2FOWA

The rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, 26 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
b'MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN L11
publication title The RNA binding domain of ribosomal protein L11: three-dimensional structure of the RNA-bound form of the protein and its interaction with 23 S rRNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosome
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2fowA00
1VQ4I 3CC4I 1FOWA 3CCLI 1HC8A 5GADJ 3CCEI 3I55I 1VQ6I 3PIOF 5JVGF 2OTJI 1FOXA 5GAEJ 5DM7F 1S72I 2E35A 3CCRI 3G71I 1VQ7I 1ACIA 3DLLF 4V19K 2K3FA 2QEXI 2ZJQF 3CCSI 2QA4I 1YJWI 3PIPF 3CC2I 2E36A 3CMAI 1Y39A 1QA6A 2H8WA 1VQ5I 1YI2I 3CF5F 1VQLI 2FOWA 3CMEI 3CCJI 1VQNI 4IOAF 3CCQI 1VQ9I 1YJNI 5GAHJ 3CD6I 2ZJPF 1YJ9I 1YIJI 1YHQI 1VQOI 3I56I 2OTLI 3G6EI 1YITI 1VQPI 5GAGJ 5DM6F 4UY8I 3J7ZI 2NXNB 3CCVI 2E34A 1VQ8I 3J7YJ 3G4SI 3CCUI 1MMSA 3CC7I 2ZJRF 4IO9F 1VQKI 3CCMI 1FOYA 3CJTB 4IOCF 2JQ7A 1VQMI
chains in the Genus database with same CATH superfamily
4GGGA 3JTHA 1GV2A 2YR2A 1LUJB 2IXSA 4LB6B 1MW7A 2K9MA 3R60A 2EINH 1G8XA 4G8XA 4CCNA 3QPLA 4B09A 2X9DA 2IS1A 1YW7A 2EV5A 3OWTA 2EA2A 1HKSA 3E6MA 5J6XA 2KPMA 3NWTA 2PEXA 5FD6A 3ASOH 1OKRA 5JLXA 2OA4A 2QGUA 3MZ8A 2CQKA 1T39A 1N77A 2FE3A 3E6DA 5DUIA 2NOGA 2A5WA 2ZJQF 1KU3A 1PVEA 3VODA 1IGNA 3ZQIA 1PYVA 3S2DJ 4M6XA 1ZLKA 1Z1DA 3WTYC 1IN5A 2CMPA 4C2TA 2ZNYA 3V7CA 2KHMA 2R92J 3I58A 2Y30A 1STZA 2F4IA 1HBXG 3S1RJ 3P9CA 4A0XA 2STWA 1S9HA 1YW8A 3ABLH 4IQJA 3Q9SA 4W1UA 3F9KA 2B7EA 2CO5A 1KA8A 3BR6A 2CQXA 5E3NA 4OIPF 1VQNI 2Z3YA 1JKRC 1RKTA 1FP2A 1X58A 2ZSIB 3GTGJ 2YX4A 4NC7A 4RGRA 4UUSA 2LOOA 1YJ9I 1POGA 4I0BA 5FLVA 4DIQA 1EH7A 1V5EA 3OYNA 3GZ6A 2OTLI 3RYRA 4P9UA 3RI4A 3J80Z 5L3FA 2RC4A 3IH2A 2JT1A 1Z9CA 1TL8A 3BQZA 2ICWG 5LD2C 3H9QA 1U8BA 2ISYA 2EV6A 2WV0A 3HTSB 3V7RA 3J7ZI 2HU9A 4ZTJA 2FQ4A 2ZJ2A 2DA5A 3OYFA 2P4WA 3WHCA 2XROA 4EJUA 3FX3A 2FNAA 4QPQA 5GP9A 3J7YJ 2STTA 1O57A 2XF7A 1KYZA 2PG4A 3DBLB 5ICFA 2FF4A 4QTRA 1MBKA 2Q1ZB 1GXQA 3ABUA 1DGWY 1UMQA 2Q2EB 4GXOA 3JREA 1Z67A 1ZN2A 2QENA 3PNYA 5EF6A 3LA7A 1TNTA 4CYCB 1E3PA 5BNGA 2XAJA 4BS9A 3T8RA 3J81K 5CQGA 4CCJA 3A1YA 4BEHB 5JI6A 2VONA 1F5TA 1A6IA 4XLEA 2EILH 1LVKA 1RKWA 1EA3A 4E7IA 2X6OA 4QIWN 4A3KJ 3A0BC 3F8BA 5DCMA 2PJPA 4HV6A 3K7AJ 2HTJA 3E7LA 2V1NA 5E8GA 3LAPA 1P4XA 4MGRA 1IXRC 2E1MB 3M3YJ 3RKWA 3DWLE 1BI3A 4A2UA 2HVQA 3RPQA 4PSWA 2R5YB 