2FOGA

Structure of porcine pancreatic elastase in 40% trifluoroethanol
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fogA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fogA01
1D3PB 1V2PT 4ZHAA 1V2VT 4K5ZA 3URDA 4CREA 1PPGE 3SGQE 2KAIA 5GCHF 2CXVA 3V13A 4BTIB 1HRTH 2XBVA 1T8MA 3LJJA 3UREA 3UY9A 2VINA 3E3TA 2G5NA 3Q3XA 1C5LH 3QO6A 3GDVA 5ESBA 2FOGA 4DT7B 1PQAA 3O8BA 1C2GA 2ZDAH 3GYLB 4KTCA 3SHAH 1DSTA 2PUXB 2HWLB 3UOPA 1AZ8A 6CHAB 2PWXA 4Q7XA 4FXGH 1B7XB 1QA7A 4UFEH 3TJVA 3SI4H 1F5LA 3QLPH 1YPMH 3A7WA 1O2GH 3E0NB 2R0LA 1TA2A 3SGAE 1RD3B 1UMAH 2A1DB 3UTUH 5ESTE 4BTTB 1V2TT 2WPJS 2WUCA 2ZU1A 3TK5A 1GCTC 3A84A 1QQ4A 3ATLA 1PYTC 2TGTA 2XNIA 1WQSA 1XXDA 3ZZAA 1LHFH 4I33A 4F49A 4NZLA 1NROH 3BIVH 3KQDA 5DP3A 1AKSA 1MBQA 5HYOA 3DFLA 3SGBE 4AFSA 4BXSA 4D8NA 1TMUH 2ZDMA 1SBWA 2BQWB 5K0HA 2CN0H 2VVVA 2SGDE 3EE0B 3LC3A 2NU1E 3Q77A 1NRSH 1SOZA 4JZFH 2Z3CA 1TMBH 4O9VA 2FOCA 2OXSA 1HAXB 4YOJA 2SNVA 1CBWC 4GLYA 2W26A 3UIRA 2FI5E 2FOAA 1P2JA 4Z6AH 1S0QA 1UVPA 3MU4A 2FI3E 1Y3WA 1GBTA 5FHTA 1CA8B 7GCHF 1WQVH 1LKAA 2QF3A 1C5UA 1W0ZU 1ELBA 1K1JA 1XVOA 1VJ9U 3BSQA 1GJBB 4YOGA 1YPLH 4A92A 2ZI2H 2XXLA 4TPIZ 4ISIH 1IAUA 5FAHA 4ASHA 1FPHH 1TLDA 1GVKB 2ZO3H 1LVYA 2OC8A 4K1EA 2BQ6B 1C2HA 4TYDA 3RP2A 1SGNE 4RN6A 5C5OA 3M7TA 2HNTE 1P9SA 3MO3A 1O3IA 2VGCB 2A7CA 2BDIA 3GY5A 1UJ1A 2RA0A 1IQFA 4B76A 5C1UA 2A5IA 1G3BA 1SPJA 1Y5UT 8LPRA 1TX6A 1O3GA 2ZPQA 2I6QA 2BQ7B 1ETTH 1N8OC 4CR5A 3KIDU 3NKKA 4HFPB 1O5AB 3IITA 2ZHFH 1AO5A 3ATIA 5CHAB 4DY7B 1SGPE 1YPKH 1GG6B 3TNSA 3E6PH 6GCHF 3DA9B 2BDBA 4K8BA 4AGKA 2FXRA 4UFDH 2Y81A 3M5NA 4K3JA 1XUHA 2ANWA 4I31A 1WTHD 2BD4A 1F2SE 2R0KA 3C1KA 2ANYA 2F9BH 2HRVA 3D62A 3ZVGA 2YOLA 1EX3A 3AW0A 3PMHB 3D49H 2SGAA 4IC6A 2IPHA 2CV3A 1C5OH 3ZVEA 2K1QA 1EAUA 3B23B 4YLUA 3TGJE 1C2EA 1Q31A 2PGQB 5F8TA 1BBRH 1A5GH 1ELEE 1OKXA 3SV9A 3V3MA 1WCZA 6ESTA 1GMCF 2D26C 1F7ZA 1ETSH 3TITA 5L2YH 2HPQH 3VFEA 2GZ7A 4JZDH 1O30A 2G4UA 1HJ8A 3SJ9A 1NT1A 5TCCA 3S9AA 2PLXA 1SSXA 3ZZ8A 1BITA 4XBBA 1GBAA 3RXJA 2QYIA 1DUAA 2VIDA 1FXYA 3RXIA 4FU9A 2ZIQH 4Y8ZA 5LPEA 2FOHA 3LGYA 5EXMA 2HALA 4OGXA 1O2IA 1ZPBA 2IJOB 3RMLH 7GCHG 3O8DA 4JYTA 3KN2A 4IGDA 5C67A 1GMDF 1H4WA 2ESTE 1DPOA 3UQOA 3ZZBA 1W12U 3ODFA 4Y6DA 1N6XA 3GCTG 1O2YA 1MZAA 1QQUA 3BEUA 1GVZA 4K8YA 3SNAA 3UPEA 2TIOA 3LH1A 4ZUHA 1G3EA 3GDSA 1Z6JH 3VGCB 3MH5A 3BTEE 2LPRA 1UTOA 1CGJE 3LPRA 2ZU2A 1DVAH 1TNKA 3GISB 3RU4D 2A5AA 2V35A 1VR1H 2SGFE 4KTUA 2FOEA 1AUTC 1ELFA 1UHBB 5GXPA 4A1XA 1O2SA 3VB5A 3LONA 3OY6U 3H5CB 5EQQA 1CHOG 3SV7A 3E91A 4MPVA 1OWJA 1MCTA 1S85A 6GCHG 1OYTH 2ZNKH 3S0NA 1D3DB 2BD7A 3HKJB 1V2JT 1G9IE 2JETC 3TK9A 1QBOA 5DP9A 3LC5A 1EZXC 1ZR0A 4WWYA 4XE4A 1HXFH 2FDAA 1J14A 1AB9C 1YCPK 5I25A 1JRTA 1NU7B 1ZSJA 3S69A 1A0LA 1C5WB 1HAIH 1Y8TA 2TGPZ 1G3CA 2H2ZA 2SFAA 2ZGHA 1KYNA 3F9GA 1EAWA 1YPGH 4B73A 1YC0A 4JZEH 2OTVA 2AEIH 1QB9A 4YO9A 5LGOA 5EW2H 3PROA 1GMCG 1X7AC 2BDHA 2ZPSA 4FUHA 2BXTH 2HNTF 1MQ6A 1MKWK 1FY1A 1ACBE 2GD4B 1OWIA 4UFFH 3ITIA 5B6OA 4XBCA 4MNYA 2ZFTA 4ESTE 1MTVA 4IW4E 2H1UA 4DCDA 1O39A 3AAUA 1O5EH 3D23A 2G52A 3FFGA 1QB6A 4JYUH 4MVNA 1SQAA 1T7CA 2FX6A 4KKDA 1AHTH 2BXUH 4I8LA 1UTKA 2BD5A 3HPTB 2QY0B 1WBGB 2SGEE 3ENSB 1V2KT 2BDAA 2QXGA 3M36A 3PMJA 5AVDA 1GHBG 1C5MD 4DURA 1DXPA 3SI3H 3RM0H 4CH8B 1HAYB 1C4U2 1O2XA 1Y59T 2VNTA 1CA0C 1TRNA 2AIQA 2AS9A 1DLEA 2PSYA 1GMHG 3ZYDA 1OX1A 3E90B 3JZ2B 2W7SA 4H6SB 4X1PU 1GJ7B 4ZXYH 3SU0A 2BOKA 3VEQB 1GHVH 1WV7H 2QC2A 4FUJA 1CGIE 2M5TA 3QUMP 4CRFA 2ZTZA 5DP5A 1RXPA 5GIBA 4Y8XA 2O8UA 1RJXB 3U1IB 3A86A 1FQ3A 5T6GA 1MKXK 5C5NA 1GBFA 1KDQB 4DVAU 2AGGX 2FI4E 4Y7BA 5PTPA 1LQEA 3L33A 1EPTB 1O2PA 2BLVA 5FPTA 1MAXA 4NA9H 1GI4A 1AWHB 1FAKH 1SHHB 3UNSA 2P8OB 3ZZCA 1ZPCA 1UVOA 1D9IA 1TPOA 2SGQE 2GVFA 3U8OH 5DKMA 4YESB 3A81A 3U69H 1Z8GA 1YKTA 1FLEE 1UVSH 1OP0A 1YPEH 2XWAA 1C1VH 3HATH 3U8RH 2NU0E 2AIPA 1YPHC 3PLPA 3T28A 1IOEA 1K1PA 3EA9A 5C1XA 1XM1A 4OGYA 4XDEA 2VIOA 4M7GA 1DSUA 3TNTA 1A4WH 3VB4A 4HI3A 1E35B 4JK5A 3DD2H 1O2UA 1RGQA 2H9EH 3I78A 1TAWA 4GPGA 1AE5A 3E16B 2BM2A 3P92A 2D8WA 3GY3A 4CR9A 1TWXB 2AMQA 1DWBH 1T32A 2AFQB 1YGCH 1CGHA 4UEHH 3SJKA 3SUDA 4X2WA 2CMYA 1G3DA 1QURH 1J9CH 1C1QA 1M9UA 2B9LA 3GY7A 2KAIB 2G81E 1VGCC 3RXCA 1UCYE 1O38A 2QAAA 2GTBA 1ELVA 4X8UH 1HNEE 1C1OA 1ZRBA 3MFJA 3LOXA 4IN2A 4ABIA 2O8LA 2BY7X 4MTBA 7ESTE 5LPFA 1DANH 1CT2E 2XCFA 1GBBA 2BD2A 3GY6A 1TOMH 4ABEA 3M3TA 4KELA 1LPGB 3TPIZ 4A5TS 2Z3EA 4YT6H 1C2MA 1NRPH 2ZPRA 1QFKH 4FUCA 1JOUB 1QJ6B 5E2PA 1XXFA 5F8XA 2BD3A 2GX4A 1O3JA 1GI5A 1Y3UA 1SLXB 5A8XA 5LH8A 3U1JB 3GY8A 3MO9A 1O2MA 1LHGH 3RUOA 5T6FA 3STJA 3R0FA 1NM6A 2VB0A 4WH8A 1AMHA 1T31A 2ZGBH 3S7HB 3PMAB 4XFQA 1BOQA 1AKSB 1AN1E 1ESBA 3GCHC 3ZZDA 1FONA 4NIWA 1K1IA 2WPIS 1C5XB 1EKBB 1JXPA 1FAXA 1V2UT 2ZQ1A 1MQ5A 2ZHEH 3U98H 2PKAA 4TPYA 2XC4A 1MD7A 1AI8H 2ZP0H 2ZC9H 4I8JA 2PTCE 3AVZA 2XTTB 1LPKB 3SU6A 1YCPH 1CBWB 1EB1H 1EATA 1ELCA 4HGCA 1PQ8A 3UUZA 2XC0A 3MH6A 1KDQA 3S9CA 3GOVB 1SC8U 3F9HA 4WMDA 1TIOA 2BY6X 4BTUB 1FPCH 4K1SA 2OC7A 1RRKA 2CGAA 3SJOA 4ABHA 2FOBA 1CU1A 2PTNA 1S84A 3O8CA 3PMBB 3VPKA 