1MTVA 1MAXA 1PPZA 3I29A 1C5YB 1QL8A 2FMJA 4DT7B 4HI3A 2F9UA 2ZCHP 3BIUH 1RTFB 2NU0E 2OLGA 2XW9A 4OS5A 3EQ0H 1LVOA 5F6MA 2IN2A 4AFZA 2QY0B 4OS7A 3LT3A 1TMUH 2O8MA 1ZTJA 3SQEE 4MDSA 4X1NU 4ZXXH 1DX5M 4UFEH 2AGGX 1PQ5A 1ETTH 2WYJA 3HPTB 4HTCH 1FIZA 1AD8H 2VIDA 4U30A 2TGPZ 2XWAA 3DUXH 5E0JA 2P16A 1JXPA 4Y6DA 5C5OA 1P9SA 1V2JT 2ZGJA 2YOLA 4WY3A 1SLVB 1FPHH 4H4FA 2C8XB 1AKSA 3PTNA 3RC4A 2P59A 3VPKA 3ZZ7A 1SGYE 1DWEH 1BMAA 1KLJH 1HAXB 1XUKA 1P02A 1O35A 2AIQA 1GMDF 4AYYB 3F1SB 1GI5A 1P10A 1AMHA 1QIXB 3BEUA 4NFFA 5GJ4B 1YLCA 1WCZA 2YNBA 3NK8A 4JCNA 2FZZA 2BDCA 1N6XA 1P03A 4CR9A 2XTTB 1TNLA 3TH3H 4I8LA 1LDTT 1GBLA 2HRVA 2G51A 2OQ5A 1TNKA 4JK5A 4GAWA 2NU1E 1IQIA 1T32A 3LDXH 1EJAA 4NG9H 1FY8E 2VU8E 4WH6A 4FUDA 1P0SH 2PKSC 1NFWA 2FYQA 3SGBE 1C2LA 2BMGB 1A5GH 1TX7A 2BQ7B 1K21H 4KELA 1GI2A 3Q3XA 1AE8H 5FHTA 1SOTA 2A4GA 1O5FH 3RMOH 8LPRA 1FAXA 1FNIA 3BTKE 1KXBA 1IQJA 1ZMLA 1MQ6A 1O2WA 2B7DH 1ZZZA 4X2YA 1LPGB 1J14A 1GGDC 1YP9A 1P2NA 3S69A 2ZPQA 4D9QA 1C5VA 2ZHEH 2FOBA 3SO3A 1TGSZ 1C2GA 1VITF 1AI8H 3HK6B 2RDLA 1RJXB 2OC8A 4DG4A 1OP8A 2WV4A 4DGJA 4B1TA 1SHYA 1C5QA 1O0DH 4YLQH 1KLIH 1GDQA 3ZZAA 5JBBS 1GG6C 1WYKA 4GCHF 1TQ7B 4AGKA 2BD7A 1PYTC 2GVFA 4KTUA 5DP8A 1SGIB 2IJOB 3BG4C 3GISB 3U8RH 4ESTE 4CRAA 2TGTA 3H7TA 4AN7A 1FMGA 2P3UB 2ZI2H 4MVNA 1LVBA 1RIWB 3KNXA 1H9LB 1GI3A 5TCAA 1CE5A 4DW2U 1K28D 2BOKA 1C5SA 1QL9A 1NY22 1O3LA 5A0BA 2VH0A 2GCHF 1IHTH 5E0GA 4DOQA 3H5CB 2R3YA 2W7UA 1A0HB 2O8UA 1SGPE 4I8GA 3M5MA 5FPSA 8GCHG 1P3EA 2Q6GA 1O3EA 1HLTH 2QXGA 2ZWLH 3M5LA 1MAYA 3VEQB 3FP7E 3L33A 2Y5FA 2ODYB 1V2KT 2V3OH 5JBTA 1N8OB 1UO6A 4HZHA 5L30H 1ZMJA 1AFQC 1C2JA 1ZSJA 2ZHQH 4B2BA 2GTBA 1O2JA 1K1NA 2UWLA 1GDUA 1GBHA 1UCYK 1Z8GA 1QB1A 1A2CH 1LHEH 1QJ7B 2KAIB 4DVAU 1SGFA 2QF3A 3QUMP 1GHAF 2JH6D 1MCTA 1KXCA 4WF8A 3M35A 1LKBA 4X1PU 1HJ9A 4CR5A 3W94A 2BX3A 4X2WA 1S6FA 3SV9A 3I77A 1TE0A 1QB9A 4RSPA 1GBBA 2BX4A 3SGQE 3RXGA 1LQDB 2NWNA 3U69H 3TGIE 1G3BA 4TPIZ 