4ITVA 1D5VA 5J47A 3MKZA 2LD5A 2KRFA 3E6CC 3BZKA 2LR8A 2DFIA 2DU9A 3LAJA 2BZTA 5A2QZ 1YJWI 2COBA 2VKVA 3A02A 2VASA 4IQ4A 3GO5A 4LIVA 2KIQA 2MA3A 1LKXA 1WJBA 4A6EA 4BL0B 4ESFA 2OQGA 5GTIC 1K79A 2BY3A 1O3TA 2ZNZA 4IF4A 1Z91A 1W7PA 3BG7A 4PK4A 2VXDA 2RV8A 3TP0A 1G3WA 2YSRA 5HOOA 1DPUA 1LDKB 1XTAA 4HX7A 2V7FA 2RREA 3DU6A 1BR1A 2XAQA 1FEXA 3DFGA 2D1VA 2DYSH 3WG9A 3ZQ7A 1FIPA 1P7IA 1ENHA 1IRFA 1T8IA 1N78A 1XC5A 2HFHA 2VQHA 3QP5A 1MJBA 1M1EB 3ML6A 3FISA 1JKPC 3CMMA 2K5CA 4GCVA 4PFOA 1W0TA 2MSYA 2L3DA 4BE1A 4A5NA 1FBUA 2KP6A 1WJAA 5HODA 4GRIA 2DTZA 3PFYA 3VSKA 3H3VK 3E3VA 1TW3A 2GXGA 1QZZA 2DI3A 1BI2A 3K4BA 1K4SA 4PJJA 4D5FA 4O3MA 2Z2SB 4Y7NJ 5FB2A 5F1JA 3NRVA 4A5MA 3FDYA 2XRLA 3BP8A 4UUTA 2BW3B 1OR7C 1U8RA 4AIKA 1J5YA 3RZOJ 3AG1H 2Y0SN 2LG4A 3KYLA 4HF0A 2NOJB 3ECOA 4JYKA 3RKYA 3RYPA 3KP6A 1K83J 3TOAA 4P9FA 4B3XA 1PJRA 3C2HA 3MCZA 3H5NA 4L9NA 5FO5A 4A3GJ 4RA2A 4BJ6C 5BS6A 3CO6C 5CVIA 3BTJA 2BVMA 2H1LA 2FMLA 4ZH4F 5LEKA 3LSTA 2R5ZB 1J9IA 4WK8F 3L2VA 1UJ8A 3NQOA 3DCFA 2WBMA 2IGKA 3PSFA 2E1NA 5FGMA 1FBSA 4R79A 2JVGA 2XV4S 1D1AA 1HC8A 4BY7J 4E7KA 1KYWA 2HPIA 4B44A 1CQTA 1S72I 1H8AC 4HDVA 4KIBA 4G7ZF 2HOAA 1LQ1A 3VDXA 1KQ0A 2KZGA 1IXSB 2WAQA 4BNCA 4PJ0C 3HGYA 2WY7Q 4V2GA 1Z3XA 5D8LB 2VLAA 2VIXA 5AONA 3QOEA 2CSOA 2P8TA 1XN7A 2LYCA 4DQ2A 4DBQA 3TEDA 3OYEA 4RB0A 4XKWA 3MZHA 3M1CA 1W7PD 4GO1A 1XX5A 4PSXA 1ETXA 4OWRB 4JBAA 2KIUA 2EIKH 3PQJA 1Y39A 1E3HA 1OJLA 3K4MA 3VOEA 2UZKA 1G59A 4IKFA 2MABA 1OLTA 2PQ8A 4M9ZA 4XBFA 3WE3A 2E1CA 1SFEA 3TDZC 4LK1F 1ODDA 1WWXA 3M8JA 2M5WA 4G6TB 1Y6IA 1P2FA 4IHSA 3IWFA 3CCJI 3FK6A 1YX5A 3Q9VA 5J1YA 4NB5A 3PFIA 2GZWA 3AL0C 3FM3A 3O3KA 5HVQC 4XOTA 4E4HA 1QRYA 3DKWA 3HEFA 3S17J 1ETOA 4JP0A 4YEJA 4OOIA 1Y8QB 1YIOA 1ZHFA 1WJ5A 3FBNB 1S29A 3ROUA 4AIDA 2XC7A 3G6EI 4RGUA 1YITI 2KL4A 4UUSB 3OS1A 4GYGA 3GLLA 1B4AA 2RAEA 3WHBA 1T95A 4BXFA 3CCVI 5HS8A 4S05A 4AYBN 1W36D 3MVPA 2W4SA 1HW1A 2E34A 1RR7A 3DF8A 4HRIA 5D6FA 2JA6J 5LBQA 1PDNC 4LLLA 4BJTA 1B6AA 3HOZJ 4LOCA 4C2MJ 3I54A 1SVLA 4DYCA 1ZAOA 2ZJRF 2P7CB 2M4KA 2AS5F 1J59A 1MNDA 4G9YA 3AAFA 4QPOA 1FOYA 3H1CA 3OOUA 1X3WB 3TP3A 1Y56A 3I9V2 3OR2C 3E1SA 1MNMC 4KT6A 4RAFA 3UR3C 4CZZA 3RJPA 4A3MJ 3IC7A 3BR5A 3X2QH 4CCKA 2ZSHB 3U21A 3GMEA 4PJLA 4HSRA 5KNLA 4G6QA 3FK7A 1S7OA 5HS9A 1YW9A 3P9IA 1AA7A 4LK0F 3ABKH 4BQAA 3FHZA 1MDMB 3PIOF 3KCCA 4HOBA 3G1OA 5LGTA 5EJCA 1X3ZB 1XDSA 5E18F 2JVHA 1W5TA 3OYAA 5IY5H 3PNVA 4KT5C 3S1MJ 1MIJA 1Z7LA 4ESJA 