4AOQA 3O8RA 1DX5M 2GT7A 2BY9X 2Z9LA 1O2LA 3P95A 1MKWH 3I29A 1CO7E 3RXEA 3A8AA 1TQ7B 2HLCA 5J4QA 2GP9B 3TGIE 3DT0H 2A2QH 2W5EA 5GWZA 1K28D 1OWEA 2VWOA 1W0YH 1XKBC 3LGUA 1SGIB 3LGVA 3PO1C 3ATMA 2EA3A 2P59A 1TB6H 3BG4C 1DWEH 3SUEA 4ISLA 3PB1E 1TX7A 4I8KA 1N8OB 1A0JA 2ODPA 3SUGA 4J1YA 2SGPE 2V0BA 1OWDA 2O8TA 1BRUP 4FU8A 4O3UA 4X8VH 3VXFH 1LHDH 1O3BA 3QDZB 4AB8A 5A09A 3FAOA 1V2OT 1C2FA 3M5MA 4ZKOU 5F6MA 2P94A 1VCPA 1TGBA 3QX5H 2WPKS 1SGQE 1HJAC 1ELGA 5EU8A 2Z9JA 1QJ7B 1B5GH 3U8TH 1G37A 2ZZUH 4MPXA 2Y5FA 2A4RA 2A5KA 1LPZB 3MWIU 1C1RA 2HPPH 1C5SA 2Q6GA 1H9LB 1HIAB 1QRZA 1C5PA 1HAGE 5IYTA 1QTFA 3A7VA 3SUFA 2XWBI 3SBKA 2ANMH 1GDQA 5A8YA 2G5VA 4GAWA 2G51A 2ULLA 5DPAA 2PKSC 1FN6A 1O5DH 2G00A 2AYWA 2NU4E 4GVUA 1S0RA 1SLWB 1UTMA 2C8ZB 2WUBA 5A0CA 2BHGA 2XRCA 1MKXH 4TY7A 1G30B 2Z94A 3ELAH 3TVJB 1H8IH 1YLCA 3KHVA 3NK8A 4D7FA 1BQYA 2F83A 1C5NH 1ZJKA 2Z9KA 3RMMH 4ABAA 3M3VA 1SB1H 4LK4A 1P3CA 2W3KA 2G8TA 2STBE 1O37A 3ODDA 1GJ5H 3A7XA 1ZMLA 4ABJA 3HK6B 3FZZA 2FP7B 2F9NA 3K2UA 1SI5H 2F3CE 3P8OA 2FWWA 1ETRH 3FP8E 4WMEA 1O3CA 4B71A 2UWOA 2Z3DA 2FLBH 2FTMA 1TX8A 1GJAB 1NY22 3K6YA 1T8OA 3Q3YA 4UE7H 2BY5X 1EZQA 2BOHB 2V3OH 4BAOB 1P06A 3BG8A 1FUJA 5CE1A 1BB0B 2WYJA 4OS1A 1GBHA 3MU0A 1KLTA 2ALPA 1MTNC 3ZZ7A 4ISHH 3RXFA 4B2AA 4YLQH 1MH0A 4I32A 2UWLA 2A31A 4BANB 4ABBA 1ZOMA 1F5KU 1MBMA 4H6TA 1A5IA 3UQVA 2UUKB 4Y10E 1GJ6A 2VJ1A 4DG4A 2FYRA 1RTFB 1S82A 1YYY1 3TJUA 3GCTF 3RXOA 2HNTC 2QXIA 4JZIA 2F9VA 1EUFA 1GL0E 1ZTLA 2GCTC 2JETB 2OQUA 1FZZA 2Z7FE 3TIUA 4FUBA 1AFQB 2VWMA 4E7NA 1KIGH 1OWHA 1O2TA 1GBEA 1FDPA 2CJIA 1UTJA 1LQDB 1VCQA 2H5DA 1GDNA 2ANKH 1P9UA 1ARBA 3RDZA 5HXFA 2PUQH 3GICB 2ZHDA 2FOFA 1NPMA 1XUIA 5K7RA 1D4PB 1CHOF 5JBCS 1O3FA 3H7TA 3NPSA 3WY8A 4X6OA 5F03A 4D7GA 3BEFB 2P3FH 2THFB 4WJG2 1MUEB 1WAYB 3KQBA 3BTKE 2B0FA 1PPFE 4UD9H 4NCYA 2BTCE 1BDAA 1G32B 1HIAA 2GZ9A 4K2YA 1VITG 2BZAA 2ZU5A 1SFQB 2TRMA 4DIHH 2GZ8A 3EAJA 2A32A 3LIWA 5FBEA 2FODA 1P02A 5JDUB 5GPIB 4NIVA 1TPAE 3QTOH 3QK1A 2EC9H 5TCAA 4CH2B 2OBOA 1FV9A 1L2EA 1BT7A 3OU0A 2D1JA 1DE7H 4RSPA 2BDCA 1UTPA 2ZDNA 2ZF0H 8ESTE 4ZH8A 1QL9A 1NRRH 4SGAE 3P8FA 3MU1A 1FY5A 3P8NA 3A88A 2ZU3A 3SNBA 1RIWB 5DP8A 1G2LA 3KL6A 1F5RA 1OSSA 3P8GA 4K60A 4TWYA 4A1TA 1K1LA 1P05A 5IDKA 5TJXA 4NSVA 1GHBF 3GY4A 1C1SA 4VGCB 1TALA 3ZZ5A 3AAVA 1ZMJA 1W7XH 4U32A 3ZZ3A 3RXSA 5A8ZA 1SGFA 1J16A 1LMWB 3A82A 5C2ZA 5E0HA 4O97A 1AD8H 1YF4A 3ZVFA 3AW1A 2C4FH 3SNCA 1GMHF 3RXRA 1W8BH 2QIQA 3ZVBA 3VB6A 1Q3XA 1HGTH 1AUJA 1C4Y2 1QR3E 1MTSA 1SGYE 1NN6A 1S6FA 4OS7A 3Q3KA 3CENA 1EJNA 2J4IA 1EOLA 1TGSZ 1ZSKA 5HMAA 1FY8E 3SOSA 3EQ0H 1P2MA 2IN2A 4OS4A 3Q00A 1DOJA 3B8JA 2C8YB 1O5BB 1KSNA 3N7OA 3SU5A 1TABE 2ZHWH 2O9QA 5DP4A 1G2MA 2CHAB 2ZDLA 2Q6DA 4QT8C 4MNVA 1BMMH 4D76A 4CRAA 3FANA 4AFQA 1UVTH 2BVRH 2QV1A 1GBDA 3TJNA 1SQOA 1BTUA 1K1MA 3SW2B 1RFNA 3F1SB 1GVLA 1AE8H 3TLOA 4Q7ZA 3TU7H 1A3EH 2VGCC 1TBQH 1B0EA 3RXHA 4BAMB 2H9TH 4LXBH 1BRBE 3QN7A 1UVUH 4YT7H 2FO9A 3MH4A 2Y7ZA 1TE0A 1TNGA 1TBZH 2J9NA 5EW1H 1AY6H 3M5OA 1O5GH 1NU9A 5CHAC 1P3EA 3GYMA 1V2RT 5JBBS 1HUTH 5E8EH 5EPYA 3HK3B 2AGIX 4FUGA 4X6NA 2FLRH 3V12A 2OUAA 5C3NA 3LH3A 1QL8A 1ZHRA 8KME2 1J8AA 2Y80A 4A7IB 2OBQA 2J95A 3SV6A 1F92A 1Z6EA 1ZZZA 2CF8H 4X6PA 4LZ4B 2C90B 4Y71A 3TK6A 2FESH 1UCYK 2R3UA 1ZSLA 2OQ5A 2UWPA 5T6DA 5GDSH 4U30A 2QCYA 1E37B 5E0JA 1C2JA 1EAIA 4H4FA 3M7QA 2VH0A 3BTME 4O3TA 2C8WB 1C1UH 3RC5A 5AFYH 1QRXA 2PKAB 4X1RU 2BDGA 1D3QB 5C1YA 1HAOH 2Z9IA 1GJDB 2AMPA 1TNJA 2WPMS 1GI3A 1TGTA 4CBOA 4X6MA 1KTSB 3URCA 1P11E 2GMTB 1CQQA 2P93A 1O3PB 1BZXE 1VJAU 3MI4A 2WV5A 1A46H 4RKOB 2GGVB 3RC6A 3OSYA 3SHCH 1V2MT 5T3HA 2DE8A 2Y7XA 1A2CH 1L1GA 1T8NA 4X1SU 1IQNA 4Y8YA 1P57B 4Y76A 2XW9A 4AZ2B 2C93B 1CVWH 5JYIA 2VVCA 1O34A 1AU8A 1SR5C 1Z8RA 1DXWA 3CS0A 4FUFA 5EQSA 1N1LA 3SU4A 1V3XA 3PO1B 1EB2A 1ARCA 2DUCA 4MNXA 3BG4B 1H9IE 1KXFA 3RXBA 2FZZA 4ABGA 1GBJA 1TBRH 5EPNA 3RXUA 3RMOH 1S5SA 2BLOA 2B8OH 3EGKH 1HAPH 4Q80A 3F9FA 3PWCA 1T8LA 4NG9H 5A0AE 5DGJA 3M37A 2JH5D 1LCYA 1THSH 4WMFA 2FX4A 1OYQA 3VB7A 1ANDA 4CRGA 2BX3A 2B5TB 4AFUA 4JK6A 1HLTH 1KXAA 1GGDB 1LVMA 3BIUH 1FMGA 2ZECA 3G01A 2ODQA 3ATWA 1ESTA 1TA6A 1ID5H 4INHA 5ABWA 3A8CA 2R2WU 4UONA 4BXWA 2GT8A 1A1RA 4HZHA 1DT2A 1O2NA 5GJ4B 3A87A 1MMJN 4ZXXH 3EA8A 3LU9B 4Z0KA 2A45B 1A61H 4BAHB 3NWUA 1WSSH 2A7HA 1L1NA 2Q1JA 1UK2A 4D9QA 3OYPA 3K65B 4X2YA 1J17T 1C1TA 4TWWA 5E2OA 1O3NA 2ILNA 4OS5A 4NFFA 3W94A 2AGEX 1L1JA 3QZRA 3RU4T 5CMXH 3PV4A 1GCTB 1AFEH 1GI1A 1HDTH 2RG3A 4XSKU 5EGMA 1JIRA 1CT4E 1TRYA 1HJ9A 3BTTE 1QRWA 1BTPA 4DGJA 3T5FH 2VU8E 1E36B 4E05H 4X1NU 1QB1A 2BMGB 3SNDA 1P04A 5FX6A 2GDEH 4U2WA 2ZU4A 1C5YB 3F6UH 1A5HA 1DY9A 3DFJA 2FEQH 2QGRA 5E0GA 4AORA 1GBKA 1O3HA 2FM2A 1UK4A 1DY8A 2NU2E 4I8HA 1GI7B 3RXMA 1FNIA 1IQJA 1ZGVA 9ESTA 3A80A 2Y82A 3A85A 3RMNH 1IHTH 3T62A 1AZZA 1SMFE 3MU5A 2JKHA 1BMLA 1A0HB 1SGCA 4FVBA 3UR9A 1N6YA 2P3UB 3TJOA 1HBTH 1W3CA 3B9FH 1O0DH 1T4VH 1BRAA 1E34B 1FJSA 2XCNA 1L4ZA 2A7JA 4NSYA 1SLVB 1EJMA 2ZFQH 3PTBA 2A4OA 1SGFG 4WH6A 3P6ZB 3MYWA 1TYNA 1IQHA 1F0TA 2R2MB 4DJZB 1QJ1B 3BN9A 4MDSA 3BEIB 3FVFB 3SJIA 