2FOWA

The rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, 26 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN L11
publication title The RNA binding domain of ribosomal protein L11: three-dimensional structure of the RNA-bound form of the protein and its interaction with 23 S rRNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosome
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2fowA00
3CC7I 1Y39A 3CCUI 1VQ6I 1VQ9I 3DLLF 3CCLI 4IO9F 1VQMI 1VQLI 2ZJQF 2QA4I 2E35A 1YHQI 5GAHJ 3G4SI 1VQOI 1MMSA 3J7ZI 3CMEI 1YJNI 1YIJI 3J7YJ 2ZJPF 1S72I 2FOWA 5DM7F 4IOCF 3CCSI 1YJWI 2OTJI 5GADJ 5GAEJ 5GAGJ 3CCRI 2E34A 1FOXA 1VQKI 5DM6F 1ACIA 3CD6I 3CCJI 3PIOF 3CCEI 3CF5F 1HC8A 3CCMI 3G71I 1FOWA 1VQNI 4UY8I 2JQ7A 3CC2I 1FOYA 2K3FA 3I55I 4IOAF 3G6EI 3PIPF 4V19K 3I56I 1VQ4I 2H8WA 2QEXI 2ZJRF 5JVGF 3CMAI 3CJTB 2E36A 1YITI 1VQ5I 1YI2I 3CCQI 2OTLI 3CC4I 1QA6A 1VQ8I 1YJ9I 2NXNB 3CCVI 1VQ7I 1VQPI
chains in the Genus database with same CATH superfamily
2CV1A 1W5CC 2XF7A 1YS7A 2CSOA 5FLXZ 2EIJH 3RZOJ 4UUTA 4L5IA 5CVVA 1TWGJ 1ETKA 1R6RA 3JRDA 2FNPA 3PSIA 3JRIA 4IRHA 3V8KA 2NS0A 3DF8A 3CO7C 1GVJA 1V5FA 3HRUA 2VBYA 4P9FA 3PO3J 1VQMI 3JAMZ 5KK1A 3A02A 4CH7A 1S3JA 4U0VA 3GZNB 4E7ZA 4UB8C 5FLVA 2XC7A 4OOIA 2JA5J 2WV1A 3FHZA 5F0CA 3LNQA 1W36C 2DOAA 1MNMC 1W36D 2KKOA 1FC3A 2EV0A 5ILVA 2ICWG 1MMSA 4G6TB 1FBSA 2KQRA 1FWZA 2JMWA 5FFXA 1ITYA 3HSRA 1F9NA 1DQUA 2OZUA 5LFAA 1HKTA 1ZRDA 1BI0A 4Y13A 1SFXA 2DO7A 3S3NA 2IAIA 5KHDA 4E7LA 1MBGA 3U1KA 1YX3A 4RBOA 4O3MA 2DA6A 1UG2A 4C30A 1LUJB 4ZDLA 3IAS2 1ZGWA 4Z6YA 3WG7H 1V5EA 2K9LA 2OTJI 5GPAA 3ZQQA 2LBFA 2HQNA 2EA2A 1XSVA 2FMLA 2GIZA 2X4HA 4HYEA 4PCQA 4XLHA 1R58A 1E2XA 3DV8A 4EJVA 5JVTA 2KP6A 1P7JA 2VQLA 2BXYA 4D5CA 3GYHX 2HVSA 1ZGAA 4A6EA 2QBYB 2OU2A 1EJ9A 5FKLA 3ZQGA 3CD6I 1DPRA 1FPQA 1NG7A 2AQFA 2EH3A 4B47A 2HPMA 2EZKA 4W97A 2B0LA 2QSFX 4P55A 5HVQC 2O61A 3CTAA 2KFDA 2OPTA 1EA3A 1FMVA 4IQJA 3CLQA 4AWXB 3O6BB 2LSOA 3HPGA 1E3HA 1MDMB 3HUGB 2LD5A 5D6EA 4B3AA 3OYGA 4JX5A 3VWBA 2GM4A 2JVGA 5CVRA 1IN4A 3GFIA 4XONA 2L7FP 5E1XA 1O7FA 1K7AA 2MABA 3HOVJ 1ZREA 3ZR8X 4UVBA 4A69C 1VQ4I 2BEOA 3UNGC 5TJJA 4HNTA 3GX4X 2OF7A 1WJ5A 1H88C 1IRXA 1XCBA 2DT7B 2D5VA 1YYVA 5FLMJ 4MTEA 2R93J 4NQWB 3RTRA 2IS2A 2BV6A 3KP6A 2OC6A 4M9SA 4EM1A 4N9IA 4PSXA 3ZQFA 3DEUA 2K9MA 4UB6C 4AIKA 2HYGD 1FBUA 1X3WB 2XAGA 3O8GA 1FYMA 3CCVI 1YW7A 2O5RA 2LDUA 3CC7I 5EYRA 2DBBA 3OYFA 1WJEA 4XLPF 1W0UA 4BHBA 2NAZA 4IF4A 4DZPA 3GTQJ 1RKWA 2G0EA 1QRYA 1OFCX 4WX9A 3BZKA 4BDYA 3A4CA 1G3SA 4HSRA 3BR5A 4HDVA 4NC7A 5EEGA 1A5JA 1HW5A 2MA3A 2Y48A 4L5EA 1QU3A 1OYIA 2ZXJA 1DU6A 2XPVA 4EV0A 3LSIA 4OINF 1T2KA 3LAPA 5DCMB 5HLIA 1P2FA 2FJ1A 2VBWA 4D0PA 4J01A 3BG5A 2HGCA 3QQAA 2AO9A 2F5DA 2W84A 2HDWA 3VSKA 3KP2A 1S72I 4PSWA 3WHBA 1I39A 3SHFA 2FD5A 1O3SA 4ETSA 2LH9A 3RYPA 1ZYRF 5L3FA 4IHVA 4U7DA 3GTMJ 2DFHA 1KYZA 3E1SA 3V7CA 5J1RA 1XGOA 3M1EA 1ZAOA 4AIHA 2QQ8A 2F48A 4IPAA 3W2VA 1L0OC 2CV0A 1XN7A 3CF2A 2ZCWA 3H1CA 3JTHA 3E3VA 2XHKA 3DPLC 2QQAA 1IXSB 4D9JA 2X1CA 3DXJF 4P96A 5D8LB 2ZB9A 2VKEA 2XDVA 1FMWA 1B9MA 1J9IA 2DI3A 5F1RA 2JSPA 2CW0F 2MLGA 4JBAA 3SFIA 3BP8A 4MEXF 3LFKA 4RDUA 1IXCA 4YIIA 3R0JA 2VXDA 3K6GA 1GXPA 2IPQX 1FTTA 3KE2A 4XK4A 1WHUA 3HRSA 1KZHA 2IEKA 3M3YJ 4HLYA 1SFUA 1Z3YA 5EG0B 2GBYA 1U9OA 2QQ9A 5HDNA 5ERIA 4I76A 3ZQHA 1T8IA 1IRFA 1MBEA 2H8WA 1FP1D 3U21A 3L2CA 1A04A 2BXZA 2L5QA 3CMAI 1A6IA 4XRSG 2JA7J 1OCCH 3CJNA 3VYUB 2LLKA 4OMYA 5E1ZB 3PNTA 3MQ0A 3L9FA 3WGHA 3OR1C 2MLKA 2P6SA 1X4OA 3BTJA 5HDGA 1RKTA 3ERMA 2WAQA 3FISA 2NXNB 3PNYA 1FYLA 4U0WA 3HGGA 1X1BA 3RPUD 3BOQA 1KQ9A 1MBFA 3C3WA 2BY3A 2VLAA 5K5QA 1ORKA 3DPTA 4Y17A 5ICFA 2E2HJ 3V7RA 1T95A 1E0EA 2M45A 2CMPA 2J5OA 2PMUA 3IH4A 4WWCA 1Y0NA 3CCLI 1JKRC 3LA3A 2R7XA 2LREA 4L5JA 1U6GA 4M6XA 5FD6A 1CF7B 5J1UA 5IP7J 4BJ5C 3LA7A 2FXAA 2DMQA 1SD5A 2WV0A 2DOFA 5LHGA 4IX7A 3G4SI 3N05A 4FHTA 2K5CA 5B1BH 2VQGA 2DA7A 2IW5A 3S17J 1K83J 3R0AA 1HDPA 4OIOF 1QVUA 2Z33A 1KYWA 3ONQA 4OAZA 3HSEA 2KMUA 1SD4A 2PEXA 3A0BC 5HNHA 4R79A 1K79A 1ULYA 1TT5B 1IW7F 1HDDC 2JA2A 1OJLA 3BQYA 4CUGA 2FOWA 3H5AA 3PO2J 4XN0A 2M7BA 2Q1ZB 3UR3C 1S7EA 4AVZA 3WU1B 1ON2A 1QHHD 3CCSI 4XICA 4TV7A 4UUSB 4FTHA 3LL7A 2E5ZA 4RLFA 3T1BA 2XAHA 2EZHA 1T56A 2DODA 3GUDA 2E34A 1UHSA 3QYBA 1SVOA 3SZGA 4BQNA 3ZMSA 4OIQF 3COAC 3B6AA 3CESA 4M74A 3MKLA 1D3YA 2L7MP 3H5RA 2QSHX 1ETVA 5IYCJ 3S2HJ 4Q47A 4EJUA 3TP0A 3FKIJ 3KETA 2IA2A 4A3CJ 1J5YA 4ZDOA 3KX2A 3BDDA 4MQVA 1ERDA 2ZFUA 1FOYA 1IN6A 2W24A 2EINH 1U5TB 1TWAJ 2KT0A 3I55I 1IO2A 2JK3A 4WXDA 4EATA 2W48A 4HPQA 2IS1A 2JRMA 4KIBA 2V9KA 1B59A 4NB5A 2HTJA 1B8IA 2KIUA 3VYTB 5F6FA 4G6QA 1JT6A 3ABTA 2BZTA 3BZ6A 2FX0A 5M5YJ 1MMGA 3F8FA 3OS0A 5CQGA 2EK5A 3RKQA 1E17A 2ELJA 3FMRA 5J8FA 2JSCA 3C7JA 4MIMA 1TLHB 3E5XA 4W1UA 2RC4A 3KEOA 2FQ3A 5IP6A 4Y33A 4ZYGA 5J4YA 1ZG1A 2Y75A 1BIAA 3LMMA 3HOZJ 3FBIB 4XR6A 2XGDA 1VQ6I 2ECCA 5CJ9A 3CLOA 2ME0A 1YIOA 2CFOA 4G12A 1LVAA 5FKOA 2LYCA 1IZ1A 2K4BA 4ZZDA 2KJBA 1SMTA 1W7PA 3W2WA 3I54A 4A3IJ 2Z99A 4A3KJ 2R3SA 2JPBA 1ETQA 2EA4A 2EV6A 4PFPA 4D5FA 3ECHA 4RAGA 4L18B 4LMYA 5M5WJ 3FXRA 4S05A 4HAMA 3BROA 4RB3C 1YLFA 2JJ7A 5FJ8J 1SMYF 4UNOA 1YJNI 4EJTA 4ZYEA 2FBHA 2W00A 3E97A 2LR8A 1YRNA 2W4SA 4CO8A 1V54H 1BI3A 3CQZJ 4A0YA 4BEHA 1IRZA 1B72B 5DM7F 4RB2C 1LE8A 4CDGA 3GLLA 2CRGA 3BG6A 1YJWI 4M9ZA 4A3MJ 3IH2A 2HOSA 4C3HJ 1S7OA 3ZCOA 3JRGA 4A3BJ 3HHHA 4YEJA 3D1NI 3BR0A 1IG7A 2K02A 2VXZA 5K7FA 5H20A 4N0BA 5DD8A 1JKPC 3BT9A 3EUHC 1NHAA 3JCUC 3VYRB 2Y69H 3EUKL 1OISA 2COMA 1BR2A 2ZMEC 3N97A 1FSHA 2O0YA 2ZMEB 3J80K 5H6QA 1R1TA 2HQAA 3TO6A 4UY8I 2X1EA 1R71A 1Z7UA 3NWTA 1ZQ3P 5EZHA 1WJFA 1BOAA 1HSJA 3CJRB 1L3LA 1OR7A 3LQRA 1MW7A 5E8IA 4AUXA 5J1YA 3ZMTA 2CYYA 2HPIA 2L7KA 3GF2A 2NNNA 3DP7A 4RGXA 2VOPA 1OLTA 5GPCA 3WTTC 4DJAA 5DYMA 4BJ6C 3S1QJ 3F8BA 4IZZA 1JGGA 4KITB 3LSKA 2DA5A 2XB5A 2ZKZA 2CGPA 2Q2EB 2LG4A 2HEOA 4XLAA 3AL0C 1YITI 3AL0B 3GBGA 5IPAA 4HF2A 2Y9ZA 3LA2A 1R23A 1YI2I 5E20A 3S1MJ 1U3EM 3F3XA 2A68F 3MCZA 1W1WE 1K6YA 3OYMA 2YX7A 4ENKA 2WAFA 4NHJA 4Q48A 4L0ZB 4L9VA 4XOTA 4FX4A 5J47A 2JZYA 1VTNC 1XS9A 3L1PA 2BOLA 3F6VA 3KPHA 3RQIA 4G6DA 4BHCA 2DT5A 4BHPA 2H6CA 1V5GA 1ZELA 2OUMA 2CQKA 4ZDPA 1UB9A 2CH0A 3OYNA 4UVAA 3OMYA 1NK2P 1R00A 3S15J 4AYBA 1F36A 3HOXJ 1UELB 2F4IA 2OQGA 3GFJA 3H0GJ 4IHSA 1XDUA 3SYTA 4U88A 2EQRA 1IV6A 1GV2A 2M30A 4ZYHA 2VKDA 1H8AC 2R7TA 3D5LA 3GXOA 2B7EA 4HG2A 3QRFF 1ZHFA 5DUIA 4CCKA 