1J2XA 3RPUA 5D4SA 2CYYA 4R8HA 4D7NA 4H0EA 4R1HA 3BCBA 5LHIA 1X19A 2JSCA 2L7KA 3F3XA 4GFBA 3DPLC 3K10A 4XNFA 1KQ9A 4D0PA 5JLWA 2A6EF 2VODA 4F3QA 1RIOH 4WXCA 5F6FA 3L09A 2XASA 4MFEA 5K7HA 5ILSA 3DTKA 2IT0A 2XRNA 3HUGA 3K2AA 2LTPA 1DU0A 3NARA 4PFPA 3DXJF 2HXOA 5KCMA 3HB9A 2K4BA 4M6YA 4WXDA 1A31A 3GTKJ 5E17F 3W2WA 2OU2A 3HJEA 4NUBA 5KAFC 2PMZA 1WI3A 2BE5F 2XUBA 3ABTA 2KDZA 2JA7J 1W7PB 3HHHA 3HHGA 3CMEI 2VE8A 2X6WA 2XPWA 2CS3A 3FXUA 2LBFB 2WB1N 2RNGA 4C3HJ 1BW6A 3MKYB 4I0AA 4ZYGA 1QHGA 3CD6I 5C3EJ 2CGPA 4B47A 1IF1A 2I8DA 3LSKA 3WU1B 4KN7X 5AIPA 4XMYA 3COAC 4L18B 4BACA 2EV0A 2K02A 3RIRA 5BMZA 4DGWB 2QVOA 2FJ1A 5FJ8J 4UV9A 1RETA 3WTUC 3AFHA 3B6AA 5GAGJ 1U6GA 4BXUA 5ILUA 4AIHA 2HYGD 1G6NA 2DLLA 1OR7A 1KU7A 2E2JJ 2VL8A 2R7VA 4E7JA 1OCTC 1S7EA 3FF5A 3KYCB 5BPIA 1SMTA 1R23A 2LF7A 1AKHA 1FSHA 2CRGA 1YFHA 2VQLA 4HF1A 3ASNH 1BI0A 2M34A 1WI9A 2ISZA 1GVJA 1LFBA 5KK1A 2VJ5A 5E79C 4M72A 5C4XJ 1TP4A 4KYWA 2P5KA 4EGYA 1XPXA 5BQTA 4DZJA 1VZ0A 2EFOA 2R3SA 1T08B 3FWEA 3L7WA 2ZMEB 2ZXWH 4IOCF 4BBRJ 2TCTA 1VQ4I 4Y4RA 3JRGA 3KZYA 1GUUA 1QU3A 1JKOC 3I0TA 2QM3A 1RESA 2D45A 3QRFF 1QZYA 2DAOA 1VQ6I 1OMIA 4CYCA 3BJ6A 3TQNA 2CFXA 4PCQA 3HYIA 3A03A 2CUZA 3RZDJ 1MMGA 3BDDA 3F0CA 4RM3A 1W4MA 1TNSA 3F6VA 3GEZA 1ULYA 2DCEA 4EV0A 1ZREA 4KIGA 2XAGA 2CV1A 3FXQA 2XGEA 3OIOA 3JAMZ 3RKQA 3CDHA 1R9TJ 3CCSI 1AHDP 2O5RA 5K7ZA 1QGPA 3F21A 3PIPF 3TOBA 3K4KA 4A3IJ 5LHGA 3CC2I 1ONVA 2R5YA 2CQQA 2QF7A 3KP3A 2EIJH 2L9RA 1YI2I 1GDTA 3SZTA 5BPDA 5IYCJ 1VQLI 2VOOA 3GF2A 3P7NA 3DEEA 3BTIA 4F93B 4HEA2 2K9SA 4UB6C 2YS9A 5IT9Z 3QQAA 3FIWA 5M5YJ 3WTSC 1MH4A 4AIJA 2IGMA 1EKEA 1JE8A 3CCQI 3U9GA 4CGZA 3LMMA 4XM3A 1WJCA 4BGDA 1BIBA 2DA6A 3QOPA 4IHXA 4G7OF 4E7ZA 2WV1A 2I5UA 2ZFWA 2BY2A 3HGGA 1U3EM 2IS6A 3GWZA 2ETHA 2K40A 2A6TA 5HDGA 3CDLA 2EWNA 1WQ2A 5E8IA 2QWWA 1D5YA 3GFJA 2V9KA 2HKOA 3GTPJ 2JA5J 1TWHJ 1JHFA 3LA3A 5DM6F 2FU4A 3BR0A 1IN4A 1A04A 3JRDA 1XGMA 4U7BA 5M5WJ 1Z6RA 3B73A 1ZH5A 2L02A 2VUMJ 2E71A 5IYDJ 2VJ4A 1K78A 2H6CA 2F48A 4HQMA 4NBQA 1S5LC 5CVRA 5D8KB 1WJDA 1TQIA 5F0CA 1SANA 3GVAA 2DA7A 3ZRGA 3RKXA 4OU0A 2VB6A 4LITA 4XLHA 4E6KG 3L2CA 4D5CA 1BC7C 5BOXA 1Y1WJ 1MJ9A 1U5TC 4AC0A 3N97A 2FBHA 2O9LA 2RQQA 1ON1A 1YS7A 1VFCA 1WH5A 4M6VA 1QPIA 2VKHA 2O6GE 4ENJA 2H1KA 3CC4I 3VYSB 1T33A 1IW7F 4BYYA 3J7AO 2HYJA 1VI0A 3HL2A 3CESA 2W85A 3LFUA 2M2EA 1JTYA 4KJZA 1FZPB 4XR6A 5DUKA 3RTRA 4RB1A 2F5CA 3OYDA 4HDUA 5L3BA 2ACJA 3KP5A 4M9XA 5HLTA 1D8KA 2KZVA 