1EPTC 2FMJA 4WXIA 2OC1A 4DW2U 3KQEA 1OWKA 1P2NA 5HM2A 1O2HA 2VH6A 2ZEBA 1QHRB 2NU3E 3M3SA 3MO6A 2XBWA 1TNLA 3MU8A 4AYYB 3P70B 1NC6A 4I8GA 2GCHF 1SQTA 2BLWA 3S7KB 2GKVE 4R8TB 1LHCH 1KTTB 3UFAA 1EAXA 1BMNH 1UCYH 1ZGIA 4Y79A 2Z9GA 2GV7A 1ZTKA 2ZDKA 1O33A 5EXNA 3S9BA 5ETXA 2WV4A 2Z6BD 3T25A 3ZV8A 3ESTA 4BAKB 3P17H 3QZQA 1BTXA 3EYDA 2F9PA 2ZFPH 3ZVCA 4THNH 2BZ6H 1LKBA 1GJ8B 2F91A 2PV9B 2G4TA 2V6NA 1BCUH 2C3SA 3RXQA 1O3KA 2G55A 1GI6A 2H5CA 1EXFA 2XC5A 2PW8H 1MU8B 5EXLA 5FCRA 3M5LA 3STIA 8GCHF 1DLKB 1LDTT 4RKJB 1C1MA 1TQ0B 3BTFE 3JZ1B 4AYVB 6LPRA 3BTGE 1L4DA 1SGEE 2FOMB 3FZDA 2V3HH 1VCWA 3PWBA 1C5RA 4NA7A 1P03A 2Q6FA 2XBYA 1VITF 3RC4A 1RS0A 1C9PA 1O2KA 1GHXH 1GHZA 3BF6H 1NO9H 1C4V2 4KP0A 4OS6A 3T29A 5L2ZH 2HVXA 1PPZA 5H4IB 2BD8A 1UK3A 2J92A 1MD8A 2W3IA 4KTSA 3MNBA 4FU7A 3GDUA 4INLA 1AQ7A 1F0RA 3KCGH 1BIOA 1GBMA 1MTWA 2PSXA 1BBRE 1O2VA 1WUNH 2FS8A 1CT0E 1W11U 1DM4B 1LVOA 3QGNB 1IQMA 2VIWA 2TBSA 3VB3A 1HAVA 1TNHA 4MG3A 4X8TH 1H8DH 5A2MH 2ZGJA 2FS9A 4BNRA 4GHQA 1NFUA 1Z1JA 2TGAA 4K1TA 3V7TA 3A7TA 3SJ8A 3ZYEA 4XBDA 4CHAC 5G4BA 5HGGA 4JCNA 4WY3A 1L0ZA 2ALVA 2EEKA 2WPLS 1UTQA 2BVSH 4J2YB 1DITH 1O3OA 3QWCH 2GDDA 2QA9E 2BD9A 1GI2A 1FI8A 1H9HE 3SV2H 1AWFH 1XMNB 3EA7A 1TMTH 2GCHG 3ZVAA 4X2XA 4YM9A 1PJPA 3RXKA 4ISNA 3LDXH 1P2QA 3RXGA 1KXCA 3KQCA 1DFPA 1GI8B 1AVGH 2J2UA 5AFZH 1C5QA 5AF9H 1TNIA 3M61U 3AASA 2ZQ2A 3BTHE 3F68H 1DWCH 1EP6A 3ZZ4A 1AB9B 3E8LA 2H6MA 3A7YA 5JBTA 5FPYA 1IHSH 1G36A 1A7SA 4NIYA 4IMQA 3SO3A 1ZJDA 1THRH 1ORFA 3D65E 1Y3VA 1NFYA 2XYAA 3A8BA 3K9XB 1W10U 1OXGA 3OTJE 1C2KA 8GCHG 2LNCA 3KNXA 1O3DA 1YPJH 4Y7AA 4AB9A 5I46H 1SOTA 1O36A 5GCHG 1BHXB 4CRCA 1SLUB 2ZHQH 3TH3H 1FY4A 2RDLA 1YCPM 3A83A 3CP7A 1ZTJA 2F9UA 1W7GH 3QGJA 1GBLA 2CF9H 1U6QA 1GDUA 1JMOH 1QNJA 2ZKSA 3EDXB 2ZCLP 3SN8A 3RM2H 1KXBA 1DDJA 4GSOA 1K2I1 1Z8JB 1ZRKA 3NUMA 4AFZA 1HAZB 1CA0B 4CRDA 1EOJA 2RCEA 5LPRA 4ABFA 3C27B 1Z8IB 2IOTA 1O2JA 1QIXB 4OS2A 2AMDA 3T26A 1KXEA 1EZSC 3UNQA 1W14U 1E0FD 1XUJA 1PPEE 2ZFFH 1YBWA 1FN8A 1GCDA 4WF8A 1QGFA 6CHAC 1ELDE 1XUGA 1O31A 1QA0A 3ZZ6A 1CE5A 3MNXA 4AGJA 4ZROA 1BTHH 1O2WA 3MNCA 1Y5AT 4BOHA 2ZGXH 3LGWA 1O2RA 4LOYH 4GCHF 2OD3B 4MQAA 1P10A 1SFIA 1IQKA 9LPRA 4NA8A 3SU2A 1CHGA 7LPRA 2Y6TA 3KEEA 1LHEH 1GHYH 3DHKH 3SU3A 3TH4H 3SQEE 2D2DA 2ZTXA 4B75A 7KMEH 2P95A 1ZYOA 3LT3A 1QBVH 2HOBA 3UOUA 4X0WU 1RTKA 2PR3A 3SZNA 3LJOA 1WYKA 4IMZA 4U01A 2BVXH 1MZDA 1JIMA 1PQ5A 1UTNA 4ZKRU 3PTNA 1EZUC 1SVPA 4YTAA 1DUEA 1O32A 2A0QB 3I77A 3UWIA 1GPZA 1O3LA 3UWJH 1JBUH 1K9OE 1YLDA 4IBLH 1C2LA 3H7OA 1J15A 1PFXC 2R9PA 5EOKA 1SGRE 3F9EA 1LO6A 3OX7U 3ZZ9A 1YP9A 2O8WA 3SORA 1P0SH 3RXAA 1O35A 3K6ZA 2WINI 2OCVB 4MNWA 3SQHE 1MAYA 2PFEA 4JZ1A 1HYLA 4MPWA 4Q7YA 5BPEA 1PPHE 4AN7A 1HFDA 1AFQC 1KY9A 2J94A 1TGCA 1EQ9A 1S81A 3M35A 1KXDA 1VGCB 1NRNH 1TFXA 1O3EA 2ZFSA 1WTGH 1K21H 1EP5A 4MPUA 4I7YH 1A3BH 2R3YA 5EODA 1NESE 1D3TB 4WVPE 1PQ7A 2QXJA 4B1TA 2JH6D 4UFGH 2ODYB 3LKWA 3BTDE 4JMYA 1F0UA 1P09A 1XUKA 1V6DA 1GG6C 3QTVH 5A0BA 1GJ9B 4UDWH 2O8MA 1NTPA 4AG1A 2DE9A 2EI6A 3RXVA 4B2BA 2JH0D 2GV6A 3R3GB 5DP6A 1Y5BT 2SNWA 2VIPA 2BB4A 1TOCB 1XX9A 3RXPA 4GCHG 4R0IA 2UUYA 3LGIA 1B0FA 4ZAEA 4D9RA 2C8XB 3DUXH 1GBIA 1HPGA 4INKA 4LZ1H 2BX4A 1O2OA 1BMAA 1T4UH 4BAQB 1HCGA 1C9TA 3GCHB 1JWTA 2ZG0H 1NFWA 3MOCA 1ANBA 1GMDG 4B2CA 1P01A 1Q2WA 1SL3A 4IN1A 1C5ZB 2VVUA 1AVXA 3MH7A 1AIXH 1BJUA 2TPIZ 5DO4H 1IQGA 1TPPA 1GHAF 5J4SA 2YNBA 1RIWC 3OY5U 2H9HA 4GHTA 3E0PB 1NFXA 1QBNA 2EI8A 1HV7A 4MLFB 3L6PA 1FY3A 4WXVA 1BA8B 1NS3A 2BY8X 4VGCC 3ZVDA 1ABJH 3W95A 3GCOA 5JB8S 4TY6A 1C5TA 2RA3A 1DWDH 5L6NH 1GI9B 1K22H 1ZHMA 3U9AH 3RXTA 2PGBB 3T27A 1LTOA 1GHWH 1IQEA 1O2ZA 4K69A 4SGBE 1WU1A 1KLJH 3V0XA 1BTWA 5FCKA 1GBCA 1ELTA 1ZPZA 2ASUB 3VGCC 2P3TB 3UR6A 2Y5GA 1MTUA 1V2ST 4HTCH 3LGTA 4NGAH 1MU6B 1P8VC 2OC0A 3HKIB 1JRSA 2ZCHP 5C20A 1UHBA 3E1XB 4B74A 1OOKB 2YNAA 3KF2A 2BLQA 1D6WA 1RTLA 3IG6B 5FBIA 3IWMA 1INCA 5FX5A 5EQRA 1GI0A 5FPSA 1YPHE 1HAHH 5FXLA 1HJAB 4A1VA 1V2WT 2CHAC 5JB9S 5DG6A 4ZHLU 2VIVA 2W7UA 1VZQH 1O3AA 1OP8A 3GCNA 3M7UA 4E06H 4PROA 5L30H 1W13U 1P2KA 1ELAA 5F8ZA 2A2XH 1D6RA 1K1OA 2J38A 2QXHA 1THPB 1PYTD 2J34A 2ZA5A 2PKSB 1P2OA 3PLBA 1HB0B 4DIIH 2ZTYA 1O5FH 4NWLA 3BTQE 5DP7A 3ATKA 1QL7A 3RU4E 1KLIH 2OINA 1UTLM 5AHGH 1OP2A 5EG4A 1V2QT 4ZHMU 3KGPA 2ZWLH 3RXLA 2VWLA 3TH2H 5DK1A 1ZMNA 4FUEA 2BYAX 1Z1IA 1GHAG 2ZCKP 2HGTH 1DS2E 1H1BA 1ZLRA 4FVDA 1SGDE 1IQIA 4NZQA 3MNSA 1C1WH 2A4QA 4H42U 2NWNA 5HM9A 4ISOA 2FTLE 4CBNA 1XKAC 2ZFRH 4KGAA 2AERH 4CRBA 1C2IA 1O3MA 1TONA 2UUJB 4ZMAH 2FPZA 2QN5T 2FYQA 1TPSA 2F9OA 1MCVA 1ZHPA 1SHYA 1P2IA 5BRRE 1BHXF 1CSOE 1HAVB 5DJ7A 2STAE 1C1NA 2TGDA 1YM0A 1C2DA 3TGKE 4CHAB 4Q2KA 1MTNB 2ZGCA 1LVBA 1TRMA 4X1QU 4X2VA 5JPMH 4AG2A 2WYGA 3PM3A 3SU1A 2AH4X 4NFEA 1SG8B 3L3TA 2P16A 2QF0A 3MHWU 4Y0ZE 3A7ZA 1P12E 1BBRK 2UUFB 1FIWA 1V2NT 3T2NA 2GMTC 1S83A 4IS5A 4YZUA 2ZDVH 2OLGA 2GCTB 3Q76A 3VXEH 1HXEH 1UO6A 1EPTA 3BV9B 3CS7A 1ABIH 1QCPA 1C5VA 1OPHB 1Z71A 3A8DA 2B7DH 4DOQA 4FUIA 1GJ4H 1TGNA 2P8OC 4NIXA 2PHBA 1DICA 3MTYA 1V2LT 3MMGA 1NRQH 1BTYA 1S6HA 2I6SA 2VWNA 4IC5A 1BJVA 1GJCB 4Y0YE 1O5CB 3RLYH 4ZKNU 1AGJA 1K1NA 1QY6A 4F4OC 3UNRA 4Y11E 4XOJA 2EI7A 1VITH 3PLKA 1OS8A 1E38B 4ABDA 3HGNA 3FP7E 1IQLA 1WOFA 1SGTA 2VIQA 3PYHA 4ZKSU 1ESAA 1NZQH 5SGAE 1GWAA 1W2KH 1XUFA 3SNEA 1XVMA 1F0SA 2WPHS 3BTWE 5JBAS 1C1PA 3ZV9A 1Y3YA 4O03A 2BDYA 3NZIA 1BUIA 3HGPA 1EASA 1O2QA 1AVWA 3A89A 3NXPA 3SV8A 4YOIA 2Y5HA 1BRCE 2FIRH 1Z7KA 4X8SH 4FUDA 4A6LA 4NWKA 1ANEA 1PPBH 4GUXA 1Y3XA 4JYVH 1ANCA 3GY2A 3FP6E 1PPCE 3NCLA 1BTZA 1FIZA 1GL1A 3RXDA 1GGDC 2XBXA 4E7RG 3RLWH 4AX9H 2OP9A 1EJAA 2A4GA