3RKYA 4UXNA 1ZK8A 4KT6A 2HOTA 3J7YJ 2HQ5A 2E7XA 2BW3A 3BQZA 1HQCA 1WI9A 3I59A 3WTVC 1IN7A 3LWFA 2R7FA 3BC8A 2E1NA 1ZTRA 4Y7NJ 2GQQA 1LEAA 3EYYA 3PJRA 4I7HA 5AIPA 3OIPA 2FRHA 1Z77A 4C2MJ 3ESWB 1RUNA 3I4MJ 2AXTC 5IOZA 1TW2A 4U0YA 4XL9A 3K2ZA 3DPUA 4UVCA 2CW8A 2FUG2 3HEFA 1REPC 4LIVA 4DGWB 1AKHA 4LLGF 4LG0A 5HOOA 3CP8A 4IVNA 4DYRA 1RI7A 1A31A 1J59A 3W6KB 2CS3A 3C2GA 3H9QA 2LC2A 2E7WA 2I8DA 3IC7A 2IP2A 1T0FA 1X1CA 3IRQA 3M4OJ 3LQQA 1XG1A 2IVMA 4HBLA 3LAJA 3ROUA 2EILH 2VC1A 2PJRB 4BE0A 2MGQA 4P5OA 2BVMA 2RNJA 4MFDA 2NVQJ 4N4NB 2RQQA 1USTA 1IV8A 4XSXF 2Y0SA 3OOPA 3K4CA 3K10A 4AIDA 2M34A 1F4KA 2G7HA 1X2NA 3S8PA 3P9CA 1K78A 3EQLF 5BMZA 5J8CA 4O5VA 5L3BA 1Z05A 2ZXIA 3HM5A 3FMSA 3CC4I 2XVCA 1H89C 1EF4A 4WXHA 5J4VA 1ETYA 2R4GA 1VQ8I 2P5KA 4CCNA 1SAUA 4EEFG 4YELA 4JOMA 3BR6A 2Q8KA 4BKXA 2NYXA 3OS2A 5M5XJ 1W5TA 4B48A 1KA8A 3A0HC 4R8HA 4IO9F 1R49A 3QYEA 1T6SA 4N4OB 1HF0A 2VKHA 3K4KA 1X3UA 5FKMA 2M1BA 1SD6A 3IL2A 1B9NA 3EETA 3GMEA 4ANJA 3KZIC 5GTHC 1VQOI 1QNTA 3JREA 1RNLA 2NNYA 3G1LA 2PMZA 3AFHA 3F23A 3HB9A 1R5ID 2GAUA 4XKWA 3HRTA 3ZP5A 1O7LA 3HDDA 3JRBA 2IA0A 3QU6A 1RETA 4QPOA 3S1RJ 2MC3A 4YIRX 2FF4A 1LDDA 4F91B 2VUMJ 2L9NA 3DWLE 4EJOA 4X0GA 2ZC2A 1GT0C 3OS1A 5TGTA 4MLOA 3QP6A 5FD5A 2VPLA 4NC8A 2JWTA 4LB6B 4BQOA 1D5VA 2VODA 4KISA 1UMQA 1TP4A 2BY2A 1HCRA 2B9SA 2MH2A 2K40A 3RZDJ 2XSJC 4HNUA 4WF2A 4M3DA 1T39A 4HLXA 2VC0A 1WFXA 5H2FC 3V8JA 1LJ9A 4Y15A 1XC5A 1MNEA 1JTYA 1R22A 2NS8A 2YX4A 5E3MA 5EZGA 3GCMA 4BXXJ 3OSFA 1LFUP 1FY7A 1OYWA 1B1BA 2DA1A 3IKVA 2ZNZA 1BN5A 3S32A 5DUKA 3CCEI 3TBIA 5D8KB 4MGRA 4F52A 1ZRCA 3C2HA 3L2QA 5F0FA 1ZN2A 3ECOA 4M3FA 4XKVA 1QZZA 3O8HA 4FCYA 2HKOA 3F8MA 2F5EA 3QOEA 5KNLA 1WJDA 3HOYJ 5J3LA 4CCMA 2L9VA 4NQWA 3I56I 2FBKA 3GVAA 3PFYA 5C4XJ 2CWEA 4IXAA 3LSRA 3P5JA 5K5RA 1ZLKA 3F22A 4ESBA 3ZQ7A 1JKOC 2W1OA 4A0XA 1OCRH 1NG6A 3ASNH 2HWVA 4AU7A 4B3XA 1OCOH 4CCJA 1CGPA 3ZQLA 2MFZA 5BNGA 1QBJA 1S5LC 5KAIC 5D5WB 1ZG5A 3GTLJ 2PQ8A 3I4PA 1DUXC 3S2DJ 3CDIA 2OTLI 2EJRA 4HV5A 5IY5H 2NVUB 1G3TA 1MGTA 3OV8A 1KGSA 3DBLB 3LSMA 2D45A 1FBQA 3DTIA 4IHTA 3IAM2 4II2A 4ZTJA 1LFBA 1G4DA 5L3GA 1G2HA 1PUFB 1TWCJ 1QGPA 2DFIA 1VF9A 1RC9A 3QPTA 3UKGA 3I5UA 2R7OA 4FASD 3CMYA 2I10A 1R5GA 4DYQA 4A5NA 1VQLI 5JHFA 3CUQA 2DA3A 2YU3A 2E35A 3TGNA 5CQEA 2W7NA 1X4PA 3CCYA 2XKOA 3WG9A 1Y0UA 3H35A 1MSEC 3MN2A 2WC2A 1TQIA 3S93A 1RPWA 3OR2C 4BQQA 3H3VK 4A3EJ 3H0DA 3HSFA 5HDKA 4PZJA 3GZ5A 1TQPA 4HRIA 2P5VA 4YFNF 2M4GA 2L01A 4B44A 4GO1A 3G73A 4FETA 3MD2A 4LG3A 4WCGA 4BXUA 2IJLA 3SXYA 2LBFB 2V1XA 5D6FA 2R7QA 3LSJA 1IN5A 1PJRA 3KP5A 1G8XA 2STWA 2XKPA 3VPRA 4MEYF 5ICGA 1SFOJ 4BY1J 5IT9K 1N77A 4RM2A 1FEXA 1ODDA 4BBSJ 4LOCA 5GAEJ 5CVUA 2HDDA 1T38A 1R9TJ 3P9KA 2XASA 5DDGA 3KEQA 4CZZA 5JHUA 2PN6A 3HYIA 2BY0A 3KLOA 1T33A 3EDPA 2EFOA 3K1PA 2DMNA 2PFBA 1Q1HA 1ETWA 1UHMA 2WY7Q 2H6BA 1XX5A 3BY6A 1YOVB 2V1UA 1TWFJ 1BI2A 3E6CC 3R6SA 3SJMA 2OA4A 3MKYB 1KQ8A 4KN4X 2EFWA 3KEYA 4M3GA 4IHWA 1Y56A 3D5SC 4PGHA 1Z21A 1SFEA 4I0AA 2W25A 2N8GA 1BW6A 1Z3XA 2F6CA 1HLVA 3PUFA 2QCOA 2WB1N 1AU7A 3KP7A 4CHUA 2V7FA 3M9AA 5EF6A 3JSOA 4GYGA 1Y1WJ 1DDNA 2PJPA 5FB2A 1WSUA 4EM0B 4HA8A 2GOMA 5AIQA 4F3QA 3K4JA 1XGNA 4A0ZA 1XDSA 2VQHA 2R5ZB 3RPUA 2VONA 4HW0A 3GTPJ 1MH3A 4S04A 2V1DA 4XKCA 5L3EA 3SQNA 1I27A 3O3KA 4RAZA 1X19A 2LOOA 2PX9A 3FK6A 2A07F 1CF7A 4E7SA 3QPSA 2LVSA 3IWFA 1D1AA 2DJIA 4BNCA 2AXLA 4E7HA 2P5LC 3H3UA 4LLNA 4CGZA 3DKWA 3FK7A 2YU9J 2V6CA 4KN7X 4OWRB 4PK4A 1MIJA 2Z9OA 3CJQB 2LK2A 2AHQA 2OCEA 1TQMA 2ZFWA 4B1RA 2R5YB 3RQ4A 3V7SA 5CVJA 3TOAA 5FRMA 2E60A 1R1VA 1SANA 3MMYB 3L2WA 2OQRA 4HX7A 1D5YA 2DQLA 2G7UA 5DCFA 1JTXA 1TWHJ 1S8NA 1WH7A 1Z9CA 1JHFA 1F5TA 3J81K 3FX3A 2E71A 4A3FJ 3HRMA 4UUSA 1YIJI 3M8EA 1F43A 4OMZA 4M72A 4G7ZF 1JHHA 4XLNF 1PUEE 3VOEA 1FYKA 3K4LA 5JFRA 4KICA 2IBDA 2P6TA 4C2UA 2A05A 4F7ZA 2K85A 4HF0A 3RDIA 3F6OA 2V1NA 2NS7A 5GADJ 3K4NA 3C18A 1P9QC 2FQ4A 2JA6J 1FIAA 3GW2A 1BIBA 1P7IA 3KP3A 3RKXA 4CICA 2YS9A 4WK8F 1NK3P 4QSHA 2M2EA 4G9YA 3PUBA 5EDNA 1TC3C 3OIOA 1JT0A 2I5UA 3CCMI 3G71I 4F55A 4C3IJ 3CDLA 1YS6A 2ISYA 2ME6A 1YW8A 1HXDA 2ELHA 1OMIA 3MKZA 3QPHA 1LDJA 1YTYA 2H27A 2X48A 4NDLA 3E6MA 4YIFA 4UV8A 3N4MA 1K4SA 1FOKA 3F9KA 3PIPF 3BPVA 4IKFA 3HL2A 3I58A 2NVTJ 3TDZC 4PDKA 1EH7A 3OY9A 3ELKA 4QWQA 3K1NA 2OZ6A 1GXQA 1YE9A 1WJBA 1BM9A 4ZYDA 4BJTA 2DW4A 2XUBA 2O9LA 4Z2YA 5LEJA 1MH4A 3ZMDA 4ASNA 3BCAA 1HW2A 1GVDA 3O2PE 1U5TC 2O03A 3L2RA 4RGSA 1VQPI 4FT8A 5EGOB 2QLZA 3OYBA 2L7ZA 4QPQA 1IUFA 1MKMA 1B4AA 2P8TA 4HDUA 2DTZA 2LY2A 3ZQCA 6PAXA 3FIWA 5ED4A 1O57A 2X0LA 3SZTA 1UG0A 3WTXC 3I4NJ 2V4JC 4AD9A 2ETHA 3NEUA 2EV5A 3ZN1A 3ABUA 1XSDA 4CYCA 2XRNA 1B72A 4BDZA 3KCCA 2FSWA 4E4HA 3KYCB 3MFKA 2ZJ2A 4RAYA 3JRHA 2QSGX 1TT0A 3RYRA 5HLHA 3E5UA 1WVRA 1K61A 1I1SA 3L00A 4MFEA 2IGOA 2P7VB 1MBJA 3BTIA 3CZ6A 1WKMA 1Z91A 4EGZA 3ZRGA 4BE1A 1Y8RB 3FXLA 3K4BA 2KLOA 4GDFA 1OQYA 2M0CA 3V42A 4LFUA 2HOEA 1IDZA 5C3EJ 3ERED 3L2UA 2KRHA 3U9GA 2A5YB 1FOXA 4KNYA 3DTEA 2DK8A 1BR4A 3Q9SA 1BC8C 2GIVA 5ILUA 2CUZA 2DPUA 3I3LA 3D0SA 5LBQA 1LQ1A 2KIFA 2Z5UA 2IRFG 4IQ4A 3M07A 5C4JJ 1MSFC 5FKNA 5KAFC 4M71A 4IHXA 2VQCA 1BJZA 3TO9A 1D1BA 3DKXA 2FNAA 2R0QC 1B8IB 2JRTA 3GFMA 4O6JA 3BWGA 4DBRA 4A93J 1JUSA 2QGUA 3HTUA 4IOAF 1SAXA 2Q2EA 2BY1A 3G6EI 3ISPA 1D0YA 1PVEA 1UCRA 3SDBA 3FWEA 4EQQA 3ZPLA 1UHWA 4DIQA 1Y6IA 2JN6A 2KJCA 1I6HJ 2MSYA 1TZLA 1P6RA 4P1WA 4PJJA 1LPQA 3S1NJ 2IS6A 3BCBA 4L9JA 4JK1X 2HTSA 1U9NA 1J09A 3DTKA 4A3LJ 2KDOA 1I3AA 2L3DA 3H36A 2ECBA 2MBFA 1FJLA 2MD0A 4LB5A 3QP5A 2WADA 2ZNYA 1XCVA 4RB0A 2F4MB 2CG4A 1IF1A 3G1OA 5LRSA 1FSEA 4M6YA 3GO5A 1VZ0A 1T08B 4M3BA 3VEPA 4RA2A 1YJ9I 1UFMA 1VQ7I 3GFLA 2DYRH 1KU9A 3TMOA 1IAWA 2Y0MA 4RLQA 1ON1A 1YX5A 2Z3YA 4KIGA 3KFWX 2L9SA 1BR1A 2HDCA 5TISC 4R1HA 3K69A 3M8FA 4DW6A 3A01A 4EGYA 2LF8A 2GLOA 4LD5A 1YHQI 4X6AJ 1ZR4A 2A6HF 4KFCA 1LFPA 2QWWA 1TW3A 1N25A 2DDAA 2HR3A 2WAEA 1M1EB 3FXUA 1T98A 3QAHA 2QYOA 3H5NA 2QM3A 2LF7A 3OL3A 1IDYA 3VDXA 1K6OA 1LE8B 1BBYA 1NH3A 1SD7A 5JI6A 4KJZA 4DBQA 3HBLA 4BBRJ 4ESFA 1FIPA 2O7OA 3ABLH 3SFZA 2ZXHA 4DQ2A 2F5CA 3KYLA 1PP8F 4D7MA 2K9NA 1A6QA 4PJNA 2HXIA 1G3YA 3G2BA 1PP7U 2X85A 4DYCA 1R1UA 2X51A 2CUFA 3IUOA 2DTRA 4RM3A 4CA0A 2X6YA 3RCOA 2VL8A 1BI1A 2EZLA 1E3OC 2XF6A 3A1YA 4EMSA 5F64A 2RVCA 2TDXA 5DM6F 2R7UA 1ACIA 3ZXSA 1G3WA 2ZBKA 3SZPA 3ABKH 3BJ6A 2Z2SB 4XBFA 4MTDA 4N9HA 3S16J 2M9HA 1MNDA 3W6VA 4JX6A 1OR7C 3AG2H 2OCCH 3BR1A 1ZLJA 1TNTA 2GOXB 1VQNI 2TRTA 1ZG3A 