1OQYA 1MBGA 2R5ZA 2QBYA 3LWFA 3W2VA 5F0FA 3CUQC 1IRZA 1VQ7I 1FNNA 3F8NA 2HZTA 3OIQA 5HNHA 2ZMEC 4BHBA 3ZMTA 1U78A 5IT3A 2P5LC 2X6YA 2K9QA 2DMTA 3CDIA 2VBZA 4HX4A 4A3FJ 4AYBA 4A3EJ 3LQQA 2QA4I 1G2HA 3E6BA 5J8CA 4F55A 3G2BA 3KX2A 1Z05A 4XKBA 1PP8F 1IDZA 4X1EA 1G3YA 5KAIC 3L2RA 1LB2A 1JTXA 2DDBA 1LFPA 3I64A 2F5FA 3WTVC 3I59A 2QSFX 4Q48A 2R0QC 2K85A 1D3YA 3B6CA 2GBYA 3HUGB 3KP4A 4EJVA 1X3UA 3H0GJ 3KEQA 4OAYA 1ZRFA 1WPKA 4Y15A 4I09A 2KDOA 1Y8RB 3DBRB 1EH6A 3JSPA 4AM3A 1A5JA 2W84A 1XS9A 2Y9YA 6PAXA 1U0JA 3ECHA 2RN7A 3M8FA 3LSHA 2KMUA 1F1ZA 2H94A 4JOMA 4F52A 3HPHA 4MLOA 5M3FJ 3OS2A 1VQPI 4L9VA 1K6OA 3K1PA 2BY1A 1V54H 2OV7A 3IWZA 1IUFA 5FLXZ 3HXLA 4EATA 1EV7A 3SDGA 3JRAA 2TDXA 3C18A 3I53A 2A07F 1MMNA 3HOUJ 4D9JA 2NVUB 4KICA 1IDYA 2OZ6A 1F9NA 3K6GA 4IXAA 2V6CA 2AQEA 2ZFUA 1AKHB 5L3DA 3DLAA 4ZJZA 1MBHA 4ABZA 3FHNA 4YIFA 1MZBA 4LJZF 3ERMA 3WG7H 1DUXC 1NH3A 1G3TA 1FTZA 2H8RA 4QLCU 3EUAA 2EQRA 5CYVA 3S1QJ 2IAIA 3HZJA 5EG0A 3ZR8X 1TWFJ 3BLYA 2WB1A 2DA2A 4YG2F 3IP4B 2NS8A 1O3SA 2E2HJ 3SEQA 2ZO4A 3ZCOA 1UCRA 4BUPA 3E5XA 1JGGA 1RZ4A 1LVAA 2JUGA 4UXNA 1BL0A 1TW2A 3L2WA 3IL2A 2HR3A 3BR2A 2HWVA 2Z99A 2ZXJA 2K86A 2LDUA 3QODA 2EFWA 4KITB 1REPC 3VYTB 3FXJA 3O8HA 3JRBA 3OV8A 1IN6A 3HPGA 1MDMA 4EVIA 1Y1VJ 3OYLA 4C2UA 3K4JA 3K70C 3DKYA 1B8IA 4A3CJ 1ORKA 5EDNA 4EJWA 1HKTA 5FKLA 1OISA 2A61A 2M0CA 4G94A 2F4OB 2KT0A 2P5VA 3DPTA 2YU9J 4PUSA 1FMWA 1OCRH 2OJED 4ZC3A 2HVSA 1UHSA 5TJJA 1BIAA 5EYRA 1FBQA 3JRIA 3R0AA 1LDDA 2ZCWA 2BYVE 1JJ8C 4D1QA 2BHYA 2QUFA 2B63J 1ZGWA 1ZLJA 2L7FP 3FXOA 3AL0B 2BGCA 2O61A 4MNUA 1W5CC 4P5OA 4X0GA 5JR3A 1LDJA 1D0ZA 4EM0B 1DDNA 4CCOA 3I56I 2HOTA 1EF4A 2ESHA 3WODF 2LF8A 2M8GX 2X85A 5J8FA 1FT9A 2LBFA 3FXRA 4ENNA 2F2EA 4PGGA 4PGHA 3SYTA 3TDUC 4Y52J 1SVOA 5TISC 1BM9A 2IS4A 5EGOA 2AO9A 1HSJA 2QQAA 3H5AA 3CQZJ 1VQ8I 3PJRA 4M73A 3VB2A 5J40A 4K2EA 2JRTA 1U5TA 1D8JA 4L9JA 5TGTA 2ZB9A 4N4OB 5LGUA 1K78B 5DD8A 1YTYA 1WFXA 3DPUA 1O4XA 4IHTA 3H3UA 1HA8A 3TMOA 3L2QA 2DMUA 2FX0A 1T38A 3ZMZA 2OCCH 2YU3A 3ABMH 4UVCA 4ZYDA 1PP7U 2PJRA 2X1EA 3I4MJ 3MD2A 1BW5A 4NDLA 2F6CA 2GA2A 1B59A 2BBYA 4LFUA 3QPSA 3OY9A 1AWCA 3SFZA 4XN0A 1RNLA 2UXXA 1U9NA 3V42A 4KDPA 2D2WA 3CUQA 1SD7A 3OSGA 2GXBA 2R4GA 3ZMVA 2ZMEA 4RLFA 5B1BH 2JA2A 2V6EA 3HIFA 2J5PA 3U2RA 4XRSG 1IC8A 2R7SA 3CP8A 2MG4A 2P0WA 3WU2C 3S14J 3W2AA 4FCYA 2IS2A 2YUSA 2CFOA 4BQQA 2H6BA 5E3LA 4BQNA 1ACIA 5DDGA 4C3IJ 3MEXA 4ZYHA 4ETSA 1OCPA 3ZQLA 2QBYB 1NK3P 2CW0F 