chains in the Genus database with same CATH superfamily
1D3PB 1V2PT 2WPDD 4ZHAA 1KMHB 1V2VT 4K5ZA 3URDA 1PPGE 3SGQE 4CREA 2KAIA 5GCHF 2CXVA 3V13A 4BTIB 1HRTH 2XBVA 1T8MA 3LJJA 3UREA 3UY9A 2VINA 3E3TA 2G5NA 3Q3XA 1C5LH 3QO6A 3GDVA 5ESBA 2FOGA 4DT7B 1PQAA 3O8BA 1C2GA 2ZDAH 3GYLB 4KTCA 3SHAH 4F48B 1DSTA 2PUXB 2HWLB 3UOPA 1AZ8A 6CHAB 2PWXA 4Q7XA 4FXGH 1B7XB 1QA7A 4UFEH 3TJVA 3SI4H 1F5LA 3QLPH 1YPMH 3A7WA 1O2GH 3E0NB 2R0LA 1TA2A 3SGAE 1RD3B 1UMAH 2A1DB 3UTUH 2QE7D 5ESTE 4BTTB 1V2TT 2WPJS 2WUCA 2HLDD 2ZU1A 3TK5A 1GCTC 3A84A 1QQ4A 3ATLA 1PYTC 2TGTA 2XNIA 1WQSA 1XXDA 3ZZAA 1LHFH 4I33A 4F49A 4NZLA 1NROH 3BIVH 3KQDA 5DP3A 3MQKC 1AKSA 1MBQA 5HYOA 3DFLA 3SGBE 4AFSA 4BXSA 4D8NA 1TMUH 2ZDMA 1SBWA 2BQWB 5K0HA 2CN0H 2VVVA 2SGDE 3EE0B 3LC3A 2NU1E 3Q77A 1NRSH 1SOZA 4JZFH 2Z3CA 1TMBH 4O9VA 2FOCA 2OXSA 1HAXB 4YOJA 2SNVA 1CBWC 3OTPA 4GLYA 2W26A 3UIRA 2FI5E 2FOAA 1P2JA 3F0PA 4Z6AH 1S0QA 1UVPA 3MU4A 2FI3E 1Y3WA 1GBTA 5FHTA 1CA8B 7GCHF 1WQVH 1LKAA 2QF3A 1C5UA 1W0ZU 1ELBA 1K1JA 1XVOA 1VJ9U 3BSQA 1GJBB 4YOGA 1YPLH 4A92A 2ZI2H 2XXLA 4TPIZ 4ISIH 1IAUA 5FAHA 4ASHA 1FPHH 1TLDA 1GVKB 2ZO3H 1LVYA 2OC8A 4K1EA 2BQ6B 5HIYA 1C2HA 4TYDA 3RP2A 1SGNE 4RN6A 5C5OA 3M7TA 2HNTE 1P9SA 3MO3A 1O3IA 2VGCB 2A7CA 2BDIA 3GY5A 1UJ1A 2RA0A 1IQFA 4B76A 3OAAD 5C1UA 2A5IA 2KX4A 1G3BA 1SPJA 1Y5UT 8LPRA 1TX6A 1O3GA 2ZPQA 2I6QA 2BQ7B 1ETTH 1N8OC 4CR5A 3KIDU 3NKKA 4HFPB 1O5AB 3IITA 2ZHFH 1AO5A 3ATIA 5CHAB 4DY7B 1SGPE 1YPKH 1GG6B 3TNSA 3E6PH 6GCHF 3DA9B 2BDBA 4K8BA 4AGKA 2FXRA 4UFDH 2Y81A 3M5NA 4K3JA 1XUHA 2ANWA 4I31A 1WTHD 2BD4A 1F2SE 2R0KA 3C1KA 2ANYA 2F9BH 2HRVA 3D62A 3ZVGA 2YOLA 1EX3A 3AW0A 3PMHB 3D49H 2SGAA 4IC6A 2IPHA 2CV3A 1C5OH 3ZVEA 2K1QA 1EAUA 3B23B 4YLUA 3TGJE 1C2EA 1Q31A 2PGQB 5F8TA 1BBRH 1A5GH 4RT1A 1ELEE 1OKXA 3SV9A 3V3MA 1WCZA 6ESTA 1GMCF 2D26C 1F7ZA 1ETSH 3TITA 5L2YH 2HPQH 3VFEA 2GZ7A 4JZDH 4OM9A 1O30A 5CHBA 2G4UA 3NRLA 1HJ8A 3SJ9A 1NT1A 5TCCA 3S9AA 2PLXA 1SSXA 3ZZ8A 1BITA 4XBBA 1GBAA 3RXJA 2QYIA 1DUAA 2VIDA 1FXYA 3RXIA 4FU9A 2ZIQH 4Y8ZA 5LPEA 2FOHA 3LGYA 5EXMA 2HALA 4OGXA 1O2IA 1ZPBA 2IJOB 3RMLH 7GCHG 3O8DA 4JYTA 3KN2A 4IGDA 5C67A 1GMDF 1H4WA 2ESTE 1DPOA 3UQOA 3FO8D 1W12U 3ODFA 3ZZBA 2KCPA 4Y6DA 1N6XA 3GCTG 1O2YA 1MZAA 1QQUA 3BEUA 1GVZA 4K8YA 3SYJA 3SNAA 3UPEA 2TIOA 3LH1A 4ZUHA 1G3EA 3GDSA 1Z6JH 3VGCB 3MH5A 3BTEE 2LPRA 3SZEA 1UTOA 1CGJE 3LPRA 2ZU2A 1DVAH 4YXWD 1TNKA 3GISB 3RU4D 2A5AA 2V35A 1VR1H 2SGFE 4KTUA 2FOEA 1AUTC 1ELFA 1UHBB 5GXPA 4A1XA 1O2SA 3VB5A 3LONA 3OY6U 3H5CB 5EQQA 1CHOG 3SV7A 3E91A 4MPVA 1OWJA 1MCTA 1S85A 6GCHG 3OE7D 1OYTH 2ZNKH 3S0NA 1D3DB 2BD7A 3HKJB 1V2JT 1G9IE 2JETC 3TK9A 1QBOA 5DP9A 3LC5A 1EZXC 1ZR0A 5EJLA 4WWYA 4XE4A 1HXFH 2FDAA 1J14A 1AB9C 1YCPK 4RT0A 5I25A 1JRTA 1NU7B 4Q4LA 1ZSJA 3S69A 1A0LA 1C5WB 1HAIH 1Y8TA 3N99A 2TGPZ 1G3CA 2H2ZA 2SFAA 2ZGHA 1KYNA 3F9GA 3EE7A 1EAWA 1YPGH 4B73A 1YC0A 4JZEH 2OTVA 2AEIH 3OFND 1QB9A 4YO9A 5LGOA 3UAIC 5EW2H 3PROA 1GMCG 1X7AC 2BDHA 2ZPSA 4FUHA 2BXTH 2HNTF 1MQ6A 1MKWK 1FY1A 1ACBE 2GD4B 1OWIA 4UFFH 3ITIA 5B6OA 4XBCA 4MNYA 2ZFTA 4ESTE 1MTVA 4IW4E 2H1UA 4DCDA 1O39A 3AAUA 1O5EH 3D23A 2G52A 3FFGA 1QB6A 4JYUH 4MVNA 1SQAA 1T7CA 2FX6A 4KKDA 1AHTH 2BXUH 4I8LA 1UTKA 2BD5A 3HPTB 2QY0B 1WBGB 2SGEE 3ENSB 1V2KT 2BDAA 2QXGA 3M36A 3PMJA 5AVDA 1GHBG 1C5MD 4DURA 1DXPA 3SI3H 3RM0H 4CH8B 3CNRA 1HAYB 1C4U2 1O2XA 1Y59T 2VNTA 1CA0C 1TRNA 2AIQA 2AS9A 1DLEA 2PSYA 1GMHG 3ZYDA 1OX1A 3E90B 3JZ2B 2W7SA 4H6SB 4X1PU 1GJ7B 4ZXYH 2RFKC 3SU0A 2BOKA 3VEQB 1GHVH 1WV7H 2QC2A 4FUJA 1CGIE 2M5TA 3QUMP 4CRFA 4TSFD 2ZTZA 5DP5A 1RXPA 5GIBA 4Y8XA 2O8UA 1RJXB 3KYGA 3U1IB 3A86A 1FQ3A 5T6GA 1MKXK 5C5NA 1GBFA 1KDQB 4DVAU 2AGGX 2FI4E 4Y7BA 5PTPA 1LQEA 1MABB 5KGOA 3L33A 1EPTB 1O2PA 2BLVA 5FPTA 1MAXA 4NA9H 1GI4A 1AWHB 1FAKH 1SHHB 3UNSA 2P8OB 3ZZCA 1ZPCA 1UVOA 1D9IA 1TPOA 2SGQE 2GVFA 3AK5A 3U8OH 5DKMA 4YESB 3GS9A 3A81A 3U69H 1Z8GA 1YKTA 1FLEE 1UVSH 1OP0A 1YPEH 2XWAA 1C1VH 3HATH 3U8RH 1YLNA 2NU0E 2AIPA 1YPHC 2KCAA 3PLPA 3T28A 1IOEA 1K1PA 3EA9A 5C1XA 1XM1A 4OGYA 4XDEA 2VIOA 4M7GA 1DSUA 3TNTA 1A4WH 2YMSD 3VB4A 4HI3A 1E35B 4JK5A 3DD2H 1O2UA 1RGQA 2H9EH 3I78A 1TAWA 4GPGA 1AE5A 3E16B 2BM2A 3P92A 2D8WA 3GY3A 4CR9A 1TWXB 2AMQA 1DWBH 1T32A 2AFQB 1YGCH 1CGHA 4UEHH 3SJKA 2XNDD 3SUDA 4X2WA 2CMYA 1G3DA 1QURH 1J9CH 1C1QA 1M9UA 2B9LA 3GY7A 2KAIB 2G81E 4FOUC 1VGCC 3RXCA 1UCYE 1O38A 2QAAA 2GTBA 1ELVA 4X8UH 1HNEE 1C1OA 1ZRBA 3MFJA 3LOXA 4IN2A 4ABIA 2O8LA 2BY7X 4MTBA 7ESTE 5LPFA 1DANH 1CT2E 2XCFA 1GBBA 2BD2A 2J97A 3GY6A 1TOMH 4ABEA 3M3TA 4KELA 1LPGB 