2K9SA 4PJMA 4XN3A 2ZSIB 3PL8A 3IP4B 2JQ7A 5BQTA 3HJEA 2D2WA 2AS5F 4GXOA 2RDPA 2K9QA 2K86A 4V19K 2EPFA 4XM3A 3Q0WA 4KMUX 5EEAA 2PBIA 5JVGF 1RESA 1WWXA 2V79A 2PG4A 5L3DA 1YO5C 2W82A 2UUZA 2VKVA 4LLLA 3S2WA 1QO0D 2OV7A 2A61A 5IOYA 2R7WA 5BOXA 3EYIA 4L9TA 1ZH5A 3L09A 1JI8A 2LTPA 3MEXA 1OCZH 3OL4A 1P4WA 2DFFA 4IHYA 4ENJA 3FDYA 3DCFA 1QPMA 3GEZA 5J40A 3K0LA 3ABMH 5B66C 4KA4A 1Y39A 3K7AJ 2VBZA 1SVLA 4GGGA 2DJNA 1ETXA 4H0EA 1KU2A 5E8GA 3X2QH 3ZQIA 4PJ0C 4Q4ZF 3GTKJ 1GLNA 2W85A 4V2GA 2UV1A 3HKZN 3BG9A 4A3GJ 3KP4A 1YQAA 3NARA 2VT3A 1ZARA 5GTIC 4A5MA 4G8XA 3FM5A 3E7LA 5FRNA 3R4KA 2QUFA 5HLGA 3F0CA 2PI0A 1TNSA 2Y0SN 3ASOH 3VYSB 3WU0A 3CDHA 3I64A 1Z6TA 3LFUA 3I9V2 3WE2A 2DQRA 5F0HA 3RI4A 1N75A 5DS9A 2ELKA 3BPXA 3CUOA 1WJCA 2MC4A 3NWSA 2MW8A 1V55H 3E0JB 1WPKA 4EM2A 2H94A 2DDBA 2ID3A 3HOUJ 3T0YA 5CYVA 4KMFA 3W2AA 3Q0VA 4HSTA 2KZGA 4A3JJ 1HSTA 2F5FA 3E6DA 1I6XA 2COBA 2XPUA 3TP3A 2E1CA 5F27A 4HOBA 3CCRI 1D0XA 2K7LA 2A69F 1JGSA 3TO7A 3KIOA 4IEJA 3V8LA 4FE7A 4XLFA 3FM3A 4NNJA 5D5XB 5HLTA 1IGNA 1DGWY 4Y52J 4G7HF 4ZJZA 2WBMA 2DT6A 1XPXA 1U2WA 5HS7A 3S14J 2QBYA 2E5NA 2WTEA 5ILSA 3M1CA 1O3RA 2Q0OA 3MVPA 1XMKA 1K78B 2PMZN 1DGRM 4FE4A 1QVTA 4P9UA 2XROA 4XOPA 4ENMA 5M3MJ 1P92A 3FXOA 9ANTA 2NOJB 2STTA 2A6TA 3S3OA 3T8TA 5JR3A 1STZA 3HOSA 4ZYAA 1MDMA 2HZDA 3HUGA 1J2XA 2UZKA 1X1AA 4ZC3A 5IT9Z 2FEZA 3ZMUA 3CJTB 3QYFA 2A3SA 2R7VA 5E3LA 2ADUA 3C1DA 3I0TA 3TL4X 1PUFA 4I0BA 3DBRB 2VIXA 4XORA 1O3TA 3QWLA 4HQMA 4CSWA 5BS6A 3TEDA 2ESNA 2HZTA 5K5OA 2E2IJ 2F5VA 3K9TA 3B02A 5FFZA 5CKTA 3G3ZA 3WTYC 2Y30A 2DA2A 5IP9J 3QPLA 1XB4A 2X6XA 3CCUI 4YFKF 1MJBA 2RNGA 2QKLB 2ACJA 2Y2ZA 3BZCA 2KRCA 2QA4I 2XAJA 4AM3A 1USSA 3KLNA 2GXAA 4LIUA 3IHUA 4DZJA 4ZH4F 3SEZA 5A2QK 3HC7A 3H9GA 1WZ2A 2OAZA 4IL6C 4XKBA 4U87A 1OYYA 5BPDA 2WA0A 5LHIA 4BYYA 2RV8A 1R7JA 2EFQA 2YR2A 1QHGA 3JRFA 1W4MA 2M7AA 1U8RA 1IC8A 3BJAA 2O3FA 2CFXA 2ISZA 1ETOA 2EIKH 2FBIA 5DCMA 3V4GA 3JSPA 4PUSA 3DEWA 4YRVA 1RUOA 4I6ZA 1AOYA 3LSGA 4S0HB 4HZFA 1UAAA 3MAJA 4BQAA 1LEBA 1D0ZA 2H1KA 2R7DA 5EEHA 4B8XA 3GWZA 2BYVE 3SEQA 1CQTA 3F8NA 5JLWA 2CUJA 1AWCA 2MH9A 2UXXA 2XPWA 2C6YA 2H1LA 1DPUA 1J7KA 3H92A 4LGWA 4V2FA 2CQQA 3MKWB 1MBHA 4G94A 4C3JJ 5AONA 2BE5F 2XAQA 1WI3A 4E7JA 1EH6A 3ZN0A 3A03A 1MMNA 1OPCA 5FLXK 3HPHA 1DP3A 4I01A 1XMAA 3J81Z 4A6DA 1E3PA 1FX7A 4Y4RA 3ZGKA 4A2UA 1FLIA 4KIFA 3EUAA 3VFZA 4BL0B 2X9DA 1VFCA 2M3AA 2XGEA 3DLAA 3JAMK 4BE2A 2R5ZA 1YW9A 2RKHA 2V26A 3FXKA 2DN0A 2LRDA 2QEXI 2GZWA 4I98B 4CCLA 1LNWA 3ML6A 1J75A 2HS5A 3VODA 3AKZA 1FP2A 4Y3OA 2CQ7A 4C9YA 5EG0A 2VE9A 5HNFA 4XRFA 2FE3A 2VE8A 4BXFA 4UV9A 4IRIA 3BTLA 5KCMA 1SC7A 3FHNA 2LY1A 1WJAA 3OOUA 2HI3A 2NRAC 1H9GA 2IXSA 1O3QA 3CUQC 3CUQB 1JJ6C 2K3PA 2WB1A 4LK0F 2TCTA 2GXGA 2HOAA 1JXSA 2CJJA 2LP0A 2R5YA 1C0WA 2HYFA 2L02A 4I2OA 5F08A 3MZYA 3DLLF 1KU7A 2B63J 2ZXWH 3TKYA 2RGVA 4B09A 3ZMVA 2LNBA 1QPIA 4GCVA 2XGCA 3OYIA 3GTGJ 1HW1A 3F8CA 2RAEA 2X1DA 4HQEA 2L4MA 3Q3SA 1GUUA 4H4KC 3DKYA 3PM1A 3K1MA 2O8KA 3HXLA 4M73A 4XLEA 2NVYJ 2QF7A 2JA8J 3CMEI 2M8EA 2IGMA 5FROA 4HX8A 3ZMZA 3BLYA 5B1AH 2F2EA 2M87A 3DU5A 3TQNA 1ZGJA 2H09A 2VJ4A 1AA7A 2VJJA 5LLQA 4ENNA 2DMTA 1I50J 3JTGA 1BC7C 1KQ0A 4CXFA 2V6EA 5D4SA 2K27A 4A12A 2HFHA 1K4TA 5E17F 2YPRA 2LY9A 1VI0A 3VSLA 3WTWC 3WHCA 1APLC 4BUPA 3DEEA 4XMYA 4RAFA 4CYDA 4C2TA 2E1MC 1IUYA 2E1MB 3K2AA 1XGSA 4ON0A 4BU2A 4JX4A 1S29A 4QLCU 3B73A 5E18F 3CCJI 1WCMJ 3WE3A 3JW4A 3JRCA 4EJWA 1MMAA 4HEA2 1Z67A 3HHGA 1MD0A 1IJWC 1IXRC 3BR2A 1TBXA 1B6AA 2Z1DA 1LKXA 4PFOA 4ZTFA 1H0MA 3BR3A 1X1PA 3HG9A 3WU2C 1BOBA 2WAQN 2EFPA 3IWZA 1MJ9A 2P81A 3REOA 3FZVA 2E2JJ 1GV5A 2KPMA 1JUPA 1U0JA 3SDGA 2X6OA 5LRRA 1EV7A 2H8RA 2VBXA 2K4JA 2X6WA 1X1DA 5FO5A 4CCOA 4DNCA 2ZJRF 3J7AY 4A3DJ 1V4RA 5HS8A 5E1WA 1POGA 3JR9A 3LSPA 2HXOA 2FA5A 4GRIA 3BJOA 1U5TA 5EGOA 4XRSA 2L54A 2JPCA 1BW5A 4RGRA 5K7ZA 1R36A 1MMDA 1S7AA 2KIMA 4U7BA 3AG3H 2Y9YA 3LSTA 4KYWA 2R7ZJ 2NOGA 3GTOJ 4LJZF 2PLYA 2EBIA 4XSZF 3W6JB 3AAFA 2EIMH 3RIRA 1BA5A 1LVKA 5D5VB 4Q5SF 1R4NB 5DEQA 3HOTA 1XD7A 4BACA 1NTCA 3OIQA 3D5RC 2CQNA 3R61A 3OYDA 3LOCA 4RB1A 1XTAA 5GAHJ 3MZ8A 2O8XA 2DFEA 4MNUA 2QENA 4GFBA 2GWRA 2UWMA 3J7ZI 3JRAA 3R60A 4YFXF 3T8RA 3U2RA 2WY8Q 2CV2A 4KDPA 5H6RA 4HF1A 4UUVA 3ZOBA 4RMNA 3Q9VA 1Z1DA 4QIWN 2F4OB 3FBNB 5J6XA 5LEKA 5CPRB 4XRMA 3OYJA 3J80Z 1W5SA 3RKWA 2BHZA 1U8BA 4MQ9F 4FQGA 4PJLA 1UJ8A 2P4WA 4D7NA 1Q1VA 5LGUA 3LSHA 4YG2F 2O6GE 2CU7A 2QZ8A 1FNNA 5GAGJ 2M5WA 1ZRFA 2MD5A 1ONVA 4PGGA 1VQKI 1LB2A 2KHMA 3IH3A 3QU3A 1SEUA 1FT9A 2IA1A 4M3EA 1D8JA 4BAYA 4E7KA 3WGGA 4B43A 4GYIA 1Z0XA 1HA8A 3RPQA 3PIOF 2M0MA 5IYBJ 3K4MA 5TRDA 3E5QA 5B5EC 4I02A 2DYSH 3H3ZA 5B3SH 5JLXA 1PDNC 1DU0A 4UHTA 3F72A 1ENHA 3Q0UA 5LGNA 3WODF 2L4AA 2G9WA 1RIOH 2ESHA 1TL8A 3CP2A 2LKXA 3EUHA 2DMPA 3S3MA 2YSRA 1RRJA 5BPIA 1X3ZB 1R5HA 4JQFA 2ID6A 2GA2A 2MG4A 4KT5C 2ZMEA 1G6NA 3TW6A 2FOKA 2HVRA 2Z16A 5FGMA 2R7SA 1D8KA 1MZBA 3KZZA 3WGIA 3P7NA 5LGTA 3QOPA 1R4MB 1Y8QB 4G7OF 2Y31A 2D1HA 2GXBA 3G1MA 1HOMA 4X1EA 3T5XA 2V9VA 3CCQI 2DLLA 1I5ZA 5K7HA 2J5PA 1BJAA 2VI6A 1ZKGA 1EH8A 5EJCA 2GA1A 1S9HA 1ZR2A 1QZEA 4ITVA 3F21A 4L0YB 2RN7A 2UXNA 4RS8A 3WTUC 1HKQA 1PYVA 2XAUA 2AQEA 1S6LA 2HNHA 2OD5A 3OYKA 1VQ9I 2VT2A 1MBKA 3CMMA 2CUEA 3OSGA 4QTRA 3Q5FA 3BTCA 4J19A 3KZYA 1H9TA 4CYCB 2R7RA 1Z7LA 4BGDA 2ZJQF 1IN8A 1QZYA 1SVMA 3AG1H 2CQXA 1G59A 2DOEA 2VPRA 2LMDA 4AIJA 4MO7A 1V3FA 1GHCA 2QQBA 2M4KA 2VJIA 2RREA 1N78A 2NVXJ 1GDTA 2QKMB 3VB2A 2BBYA 3DBHB 4IRGA 5GP9A 1W7PB 1W7PD 2EWNA 2JVHA 2KL4A 2DU9A 5D5UB 1A35A 3RJPA 3C2BA 2A6EF 4J00A 2ZJPF 3CO6C 2VOOA 3IKTA 3EPZA 5L3CA 3I71A 4XNFA 1RZ4A 4ABZA 4HV6A 3W3CA 4OAYA 1FZPB 1I3QJ 2XF5A 1YFHA 2XIGA 4XQFA 3J7AO 1FTZA 3FXMA 1YRNB 3L7WA 2KZVA 1OKRA 4BS9A 5IT3A 4BEHB 5C44J 1P4XA 4NC6A 1YG2A 2XGXA 4E70A 1VNDA 3E6BA 3ULQB 4HX4A 2LFBA 3IRRA 4FX0A 3L2VA 3QODA 2EFNA 2VASA 4M9XA 3I53A 1JE8A 2BGCA 4XLCA 1WQ2A 4RGUA 3CF5F 2LKPA 1HBXG 3DFGA 1FOWA 4DOZA 4B4CA 2WWYA 3DQVC 5FKKA 4ZZLA 5E3NA 3MZHA 4FISA 3K70C 1TTYA 5DTDA 3K70D 2XB0X 3CC2I 2K3FA 3B6CA 2ZO4A 2IGNA 2D1VA 4K2EA 1U78A 1A36A 5K1YA 2E1OA 1RR8C 2IT0A 4F92B 2FU4A 3P9IA 2VJ5A 4JP0A 1KU3A 1RR7A 4D1QA 1X2MA 1Y1VJ 2PJRA 2E36A 4CZCA 4JYKA 1LDKB 5E79C 3OYEA 5D4RA 4AYBN 5DV5A 2P0WA 4MHGA 2PMHA 5ICCA 2XAFA 2BHYA 5CVIA 3A01B 4XIDA 4E7IA 2IS4A 2HVQA 3HIFA 2P7CB 1BL0A 3M8JA 4E6KG 3PQKA 1XSXA 4NUBA 5IYDJ 2L9RA 3GLXA 1MJAA 3U1DA 1JJ8C 2MYSA 3OYCA 2HYJA 2XSDC 2HU9A 4AVPA 2VB6A 2JUCA 2VN2A 4I09A 3WTZA 2YUSA 2DCEA 1F1ZA 2HKXA 5F1JA 3GZ6A 4HNVA 5F04A 1WH5A 1XMXA 2DMUA 2KRFA 5HODA 1WRJA 2XRLA 2JTVA 4WXCA 4OU0A 1WGXA 3PSFA 4LK1F 1SFKA 3NAUA 1JUMA 1XGMA 1I1GA 3FMQA 3MWMA 3PNVA 5E3OA 2V9PA 4BY7J 2QVOA 4OIRF 1D1CA 3HKZA 3OYLA 5M3FJ 2KIQA 3FF5A 4IOCF 3OYAA 2RQPA 2EZIA 1P4AA 1KONA 3TW7A 4II3A 5ICEA 1IRGA 2BW3B 3I59B 2HQRA 4AC0A 3TOBA 4NBQA 5CLSA 3HTSB 2DK5A 2R92J 1OCTC 2A5WA 5LD2C 2DXIA 2JT1A 3OWTA 1UZCA 2CO5A 1OCPA 3OYHA 4OIPF 2M8GX 2DA4A 4LITA 3FXJA 2BVLA 3IV5A 3HOWJ 2OBPA 4IJAA 5A2QZ 4ESJA 3NQOA 4M6VA 1HC8A 1X58A 2KDZA 3RSNA 3FXQA 2KISA 4F93B 1AKHB 4LG0B 2XV4S 4L9NA 3DU6A 3NRVA 3M7GA 3PFIA 3PQJA 1T0FC 5DD4A 2L0KA 4KUMA 2FMYA 3TDUC 2ZSHB 5LHHA 2OJED 3BG7A 4BH9A 4EVIA 2DPDA 2EB7A 3AG4H 1AHDP 2CW7A 3H9JA 1O4XA 1W0TA 3WTSC 5HS9A 3A2KA 1DP7P 2JUGA 2W57A 1J0RA 3KYDB 1VQ5I 2IGKA 1EKEA 3FKJA 5KVRA 1HKSA 3BG3A 2L2OA 4I99C 1QQIA 3HZJA 3GTJJ 1QA6A 2DAOA 1Z6RA 2E19A 3HGYA 1JKQC 2LKSA