5D5XB 4M3BA 4N9IA 3GUDA 5D6EA 4Q4ZF 3H3ZA 4LG3A 2FSWA 2WTEA 3Q0VA 4FISA 3MZYA 5ICGA 1ZG1A 2K7LA 2O8KA 3C2BA 3ZP5A 3E97A 3EQLF 5FRNA 5J4VA 3U1DA 2R93J 4XKVA 4HNVA 1EJ9A 3P5JA 1ZARA 3ZN1A 5CVVA 5A2QK 3AKZA 2VT3A 1Z21A 1O7FA 2JTVA 3O6BB 4GYIA 4L9TA 4MTDA 3KETA 1UHMA 3IHUA 4AD9A 2QQ9A 1ITYA 3ZMUA 3TGNA 2FBIA 2V9VA 4CCLA 1BR4A 3I59B 4OMZA 3ZN0A 3QWLA 4XONA 5B1AH 2N8GA 1IZ1A 3KZIC 1FP1D 4HLXA 4ZDOA 2HNHA 2VBXA 2XKOA 3BTCA 3DEUA 3TO6A 2O03A 3ZQGA 4B3AA 1FPQA 1R00A 4J01A 5J4YA 1ETWA 1BI1A 1QZEA 1YG2A 5GPAA 1P4AA 1L3LA 2O3FA 5CVUA 1JUPA 3TW7A 1R1UA 2PMHA 3S2HJ 5B5EC 4A69C 5DS9A 1YO5C 2M4GA 2R7WA 4A3DJ 1ZTRA 2X0LA 3GTOJ 3H9JA 4CUGA 5LLQA 4TV7A 2L9SA 2M9HA 3KEOA 2IA0A 1FX7A 2LY2A 3L2UA 2LP0A 1WHUA 4C3JJ 2JN6A 3JCUC 2M45A 3C7JA 2FMYA 3SDBA 3HKZN 1R5GA 3CJTB 3AG3H 5CKTA 3SXYA 2CQNA 4MEXF 2CQ7A 5LRSA 3TL4X 3D5RC 3L00A 3I71A 1FOWA 5CQEA 4FT8A 4DYRA 2LVSA 3TKYA 3I55I 1SD6A 3FMRA 2VKDA 3ONQA 1R5HA 1JJ6C 5EG0B 2L7MP 4IHYA 4BJ5C 1B1BA 5FKOA 2XDVA 4JX6A 3BPXA 3V8JA 4IX7A 1BOAA 2X1DA 4LD5A 5EEAA 1TQMA 4Z6YA 2VPLA 4MHGA 4DYQA 2Y69H 3OYCA 1XD7A 4BDZA 2OCEA 4CA0A 4MEYF 2M30A 3Q3SA 4J00A 2DOFA 3WU0A 1D1CA 3BC8A 2JJ7A 4NNJA 1E17A 4I6ZA 2NVYJ 3QYEA 2E36A 2MC3A 3SFIA 3S15J 5C4JJ 4ZTFA 2M7AA 2ZXHA 5LHHA 3H36A 2CU7A 2IJLA 1L0OC 1ZRDA 2Z9OA 4UVBA 4EJOA 1B8IB 4EM2A 2LREA 1IAWA 1XB4A 4XLNF 5J3LA 1IV8A 4N0BA 2VC1A 1C0WA 1SFXA 3S3NA 1Z77A 1FLIA 3PUBA 4ZYEA 3HRUA 3D0SA 3PSIA 4IOAF 1G3SA 1S7AA 2MH2A 2W7NA 1GLNA 4I01A 4JK1X 3M4OJ 5FKMA 1R58A 4HSTA 2IRFG 1TBXA 2ELJA 2LSOA 3FXMA 2ZXIA 1VQOI 2QYOA 4BKXA 5D5VB 3KE2A 1TTYA 4AWXB 3W3CA 4KUMA 2FXAA 3CZ6A 4L5EA 1GHCA 4ZZLA 2PFBA 4YFKF 5M3MJ 4RGXA 2HVRA 4B4CA 2DW4A 5JHUA 1T56A 1I27A 1KGSA 1SC7A 1NK2P 3F72A 2VBYA 2L0KA 3K1MA 3KP7A 4BQOA 2F5DA 2GOMA 2BXYA 4Y17A 1V5FA 3NAUA 4F92B 3DTIA 1TWGJ 1X4OA 1TLHB 5EGOB 4BAYA 2RGVA 2HI3A 3JRFA 1UFMA 4U0VA 1X1BA 4RAGA 1PUFA 2L9VA 4BHPA 3BG6A 3VWBA 1G4DA 3U1KA 4ZYAA 1U5TB 2XF6A 1ETVA 4HZFA 2J5OA 4ASNA 3JW4A 2XB0X 2HDWA 3LSRA 3RSNA 3FMQA 2MW8A 3HSEA 3BJAA 1I3AA 2JSPA 2E7XA 4I76A 2OD5A 3HM5A 1ETYA 1MNEA 2B9SA 2PJRB 4MFDA 3OMYA 3ZMDA 2AQFA 3LSGA 4MIMA 3VSLA 5FKNA 5J1RA 3K70D 3OIPA 2LLKA 2V26A 4L5JA 3S93A 1BOBA 4F7ZA 3D5LA 4AU7A 1BBYA 2W25A 2M3AA 2HQAA 3CUQB 2VT2A 1ZGJA 1YOVB 2LY1A 5FFZA 2NNNA 1FSEA 3UNGC 4NC6A 2K3FA 4I98B 2HDCA 2CUJA 2VQCA 4C30A 5IYBJ 3WGGA 4Z2YA 3CMAI 1KZHA 5D5UB 4PZJA 2PI0A 1XSVA 4OIQF 2HPMA 2JA8J 5ED4A 5E1WA 3V8LA 1B72A 3F6OA 