3TPIZ 4A5TS 1QZ8A 2Z3EA 4YT6H 1C2MA 1NRPH 2ZPRA 1QFKH 5CDFE 4FUCA 1JOUB 1QJ6B 5E2PA 1XXFA 5F8XA 2BD3A 2GX4A 1O3JA 1GI5A 1Y3UA 1SLXB 5A8XA 5LH8A 3U1JB 3GY8A 3MO9A 4P02A 1O2MA 2W6ID 1LHGH 3RUOA 5T6FA 3STJA 2KFWA 3R0FA 1NM6A 2VB0A 1E1RD 4WH8A 1AMHA 1T31A 2ZGBH 3S7HB 3PMAB 4XFQA 1BOQA 1AKSB 1AN1E 5EJZA 1ESBA 3GCHC 3ZZDA 1FONA 4NIWA 1K1IA 2WPIS 1C5XB 1EKBB 1COWD 1JXPA 1FAXA 1V2UT 2ZQ1A 1MQ5A 2ZHEH 3U98H 2PKAA 4TPYA 2XC4A 1MD7A 1AI8H 2ZP0H 2ZC9H 4I8JA 2OK5A 2PTCE 3AVZA 2XTTB 1LPKB 3SU6A 1YCPH 1CBWB 1EB1H 1EATA 1ELCA 4HGCA 3F2GA 1PQ8A 3UUZA 2XC0A 2J98A 1KDQA 3MH6A 3S9CA 3GOVB 1SC8U 3F9HA 4WMDA 1TIOA 2BY6X 4BTUB 1FPCH 4K1SA 2OC7A 1RRKA 2CGAA 3SJOA 4ABHA 2FOBA 1CU1A 2PTNA 1S84A 3O8CA 3PMBB 3VPKA 4AOQA 3O8RA 1DX5M 2GT7A 2BY9X 2GJGA 2Z9LA 1O2LA 3P95A 1MKWH 3I29A 1CO7E 3RXEA 3A8AA 1TQ7B 2HLCA 5C0UA 5J4QA 2GP9B 3TGIE 3DT0H 2A2QH 2W5EA 5GWZA 1K28D 1OWEA 2VWOA 1W0YH 1XKBC 3LGUA 1SGIB 3LGVA 3PO1C 3ATMA 2EA3A 5T1VA 2P59A 1TB6H 3BG4C 1DWEH 3SUEA 4ISLA 3PB1E 1TX7A 4I8KA 1N8OB 1A0JA 2ODPA 3SUGA 4J1YA 2SGPE 2V0BA 1OWDA 2O8TA 1BRUP 4FU8A 4O3UA 4X8VH 3VXFH 1LHDH 1O3BA 3QDZB 4AB8A 5A09A 3FAOA 1V2OT 1C2FA 3M5MA 4ZKOU 5F6MA 2P94A 1VCPA 1TGBA 2KR7A 2WPKS 3QX5H 1SGQE 1HJAC 1ELGA 5EU8A 2Z9JA 1QJ7B 1B5GH 3U8TH 1G37A 2ZZUH 4MPXA 2Y5FA 4RI0A 2A4RA 2A5KA 1LPZB 3MWIU 1C1RA 2HPPH 2EY4C 1C5SA 2Q6GA 1H9LB 1HIAB 1QRZA 1C5PA 1HAGE 5IYTA 1QTFA 3A7VA 3SUFA 2XWBI 3SBKA 2ANMH 1GDQA 5A8YA 2G5VA 4GAWA 2G51A 2ULLA 5DPAA 2PKSC 1FN6A 1O5DH 2G00A 2AYWA 2NU4E 4GVUA 1S0RA 1SLWB 1UTMA 2C8ZB 2WUBA 5A0CA 2BHGA 2XRCA 1MKXH 4TY7A 1OHHD 1G30B 2Z94A 3ELAH 3TVJB 1H8IH 1YLCA 3KHVA 3NK8A 4D7FA 1BQYA 2F83A 1C5NH 1ZJKA 2Z9KA 3RMMH 4ABAA 3M3VA 1SB1H 4LK4A 1P3CA 4Q63A 2W3KA 2G8TA 5DSFA 2STBE 1O37A 3ODDA 1GJ5H 3A7XA 1ZMLA 4ABJA 3HK6B 3FZZA 2FP7B 2F9NA 3K2UA 1SI5H 2F3CE 3P8OA 2FWWA 1ETRH 3FP8E 4WMEA 1O3CA 4B71A 2UWOA 2Z3DA 2FLBH 2FTMA 1TX8A 1GJAB 1NY22 3K6YA 1T8OA 3Q3YA 4UE7H 2BY5X 1EZQA 2BOHB 2V3OH 4BAOB 1P06A 3BG8A 1FUJA 5CE1A 2LP6A 1BB0B 2WYJA 4OS1A 3WW7A 1GBHA 3MU0A 1KLTA 2ALPA 1MTNC 3ZZ7A 4ISHH 3RXFA 2HVYB 4B2AA 4YLQH 1MH0A 4I32A 2UWLA 3F2HA 2A31A 4BANB 4ABBA 1ZOMA 1F5KU 1MBMA 4H6TA 1A5IA 3DCLA 3UQVA 2UUKB 4Y10E 1GJ6A 2VJ1A 4DG4A 2FYRA 1RTFB 1S82A 1YYY1 3TJUA 3GCTF 3RXOA 2HNTC 2QXIA 4JZIA 2F9VA 1EUFA 1GL0E 1ZTLA 2GCTC 2JETB 2OQUA 1FZZA 2Z7FE 3TIUA 4FUBA 1AFQB 2VWMA 4E7NA 1KIGH 1OWHA 1O2TA 1GBEA 1FDPA 2CJIA 1UTJA 1LQDB 1VCQA 2H5DA 1GDNA 2ANKH 1P9UA 3KQ5A 1ARBA 2KCOA 3RDZA 5HXFA 2PUQH 3GICB 2ZHDA 2FOFA 1NPMA 1XUIA 5K7RA 1D4PB 1CHOF 5JBCS 1O3FA 3F3BA 3H7TA 3NPSA 3WY8A 4X6OA 1SKYE 5F03A 4D7GA 3BEFB 1W0KD 2P3FH 2THFB 4WJG2 1MUEB 1WAYB 3KQBA 3BTKE 5IK2D 2M2AA 2B0FA 1PPFE 4UD9H 4NCYA 2BTCE 1BDAA 1G32B 1YY3A 1HIAA 2GZ9A 4K2YA 1VITG 2BZAA 2ZU5A 1SFQB 2TRMA 4DIHH 1WXRA 2GZ8A 3EAJA 2A32A 3LIWA 5FBEA 2FODA 1P02A 5JDUB 5GPIB 4NIVA 1TPAE 3QTOH 3QK1A 2EC9H 5TCAA 4CH2B 2OBOA 1FV9A 1L2EA 1BT7A 3OU0A 2D1JA 1DE7H 4RSPA 2BDCA 1UTPA 2ZDNA 2ZF0H 8ESTE 4ZH8A 1QL9A 1NRRH 4SGAE 3P8FA 3MU1A 1FY5A 2QF4A 3P8NA 3A88A 2ZU3A 3SNBA 1RIWB 5DP8A 1G2LA 3KL6A 1F5RA 1OSSA 3P8GA 4K60A 4TWYA 4A1TA 1K1LA 1P05A 5IDKA 5TJXA 4NSVA 1GHBF 3GY4A 1C1SA 4VGCB 1TALA 3ZZ5A 3AAVA 1ZMJA 1W7XH 4U32A 3ZZ3A 2RDEA 3RXSA 5A8ZA 1SGFA 1J16A 1LMWB 3A82A 5C2ZA 5E0HA 4O97A 1AD8H 1YF4A 3ZVFA 3AW1A 2C4FH 3SNCA 3N7EA 1GMHF 3RXRA 1W8BH 2QIQA 3ZVBA 3VB6A 1Q3XA 1HGTH 1AUJA 1C4Y2 1QR3E 3ZIAD 1MTSA 1SGYE 1NN6A 1S6FA 4OS7A 3Q3KA 3CENA 4F55A 1EJNA 2J4IA 1EOLA 1TGSZ 1ZSKA 5HMAA 1FY8E 3SOSA 3EQ0H 1P2MA 2IN2A 4OS4A 3Q00A 1DOJA 3B8JA 2C8YB 1O5BB 1KSNA 3N7OA 3SU5A 1TABE 2ZHWH 2O9QA 4XRNA 5DP4A 1G2MA 2CHAB 2ZDLA 2Q6DA 4QT8C 4MNVA 1BMMH 4D76A 4CRAA 1VKYA 3FANA 4AFQA 1UVTH 2BVRH 2QV1A 1GBDA 3TJNA 3U28C 1SQOA 1BTUA 4XD7D 1K1MA 3SW2B 1RFNA 3F1SB 1GVLA 1AE8H 3TLOA 4Q7ZA 3TU7H 1A3EH 2VGCC 1TBQH 1B0EA 2WSSD 3RXHA 2H9TH 4BAMB 4LXBH 1BRBE 3QN7A 1UVUH 4YT7H 2FO9A 3MH4A 2Y7ZA 1TE0A 1TNGA 1TBZH 2J9NA 5EW1H 1AY6H 3M5OA 1O5GH 1NU9A 5CHAC 1P3EA 3GYMA 1V2RT 5JBBS 1HUTH 5E8EH 5EPYA 3HK3B 2AGIX 4FUGA 4X6NA 2FLRH 3V12A 2OUAA 5C3NA 3LH3A 1QL8A 4M9FA 1ZHRA 8KME2 1J8AA 2Y80A 4A7IB 3WWFA 2OBQA 2J95A 5GNDA 3SV6A 1F92A 1Z6EA 1ZZZA 2CF8H 3VG8A 4X6PA 5EJ1A 4LZ4B 2C90B 4Y71A 3TK6A 2FESH 1UCYK 2R3UA 1ZSLA 4ASUD 2OQ5A 2UWPA 5T6DA 5GDSH 4U30A 2QCYA 1E37B 5E0JA 1C2JA 1EAIA 2IJD1 4H4FA 3M7QA 2VH0A 3BTME 4O3TA 2C8WB 1C1UH 3RC5A 5AFYH 3FKSD 1QRXA 2PKAB 4X1RU 2BDGA 1D3QB 5C1YA 1HAOH 2Z9IA 1GJDB 2AMPA 1TNJA 3DSOA 2WPMS 1GI3A 1TGTA 4FETA 4X6MA 1KTSB 4CBOA 3URCA 1P11E 2GMTB 1CQQA 2P93A 1O3PB 1BZXE 1VJAU 3MI4A 2WV5A 2J98B 1A46H 4B6EA 4RKOB 2GGVB 3RC6A 3OSYA 3SHCH 1V2MT 5T3HA 2DE8A 2Y7XA 1A2CH 1L1GA 1T8NA 4X1SU 3KYFA 2W6JD 1IQNA 4Y8YA 1P57B 4Y76A 2XW9A 4AZ2B 2C93B 2KCYA 1CVWH 5JYIA 2VVCA 1O34A 1AU8A 1SR5C 1Z8RA 1DXWA 3CS0A 4FUFA 5EQSA 1N1LA 3SU4A 1V3XA 3PO1B 1EB2A 1ARCA 2DUCA 2CK3D 4MNXA 3BG4B 1H9IE 1KXFA 3RXBA 2FZZA 4ABGA 1GBJA 1TBRH 5EPNA 3RXUA 3RMOH 1S5SA 2BLOA 2B8OH 3EGKH 1HAPH 4Q80A 3F9FA 3PWCA 1T8LA 4NG9H 5A0AE 5DGJA 3M37A 2JH5D 1LCYA 1THSH 4WMFA 2FX4A 1OYQA 3VB7A 