chains in the Genus database with same CATH topology
3CC7I 1Y39A 3CCUI 1VQ6I 1VQ9I 3DLLF 3CCLI 4IO9F 1VQMI 1VQLI 2ZJQF 2QA4I 2E35A 1YHQI 5GAHJ 3G4SI 1VQOI 1MMSA 3J7ZI 3CMEI 1YJNI 1YIJI 3J7YJ 2ZJPF 1S72I 2FOWA 5DM7F 4IOCF 3CCSI 1YJWI 2OTJI 5GADJ 5GAEJ 5GAGJ 3CCRI 2E34A 1FOXA 1VQKI 5DM6F 1ACIA 3CD6I 3CCJI 3PIOF 3CCEI 3CF5F 1HC8A 3CCMI 3G71I 1FOWA 1VQNI 4UY8I 2JQ7A 3CC2I 1FOYA 2K3FA 3I55I 4IOAF 3G6EI 3PIPF 4V19K 3I56I 1VQ4I 2H8WA 2QEXI 2ZJRF 5JVGF 3CMAI 3CJTB 2E36A 1YITI 1VQ5I 1YI2I 3CCQI 2OTLI 3CC4I 1QA6A 1VQ8I 1YJ9I 2NXNB 3CCVI 1VQ7I 1VQPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 I;  1Y39 A;  3CCU I;  1VQ6 I;  1VQ9 I;  3DLL F;  3CCL I;  4IO9 F;  1VQM I;  1VQL I;  2ZJQ F;  2QA4 I;  2E35 A;  1YHQ I;  5GAH J;  3G4S I;  1VQO I;  1MMS A;  3J7Z I;  3CME I;  1YJN I;  1YIJ I;  3J7Y J;  2ZJP F;  1S72 I;  2FOW A;  5DM7 F;  4IOC F;  3CCS I;  1YJW I;  2OTJ I;  5GAD J;  5GAE J;  5GAG J;  3CCR I;  2E34 A;  1FOX A;  1VQK I;  5DM6 F;  1ACI A;  3CD6 I;  3CCJ I;  3PIO F;  3CCE I;  3CF5 F;  1HC8 A;  3CCM I;  3G71 I;  1FOW A;  1VQN I;  4UY8 I;  2JQ7 A;  3CC2 I;  1FOY A;  2K3F A;  3I55 I;  4IOA F;  3G6E I;  3PIP F;  4V19 K;  3I56 I;  1VQ4 I;  2H8W A;  2QEX I;  2ZJR F;  5JVG F;  3CMA I;  3CJT B;  2E36 A;  1YIT I;  1VQ5 I;  1YI2 I;  3CCQ I;  2OTL I;  3CC4 I;  1QA6 A;  1VQ8 I;  1YJ9 I;  2NXN B;  3CCV I;  1VQ7 I;  1VQP I; 
#chains in the Genus database with same CATH topology
 2CV1 A;  1W5C C;  2XF7 A;  1YS7 A;  2CSO A;  5FLX Z;  2EIJ H;  3RZO J;  4UUT A;  4L5I A;  5CVV A;  1TWG J;  1ETK A;  1R6R A;  3JRD A;  2FNP A;  3PSI A;  3JRI A;  4IRH A;  3V8K A;  2NS0 A;  3DF8 A;  3CO7 C;  1GVJ A;  1V5F A;  3HRU A;  2VBY A;  4P9F A;  3PO3 J;  1VQM I;  3JAM Z;  5KK1 A;  3A02 A;  4CH7 A;  1S3J A;  4U0V A;  3GZN B;  4E7Z A;  4UB8 C;  5FLV A;  2XC7 A;  4OOI A;  2JA5 J;  2WV1 A;  3FHZ A;  5F0C A;  3LNQ A;  1W36 C;  2DOA A;  1MNM C;  1W36 D;  2KKO A;  1FC3 A;  2EV0 A;  5ILV A;  2ICW G;  1MMS A;  4G6T B;  1FBS A;  2KQR A;  1FWZ A;  2JMW A;  5FFX A;  1ITY A;  3HSR A;  1F9N A;  1DQU A;  2OZU A;  5LFA A;  1HKT A;  1ZRD A;  1BI0 A;  4Y13 A;  1SFX A;  2DO7 A;  3S3N A;  2IAI A;  5KHD A;  4E7L A;  1MBG A;  3U1K A;  1YX3 A;  4RBO A;  4O3M A;  2DA6 A;  1UG2 A;  4C30 A;  1LUJ B;  4ZDL A;  3IAS 2;  1ZGW A;  4Z6Y A;  3WG7 H;  1V5E A;  2K9L A;  2OTJ I;  5GPA A;  3ZQQ A;  2LBF A;  2HQN A;  2EA2 A;  1XSV A;  2FML A;  2GIZ A;  2X4H A;  4HYE A;  4PCQ A;  4XLH A;  1R58 A;  1E2X A;  3DV8 A;  4EJV A;  5JVT A;  2KP6 A;  1P7J A;  2VQL A;  2BXY A;  4D5C A;  3GYH X;  2HVS A;  1ZGA A;  4A6E A;  2QBY B;  2OU2 A;  1EJ9 A;  5FKL A;  3ZQG A;  3CD6 I;  1DPR A;  1FPQ A;  1NG7 A;  2AQF A;  2EH3 A;  4B47 A;  2HPM A;  2EZK A;  4W97 A;  2B0L A;  2QSF X;  4P55 A;  5HVQ C;  2O61 A;  3CTA A;  2KFD A;  2OPT A;  1EA3 A;  1FMV A;  4IQJ A;  3CLQ A;  4AWX B;  3O6B B;  2LSO A;  3HPG A;  1E3H A;  1MDM B;  3HUG B;  2LD5 A;  5D6E A;  4B3A A;  3OYG A;  4JX5 A;  3VWB A;  2GM4 A;  2JVG A;  5CVR A;  1IN4 A;  3GFI A;  4XON A;  2L7F P;  5E1X A;  1O7F A;  1K7A A;  2MAB A;  3HOV J;  1ZRE A;  3ZR8 X;  4UVB A;  4A69 C;  1VQ4 I;  2BEO A;  3UNG C;  5TJJ A;  4HNT A;  3GX4 X;  2OF7 A;  1WJ5 A;  1H88 C;  1IRX A;  1XCB A;  2DT7 B;  2D5V A;  1YYV A;  5FLM J;  4MTE A;  2R93 J;  4NQW B;  3RTR A;  2IS2 A;  2BV6 A;  3KP6 A;  2OC6 A;  4M9S A;  4EM1 A;  4N9I A;  4PSX A;  3ZQF A;  3DEU A;  2K9M A;  4UB6 C;  4AIK A;  2HYG D;  1FBU A;  1X3W B;  2XAG A;  3O8G A;  1FYM A;  3CCV I;  1YW7 A;  2O5R A;  2LDU A;  3CC7 I;  5EYR A;  2DBB A;  3OYF A;  1WJE A;  4XLP F;  1W0U A;  4BHB A;  2NAZ A;  4IF4 A;  4DZP A;  3GTQ J;  1RKW A;  2G0E A;  1QRY A;  1OFC X;  4WX9 A;  3BZK A;  4BDY A;  3A4C A;  1G3S A;  4HSR A;  3BR5 A;  4HDV A;  4NC7 A;  5EEG A;  1A5J A;  1HW5 A;  2MA3 A;  2Y48 A;  4L5E A;  1QU3 A;  1OYI A;  2ZXJ A;  1DU6 A;  2XPV A;  4EV0 A;  3LSI A;  4OIN F;  1T2K A;  3LAP A;  5DCM B;  5HLI A;  1P2F A;  2FJ1 A;  2VBW A;  4D0P A;  4J01 A;  3BG5 A;  2HGC A;  3QQA A;  2AO9 A;  2F5D A;  2W84 A;  2HDW A;  3VSK A;  3KP2 A;  1S72 I;  4PSW A;  3WHB A;  1I39 A;  3SHF A;  2FD5 A;  1O3S A;  4ETS A;  2LH9 A;  3RYP A;  1ZYR F;  5L3F A;  4IHV A;  4U7D A;  3GTM J;  2DFH A;  1KYZ A;  3E1S A;  3V7C A;  5J1R A;  1XGO A;  3M1E A;  1ZAO A;  4AIH A;  2QQ8 A;  2F48 A;  4IPA A;  3W2V A;  1L0O C;  2CV0 A;  1XN7 A;  3CF2 A;  2ZCW A;  3H1C A;  3JTH A;  3E3V A;  2XHK A;  3DPL C;  2QQA A;  1IXS B;  4D9J A;  2X1C A;  3DXJ F;  4P96 A;  5D8L B;  2ZB9 A;  2VKE A;  2XDV A;  1FMW A;  1B9M A;  1J9I A;  2DI3 A;  5F1R A;  2JSP A;  2CW0 F;  2MLG A;  4JBA A;  3SFI A;  3BP8 A;  4MEX F;  3LFK A;  4RDU A;  1IXC A;  4YII A;  3R0J A;  2VXD A;  3K6G A;  1GXP A;  2IPQ X;  1FTT A;  3KE2 A;  4XK4 A;  1WHU A;  3HRS A;  1KZH A;  2IEK A;  3M3Y J;  4HLY A;  1SFU A;  1Z3Y A;  5EG0 B;  2GBY A;  1U9O A;  2QQ9 A;  5HDN A;  5ERI A;  4I76 A;  3ZQH A;  1T8I A;  1IRF A;  1MBE A;  2H8W A;  1FP1 D;  3U21 A;  3L2C A;  1A04 A;  2BXZ A;  2L5Q A;  3CMA I;  1A6I A;  4XRS G;  2JA7 J;  1OCC H;  3CJN A;  3VYU B;  2LLK A;  4OMY A;  5E1Z B;  3PNT A;  3MQ0 A;  3L9F A;  3WGH A;  3OR1 C;  2MLK A;  2P6S A;  1X4O A;  3BTJ A;  5HDG A;  1RKT A;  3ERM A;  2WAQ A;  3FIS A;  2NXN B;  3PNY A;  1FYL A;  4U0W A;  3HGG A;  1X1B A;  3RPU D;  3BOQ A;  1KQ9 A;  1MBF A;  3C3W A;  2BY3 A;  2VLA A;  5K5Q A;  1ORK A;  3DPT A;  4Y17 A;  5ICF A;  2E2H J;  