5L2ZH 1TNJA 1GHBG 2ZGHA 1CBWC 4SGBE 1GHZA 1MH0A 5G4BA 5FCKA 1VR1H 2AMPA 3TK5A 1EKBB 1ORFA 2ANYA 3MU4A 4NIVA 2C4FH 1VZQH 1S81A 3MI4A 1SQAA 1AO5A 2WPLS 1S82A 3HGPA 4ZHLU 1QBVH 5EW1H 3V7TA 2BQ6B 5CHAC 5H4IB 3DA9B 3GCTG 4IMZA 3RXJA 3BTTE 1T8LA 1RGQA 2A7JA 1P9UA 2QN5T 1V2VT 4X8SH 2H6MA 1B0EA 4X0WU 3MFJA 2PKAA 1GCTC 1L4DA 1KXFA 3F68H 1UTQA 3TJUA 3E0PB 3PMBB 1V2RT 3UWJH 1D3TB 4K60A 2GGVB 1XKBC 1UTMA 5LGOA 3SV7A 1EJNA 1O2TA 1BBRH 1P09A 1A46H 1BRBE 1ZR0A 3M5NA 1FY5A 4NSVA 3QLPH 4Q7XA 4X8VH 3A88A 2ZHWH 2Z9KA 1XMNB 4J1YA 4JK6A 3VB4A 3UUZA 1WQSA 2BZ6H 1W0ZU 2ZKSA 2A31A 3BTDE 3PROA 1HAPH 1QRZA 2Z3EA 3OU0A 5GPIB 1C4U2 1GHXH 3RXOA 1IQNA 2A0QB 2QXIA 2BLWA 5JYIA 2JH5D 3M7QA 1UTLM 3AVZA 1O2KA 1O2RA 4AGJA 1GVKB 3ZZ5A 3ITIA 5EW2H 1SGNE 1YGCH 3QK1A 1ESTA 3UREA 1NRNH 3LC3A 5GXPA 2PGQB 3MOCA 3VB5A 1SI5H 3SNBA 1UVTH 5K0HA 3K65B 1HBTH 3TGKE 4CRBA 1FZZA 3A7ZA 4IW4E 1AB9C 2Q6DA 1HB0B 2V0BA 1HIAB 1GJ5H 4O9VA 2B5TB 4WWYA 3FP8E 4IC6A 4X1RU 1X7AC 1YF4A 1UVSH 2ASUB 2ZDLA 2H9TH 3B9FH 1DWBH 4QT8C 2F91A 1O3GA 1MTNC 1SL3A 1GVZA 1SPJA 1W7XH 1K1PA 4Q2KA 1A3EH 3MNBA 3BTME 1G2MA 2BVSH 4ZXYH 3E16B 3Q3KA 3IG6B 4B71A 1ZHPA 2NU3E 1QQUA 1ELFA 1DANH 3KL6A 3RXFA 1NROH 1ELEE 1J9CH 1SOZA 2Y7XA 1P57B 2A5KA 4UEHH 3ZVGA 4NWLA 4NSYA 6GCHG 2FWWA 3P6ZB 1GHYH 1WOFA 2R2WU 2THFB 4X8TH 3UTUH 1SB1H 1SC8U 3ZZ8A 3O8CA 3U8TH 2AGIX 1GJCB 3ENSB 5DP4A 3RC5A 2ZTZA 5EXLA 1QB6A 1MQ5A 4A1XA 4CHAC 1GDNA 1MKWH 3GY6A 1G3EA 3V12A 4IS5A 2ILNA 1DDJA 1VJ9U 3D65E 4ISHH 4BTTB 3RU4D 1QL7A 1BZXE 4JZEH 4U01A 1GL0E 2BDIA 4K8YA 4BAKB 1NRQH 2ZFPH 2ZQ1A 3RXKA 3ZV8A 1YCPK 1LHGH 1P12E 2VVCA 2RG3A 4TWYA 4VGCC 2F9PA 4INLA 1ARBA 1TOMH 4OS6A 1SMFE 2ZGBH 1INCA 4NIWA 1GBCA 1O5BB 1UK4A 1OKXA 4AG1A 1KYNA 1T8NA 4MLFB 1W2KH 3BTHE 1O3BA 4BXWA 1L1NA 3VB3A 4Y11E 2P94A 3SI4H 3A82A 3P70B 5LPRA 1VJAU 3S7HB 2A2XH 4INKA 1IQGA 2BD4A 2G4TA 2NU2E 3K9XB 1BIOA 4A5TS 3SU3A 3SGAE 1GG6B 2HOBA 5C1UA 2AH4X 4D8NA 2C8WB 2SGAA 3SN8A 4GVUA 