1ANDA 4CRGA 2BX3A 2B5TB 4AFUA 5KECA 4JK6A 1HLTH 1KXAA 1GGDB 1LVMA 3BIUH 3PRBA 1FMGA 2ZECA 3G01A 2ODQA 3ATWA 1ESTA 1TA6A 1ID5H 4INHA 5ABWA 3A8CA 2F43B 2R2WU 5HKKD 4UONA 4BXWA 2GT8A 1A1RA 4HZHA 1DT2A 4I86A 4AC9A 1O2NA 5GJ4B 3A87A 1FX0B 1MMJN 4ZXXH 3EA8A 3LU9B 4Z0KA 2A45B 1A61H 4BAHB 3NWUA 1WSSH 2A7HA 1L1NA 2Q1JA 1UK2A 4D9QA 3OYPA 3K65B 4X2YA 1J17T 1C1TA 4TWWA 5E2OA 1O3NA 2ILNA 4OS5A 4NFFA 3W94A 2AGEX 1L1JA 3QZRA 3RU4T 5CMXH 3PV4A 1GCTB 1AFEH 1GI1A 1HDTH 2RG3A 4XSKU 5EGMA 1JIRA 1CT4E 1TRYA 1HJ9A 3BTTE 1QRWA 4B6FA 2K0QA 1BTPA 4DGJA 3T5FH 2VU8E 1E36B 2AHME 4E05H 4X1NU 1QB1A 2BMGB 3SNDA 4DT4A 1P04A 5FX6A 2GDEH 4U2WA 2ZU4A 1C5YB 2K8IA 3F6UH 1A5HA 1DY9A 3DFJA 2FEQH 2QGRA 5E0GA 4AORA 1GBKA 1O3HA 2FM2A 1UK4A 1DY8A 2NU2E 4I8HA 1GI7B 3RXMA 1FNIA 1IQJA 1ZGVA 9ESTA 3A80A 2Y82A 3A85A 3RMNH 1IHTH 3T62A 1AZZA 1SMFE 3MU5A 2JKHA 1BMLA 1A0HB 1SGCA 3H09A 4FVBA 3UR9A 1N6YA 2P3UB 3TJOA 1HBTH 1W3CA 3B9FH 1O0DH 1T4VH 1BRAA 1E34B 1FJSA 2XCNA 1L4ZA 2A7JA 4NSYA 1SLVB 5DN6D 1EJMA 2ZFQH 1EFRD 3PTBA 2A4OA 1SGFG 4WH6A 3P6ZB 3MYWA 1TYNA 3WWBA 1IQHA 1F0TA 2R2MB 4DJZB 1QJ1B 3BN9A 4MDSA 3BEIB 2EQNA 3FVFB 2KZ4A 3SJIA 1EPTC 2FMJA 3DSPA 4WXIA 2OC1A 5B6LA 4DW2U 3KQEA 1OWKA 1P2NA 5HM2A 1O2HA 2VH6A 2ZEBA 1QHRB 2NU3E 3M3SA 3MO6A 5F53A 2XBWA 1TNLA 3MU8A 4AYYB 3P70B 1NC6A 4I8GA 2GCHF 1SQTA 2BLWA 3S7KB 2GKVE 4R8TB 1LHCH 1KTTB 3UFAA 1EAXA 1BMNH 1UCYH 1ZGIA 4Y79A 2Z9GA 2GV7A 1ZTKA 2ZDKA 1O33A 5EXNA 3S9BA 5ETXA 1WDIA 2WV4A 2Z6BD 3T25A 3ZV8A 3ESTA 4BAKB 3P17H 3QZQA 1BTXA 3EYDA 4TT3D 2F9PA 2ZFPH 3ZVCA 4THNH 2BZ6H 1LKBA 1GJ8B 2F91A 2PV9B 2G4TA 2V6NA 1BCUH 2C3SA 3RXQA 3FN8A 1O3KA 2G55A 1GI6A 2H5CA 1EXFA 2XC5A 2PW8H 1MU8B 5EXLA 5FCRA 3M5LA 3STIA 8GCHF 1DLKB 1LDTT 4RKJB 1C1MA 1TQ0B 3BTFE 2YMSC 3JZ1B 4AYVB 6LPRA 3BTGE 1L4DA 1SGEE 2FOMB 2LELA 3FZDA 2V3HH 1VCWA 3PWBA 1C5RA 4NA7A 1P03A 1W0JD 2Q6FA 2XBYA 1VITF 3RC4A 1RS0A 1C9PA 1O2KA 1GHXH 1GHZA 3BF6H 1NO9H 1C4V2 4KP0A 4OS6A 3T29A 5L2ZH 2HVXA 1PPZA 5H4IB 2BD8A 1UK3A 2J92A 1MD8A 2W3IA 4KTSA 3MNBA 4FU7A 3GDUA 4INLA 1AQ7A 1F0RA 3KCGH 1BIOA 1GBMA 1MTWA 2PSXA 1BBRE 1O2VA 1WUNH 2FS8A 1CT0E 1W11U 1DM4B 1LVOA 3QGNB 1IQMA 2VIWA 2TBSA 3VB3A 1HAVA 1TNHA 4MG3A 4X8TH 3OEED 1H8DH 5A2MH 2ZGJA 2FS9A 4BNRA 4GHQA 1NFUA 1Z1JA 2TGAA 4K1TA 3V7TA 1E79D 3A7TA 3SJ8A 3ZYEA 4XBDA 4CHAC 5G4BA 5HGGA 4JCNA 4WY3A 3OEHD 1L0ZA 2ALVA 2EEKA 2WPLS 1UTQA 2BVSH 4J2YB 1DITH 1O3OA 3QWCH 2GDDA 2QA9E 2BD9A 1GI2A 1FI8A 1H9HE 3SV2H 1AWFH 1XMNB 3EA7A 1TMTH 2GCHG 3ZVAA 3W1EA 4X2XA 4YM9A 1S6LA 4HG6A 1PJPA 3RXKA 4ISNA 3LDXH 1P2QA 3RXGA 1KXCA 3KQCA 1DFPA 1GI8B 1AVGH 2J2UA 5AFZH 1C5QA 5AF9H 1TNIA 3M61U 3AASA 2ZQ2A 3BTHE 3F68H 2V3MA 3FOAA 1DWCH 1EP6A 3ZZ4A 1AB9B 3E8LA 2H6MA 3A7YA 5JBTA 5FPYA 1IHSH 1G36A 1A7SA 4NIYA 4IMQA 3SO3A 1ZJDA 1THRH 1ORFA 3D65E 1Y3VA 1NFYA 2XYAA 3A8BA 3K9XB 1W10U 1OXGA 3OTJE 1C2KA 8GCHG 2LNCA 3KNXA 1O3DA 1YPJH 4Y7AA 4AB9A 5I46H 1SOTA 1O36A 5GCHG 1BHXB 4CRCA 4P00A 1SLUB 2ZHQH 3TH3H 1FY4A 2RDLA 1YCPM 3A83A 3CP7A 1ZTJA 2F9UA 1W7GH 3QGJA 1GBLA 2CF9H 1U6QA 1GDUA 3F2FA 1JMOH 1QNJA 2ZKSA 3EDXB 2ZCLP 3SN8A 3RM2H 1KXBA 1DDJA 4GSOA 1K2I1 1Z8JB 1ZRKA 3NUMA 4AFZA 1HAZB 1CA0B 4CRDA 1EOJA 2RCEA 3PV2A 5LPRA 4ABFA 3C27B 1Z8IB 2IOTA 1O2JA 1QIXB 2WV9A 4OS2A 2AMDA 3T26A 1KXEA 1EZSC 3UNQA 1W14U 1E0FD 1XUJA 1PPEE 2ZFFH 1YBWA 1FN8A 1GCDA 4WF8A 1QGFA 2IPQX 6CHAC 1ELDE 1XUGA 1O31A 1QA0A 3ZZ6A 1CE5A 3MNXA 4AGJA 4ZROA 1BTHH 1O2WA 3MNCA 2PP6A 1Y5AT 4BOHA 2ZGXH 3LGWA 1O2RA 4LOYH 5HIZA 4GCHF 2OD3B 4MQAA 1P10A 1SFIA 1IQKA 9LPRA 4NA8A 3SU2A 1CHGA 7LPRA 2Y6TA 3KEEA 1LHEH 1GHYH 3DHKH 3SU3A 3TH4H 3SQEE 2D2DA 2ZTXA 4B75A 7KMEH 2P95A 1ZYOA 3LT3A 1QBVH 2HOBA 3UOUA 4X0WU 1RTKA 2PR3A 3SZNA 3LJOA 1WYKA 4IMZA 4U01A 2BVXH 1MZDA 1JIMA 1PQ5A 1UTNA 2L74A 4ZKRU 2XOKD 3PTNA 1EZUC 1SVPA 4YTAA 1DUEA 1O32A 2A0QB 3I77A 3UWIA 1GPZA 1O3LA 3UWJH 1JBUH 1K9OE 1YLDA 4IBLH 1C2LA 3H7OA 1J15A 1PFXC 2R9PA 5EOKA 1SGRE 3F9EA 1LO6A 3OX7U 3ZZ9A 1YP9A 2O8WA 3SORA 1P0SH 3RXAA 1O35A 3K6ZA 2WINI 2OCVB 4MNWA 3SQHE 1MAYA 2PFEA 4JZ1A 1HYLA 4MPWA 4Q7YA 5C17A 5EIYA 5BPEA 1PPHE 4AN7A 2KM0A 1HFDA 1AFQC 1KY9A 2J94A 1TGCA 1EQ9A 1S81A 3M35A 1KXDA 1VGCB 1NRNH 1TFXA 1O3EA 2ZFSA 1WTGH 1K21H 2VBCA 1EP5A 4MPUA 4I7YH 1A3BH 2R3YA 5EODA 1NESE 1D3TB 4WVPE 1PQ7A 2QXJA 4B1TA 1BMFD 2JH6D 4UFGH 2ODYB 3LKWA 3BTDE 4JMYA 1F0UA 1P09A 1XUKA 2JJ2D 1V6DA 1GG6C 3QTVH 5A0BA 1GJ9B 4UDWH 2O8MA 1NTPA 4AG1A 2DE9A 2EI6A 3RXVA 5KEDA 4B2BA 2JH0D 1K0HA 2GV6A 3R3GB 5DP6A 1Y5BT 2SNWA 2VIPA 2BB4A 1TOCB 1XX9A 3RXPA 4GCHG 4R0IA 2UUYA 3LGIA 1B0FA 4ZAEA 4D9RA 2C8XB 3DUXH 5FL7D 1GBIA 1HPGA 4INKA 4LZ1H 2BX4A 1O2OA 1BMAA 1T4UH 4BAQB 1HCGA 1C9TA 3GCHB 1JWTA 2ZG0H 1NFWA 3MOCA 1ANBA 1GMDG 1H8ED 4B2CA 1P01A 1Q2WA 1NBMD 1SL3A 4IN1A 1C5ZB 2VVUA 1AVXA 3MH7A 1AIXH 1BJUA 2TPIZ 5DO4H 1IQGA 1TPPA 1GHAF 5J4SA 2YNBA 1RIWC 3OY5U 2H9HA 4GHTA 3E0PB 1NFXA 1QBNA 2EI8A 1HV7A 4MLFB 3L6PA 1FY3A 4WXVA 1BA8B 1NS3A 2BY8X 4VGCC 3ZVDA 1ABJH 3W95A 3GCOA 5JB8S 4TY6A 1C5TA 2RA3A 1DWDH 5L6NH 1GI9B 1K22H 1ZHMA 2F4LA 3U9AH 3RXTA 2V7QD 2PGBB 3T27A 1LTOA 1GHWH 1IQEA 1O2ZA 4K69A 