3V7R A;  1T95 A;  1E0E A;  2M45 A;  2CMP A;  2J5O A;  2PMU A;  3IH4 A;  4WWC A;  1Y0N A;  3CCL I;  1JKR C;  3LA3 A;  2R7X A;  2LRE A;  4L5J A;  1U6G A;  4M6X A;  5FD6 A;  1CF7 B;  5J1U A;  5IP7 J;  4BJ5 C;  3LA7 A;  2FXA A;  2DMQ A;  1SD5 A;  2WV0 A;  2DOF A;  5LHG A;  4IX7 A;  3G4S I;  3N05 A;  4FHT A;  2K5C A;  5B1B H;  2VQG A;  2DA7 A;  2IW5 A;  3S17 J;  1K83 J;  3R0A A;  1HDP A;  4OIO F;  1QVU A;  2Z33 A;  1KYW A;  3ONQ A;  4OAZ A;  3HSE A;  2KMU A;  1SD4 A;  2PEX A;  3A0B C;  5HNH A;  4R79 A;  1K79 A;  1ULY A;  1TT5 B;  1IW7 F;  1HDD C;  2JA2 A;  1OJL A;  3BQY A;  4CUG A;  2FOW A;  3H5A A;  3PO2 J;  4XN0 A;  2M7B A;  2Q1Z B;  3UR3 C;  1S7E A;  4AVZ A;  3WU1 B;  1ON2 A;  1QHH D;  3CCS I;  4XIC A;  4TV7 A;  4UUS B;  4FTH A;  3LL7 A;  2E5Z A;  4RLF A;  3T1B A;  2XAH A;  2EZH A;  1T56 A;  2DOD A;  3GUD A;  2E34 A;  1UHS A;  3QYB A;  1SVO A;  3SZG A;  4BQN A;  3ZMS A;  4OIQ F;  3COA C;  3B6A A;  3CES A;  4M74 A;  3MKL A;  1D3Y A;  2L7M P;  3H5R A;  2QSH X;  1ETV A;  5IYC J;  3S2H J;  4Q47 A;  4EJU A;  3TP0 A;  3FKI J;  3KET A;  2IA2 A;  4A3C J;  1J5Y A;  4ZDO A;  3KX2 A;  3BDD A;  4MQV A;  1ERD A;  2ZFU A;  1FOY A;  1IN6 A;  2W24 A;  2EIN H;  1U5T B;  1TWA J;  2KT0 A;  3I55 I;  1IO2 A;  2JK3 A;  4WXD A;  4EAT A;  2W48 A;  4HPQ A;  2IS1 A;  2JRM A;  4KIB A;  2V9K A;  1B59 A;  4NB5 A;  2HTJ A;  1B8I A;  2KIU A;  3VYT B;  5F6F A;  4G6Q A;  1JT6 A;  3ABT A;  2BZT A;  3BZ6 A;  2FX0 A;  5M5Y J;  1MMG A;  3F8F A;  3OS0 A;  5CQG A;  2EK5 A;  3RKQ A;  1E17 A;  2ELJ A;  3FMR A;  5J8F A;  2JSC A;  3C7J A;  4MIM A;  1TLH B;  3E5X A;  4W1U A;  2RC4 A;  3KEO A;  2FQ3 A;  5IP6 A;  4Y33 A;  4ZYG A;  5J4Y A;  1ZG1 A;  2Y75 A;  1BIA A;  3LMM A;  3HOZ J;  3FBI B;  4XR6 A;  2XGD A;  1VQ6 I;  2ECC A;  5CJ9 A;  3CLO A;  2ME0 A;  1YIO A;  2CFO A;  4G12 A;  1LVA A;  5FKO A;  2LYC A;  1IZ1 A;  2K4B A;  4ZZD A;  2KJB A;  1SMT A;  1W7P A;  3W2W A;  3I54 A;  4A3I J;  2Z99 A;  4A3K J;  2R3S A;  2JPB A;  1ETQ A;  2EA4 A;  2EV6 A;  4PFP A;  4D5F A;  3ECH A;  4RAG A;  4L18 B;  4LMY A;  5M5W J;  3FXR A;  4S05 A;  4HAM A;  3BRO A;  4RB3 C;  1YLF A;  2JJ7 A;  5FJ8 J;  1SMY F;  4UNO A;  1YJN I;  4EJT A;  4ZYE A;  2FBH A;  2W00 A;  3E97 A;  2LR8 A;  1YRN A;  2W4S A;  4CO8 A;  1V54 H;  1BI3 A;  3CQZ J;  4A0Y A;  4BEH A;  1IRZ A;  1B72 B;  5DM7 F;  4RB2 C;  1LE8 A;  4CDG A;  3GLL A;  2CRG A;  3BG6 A;  1YJW I;  4M9Z A;  4A3M J;  3IH2 A;  2HOS A;  4C3H J;  1S7O A;  3ZCO A;  3JRG A;  4A3B J;  3HHH A;  4YEJ A;  3D1N I;  3BR0 A;  1IG7 A;  2K02 A;  2VXZ A;  5K7F A;  5H20 A;  4N0B A;  5DD8 A;  1JKP C;  3BT9 A;  3EUH C;  1NHA A;  3JCU C;  3VYR B;  2Y69 H;  3EUK L;  1OIS A;  2COM A;  1BR2 A;  2ZME C;  3N97 A;  1FSH A;  2O0Y A;  2ZME B;  3J80 K;  5H6Q A;  1R1T A;  2HQA A;  3TO6 A;  4UY8 I;  2X1E A;  1R71 A;  1Z7U A;  3NWT A;  1ZQ3 P;  5EZH A;  1WJF A;  1BOA A;  1HSJ A;  3CJR B;  1L3L A;  1OR7 A;  3LQR A;  1MW7 A;  5E8I A;  4AUX A;  5J1Y A;  3ZMT A;  2CYY A;  2HPI A;  2L7K A;  3GF2 A;  2NNN A;  3DP7 A;  4RGX A;  2VOP A;  1OLT A;  5GPC A;  3WTT C;  4DJA A;  5DYM A;  4BJ6 C;  3S1Q J;  3F8B A;  4IZZ A;  1JGG A;  4KIT B;  3LSK A;  2DA5 A;  2XB5 A;  2ZKZ A;  2CGP A;  2Q2E B;  2LG4 A;  2HEO A;  4XLA A;  3AL0 C;  1YIT I;  3AL0 B;  3GBG A;  5IPA A;  4HF2 A;  2Y9Z A;  3LA2 A;  1R23 A;  1YI2 I;  5E20 A;  3S1M J;  1U3E M;  3F3X A;  2A68 F;  3MCZ A;  1W1W E;  1K6Y A;  3OYM A;  2YX7 A;  4ENK A;  2WAF A;  4NHJ A;  4Q48 A;  4L0Z B;  4L9V A;  4XOT A;  4FX4 A;  5J47 A;  2JZY A;  1VTN C;  1XS9 A;  3L1P A;  2BOL A;  3F6V A;  3KPH A;  3RQI A;  4G6D A;  4BHC A;  2DT5 A;  4BHP A;  2H6C A;  1V5G A;  1ZEL A;  2OUM A;  2CQK A;  4ZDP A;  1UB9 A;  2CH0 A;  3OYN A;  4UVA A;  3OMY A;  1NK2 P;  1R00 A;  3S15 J;  4AYB A;  1F36 A;  3HOX J;  1UEL B;  2F4I A;  2OQG A;  3GFJ A;  3H0G J;  4IHS A;  1XDU A;  3SYT A;  4U88 A;  2EQR A;  1IV6 A;  1GV2 A;  2M30 A;  4ZYH A;  2VKD A;  1H8A C;  2R7T A;  3D5L A;  3GXO A;  2B7E A;  4HG2 A;  3QRF F;  1ZHF A;  5DUI A;  4CCK A;  3RKY A;  4UXN A;  1ZK8 A;  4KT6 A;  2HOT A;  3J7Y J;  2HQ5 A;  2E7X A;  2BW3 A;  3BQZ A;  1HQC A;  1WI9 A;  3I59 A;  3WTV C;  1IN7 A;  3LWF A;  2R7F A;  3BC8 A;  2E1N A;  1ZTR A;  4Y7N J;  2GQQ A;  1LEA A;  3EYY A;  3PJR A;  4I7H A;  5AIP A;  3OIP A;  2FRH A;  1Z77 A;  4C2M J;  3ESW B;  1RUN A;  3I4M J;  2AXT C;  5IOZ A;  1TW2 A;  4U0Y A;  4XL9 A;  3K2Z A;  3DPU A;  4UVC A;  2CW8 A;  2FUG 2;  3HEF A;  1REP C;  4LIV A;  4DGW B;  1AKH A;  4LLG F;  4LG0 A;  5HOO A;  3CP8 A;  4IVN A;  4DYR A;  1RI7 A;  1A31 A;  1J59 A;  3W6K B;  2CS3 A;  3C2G A;  3H9Q A;  2LC2 A;  2E7W A;  2I8D A;  3IC7 A;  2IP2 A;  1T0F A;  1X1C A;  3IRQ A;  3M4O J;  3LQQ A;  1XG1 A;  2IVM A;  4HBL A;  3LAJ A;  3ROU A;  2EIL H;  2VC1 A;  2PJR B;  4BE0 A;  2MGQ A;  4P5O A;  2BVM A;  2RNJ A;  4MFD A;  2NVQ J;  4N4N B;  2RQQ A;  1UST A;  1IV8 A;  4XSX F;  2Y0S A;  3OOP A;  3K4C A;  3K10 A;  4AID A;  2M34 A;  1F4K A;  2G7H A;  1X2N A;  3S8P A;  3P9C A;  1K78 A;  3EQL F;  5BMZ A;  5J8C A;  4O5V A;  5L3B A;  1Z05 A;  2ZXI A;  3HM5 A;  3FMS A;  3CC4 I;  2XVC A;  1H89 C;  1EF4 A;  4WXH A;  5J4V A;  1ETY A;  2R4G A;  1VQ8 I;  2P5K A;  4CCN A;  1SAU A;  4EEF G;  4YEL A;  4JOM A;  3BR6 A;  2Q8K A;  4BKX A;  2NYX A;  3OS2 A;  5M5X J;  1W5T A;  4B48 A;  1KA8 A;  3A0H C;  4R8H A;  4IO9 F;  1R49 A;  3QYE A;  1T6S A;  4N4O B;  1HF0 A;  2VKH A;  3K4K A;  1X3U A;  5FKM A;  2M1B A;  1SD6 A;  3IL2 A;  1B9N A;  3EET A;  3GME A;  4ANJ A;  3KZI C;  5GTH C;  1VQO I;  1QNT A;  3JRE A;  1RNL A;  2NNY A;  3G1L A;  2PMZ A;  3AFH A;  3F23 A;  3HB9 A;  1R5I D;  2GAU A;  4XKW A;  3HRT A;  3ZP5 A;  1O7L A;  3HDD A;  3JRB A;  2IA0 A;  3QU6 A;  1RET A;  4QPO A;  3S1R J;  2MC3 A;  4YIR X;  2FF4 A;  1LDD A;  4F91 B;  2VUM J;  2L9N A;  3DWL E;  4EJO A;  4X0G A;  2ZC2 A;  1GT0 C;  3OS1 A;  5TGT A;  4MLO A;  3QP6 A;  5FD5 A;  2VPL A;  4NC8 A;  2JWT A;  4LB6 B;  4BQO A;  1D5V A;  2VOD A;  4KIS A;  1UMQ A;  1TP4 A;  2BY2 A;  1HCR A;  2B9S A;  2MH2 A;  2K40 A;  3RZD J;  2XSJ C;  4HNU A;  4WF2 A;  4M3D A;  1T39 A;  4HLX A;  2VC0 A;  1WFX A;  5H2F C;  3V8J A;  1LJ9 A;  4Y15 A;  1XC5 A;  1MNE A;  1JTY A;  1R22 A;  2NS8 A;  2YX4 A;  5E3M A;  5EZG A;  3GCM A;  4BXX J;  3OSF A;  1LFU P;  1FY7 A;  1OYW A;  1B1B A;  2DA1 A;  3IKV A;  