4XLFA 4FASD 3CF5F 1MGTA 2IPQX 1XGOA 4FE4A 3Q5FA 2VJJA 4EM1A 1OCZH 1X1PA 2DA3A 2R7QA 1USSA 4BE2A 2IEKA 1ZR2A 1R22A 3BY6A 4YFNF 2W24A 4NQWB 2KJCA 1P4WA 4RB3C 3KLNA 1TWAJ 2XIGA 2L9NA 3HOTA 3AG2H 4IJAA 1JKQC 3DP7A 4YIRX 3HOWJ 3FXKA 2ZJPF 2DN0A 4C9YA 1IRXA 3HBLA 4JQFA 3PQKA 3IRRA 2Y0SA 2QKLB 2NRAC 3CLOA 2WAFA 2IA2A 4BHCA 4II3A 1TZLA 4BU2A 1JXSA 2GOXB 1IV6A 1ZG5A 5K7FA 4DOZA 1IG7A 2RVCA 1ETKA 2VN2A 4E7HA 2RQPA 3MMYB 1TWCJ 2CUEA 3LFKA 3PO3J 2VC0A 4JX5A 1SEUA 2RNJA 2XAFA 1HF0A 1ETQA 3BZCA 3OL4A 1FIAA 1A35A 1SD5A 2EBIA 3N4MA 1MMDA 1WSUA 2DK8A 1FC3A 1XSDA 4KISA 3ISPA 4U88A 1IJWC 3C3WA 4RGSA 2XGCA 4IO9F 2R7ZJ 1LEBA 1DP3A 3DBHB 5CPRB 2L4MA 2Y31A 2JQ7A 4E70A 3DLLF 1SVMA 1QPMA 1Y0UA 3HOSA 4HYEA 3F23A 3FKJA 3HRMA 3JRHA 4IRIA 3PO2J 4RB2C 2IW5A 2MGQA 3TO7A 3JRCA 2BHZA 3HSRA 4UUVA 5FRMA 4CHUA 4OIOF 3BR1A 1KONA 1UZCA 4EMSA 4YELA 1DPRA 3OSFA 4IRHA 1P6RA 2KLOA 4WWCA 5J1UA 2LK2A 4V2FA 4HX8A 5DEQA 1MJAA 3JTGA 1TC3C 3OYHA 4QWQA 2LH9A 1V55H 2UUZA 5GPCA 2EFNA 1BJAA 1OCOH 1GVDA 4BE0A 2W48A 3KZZA 4OIRF 3W6KB 1JI8A 2M8EA 2KIMA 5K5QA 1FWZA 2DT7B 4OAZA 1YQAA 1R4MB 2HYFA 2NVXJ 2V1DA 3REOA 2DQRA 3HDDA 2PLYA 1GXPA 3V8KA 4EJTA 1LEAA 2R7XA 2V9PA 4L0YB 4IVNA 3T8TA 2ELHA 3G1LA 3VYRB 1QA6A 3S16J 3FBIB 2H8WA 2MYSA 1ZQ3P 3A0HC 1HW5A 5K5RA 3D5SC 3CJRB 3PNTA 2CG4A 2WAQN 4XSZF 1VF9A 3MWMA 3QP6A 2FOWA 2CW7A 3FXLA 5HS7A 1YRNA 2EA4A 1I1GA 2Z5UA 2W57A 2Q8KA 2HEOA 2WA0A 4MQ9F 2IGOA 2A5YB 3LSIA 3QU6A 1O3QA 1XMAA 1QNTA 2DMQA 3SZPA 2EJRA 5JHFA 3H92A 1XGSA 2CJJA 2VBWA 2HTSA 2E19A 3H5RA 3BOQA 3QYFA 1HKQA 5EEGA 1I3QJ 5IT9K 1ERDA 5HLIA 2L01A 1ZK8A 2KFDA 5LRRA 2Y2ZA 1RPWA 5L3CA 1DU6A 3O2PE 2DMNA 3GFIA 3A2KA 2GLOA 3OYMA 4CSWA 1RUOA 1V4RA 1N75A 3OYGA 5DV5A 3FKIJ 1Z6TA 3OR1C 1TT0A 1WJEA 2DPDA 2O8XA 3KPHA 3LSPA 3J81Z 5E20A 3O8GA 4O6JA 2OUMA 2VQGA 1DGRM 4LLNA 2PN6A 2X48A 5HLGA 1T0FC 1T6SA 4CH7A 1R4NB 2AXTC 2VOPA 2EB7A 3EETA 4MTEA 1R5ID 3MQ0A 4RM2A 5ILVA 2XSDC 1LE8A 2VE9A 2DTRA 5K1YA 2G0EA 4Y13A 1V3FA 1P7JA 1R7JA 1ZRCA 1DQUA 1PUFB 3V7SA 3S2WA 1ON2A 4MQVA 1W5SA 3CMYA 5EEHA 1QO0D 4UB8C 4NHJA 4LLGF 3BROA 3GTLJ 5EZGA 2RKHA 4RBOA 2JK3A 2IGNA 2JZYA 4OINF 1Y0NA 5E1XA 2IBDA 4BY1J 1WH7A 3DEWA 4UNOA 5ICCA 2E35A 3GTMJ 2EK5A 3E5UA 4ON0A 3TBIA 2M87A 2ZBKA 2LRDA 1R1TA 4W97A 2MLKA 4UV8A 3M07A 3LNQA 4WCGA 5HDKA 5F08A 2NAZA 3ZXSA 1UELB 5L3GA 3IV5A 3BTLA 1HDDC 4N4NB 4FETA 1CF7B 2DA1A 3OYKA 2D1HA 5AIQA 2DFEA 4H4KC 1U2WA 2LC2A 4EQQA 2P81A 5H2FC 4IHVA 4ZDPA 3OYBA 