4SGBE 1WU1A 1KLJH 3V0XA 1BTWA 5FCKA 1GBCA 1ELTA 1ZPZA 2ASUB 3VGCC 2P3TB 3UR6A 2Y5GA 1MTUA 1V2ST 4HTCH 3LGTA 1UW7A 4NGAH 1MU6B 1P8VC 2OC0A 3HKIB 1JRSA 2ZCHP 5C20A 1UHBA 3E1XB 4B74A 1OOKB 2YNAA 3KF2A 2BLQA 1D6WA 1RTLA 3IG6B 5FBIA 3IWMA 3F0OA 1INCA 5FX5A 5EQRA 1GI0A 5FPSA 1YPHE 1HAHH 5FXLA 1HJAB 1H8HD 4A1VA 1V2WT 2CHAC 5JB9S 5DG6A 4ZHLU 2VIVA 2W7UA 1VZQH 5C0TA 1O3AA 1OP8A 3GCNA 3M7UA 4E06H 4PROA 5L30H 1W13U 1P2KA 1ELAA 5F8ZA 2A2XH 1D6RA 1K1OA 2J38A 2QXHA 1THPB 1PYTD 2J34A 2ZA5A 2PKSB 1P2OA 3PLBA 1HB0B 4DIIH 2ZTYA 1O5FH 2YMSB 4NWLA 3BTQE 5DP7A 3ATKA 1QL7A 3RU4E 1KLIH 2OINA 1UTLM 5AHGH 1OP2A 1YWUA 5EG4A 1V2QT 4ZHMU 3KGPA 2ZWLH 3RXLA 2VWLA 3TH2H 5C94A 5DK1A 1ZMNA 4FUEA 2BYAX 1Z1IA 1GHAG 2ZCKP 2HGTH 1DS2E 1H1BA 1ZLRA 2QF5A 4FVDA 1SGDE 1IQIA 4NZQA 3DSGA 3MNSA 1C1WH 2J5UA 2A4QA 4H42U 2NWNA 5HM9A 4ISOA 2FTLE 4CBNA 1SQRA 1XKAC 2L6OA 2ZFRH 4KGAA 2AERH 4CRBA 1C2IA 1O3MA 1TONA 2UUJB 1E1QD 4ZMAH 2FPZA 2QN5T 2FYQA 1TPSA 2F9OA 1MCVA 1ZHPA 1SHYA 1P2IA 5BRRE 1BHXF 1CSOE 1HAVB 2JJ1D 5DJ7A 2STAE 1C1NA 2TGDA 1YM0A 1C2DA 4ZCNA 3TGKE 3UB0A 4CHAB 4Q2KA 1MTNB 2ZGCA 1LVBA 1TRMA 4X1QU 4X2VA 5JPMH 4AG2A 2WYGA 2JDID 3PM3A 3SU1A 2AH4X 4NFEA 1SG8B 3L3TA 2P16A 2QF0A 3MHWU 4Y0ZE 3A7ZA 1P12E 1BBRK 2UUFB 1FIWA 1V2NT 3T2NA 2GMTC 1S83A 4IS5A 4YZUA 2ZDVH 2OLGA 2GCTB 3Q76A 3VXEH 1HXEH 1UO6A 1EPTA 3BV9B 3CS7A 1ABIH 1QCPA 1C5VA 1OPHB 1Z71A 3A8DA 2B7DH 4DOQA 4FUIA 3PV5A 1GJ4H 1TGNA 2P8OC 4NIXA 2PHBA 1DICA 3MTYA 1V2LT 3MMGA 1NRQH 2I6SA 1BTYA 1S6HA 2VWNA 4IC5A 1BJVA 1GJCB 4Y0YE 1O5CB 1NBME 3RLYH 4ZKNU 1AGJA 1K1NA 1QY6A 4F4OC 3UNRA 4Y11E 4Z1MD 4XOJA 2EI7A 1VITH 2WZQA 3PLKA 1OS8A 1E38B 4ABDA 3HGNA 3FP7E 1IQLA 1WOFA 1SGTA 2VIQA 3PYHA 4ZKSU 1ESAA 1NZQH 5SGAE 1GWAA 1W2KH 1XUFA 3SNEA 1XVMA 1F0SA 2WPHS 3BTWE 5JBAS 1C1PA 3ZV9A 4ACBA 1Y3YA 4O03A 2BDYA 3NZIA 1BUIA 3HGPA 1EASA 4ACAA 3PRDA 1O2QA 1AVWA 2JIZD 3A89A 3NXPA 3SV8A 4YOIA 2Y5HA 1BRCE 2FIRH 1Z7KA 2WHXA 4FUDA 4X8SH 4NWKA 1ANEA 1PPBH 3N7DA 4GUXA 1Y3XA 4JYVH 4A6LA 1ANCA 3GY2A 3FP6E 1PPCE 3NCLA 1BTZA 1FIZA 1GL1A 3RXDA 1GGDC 2XBXA 4E7RG 3RLWH 4AX9H 2OP9A 1EJAA 2A4GA
chains in the Genus database with same CATH topology
1D3PB 1V2PT 4ZHAA 1V2VT 4K5ZA 3URDA 4CREA 1PPGE 3SGQE 2KAIA 5GCHF 2CXVA 3V13A 4BTIB 1HRTH 2XBVA 1T8MA 3LJJA 3UREA 3UY9A 2VINA 3E3TA 2G5NA 3Q3XA 1C5LH 3QO6A 3GDVA 5ESBA 2FOGA 4DT7B 1PQAA 3O8BA 1C2GA 2ZDAH 3GYLB 4KTCA 3SHAH 1DSTA 2PUXB 2HWLB 3UOPA 1AZ8A 6CHAB 2PWXA 4Q7XA 4FXGH 1B7XB 1QA7A 4UFEH 3TJVA 3SI4H 1F5LA 3QLPH 1YPMH 3A7WA 1O2GH 3E0NB 2R0LA 1TA2A 3SGAE 1RD3B 1UMAH 2A1DB 3UTUH 5ESTE 4BTTB 1V2TT 2WPJS 2WUCA 2ZU1A 3TK5A 1GCTC 3A84A 1QQ4A 3ATLA 1PYTC 2TGTA 2XNIA 1WQSA 1XXDA 3ZZAA 1LHFH 4I33A 4F49A 4NZLA 1NROH 3BIVH 3KQDA 5DP3A 1AKSA 1MBQA 5HYOA 3DFLA 3SGBE 4AFSA 4BXSA 4D8NA 1TMUH 2ZDMA 1SBWA 2BQWB 5K0HA 2CN0H 2VVVA 2SGDE 3EE0B 3LC3A 2NU1E 3Q77A 1NRSH 1SOZA 4JZFH 2Z3CA 1TMBH 4O9VA 2FOCA 2OXSA 1HAXB 4YOJA 2SNVA 1CBWC 4GLYA 2W26A 3UIRA 2FI5E 2FOAA 1P2JA 4Z6AH 1S0QA 1UVPA 3MU4A 2FI3E 1Y3WA 1GBTA 5FHTA 1CA8B 7GCHF 1WQVH 1LKAA 2QF3A 1C5UA 1W0ZU 1ELBA 1K1JA 1XVOA 1VJ9U 3BSQA 1GJBB 4YOGA 1YPLH 4A92A 2ZI2H 2XXLA 4TPIZ 4ISIH 1IAUA 5FAHA 4ASHA 1FPHH 1TLDA 1GVKB 2ZO3H 1LVYA 2OC8A 4K1EA 2BQ6B 1C2HA 4TYDA 3RP2A 1SGNE 4RN6A 5C5OA 3M7TA 2HNTE 1P9SA 3MO3A 1O3IA 2VGCB 2A7CA 2BDIA 3GY5A 1UJ1A 2RA0A 1IQFA 4B76A 5C1UA 2A5IA 1G3BA 1SPJA 1Y5UT 8LPRA 1TX6A 1O3GA 2ZPQA 2I6QA 2BQ7B 1ETTH 1N8OC 4CR5A 3KIDU 3NKKA 4HFPB 1O5AB 3IITA 2ZHFH 1AO5A 3ATIA 5CHAB 4DY7B 1SGPE 1YPKH 1GG6B 3TNSA 3E6PH 6GCHF 3DA9B 2BDBA 4K8BA 4AGKA 2FXRA 4UFDH 2Y81A 3M5NA 4K3JA 1XUHA 2ANWA 4I31A 1WTHD 2BD4A 1F2SE 2R0KA 3C1KA 2ANYA 2F9BH 2HRVA 3D62A 3ZVGA 2YOLA 1EX3A 3AW0A 3PMHB 3D49H 2SGAA 4IC6A 2IPHA 2CV3A 1C5OH 3ZVEA 2K1QA 1EAUA 3B23B 4YLUA 3TGJE 1C2EA 1Q31A 2PGQB 5F8TA 1BBRH 1A5GH 1ELEE 1OKXA 3SV9A 3V3MA 1WCZA 6ESTA 1GMCF 2D26C 1F7ZA 1ETSH 3TITA 5L2YH 2HPQH 3VFEA 2GZ7A 4JZDH 1O30A 2G4UA 1HJ8A 3SJ9A 1NT1A 5TCCA 3S9AA 2PLXA 1SSXA 3ZZ8A 1BITA 4XBBA 1GBAA 3RXJA 2QYIA 1DUAA 2VIDA 1FXYA 3RXIA 4FU9A 2ZIQH 4Y8ZA 5LPEA 2FOHA 3LGYA 5EXMA 2HALA 4OGXA 1O2IA 1ZPBA 2IJOB 3RMLH 7GCHG 3O8DA 4JYTA 3KN2A 4IGDA 5C67A 1GMDF 1H4WA 2ESTE 1DPOA 3UQOA 3ZZBA 1W12U 3ODFA 4Y6DA 1N6XA 3GCTG 1O2YA 1MZAA 1QQUA 3BEUA 1GVZA 4K8YA 3SNAA 3UPEA 2TIOA 3LH1A 4ZUHA 1G3EA 3GDSA 1Z6JH 3VGCB 3MH5A 3BTEE 2LPRA 1UTOA 1CGJE 3LPRA 2ZU2A 1DVAH 1TNKA 3GISB 3RU4D 2A5AA 2V35A 1VR1H 2SGFE 4KTUA 2FOEA 1AUTC 1ELFA 1UHBB 5GXPA 4A1XA 1O2SA 3VB5A 3LONA 3OY6U 3H5CB 5EQQA 1CHOG 3SV7A 3E91A 4MPVA 1OWJA 1MCTA 1S85A 6GCHG 1OYTH 2ZNKH 3S0NA 1D3DB 2BD7A 3HKJB 1V2JT 1G9IE 2JETC 3TK9A 1QBOA 5DP9A 3LC5A 1EZXC 1ZR0A 4WWYA 4XE4A 1HXFH 2FDAA 1J14A 1AB9C 1YCPK 5I25A 1JRTA 1NU7B 1ZSJA 3S69A 1A0LA 1C5WB 1HAIH 1Y8TA 2TGPZ 1G3CA 2H2ZA 2SFAA 2ZGHA 1KYNA 3F9GA 1EAWA 1YPGH 4B73A 1YC0A 4JZEH 2OTVA 2AEIH 1QB9A 4YO9A 5LGOA 5EW2H 3PROA 1GMCG 1X7AC 2BDHA 2ZPSA 4FUHA 2BXTH 2HNTF 1MQ6A 1MKWK 1FY1A 1ACBE 2GD4B 1OWIA 4UFFH 3ITIA 5B6OA 4XBCA 4MNYA 2ZFTA 4ESTE 1MTVA 4IW4E 2H1UA 4DCDA 1O39A 3AAUA 1O5EH 3D23A 2G52A 