2ZNZ A;  1BN5 A;  3S32 A;  5DUK A;  3CCE I;  3TBI A;  5D8K B;  4MGR A;  4F52 A;  1ZRC A;  3C2H A;  3L2Q A;  5F0F A;  1ZN2 A;  3ECO A;  4M3F A;  4XKV A;  1QZZ A;  3O8H A;  4FCY A;  2HKO A;  3F8M A;  2F5E A;  3QOE A;  5KNL A;  1WJD A;  3HOY J;  5J3L A;  4CCM A;  2L9V A;  4NQW A;  3I56 I;  2FBK A;  3GVA A;  3PFY A;  5C4X J;  2CWE A;  4IXA A;  3LSR A;  3P5J A;  5K5R A;  1ZLK A;  3F22 A;  4ESB A;  3ZQ7 A;  1JKO C;  2W1O A;  4A0X A;  1OCR H;  1NG6 A;  3ASN H;  2HWV A;  4AU7 A;  4B3X A;  1OCO H;  4CCJ A;  1CGP A;  3ZQL A;  2MFZ A;  5BNG A;  1QBJ A;  1S5L C;  5KAI C;  5D5W B;  1ZG5 A;  3GTL J;  2PQ8 A;  3I4P A;  1DUX C;  3S2D J;  3CDI A;  2OTL I;  2EJR A;  4HV5 A;  5IY5 H;  2NVU B;  1G3T A;  1MGT A;  3OV8 A;  1KGS A;  3DBL B;  3LSM A;  2D45 A;  1FBQ A;  3DTI A;  4IHT A;  3IAM 2;  4II2 A;  4ZTJ A;  1LFB A;  1G4D A;  5L3G A;  1G2H A;  1PUF B;  1TWC J;  1QGP A;  2DFI A;  1VF9 A;  1RC9 A;  3QPT A;  3UKG A;  3I5U A;  2R7O A;  4FAS D;  3CMY A;  2I10 A;  1R5G A;  4DYQ A;  4A5N A;  1VQL I;  5JHF A;  3CUQ A;  2DA3 A;  2YU3 A;  2E35 A;  3TGN A;  5CQE A;  2W7N A;  1X4P A;  3CCY A;  2XKO A;  3WG9 A;  1Y0U A;  3H35 A;  1MSE C;  3MN2 A;  2WC2 A;  1TQI A;  3S93 A;  1RPW A;  3OR2 C;  4BQQ A;  3H3V K;  4A3E J;  3H0D A;  3HSF A;  5HDK A;  4PZJ A;  3GZ5 A;  1TQP A;  4HRI A;  2P5V A;  4YFN F;  2M4G A;  2L01 A;  4B44 A;  4GO1 A;  3G73 A;  4FET A;  3MD2 A;  4LG3 A;  4WCG A;  4BXU A;  2IJL A;  3SXY A;  2LBF B;  2V1X A;  5D6F A;  2R7Q A;  3LSJ A;  1IN5 A;  1PJR A;  3KP5 A;  1G8X A;  2STW A;  2XKP A;  3VPR A;  4MEY F;  5ICG A;  1SFO J;  4BY1 J;  5IT9 K;  1N77 A;  4RM2 A;  1FEX A;  1ODD A;  4BBS J;  4LOC A;  5GAE J;  5CVU A;  2HDD A;  1T38 A;  1R9T J;  3P9K A;  2XAS A;  5DDG A;  3KEQ A;  4CZZ A;  5JHU A;  2PN6 A;  3HYI A;  2BY0 A;  3KLO A;  1T33 A;  3EDP A;  2EFO A;  3K1P A;  2DMN A;  2PFB A;  1Q1H A;  1ETW A;  1UHM A;  2WY7 Q;  2H6B A;  1XX5 A;  3BY6 A;  1YOV B;  2V1U A;  1TWF J;  1BI2 A;  3E6C C;  3R6S A;  3SJM A;  2OA4 A;  3MKY B;  1KQ8 A;  4KN4 X;  2EFW A;  3KEY A;  4M3G A;  4IHW A;  1Y56 A;  3D5S C;  4PGH A;  1Z21 A;  1SFE A;  4I0A A;  2W25 A;  2N8G A;  1BW6 A;  1Z3X A;  2F6C A;  1HLV A;  3PUF A;  2QCO A;  2WB1 N;  1AU7 A;  3KP7 A;  4CHU A;  2V7F A;  3M9A A;  5EF6 A;  3JSO A;  4GYG A;  1Y1W J;  1DDN A;  2PJP A;  5FB2 A;  1WSU A;  4EM0 B;  4HA8 A;  2GOM A;  5AIQ A;  4F3Q A;  3K4J A;  1XGN A;  4A0Z A;  1XDS A;  2VQH A;  2R5Z B;  3RPU A;  2VON A;  4HW0 A;  3GTP J;  1MH3 A;  4S04 A;  2V1D A;  4XKC A;  5L3E A;  3SQN A;  1I27 A;  3O3K A;  4RAZ A;  1X19 A;  2LOO A;  2PX9 A;  3FK6 A;  2A07 F;  1CF7 A;  4E7S A;  3QPS A;  2LVS A;  3IWF A;  1D1A A;  2DJI A;  4BNC A;  2AXL A;  4E7H A;  2P5L C;  3H3U A;  4LLN A;  4CGZ A;  3DKW A;  3FK7 A;  2YU9 J;  2V6C A;  4KN7 X;  4OWR B;  4PK4 A;  1MIJ A;  2Z9O A;  3CJQ B;  2LK2 A;  2AHQ A;  2OCE A;  1TQM A;  2ZFW A;  4B1R A;  2R5Y B;  3RQ4 A;  3V7S A;  5CVJ A;  3TOA A;  5FRM A;  2E60 A;  1R1V A;  1SAN A;  3MMY B;  3L2W A;  2OQR A;  4HX7 A;  1D5Y A;  2DQL A;  2G7U A;  5DCF A;  1JTX A;  1TWH J;  1S8N A;  1WH7 A;  1Z9C A;  1JHF A;  1F5T A;  3J81 K;  3FX3 A;  2E71 A;  4A3F J;  3HRM A;  4UUS A;  1YIJ I;  3M8E A;  1F43 A;  4OMZ A;  4M72 A;  4G7Z F;  1JHH A;  4XLN F;  1PUE E;  3VOE A;  1FYK A;  3K4L A;  5JFR A;  4KIC A;  2IBD A;  2P6T A;  4C2U A;  2A05 A;  4F7Z A;  2K85 A;  4HF0 A;  3RDI A;  3F6O A;  2V1N A;  2NS7 A;  5GAD J;  3K4N A;  3C18 A;  1P9Q C;  2FQ4 A;  2JA6 J;  1FIA A;  3GW2 A;  1BIB A;  1P7I A;  3KP3 A;  3RKX A;  4CIC A;  2YS9 A;  4WK8 F;  1NK3 P;  4QSH A;  2M2E A;  4G9Y A;  3PUB A;  5EDN A;  1TC3 C;  3OIO A;  1JT0 A;  2I5U A;  3CCM I;  3G71 I;  4F55 A;  4C3I J;  3CDL A;  1YS6 A;  2ISY A;  2ME6 A;  1YW8 A;  1HXD A;  2ELH A;  1OMI A;  3MKZ A;  3QPH A;  1LDJ A;  1YTY A;  2H27 A;  2X48 A;  4NDL A;  3E6M A;  4YIF A;  4UV8 A;  3N4M A;  1K4S A;  1FOK A;  3F9K A;  3PIP F;  3BPV A;  4IKF A;  3HL2 A;  3I58 A;  2NVT J;  3TDZ C;  4PDK A;  1EH7 A;  3OY9 A;  3ELK A;  4QWQ A;  3K1N A;  2OZ6 A;  1GXQ A;  1YE9 A;  1WJB A;  1BM9 A;  4ZYD A;  4BJT A;  2DW4 A;  2XUB A;  2O9L A;  4Z2Y A;  5LEJ A;  1MH4 A;  3ZMD A;  4ASN A;  3BCA A;  1HW2 A;  1GVD A;  3O2P E;  1U5T C;  2O03 A;  3L2R A;  4RGS A;  1VQP I;  4FT8 A;  5EGO B;  2QLZ A;  3OYB A;  2L7Z A;  4QPQ A;  1IUF A;  1MKM A;  1B4A A;  2P8T A;  4HDU A;  2DTZ A;  2LY2 A;  3ZQC A;  6PAX A;  3FIW A;  5ED4 A;  1O57 A;  2X0L A;  3SZT A;  1UG0 A;  3WTX C;  3I4N J;  2V4J C;  4AD9 A;  2ETH A;  3NEU A;  2EV5 A;  3ZN1 A;  3ABU A;  1XSD A;  4CYC A;  2XRN A;  1B72 A;  4BDZ A;  3KCC A;  2FSW A;  4E4H A;  3KYC B;  3MFK A;  2ZJ2 A;  4RAY A;  3JRH A;  2QSG X;  1TT0 A;  3RYR A;  5HLH A;  3E5U A;  1WVR A;  1K61 A;  1I1S A;  3L00 A;  4MFE A;  2IGO A;  2P7V B;  1MBJ A;  3BTI A;  3CZ6 A;  1WKM A;  1Z91 A;  4EGZ A;  3ZRG A;  4BE1 A;  1Y8R B;  3FXL A;  3K4B A;  2KLO A;  4GDF A;  1OQY A;  2M0C A;  3V42 A;  4LFU A;  2HOE A;  1IDZ A;  5C3E J;  3ERE D;  3L2U A;  2KRH A;  3U9G A;  2A5Y B;  1FOX A;  4KNY A;  3DTE A;  2DK8 A;  1BR4 A;  3Q9S A;  1BC8 C;  2GIV A;  5ILU A;  2CUZ A;  2DPU A;  3I3L A;  3D0S A;  5LBQ A;  1LQ1 A;  2KIF A;  2Z5U A;  2IRF G;  4IQ4 A;  3M07 A;  5C4J J;  1MSF C;  5FKN A;  5KAF C;  4M71 A;  4IHX A;  2VQC A;  1BJZ A;  3TO9 A;  1D1B A;  3DKX A;  2FNA A;  2R0Q C;  1B8I B;  2JRT A;  3GFM A;  4O6J A;  3BWG A;  4DBR A;  4A93 J;  1JUS A;  2QGU A;  3HTU A;  4IOA F;  1SAX A;  2Q2E A;  2BY1 A;  3G6E I;  3ISP A;  1D0Y A;  1PVE A;  1UCR A;  3SDB A;  3FWE A;  4EQQ A;  3ZPL A;  1UHW A;  4DIQ A;  1Y6I A;  2JN6 A;  2KJC A;  1I6H J;  2MSY A;  1TZL A;  1P6R A;  4P1W A;  4PJJ A;  1LPQ A;  3S1N J;  2IS6 A;  3BCB A;  4L9J A;  4JK1 X;  2HTS A;  1U9N A;  1J09 A;  3DTK A;  4A3L J;  2KDO A;  1I3A A;  2L3D A;  3H36 A;  2ECB A;  2MBF A;  1FJL A;  2MD0 A;  4LB5 A;  3QP5 A;  2WAD A;  2ZNY A;  1XCV A;  4RB0 A;  2F4M B;  2CG4 A;  1IF1 A;  3G1O A;  5LRS A;  1FSE A;  4M6Y A;  3GO5 A;  1VZ0 A;  1T08 B;  4M3B A;  3VEP A;  4RA2 A;  1YJ9 I;  1UFM A;  1VQ7 I;  3GFL A;  2DYR H;  1KU9 A;  3TMO A;  1IAW A;  2Y0M A;  4RLQ A;  1ON1 A;  1YX5 A;  2Z3Y A;  4KIG A;  3KFW X;  2L9S A;  1BR1 A;  2HDC A;  5TIS C;  4R1H A;  3K69 A;  3M8F A;  4DW6 A;  3A01 A;  4EGY A;  2LF8 A;  2GLO A;  4LD5 A;  1YHQ I;  4X6A J;  1ZR4 A;  2A6H F;  4KFC A;  1LFP A;  2QWW A;  1TW3 