3BG4B 2ZO3H 4RKOB 4RN6A 3TH2H 1HAVA 3ZZ4A 1KXAA 1N1LA 4KP0A 1G37A 1EZSC 1Z6JH 2BDYA 1GMCG 3LJOA 5JB9S 2P93A 1OWIA 3ZYDA 4ZUHA 1S0QA 1SGTA 1ZGIA 3RXUA 1CA0B 3A89A 1EP5A 3GY5A 1NT1A 5EU8A 3A84A 1BTXA 1DUAA 4DURA 3VGCC 1O39A 2AMDA 3RU4E 4D7FA 2BD8A 1THSH 2QXJA 1JMOH 3M5OA 1CU1A 1G2LA 1SG8B 4MPWA 1O33A 1TGNA 1GJ4H 3KQCA 1YPMH 4GLYA 3A85A 1W14U 1AZZA 2C3SA 2VIVA 2WPMS 1DFPA 1TBZH 4HGCA 3PO1C 5EQRA 2BXUH 1YPKH 1DPOA 1MU6B 1GI4A 1XX9A 3P17H 4XOJA 1K9OE 1F5LA 3SU6A 3K6YA 5EQQA 2ZU2A 3QTOH 1C4V2 4I31A 3A7XA 3SJ9A 2PFEA 4FUGA 4O03A 4MPXA 1A5HA 1D3QB 1PQ8A 4YOIA 2ZGXH 2ZGCA 4B75A 4CREA 1C1OA 1ZYOA 1L1GA 4UFDH 4Y71A 1IQMA 4MQAA 2VIOA 1WQVH 1EPTC 1MKXK 2XCNA 1ZSKA 3BG8A 2AYWA 3NPSA 2LNCA 1MU8B 4I8HA 5IDKA 4X6NA 1CBWB 4TWWA 1HUTH 1GI0A 4TYDA 1UHBA 2R2MB 4JZFH 2BLVA 4JZ1A 4FU8A 5DP6A 1TABE 1TNGA 2OQUA 2C8ZB 2RA3A 3SHCH 2G52A 3LGWA 2VVVA 2Z7FE 4K1SA 4HFPB 1O2ZA 5CHAB 2HNTE 1UVOA 2BY8X 2VVUA 3TJVA 1RFNA 3KHVA 1LQEA 2A1DB 1DOJA 2Z9IA 2FPZA 1OOKB 1PQ7A 4FU9A 3DFLA 3F9EA 3ZVDA 2A4RA 4TY6A 2RA0A 1HXFH 4ASHA 1HJAB 2XYAA 1P8VC 1ZPZA 2VGCC 3TIUA 1DVAH 1HAGE 2D26C 1XUFA 1GCTB 4ZH8A 4UFGH 3SBKA 1NZQH 3RXTA 2J2UA 1GHAG 5EGMA 5HYOA 4DY7B 5JDUB 3E8LA 3KQDA 5FBIA 3SUDA 1T7CA 1V2MT 3SUFA 1ID5H 4IN1A 3BEFB 1P2KA 4H42U 3RXHA 3TH4H 5ABWA 4ZMAH 3E90B 1BJVA 1PFXC 2OINA 4ISLA 1PQAA 3A81A 4K1TA 4Z0KA 3RXDA 4PROA 2FO9A 3AW0A 5DP7A 2F9BH 2FIRH 4Y8ZA 1HFDA 1UK2A 8ESTE 5E8EH 2PTNA 4B76A 1JIRA 3BTFE 1NM6A 1C5TA 3RXSA 3UNSA 2Y5HA 3Q3YA 3CENA 3C27B 4FUEA 2HGTH 4CBNA 1GJ6A 3EA9A 3MU1A 4YLUA 1NFXA 4A92A 4YESB 1YPGH 1BMMH 4Y76A 1Y8TA 1F0UA 3SOSA 4BTIB 1C1WH 3MNCA 1DS2E 2BYAX 3KIDU 2CXVA 4K1EA 1VCPA 2AS9A 3TJOA 4YT6H 4BOHA 3FP6E 1TPOA 2J95A 2J94A 5AVDA 3GY8A 3RMMH 1ELDE 4DJZB 2P8OC 2ZTYA 4AOQA 4Y8YA 5HGGA 4CRCA 4AFSA 1AB9B 3GDVA 4ZKSU 1U6QA 3BN9A 3A7TA 1GBIA 1O37A 3M7TA 1SGDE 1LPKB 1V6DA 3CP7A 4Z6AH 3WY8A 4IMQA 1Z7KA 3ZZ3A 1GL1A 1CVWH 2W7SA 1BTUA 1DUEA 3M37A 1HYLA 4FUCA 