3FFGA 1QB6A 4JYUH 4MVNA 1SQAA 1T7CA 2FX6A 4KKDA 1AHTH 2BXUH 4I8LA 1UTKA 2BD5A 3HPTB 2QY0B 1WBGB 2SGEE 3ENSB 1V2KT 2BDAA 2QXGA 3M36A 3PMJA 5AVDA 1GHBG 1C5MD 4DURA 1DXPA 3SI3H 3RM0H 4CH8B 1HAYB 1C4U2 1O2XA 1Y59T 2VNTA 1CA0C 1TRNA 2AIQA 2AS9A 1DLEA 2PSYA 1GMHG 3ZYDA 1OX1A 3E90B 3JZ2B 2W7SA 4H6SB 4X1PU 1GJ7B 4ZXYH 3SU0A 2BOKA 3VEQB 1GHVH 1WV7H 2QC2A 4FUJA 1CGIE 2M5TA 3QUMP 4CRFA 2ZTZA 5DP5A 1RXPA 5GIBA 4Y8XA 2O8UA 1RJXB 3U1IB 3A86A 1FQ3A 5T6GA 1MKXK 5C5NA 1GBFA 1KDQB 4DVAU 2AGGX 2FI4E 4Y7BA 5PTPA 1LQEA 3L33A 1EPTB 1O2PA 2BLVA 5FPTA 1MAXA 4NA9H 1GI4A 1AWHB 1FAKH 1SHHB 3UNSA 2P8OB 3ZZCA 1ZPCA 1UVOA 1D9IA 1TPOA 2SGQE 2GVFA 3U8OH 5DKMA 4YESB 3A81A 3U69H 1Z8GA 1YKTA 1FLEE 1UVSH 1OP0A 1YPEH 2XWAA 1C1VH 3HATH 3U8RH 2NU0E 2AIPA 1YPHC 3PLPA 3T28A 1IOEA 1K1PA 3EA9A 5C1XA 1XM1A 4OGYA 4XDEA 2VIOA 4M7GA 1DSUA 3TNTA 1A4WH 3VB4A 4HI3A 1E35B 4JK5A 3DD2H 1O2UA 1RGQA 2H9EH 3I78A 1TAWA 4GPGA 1AE5A 3E16B 2BM2A 3P92A 2D8WA 3GY3A 4CR9A 1TWXB 2AMQA 1DWBH 1T32A 2AFQB 1YGCH 1CGHA 4UEHH 3SJKA 3SUDA 4X2WA 2CMYA 1G3DA 1QURH 1J9CH 1C1QA 1M9UA 2B9LA 3GY7A 2KAIB 2G81E 1VGCC 3RXCA 1UCYE 1O38A 2QAAA 2GTBA 1ELVA 4X8UH 1HNEE 1C1OA 1ZRBA 3MFJA 3LOXA 4IN2A 4ABIA 2O8LA 2BY7X 4MTBA 7ESTE 5LPFA 1DANH 1CT2E 2XCFA 1GBBA 2BD2A 3GY6A 1TOMH 4ABEA 3M3TA 4KELA 1LPGB 3TPIZ 4A5TS 2Z3EA 4YT6H 1C2MA 1NRPH 2ZPRA 1QFKH 4FUCA 1JOUB 1QJ6B 5E2PA 1XXFA 5F8XA 2BD3A 2GX4A 1O3JA 1GI5A 1Y3UA 1SLXB 5A8XA 5LH8A 3U1JB 3GY8A 3MO9A 1O2MA 1LHGH 3RUOA 5T6FA 3STJA 3R0FA 1NM6A 2VB0A 4WH8A 1AMHA 1T31A 2ZGBH 3S7HB 3PMAB 4XFQA 1BOQA 1AKSB 1AN1E 1ESBA 3GCHC 3ZZDA 1FONA 4NIWA 1K1IA 2WPIS 1C5XB 1EKBB 1JXPA 1FAXA 1V2UT 2ZQ1A 1MQ5A 2ZHEH 3U98H 2PKAA 4TPYA 2XC4A 1MD7A 1AI8H 2ZP0H 2ZC9H 4I8JA 2PTCE 3AVZA 2XTTB 1LPKB 3SU6A 1YCPH 1CBWB 1EB1H 1EATA 1ELCA 4HGCA 1PQ8A 3UUZA 2XC0A 3MH6A 1KDQA 3S9CA 3GOVB 1SC8U 3F9HA 4WMDA 1TIOA 2BY6X 4BTUB 1FPCH 4K1SA 2OC7A 1RRKA 2CGAA 3SJOA 4ABHA 2FOBA 1CU1A 2PTNA 1S84A 3O8CA 3PMBB 3VPKA 4AOQA 3O8RA 1DX5M 2GT7A 2BY9X 2Z9LA 1O2LA 3P95A 1MKWH 3I29A 1CO7E 3RXEA 3A8AA 1TQ7B 2HLCA 5J4QA 2GP9B 3TGIE 3DT0H 2A2QH 2W5EA 5GWZA 1K28D 1OWEA 2VWOA 1W0YH 1XKBC 3LGUA 1SGIB 3LGVA 3PO1C 3ATMA 2EA3A 2P59A 1TB6H 3BG4C 1DWEH 3SUEA 4ISLA 3PB1E 1TX7A 4I8KA 1N8OB 1A0JA 2ODPA 3SUGA 4J1YA 2SGPE 2V0BA 1OWDA 2O8TA 1BRUP 4FU8A 4O3UA 4X8VH 3VXFH 1LHDH 1O3BA 3QDZB 4AB8A 5A09A 3FAOA 1V2OT 1C2FA 3M5MA 4ZKOU 5F6MA 2P94A 1VCPA 1TGBA 3QX5H 2WPKS 1SGQE 1HJAC 1ELGA 5EU8A 2Z9JA 1QJ7B 1B5GH 3U8TH 1G37A 2ZZUH 4MPXA 2Y5FA 2A4RA 2A5KA 1LPZB 3MWIU 1C1RA 2HPPH 1C5SA 2Q6GA 1H9LB 1HIAB 1QRZA 1C5PA 1HAGE 5IYTA 1QTFA 3A7VA 3SUFA 2XWBI 3SBKA 2ANMH 1GDQA 5A8YA 2G5VA 4GAWA 2G51A 2ULLA 5DPAA 2PKSC 1FN6A 1O5DH 2G00A 2AYWA 2NU4E 4GVUA 1S0RA 1SLWB 1UTMA 2C8ZB 2WUBA 5A0CA 2BHGA 2XRCA 1MKXH 4TY7A 1G30B 2Z94A 3ELAH 3TVJB 1H8IH 1YLCA 3KHVA 3NK8A 4D7FA 1BQYA 2F83A 1C5NH 1ZJKA 2Z9KA 3RMMH 4ABAA 3M3VA 1SB1H 4LK4A 1P3CA 2W3KA 2G8TA 2STBE 1O37A 3ODDA 1GJ5H 3A7XA 1ZMLA 4ABJA 3HK6B 3FZZA 2FP7B 2F9NA 3K2UA 1SI5H 2F3CE 3P8OA 2FWWA 1ETRH 3FP8E 4WMEA 1O3CA 4B71A 2UWOA 2Z3DA 2FLBH 2FTMA 1TX8A 1GJAB 1NY22 3K6YA 1T8OA 3Q3YA 4UE7H 2BY5X 1EZQA 2BOHB 2V3OH 4BAOB 1P06A 3BG8A 1FUJA 5CE1A 1BB0B 2WYJA 4OS1A 1GBHA 3MU0A 1KLTA 2ALPA 1MTNC 3ZZ7A 4ISHH 3RXFA 4B2AA 4YLQH 1MH0A 4I32A 2UWLA 2A31A 4BANB 4ABBA 1ZOMA 1F5KU 1MBMA 4H6TA 1A5IA 3UQVA 2UUKB 4Y10E 1GJ6A 2VJ1A 4DG4A 2FYRA 1RTFB 1S82A 1YYY1 3TJUA 3GCTF 3RXOA 2HNTC 2QXIA 4JZIA 2F9VA 1EUFA 1GL0E 1ZTLA 2GCTC 2JETB 2OQUA 1FZZA 2Z7FE 3TIUA 4FUBA 1AFQB 2VWMA 4E7NA 1KIGH 1OWHA 1O2TA 1GBEA 1FDPA 2CJIA 1UTJA 1LQDB 1VCQA 2H5DA 1GDNA 2ANKH 1P9UA 1ARBA 3RDZA 5HXFA 2PUQH 3GICB 2ZHDA 2FOFA 1NPMA 1XUIA 5K7RA 1D4PB 1CHOF 5JBCS 1O3FA 3H7TA 3NPSA 3WY8A 4X6OA 5F03A 4D7GA 3BEFB 2P3FH 2THFB 4WJG2 1MUEB 1WAYB 3KQBA 3BTKE 2B0FA 1PPFE 4UD9H 4NCYA 2BTCE 1BDAA 1G32B 1HIAA 2GZ9A 4K2YA 1VITG 2BZAA 2ZU5A 1SFQB 2TRMA 4DIHH 2GZ8A 3EAJA 2A32A 3LIWA 5FBEA 2FODA 1P02A 5JDUB 5GPIB 4NIVA 1TPAE 3QTOH 3QK1A 2EC9H 5TCAA 4CH2B 2OBOA 1FV9A 1L2EA 1BT7A 3OU0A 2D1JA 1DE7H 4RSPA 2BDCA 1UTPA 2ZDNA 2ZF0H 8ESTE 4ZH8A 1QL9A 1NRRH 4SGAE 3P8FA 3MU1A 1FY5A 3P8NA 3A88A 2ZU3A 3SNBA 1RIWB 5DP8A 1G2LA 3KL6A 1F5RA 1OSSA 3P8GA 4K60A 4TWYA 4A1TA 1K1LA 1P05A 5IDKA 5TJXA 4NSVA 1GHBF 3GY4A 1C1SA 4VGCB 1TALA 3ZZ5A 3AAVA 1ZMJA 1W7XH 4U32A 3ZZ3A 3RXSA 5A8ZA 1SGFA 1J16A 1LMWB 3A82A 5C2ZA 5E0HA 4O97A 1AD8H 1YF4A 3ZVFA 3AW1A 2C4FH 3SNCA 1GMHF 3RXRA 1W8BH 2QIQA 3ZVBA 3VB6A 1Q3XA 1HGTH 1AUJA 1C4Y2 1QR3E 1MTSA 1SGYE 1NN6A 1S6FA 4OS7A 3Q3KA 3CENA 1EJNA 2J4IA 1EOLA 1TGSZ 1ZSKA 5HMAA 1FY8E 3SOSA 3EQ0H 1P2MA 2IN2A 4OS4A 3Q00A 1DOJA 3B8JA 2C8YB 1O5BB 1KSNA 3N7OA 3SU5A 1TABE 2ZHWH 2O9QA 5DP4A 1G2MA 2CHAB 2ZDLA 2Q6DA 4QT8C 4MNVA 1BMMH 4D76A 4CRAA 3FANA 4AFQA 1UVTH 2BVRH 2QV1A 1GBDA 3TJNA 1SQOA 1BTUA 1K1MA 3SW2B 1RFNA 3F1SB 1GVLA 1AE8H 3TLOA 4Q7ZA 3TU7H 1A3EH 2VGCC 1TBQH 1B0EA 3RXHA 4BAMB 2H9TH 4LXBH 1BRBE 3QN7A 1UVUH 4YT7H 2FO9A 3MH4A 2Y7ZA 1TE0A 1TNGA 1TBZH 2J9NA 5EW1H 1AY6H 3M5OA 1O5GH 1NU9A 5CHAC 1P3EA 3GYMA 1V2RT 5JBBS 1HUTH 5E8EH 5EPYA 3HK3B 2AGIX