A;  1N25 A;  2DDA A;  2HR3 A;  2WAE A;  1M1E B;  3FXU A;  1T98 A;  3QAH A;  2QYO A;  3H5N A;  2QM3 A;  2LF7 A;  3OL3 A;  1IDY A;  3VDX A;  1K6O A;  1LE8 B;  1BBY A;  1NH3 A;  1SD7 A;  5JI6 A;  4KJZ A;  4DBQ A;  3HBL A;  4BBR J;  4ESF A;  1FIP A;  2O7O A;  3ABL H;  3SFZ A;  2ZXH A;  4DQ2 A;  2F5C A;  3KYL A;  1PP8 F;  4D7M A;  2K9N A;  1A6Q A;  4PJN A;  2HXI A;  1G3Y A;  3G2B A;  1PP7 U;  2X85 A;  4DYC A;  1R1U A;  2X51 A;  2CUF A;  3IUO A;  2DTR A;  4RM3 A;  4CA0 A;  2X6Y A;  3RCO A;  2VL8 A;  1BI1 A;  2EZL A;  1E3O C;  2XF6 A;  3A1Y A;  4EMS A;  5F64 A;  2RVC A;  2TDX A;  5DM6 F;  2R7U A;  1ACI A;  3ZXS A;  1G3W A;  2ZBK A;  3SZP A;  3ABK H;  3BJ6 A;  2Z2S B;  4XBF A;  4MTD A;  4N9H A;  3S16 J;  2M9H A;  1MND A;  3W6V A;  4JX6 A;  1OR7 C;  3AG2 H;  2OCC H;  3BR1 A;  1ZLJ A;  1TNT A;  2GOX B;  1VQN I;  2TRT A;  1ZG3 A;  2K9S A;  4PJM A;  4XN3 A;  2ZSI B;  3PL8 A;  3IP4 B;  2JQ7 A;  5BQT A;  3HJE A;  2D2W A;  2AS5 F;  4GXO A;  2RDP A;  2K9Q A;  2K86 A;  4V19 K;  2EPF A;  4XM3 A;  3Q0W A;  4KMU X;  5EEA A;  2PBI A;  5JVG F;  1RES A;  1WWX A;  2V79 A;  2PG4 A;  5L3D A;  1YO5 C;  2W82 A;  2UUZ A;  2VKV A;  4LLL A;  3S2W A;  1QO0 D;  2OV7 A;  2A61 A;  5IOY A;  2R7W A;  5BOX A;  3EYI A;  4L9T A;  1ZH5 A;  3L09 A;  1JI8 A;  2LTP A;  3MEX A;  1OCZ H;  3OL4 A;  1P4W A;  2DFF A;  4IHY A;  4ENJ A;  3FDY A;  3DCF A;  1QPM A;  3GEZ A;  5J40 A;  3K0L A;  3ABM H;  5B66 C;  4KA4 A;  1Y39 A;  3K7A J;  2VBZ A;  1SVL A;  4GGG A;  2DJN A;  1ETX A;  4H0E A;  1KU2 A;  5E8G A;  3X2Q H;  3ZQI A;  4PJ0 C;  4Q4Z F;  3GTK J;  1GLN A;  2W85 A;  4V2G A;  2UV1 A;  3HKZ N;  3BG9 A;  4A3G J;  3KP4 A;  1YQA A;  3NAR A;  2VT3 A;  1ZAR A;  5GTI C;  4A5M A;  4G8X A;  3FM5 A;  3E7L A;  5FRN A;  3R4K A;  2QUF A;  5HLG A;  3F0C A;  2PI0 A;  1TNS A;  2Y0S N;  3ASO H;  3VYS B;  3WU0 A;  3CDH A;  3I64 A;  1Z6T A;  3LFU A;  3I9V 2;  3WE2 A;  2DQR A;  5F0H A;  3RI4 A;  1N75 A;  5DS9 A;  2ELK A;  3BPX A;  3CUO A;  1WJC A;  2MC4 A;  3NWS A;  2MW8 A;  1V55 H;  3E0J B;  1WPK A;  4EM2 A;  2H94 A;  2DDB A;  2ID3 A;  3HOU J;  3T0Y A;  5CYV A;  4KMF A;  3W2A A;  3Q0V A;  4HST A;  2KZG A;  4A3J J;  1HST A;  2F5F A;  3E6D A;  1I6X A;  2COB A;  2XPU A;  3TP3 A;  2E1C A;  5F27 A;  4HOB A;  3CCR I;  1D0X A;  2K7L A;  2A69 F;  1JGS A;  3TO7 A;  3KIO A;  4IEJ A;  3V8L A;  4FE7 A;  4XLF A;  3FM3 A;  4NNJ A;  5D5X B;  5HLT A;  1IGN A;  1DGW Y;  4Y52 J;  4G7H F;  4ZJZ A;  2WBM A;  2DT6 A;  1XPX A;  1U2W A;  5HS7 A;  3S14 J;  2QBY A;  2E5N A;  2WTE A;  5ILS A;  3M1C A;  1O3R A;  2Q0O A;  3MVP A;  1XMK A;  1K78 B;  2PMZ N;  1DGR M;  4FE4 A;  1QVT A;  4P9U A;  2XRO A;  4XOP A;  4ENM A;  5M3M J;  1P92 A;  3FXO A;  9ANT A;  2NOJ B;  2STT A;  2A6T A;  3S3O A;  3T8T A;  5JR3 A;  1STZ A;  3HOS A;  4ZYA A;  1MDM A;  2HZD A;  3HUG A;  1J2X A;  2UZK A;  1X1A A;  4ZC3 A;  5IT9 Z;  2FEZ A;  3ZMU A;  3CJT B;  3QYF A;  2A3S A;  2R7V A;  5E3L A;  2ADU A;  3C1D A;  3I0T A;  3TL4 X;  1PUF A;  4I0B A;  3DBR B;  2VIX A;  4XOR A;  1O3T A;  3QWL A;  4HQM A;  4CSW A;  5BS6 A;  3TED A;  2ESN A;  2HZT A;  5K5O A;  2E2I J;  2F5V A;  3K9T A;  3B02 A;  5FFZ A;  5CKT A;  3G3Z A;  3WTY C;  2Y30 A;  2DA2 A;  5IP9 J;  3QPL A;  1XB4 A;  2X6X A;  3CCU I;  4YFK F;  1MJB A;  2RNG A;  2QKL B;  2ACJ A;  2Y2Z A;  3BZC A;  2KRC A;  2QA4 I;  2XAJ A;  4AM3 A;  1USS A;  3KLN A;  2GXA A;  4LIU A;  3IHU A;  4DZJ A;  4ZH4 F;  3SEZ A;  5A2Q K;  3HC7 A;  3H9G A;  1WZ2 A;  2OAZ A;  4IL6 C;  4XKB A;  4U87 A;  1OYY A;  5BPD A;  2WA0 A;  5LHI A;  4BYY A;  2RV8 A;  1R7J A;  2EFQ A;  2YR2 A;  1QHG A;  3JRF A;  1W4M A;  2M7A A;  1U8R A;  1IC8 A;  3BJA A;  2O3F A;  2CFX A;  2ISZ A;  1ETO A;  2EIK H;  2FBI A;  5DCM A;  3V4G A;  3JSP A;  4PUS A;  3DEW A;  4YRV A;  1RUO A;  4I6Z A;  1AOY A;  3LSG A;  4S0H B;  4HZF A;  1UAA A;  3MAJ A;  4BQA A;  1LEB A;  1D0Z A;  2H1K A;  2R7D A;  5EEH A;  4B8X A;  3GWZ A;  2BYV E;  3SEQ A;  1CQT A;  3F8N A;  5JLW A;  2CUJ A;  1AWC A;  2MH9 A;  2UXX A;  2XPW A;  2C6Y A;  2H1L A;  1DPU A;  1J7K A;  3H92 A;  4LGW A;  4V2F A;  2CQQ A;  3MKW B;  1MBH A;  4G94 A;  4C3J J;  5AON A;  2BE5 F;  2XAQ A;  1WI3 A;  4E7J A;  1EH6 A;  3ZN0 A;  3A03 A;  1MMN A;  1OPC A;  5FLX K;  3HPH A;  1DP3 A;  4I01 A;  1XMA A;  3J81 Z;  4A6D A;  1E3P A;  1FX7 A;  4Y4R A;  3ZGK A;  4A2U A;  1FLI A;  4KIF A;  3EUA A;  3VFZ A;  4BL0 B;  2X9D A;  1VFC A;  2M3A A;  2XGE A;  3DLA A;  3JAM K;  4BE2 A;  2R5Z A;  1YW9 A;  2RKH A;  2V26 A;  3FXK A;  2DN0 A;  2LRD A;  2QEX I;  2GZW A;  4I98 B;  4CCL A;  1LNW A;  3ML6 A;  1J75 A;  2HS5 A;  3VOD A;  3AKZ A;  1FP2 A;  4Y3O A;  2CQ7 A;  4C9Y A;  5EG0 A;  2VE9 A;  5HNF A;  4XRF A;  2FE3 A;  2VE8 A;  4BXF A;  4UV9 A;  4IRI A;  3BTL A;  5KCM A;  1SC7 A;  3FHN A;  2LY1 A;  1WJA A;  3OOU A;  2HI3 A;  2NRA C;  1H9G A;  2IXS A;  1O3Q A;  3CUQ C;  3CUQ B;  1JJ6 C;  2K3P A;  2WB1 A;  4LK0 F;  2TCT A;  2GXG A;  2HOA A;  1JXS A;  2CJJ A;  2LP0 A;  2R5Y A;  1C0W A;  2HYF A;  2L02 A;  4I2O A;  5F08 A;  3MZY A;  3DLL F;  1KU7 A;  2B63 J;  2ZXW H;  3TKY A;  2RGV A;  4B09 A;  3ZMV A;  2LNB A;  1QPI A;  4GCV A;  2XGC A;  3OYI A;  3GTG J;  1HW1 A;  3F8C A;  2RAE A;  2X1D A;  4HQE A;  2L4M A;  3Q3S A;  1GUU A;  4H4K C;  3DKY A;  3PM1 A;  3K1M A;  2O8K A;  3HXL A;  4M73 A;  4XLE A;  2NVY J;  2QF7 A;  2JA8 J;  3CME I;  2M8E A;  2IGM A;  5FRO A;  4HX8 A;  3ZMZ A;  3BLY A;  5B1A H;  2F2E A;  2M87 A;  3DU5 A;  3TQN A;  1ZGJ A;  2H09 A;  2VJ4 A;  1AA7 A;  2VJJ A;  5LLQ A;  4ENN A;  2DMT A;  1I50 J;  3JTG A;  1BC7 C;  1KQ0 A;  4CXF A;  2V6E A;  5D4S A;  2K27 A;  4A12 A;  2HFH A;  1K4T A;  5E17 F;  2YPR A;  2LY9 A;  1VI0 A;  3VSL A;  3WTW C;  3WHC A;  1APL C;  4BUP A;  3DEE A;  4XMY A;  4RAF A;  4CYD A;  4C2T A;  2E1M C;  1IUY A;  2E1M B;  3K2A A;  1XGS A;  4ON0 A;  4BU2 A;  4JX4 A;  1S29 A;  4QLC U;  3B73 A;  5E18 F;  3CCJ I;  1WCM J;  3WE3 A;  3JW4 A;  3JRC A;  4EJW A;  1MMA A;  4HEA 2;  1Z67 A;  3HHG A;  1MD0 A;  1IJW C;  1IXR C;  3BR2 A;  1TBX A;  1B6A A;  2Z1D A;  1LKX A;  4PFO A;  4ZTF A;  1H0M A;  3BR3 A;  1X1P A;  3HG9 A;  3WU2 C;  1BOB A;  2WAQ N;  2EFP A;  3IWZ A;  1MJ9 A;  2P81 A;  3REO A;  3FZV A;  2E2J J;  1GV5 A;  2KPM A;  1JUP A;  1U0J A;  3SDG A;  2X6O A;  5LRR A;  1EV7 A;  2H8R A;  2VBX A;  2K4J A;  2X6W A;  1X1D