2XVCA 2BY0A 2E1OA 1YX3A 5EZHA 4HG2A 4P96A 5DTDA 5IOYA 1H9GA 3WTTC 4A0ZA 1K4TA 1FJLA 1R36A 2GA1A 4LGWA 1UG0A 5GTHC 1YE9A 2QQ8A 5K5OA 3F8MA 1H9TA 4AVPA 3BCAA 2WADA 4XRSA 1B72B 1JUMA 3EPZA 1E0EA 4XRMA 2ID6A 3MAJA 4ANJA 3W6JB 3ZQHA 4CICA 1QHHD 3RCOA 1ZG3A 2NS0A 1UG2A 3K2ZA 1CGPA 2QCOA 4G7HF 4AUXA 3SZGA 1MSFC 1MSEC 4I02A 1QVUA 4IPAA 1MBFA 2PMZN 2L2OA 4CXFA 3P9KA 3OL3A 4N9HA 2E5ZA 4KIFA 2VXZA 2NYXA 3CLQA 3R6SA 2QKMB 5F0HA 2DYRH 1QQIA 1MH3A 4UVAA 4UY8I 3HRSA 3EUHC 5FLMJ 2LNBA 3M9AA 5HDNA 2OAZA 3BG3A 3MKWB 2M1BA 3G4SI 2NVTJ 1UB9A 3JSOA 2FD5A 4KNYA 2IA1A 3QU3A 5HNFA 2Y9ZA 3HTUA 2YPRA 3K9TA 2JPCA 3CC7I 1NG6A 5FLXK 1XCVA 1IRGA 2OPTA 2P6TA 2OZUA 1F4KA 3DKXA 2MD0A 1HDPA 2EPFA 2FNPA 5H6QA 1MKMA 3T5XA 3OS0A 3F22A 2NS7A 4FTHA 2UXNA 3KFWX 2W1OA 3S8PA 3A01A 3GTJJ 2FA5A 4HBLA 1B9NA 4EEFG 1E3OC 1X4PA 2HXIA 3J80K 1W1WE 3OYIA 1OYIA 3GW2A 3K4LA 1XSXA 3IKTA 1JT0A 2I10A 4CCMA 2TRTA 5DM7F 1XG1A 1AOYA 1QBJA 4RAYA 4LG0A 4HLYA 4OMYA 4XICA 3UKGA 1WRJA 2DFHA 2MH9A 3GTQJ 2HS5A 1H0MA 4V19K 2DJIA 3ELKA 4XRFA 1LPQA 4JX4A 1K61A 3GLXA 2AHQA 4DNCA 2X6XA 2K27A 2VKEA 2MFZA 1RR8C 4QSHA 2OC6A 5FROA 1JGSA 2ELKA 4Y3OA 1JT6A 3T0YA 4FX4A 2KIFA 4FQGA 1TQPA 2EZLA 5LFAA 3LSJA 5LEJA 3I5UA 1WZ2A 3G73A 2WWYA 1BR2A 3MFKA 3A4CA 1IN7A 3NWSA 2ESNA 4WX9A 2DQLA 5ICEA 5IP6A 2X51A 4M74A 3VEPA 4B8XA 1Q1VA 3VYUB 3F8CA 4L5IA 1LNWA 2X1CA 3K69A 1J0RA 3VPRA 2PBIA 4HA8A 2FQ3A 2XHKA 1VNDA 5GAHJ 3JR9A 2NNYA 2KISA 3BQYA 3H0DA 1FMVA 2L5QA 1R1VA 2QQBA 3WE2A 1YRNB 1N25A 1X1AA 4BDYA 2V1UA 4DZPA 1YHQI 4XORA 1LFUP 2F4MB 4NQWA 1I1SA 1I5ZA 2GWRA 1FY7A 1NHAA 1I6HJ 2R7UA 1X2MA 2RDPA 4IEJA 1HW2A 3QPTA 2GAUA 3OYJA 1UHWA 3OOPA 3BJOA 4MO7A 3G1MA 1MMAA 2GIZA 1O3RA 4YFXF 1T0FA 1WVRA 3L1PA 1R71A 1W0UA 1H88C 2A3SA 4A93J 4P1WA 1S6LA 1U9OA 2C6YA 4U0YA 3PM1A 2XSJC 4B1RA 2PMUA 3M7GA 1FYLA 3IAS2 4A6DA 2HQNA 2AXLA 1MMSA 1OYYA 1YLFA 1I39A 2E7WA 2DO7A 3FMSA 5KVRA 3GFMA 4G12A 4WF2A 1VQKI 4E7SA 2L7ZA 5D4RA 4HNTA 2LFBA 1T98A 1BJZA 1USTA 1XDUA 2Z16A 4DBRA 3R0JA 3DTEA 3KYDB 1NTCA 1LE8B 3C1DA 2BVLA 1SAXA 1HQCA 1DP7P 3SQNA 5TRDA 1FYKA 1X1DA 5FD5A 2G7UA 4II2A 4FHTA 2M0MA 2DBBA 4ESBA 3TW6A 1AU7A 1BN5A 2E1MC 4BBSJ 2B0LA 2OTJI 2ZKZA 3TO9A 4RDUA 2K4JA 2MC4A 3I4NJ 1IN8A 2E5NA 4CZCA 3BPVA 1KU9A 3G71I 2HOSA 2A68F 3ZOBA 4A3BJ 1K6YA 2LMDA 1Z3YA 3CP2A 3CCYA 3VFZA 3WTXC 2OF7A 4O5VA 5H20A 3Q0WA 4E7LA 3GXOA 2DMPA 2XAUA 2HZDA 1PUEE 4FX0A 2KRCA 2EFPA 2O0YA 2V1XA 3EDPA 2CV2A 2QSHX 1Z7UA 2Y0MA 1ZKGA 