4Y0YE 1CHGA 3SJIA 3T27A 2R0KA 1E36B 1G9IE 2GP9B 1B7XB 3VXEH 2ANMH 2CMYA 4Q7YA 1B0FA 3M3SA 3MO3A 2VNTA 1VGCC 1C2FA 4I33A 3AASA 4LK4A 2A4QA 7ESTE 2Q6FA 3ATLA 3OYPA 2ODQA 1HCGA 1MUEB 1BTHH 2SGEE 4OGXA 1Z8IB 2ZHFH 1DSUA 2FOAA 2ZHDA 1C1MA 1W8BH 2HLCA 1DY8A 1D9IA 1EAWA 1KDQB 3BTWE 5A2MH 3T62A 6CHAC 1QRXA 3RDZA 3E6PH 3PWCA 1O2UA 2FLBH 5DGJA 1ZHRA 2FTLE 1CT0E 3PMAB 5F8XA 3MH7A 5A09A 2GCTC 1BUIA 2EC9H 1IOEA 1TOCB 5HXFA 4DIIH 1HAYB 4DIHH 3T5FH 1GI8B 2G5VA 2VH6A 2HALA 2W3IA 4XDEA 2FP7B 1NRSH 3LOXA 3GY2A 4XBDA 1P2JA 3GCHB 2O9QA 1CHOF 1VCQA 2ZFFH 4ABBA 1IQLA 3GY3A 3UQOA 5LPFA 3A87A 1H1BA 1VITH 2HNTC 2ZQ2A 1SLUB 3SW2B 4E06H 1ETSH 4D76A 3O8DA 1TX6A 2QA9E 1TAWA 1C2HA 3SNEA 1LHCH 3GY4A 2OCVB 1TA6A 1G3DA 3A83A 1EB1H 3LC5A 3SHAH 3I78A 1UTKA 2ZG0H 1C2KA 4ZAEA 1XM1A 4I32A 5L6NH 2Q1JA 2BDHA 1AQ7A 1H9IE 2XC0A 1H8IH 4WH8A 1BA8B 3BF6H 3M7UA 4DCDA 1EB2A 4FVDA 2Y7ZA 3LKWA 4FUFA 3EA7A 1GI7B 1GMHF 3RXLA 1V2LT 3QTVH 1SLWB 1G36A 2VIQA 1Z6EA 1GJDB 4AORA 1SFQB 3MTYA 2FOFA 1RD3B 1W12U 1TRMA 1QY6A 3A8DA 2QGRA 3OTJE 3VGCB 2JETC 1JIMA 3T25A 1O5EH 3GY7A 3PTBA 2JH0D 2ZU1A 1GVLA 4X6OA 3SU5A 1TNHA 1M9UA 1HAZB 5DJ7A 5PTPA 2EI7A 1W10U 2ZCLP 3VXFH 2PV9B 2GZ9A 4CRGA 1MKXH 4UONA 1UVUH 1CT2E 1XKAC 4ABHA 1ZGVA 4BNRA 5EG4A 3TK9A 2J4IA 3PO1B 4X8UH 2HVXA 2PKAB 5DKMA 3O8BA 1QGFA 1Z71A 3KQBA 1K22H 3MU5A 3ATMA 3N7OA 3UNRA 1QQ4A 1THRH 1O5GH 1ZSLA 1EAUA 1O2IA 2FOCA 1DICA 2H5DA 3GYLB 3LGYA 1G32B 1P05A 3UFAA 1O2YA 1A5IA 5E0HA 2XXLA 1EPTB 2V35A 3MHWU 4GPGA 2ZNKH 1K1MA 5GCHG 4ISOA 1T4UH 2ZFTA 1DE7H 1DT2A 1BB0B 2BVRH 2H2ZA 3RLWH 1D6WA 1OP2A 1C2MA 1ABJH 1YPLH 3URDA 4Y7AA 4TY7A 2ZECA 1FV9A 1UJ1A 3MH6A 1KTSB 1BITA 2KAIA 3QWCH 3DHKH 5DPAA 1Y59T 1NPMA 5BPEA 4FUIA 2ULLA 1E0FD 1KTTB 1NU9A 4Y10E 2OTVA 2XC5A 3UOUA 3PM3A 3QO6A 2SNVA 4NZQA 2F9OA 1JOUB 1DLKB 1DXPA 4Y79A 1QFKH 2GMTC 5DG6A 3LH1A 1W11U 1C4Y2 1G30B 4U32A 2FOEA 3Q00A 3MO9A 1UMAH 3FZZA 5FBEA 3ZZ6A 3SV6A 2FI3E 2CJIA 5FXLA 2C93B 2FX4A