A;  5FO5 A;  4CCO A;  4DNC A;  2ZJR F;  3J7A Y;  4A3D J;  1V4R A;  5HS8 A;  5E1W A;  1POG A;  3JR9 A;  3LSP A;  2HXO A;  2FA5 A;  4GRI A;  3BJO A;  1U5T A;  5EGO A;  4XRS A;  2L54 A;  2JPC A;  1BW5 A;  4RGR A;  5K7Z A;  1R36 A;  1MMD A;  1S7A A;  2KIM A;  4U7B A;  3AG3 H;  2Y9Y A;  3LST A;  4KYW A;  2R7Z J;  2NOG A;  3GTO J;  4LJZ F;  2PLY A;  2EBI A;  4XSZ F;  3W6J B;  3AAF A;  2EIM H;  3RIR A;  1BA5 A;  1LVK A;  5D5V B;  4Q5S F;  1R4N B;  5DEQ A;  3HOT A;  1XD7 A;  4BAC A;  1NTC A;  3OIQ A;  3D5R C;  2CQN A;  3R61 A;  3OYD A;  3LOC A;  4RB1 A;  1XTA A;  5GAH J;  3MZ8 A;  2O8X A;  2DFE A;  4MNU A;  2QEN A;  4GFB A;  2GWR A;  2UWM A;  3J7Z I;  3JRA A;  3R60 A;  4YFX F;  3T8R A;  3U2R A;  2WY8 Q;  2CV2 A;  4KDP A;  5H6R A;  4HF1 A;  4UUV A;  3ZOB A;  4RMN A;  3Q9V A;  1Z1D A;  4QIW N;  2F4O B;  3FBN B;  5J6X A;  5LEK A;  5CPR B;  4XRM A;  3OYJ A;  3J80 Z;  1W5S A;  3RKW A;  2BHZ A;  1U8B A;  4MQ9 F;  4FQG A;  4PJL A;  1UJ8 A;  2P4W A;  4D7N A;  1Q1V A;  5LGU A;  3LSH A;  4YG2 F;  2O6G E;  2CU7 A;  2QZ8 A;  1FNN A;  5GAG J;  2M5W A;  1ZRF A;  2MD5 A;  1ONV A;  4PGG A;  1VQK I;  1LB2 A;  2KHM A;  3IH3 A;  3QU3 A;  1SEU A;  1FT9 A;  2IA1 A;  4M3E A;  1D8J A;  4BAY A;  4E7K A;  3WGG A;  4B43 A;  4GYI A;  1Z0X A;  1HA8 A;  3RPQ A;  3PIO F;  2M0M A;  5IYB J;  3K4M A;  5TRD A;  3E5Q A;  5B5E C;  4I02 A;  2DYS H;  3H3Z A;  5B3S H;  5JLX A;  1PDN C;  1DU0 A;  4UHT A;  3F72 A;  1ENH A;  3Q0U A;  5LGN A;  3WOD F;  2L4A A;  2G9W A;  1RIO H;  2ESH A;  1TL8 A;  3CP2 A;  2LKX A;  3EUH A;  2DMP A;  3S3M A;  2YSR A;  1RRJ A;  5BPI A;  1X3Z B;  1R5H A;  4JQF A;  2ID6 A;  2GA2 A;  2MG4 A;  4KT5 C;  2ZME A;  1G6N A;  3TW6 A;  2FOK A;  2HVR A;  2Z16 A;  5FGM A;  2R7S A;  1D8K A;  1MZB A;  3KZZ A;  3WGI A;  3P7N A;  5LGT A;  3QOP A;  1R4M B;  1Y8Q B;  4G7O F;  2Y31 A;  2D1H A;  2GXB A;  3G1M A;  1HOM A;  4X1E A;  3T5X A;  2V9V A;  3CCQ I;  2DLL A;  1I5Z A;  5K7H A;  2J5P A;  1BJA A;  2VI6 A;  1ZKG A;  1EH8 A;  5EJC A;  2GA1 A;  1S9H A;  1ZR2 A;  1QZE A;  4ITV A;  3F21 A;  4L0Y B;  2RN7 A;  2UXN A;  4RS8 A;  3WTU C;  1HKQ A;  1PYV A;  2XAU A;  2AQE A;  1S6L A;  2HNH A;  2OD5 A;  3OYK A;  1VQ9 I;  2VT2 A;  1MBK A;  3CMM A;  2CUE A;  3OSG A;  4QTR A;  3Q5F A;  3BTC A;  4J19 A;  3KZY A;  1H9T A;  4CYC B;  2R7R A;  1Z7L A;  4BGD A;  2ZJQ F;  1IN8 A;  1QZY A;  1SVM A;  3AG1 H;  2CQX A;  1G59 A;  2DOE A;  2VPR A;  2LMD A;  4AIJ A;  4MO7 A;  1V3F A;  1GHC A;  2QQB A;  2M4K A;  2VJI A;  2RRE A;  1N78 A;  2NVX J;  1GDT A;  2QKM B;  3VB2 A;  2BBY A;  3DBH B;  4IRG A;  5GP9 A;  1W7P B;  1W7P D;  2EWN A;  2JVH A;  2KL4 A;  2DU9 A;  5D5U B;  1A35 A;  3RJP A;  3C2B A;  2A6E F;  4J00 A;  2ZJP F;  3CO6 C;  2VOO A;  3IKT A;  3EPZ A;  5L3C A;  3I71 A;  4XNF A;  1RZ4 A;  4ABZ A;  4HV6 A;  3W3C A;  4OAY A;  1FZP B;  1I3Q J;  2XF5 A;  1YFH A;  2XIG A;  4XQF A;  3J7A O;  1FTZ A;  3FXM A;  1YRN B;  3L7W A;  2KZV A;  1OKR A;  4BS9 A;  5IT3 A;  4BEH B;  5C44 J;  1P4X A;  4NC6 A;  1YG2 A;  2XGX A;  4E70 A;  1VND A;  3E6B A;  3ULQ B;  4HX4 A;  2LFB A;  3IRR A;  4FX0 A;  3L2V A;  3QOD A;  2EFN A;  2VAS A;  4M9X A;  3I53 A;  1JE8 A;  2BGC A;  4XLC A;  1WQ2 A;  4RGU A;  3CF5 F;  2LKP A;  1HBX G;  3DFG A;  1FOW A;  4DOZ A;  4B4C A;  2WWY A;  3DQV C;  5FKK A;  4ZZL A;  5E3N A;  3MZH A;  4FIS A;  3K70 C;  1TTY A;  5DTD A;  3K70 D;  2XB0 X;  3CC2 I;  2K3F A;  3B6C A;  2ZO4 A;  2IGN A;  2D1V A;  4K2E A;  1U78 A;  1A36 A;  5K1Y A;  2E1O A;  1RR8 C;  2IT0 A;  4F92 B;  2FU4 A;  3P9I A;  2VJ5 A;  4JP0 A;  1KU3 A;  1RR7 A;  4D1Q A;  1X2M A;  1Y1V J;  2PJR A;  2E36 A;  4CZC A;  4JYK A;  1LDK B;  5E79 C;  3OYE A;  5D4R A;  4AYB N;  5DV5 A;  2P0W A;  4MHG A;  2PMH A;  5ICC A;  2XAF A;  2BHY A;  5CVI A;  3A01 B;  4XID A;  4E7I A;  2IS4 A;  2HVQ A;  3HIF A;  2P7C B;  1BL0 A;  3M8J A;  4E6K G;  3PQK A;  1XSX A;  4NUB A;  5IYD J;  2L9R A;  3GLX A;  1MJA A;  3U1D A;  1JJ8 C;  2MYS A;  3OYC A;  2HYJ A;  2XSD C;  2HU9 A;  4AVP A;  2VB6 A;  2JUC A;  2VN2 A;  4I09 A;  3WTZ A;  2YUS A;  2DCE A;  1F1Z A;  2HKX A;  5F1J A;  3GZ6 A;  4HNV A;  5F04 A;  1WH5 A;  1XMX A;  2DMU A;  2KRF A;  5HOD A;  1WRJ A;  2XRL A;  2JTV A;  4WXC A;  4OU0 A;  1WGX A;  3PSF A;  4LK1 F;  1SFK A;  3NAU A;  1JUM A;  1XGM A;  1I1G A;  3FMQ A;  3MWM A;  3PNV A;  5E3O A;  2V9P A;  4BY7 J;  2QVO A;  4OIR F;  1D1C A;  3HKZ A;  3OYL A;  5M3F J;  2KIQ A;  3FF5 A;  4IOC F;  3OYA A;  2RQP A;  2EZI A;  1P4A A;  1KON A;  3TW7 A;  4II3 A;  5ICE A;  1IRG A;  2BW3 B;  3I59 B;  2HQR A;  4AC0 A;  3TOB A;  4NBQ A;  5CLS A;  3HTS B;  2DK5 A;  2R92 J;  1OCT C;  2A5W A;  5LD2 C;  2DXI A;  2JT1 A;  3OWT A;  1UZC A;  2CO5 A;  1OCP A;  3OYH A;  4OIP F;  2M8G X;  2DA4 A;  4LIT A;  3FXJ A;  2BVL A;  3IV5 A;  3HOW J;  2OBP A;  4IJA A;  5A2Q Z;  4ESJ A;  3NQO A;  4M6V A;  1HC8 A;  1X58 A;  2KDZ A;  3RSN A;  3FXQ A;  2KIS A;  4F93 B;  1AKH B;  4LG0 B;  2XV4 S;  4L9N A;  3DU6 A;  3NRV A;  3M7G A;  3PFI A;  3PQJ A;  1T0F C;  5DD4 A;  2L0K A;  4KUM A;  2FMY A;  3TDU C;  2ZSH B;  5LHH A;  2OJE D;  3BG7 A;  4BH9 A;  4EVI A;  2DPD A;  2EB7 A;  3AG4 H;  1AHD P;  2CW7 A;  3H9J A;  1O4X A;  1W0T A;  3WTS C;  5HS9 A;  3A2K A;  1DP7 P;  2JUG A;  2W57 A;  1J0R A;  3KYD B;  1VQ5 I;  2IGK A;  1EKE A;  3FKJ A;  5KVR A;  1HKS A;  3BG3 A;  2L2O A;  4I99 C;  1QQI A;  3HZJ A;  3GTJ J;  1QA6 A;  2DAO A;  1Z6R A;  2E19 A;  3HGY A;  1JKQ C;  2LKS A; 
#chains in the Genus database with same CATH homology
 3CC7 I;  1Y39 A;  3CCU I;  1VQ6 I;  1VQ9 I;  3DLL F;  3CCL I;  4IO9 F;  1VQM I;  1VQL I;  2ZJQ F;  2QA4 I;  2E35 A;  1YHQ I;  5GAH J;  3G4S I;  1VQO I;  1MMS A;  3J7Z I;  3CME I;  1YJN I;  1YIJ I;  3J7Y J;  2ZJP F;  1S72 I;  2FOW A;  5DM7 F;  4IOC F;  3CCS I;  1YJW I;  2OTJ I;  5GAD J;  5GAE J;  5GAG J;  3CCR I;  2E34 A;  1FOX A;  1VQK I;  5DM6 F;  1ACI A;  3CD6 I;  3CCJ I;  3PIO F;  3CCE I;  3CF5 F;  1HC8 A;  3CCM I;  3G71 I;  1FOW A;  1VQN I;  4UY8 I;  2JQ7 A;  3CC2 I;  1FOY A;  2K3F A;  3I55 I;  4IOA F;  3G6E I;  3PIP F;  4V19 K;  3I56 I;  1VQ4 I;  2H8W A;  2QEX I;  2ZJR F;  5JVG F;  3CMA I;  3CJT B;  2E36 A;  1YIT I;  1VQ5 I;  1YI2 I;  3CCQ I;  2OTL I;  3CC4 I;  1QA6 A;  1VQ8 I;  1YJ9 I;  2NXN B;  3CCV I;  1VQ7 I;  1VQP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...