2ECBA 5IP9J 2R7TA 3PUFA 3IUOA 3SHFA 1VQ5I 4U0WA 2ZC2A 1D1BA 2MLGA 4XOPA 4ENMA 3GYHX 3K1NA 5ERIA 1D0YA 4KN4X 4HAMA 1Q1HA 5C44J 1F36A 1NG7A 2HDDA 2H09A 1O7LA 2JMWA 2R7DA 1OPCA 1VQ9I 3FZVA 4PJNA 1IO2A 3ULQB 3BG9A 1OCCH 1MBEA 1S8NA 1X1CA 5CLSA 2G7HA 5JVTA 3CO7C 1YIJI 4LB5A 4WXHA 2JPBA 3ZGKA 5B3SH 4ENKA 2LKXA 1K7AA 2XGDA 3I4PA 2XPVA 2DT5A 3BG5A 3EUHA 4I7HA 2R7OA 4B43A 3CJNA 2HGCA 4HNUA 4U7DA 2DPUA 3EYYA 1WKMA 1A36A 1OFCX 1EH8A 3BWGA 3S3MA 3V4GA 2Y48A 1ZELA 2ME0A 2P6SA 4X6AJ 5IPAA 4I2OA 3KEYA 4HW0A 1B9MA 3HC7A 3LA2A 1KQ8A 3IAM2 3HOVJ 2O7OA 1BA5A 2HOEA 3DU5A 1T2KA 2H27A 2GIVA 3L9FA 5F04A 3ZQCA 2Z33A 4S04A 2LKPA 3MKLA 1ZYRF 5DCMB 1RC9A 3HRTA 4ZDLA 4XL9A 1LJ9A 4L0ZB 3CCMI 3QAHA 4HPQA 3KP2A 5FKKA 4I99C 2XKPA 3BT9A 2WY8Q 4M3FA 4CYDA 2VPRA 1S3JA 1GT0C 4M3EA 2VI6A 1D0XA 3GZ5A 1MD0A 3IRQA 1HCRA 3F8FA 4XN3A 3IKVA 1APLC 4LIUA 4KFCA 4KA4A 5E3MA 4G6DA 5F27A 2LY9A 5GADJ 2BXZA 3HOXJ 3GFLA 4J19A 3GBGA 5KHDA 4CDGA 3T1BA 1QVTA 3RQ4A 3A01B 3M8EA 1KU2A 5HLHA 2FOKA 3K0LA 4A0YA 3J7AY 2HKXA 3RDIA 3ERED 2CW8A 2WC2A 4XKCA 4FE7A 4LG0B 4XQFA 4XSXF 2DFFA 4DJAA 1P92A 9ANTA 1YS6A 2UWMA 1XMKA 3B02A 2JWTA 1X2NA 2ID3A 4HF2A 1WJFA 2Y75A 3C2GA 1J09A 1ZGAA 3WGHA 2QZ8A 3ZQQA 4RMNA 2UV1A 4DW6A 3GZNB 2OBPA 2BOLA 4UHTA 1XMXA 2GM4A 1ZR4A 2L4AA 2KQRA 2P7VB 1CF7A 3S32A 1SFKA 5DD4A 1XGNA 2A6HF 2W82A 3E5QA 2EFQA 1BC8C 2EIMH 4EGZA 3HG9A 2D5VA 1TT5B 3EUKL 4CO8A 2PX9A 1YJNI 1SFOJ 2CWEA 1WGXA 2E2IJ 1Z0XA 2QLZA 3IH4A 1HOMA 1XCBA 5M5XJ 4IZZA 1SAUA 1IUYA 2MD5A 2KJBA 3CF2A 1OYWA 4A3LJ 2W00A 2EH3A 4Y33A 5F64A 2IP2A 4M9SA 3ZQFA 3ZMSA 4U87A 3S1NJ 2K9NA 2JUCA 1P9QC 2Q2EA 3HOYJ 3WTWC 1A6QA 2R7RA 2R7FA 5H6RA 4XLPF 3Q0UA 3RPUD 4XK4A 4D7MA 3KIOA 4XLCA 4ZZDA 4BEHA 1UAAA 3FM5A 2DOEA 4GDFA 4A3JJ 1SD4A 2HQ5A 4BXXJ 5B66C 3R61A 2FBKA 1VQMI 1HLVA 1RUNA 2X4HA 2EZIA 5DYMA 4S0HB 2M7BA 1FOKA 2DODA 2LKSA 4YIIA 1R49A 3CCLI 3DQVC 5FFXA 2Q0OA 2A69F 4YRVA 3RQIA 4BH9A 3CCEI 5L3EA 3LL7A 2V79A 4NC8A 5JVGF 3QPHA 1FOXA 3ZPLA 1FYMA 5GAEJ 1R6RA 5IP7J 2XPUA 3LSMA 3G3ZA 3CCRI 2DJNA 2COMA 2XF5A 2GXAA 4M71A 1SFUA 2EZHA 1GV5A 1V5GA 5CVJA 4KMFA 4IHWA 1J75A 3AG4H 2QEXI 2JRMA 3NEUA 3SJMA 3I3LA 4HQEA 2KRHA 3R4KA 1RI7A 3M1EA 2ECCA 2CV0A 3ESWB 2XAHA 4M3DA 2K9LA 4HV5A 5IOZA 2DXIA 4A12A 1HXDA 2Z1DA 3CUOA 2KKOA 1RRJA 2BEOA 4M3GA 4F91B 5CJ9A 1FTTA 2FUG2 2F5VA 2FRHA 2CUFA 3EYIA 2L54A 1VTNC 2XGXA 3CTAA 3HSFA 3MN2A 4LMYA 2BV6A 3QYBA 1E2XA 3GX4X 4IL6C 2A05A 3H9GA 5E3OA 4XIDA 1YYVA 2GQQA 2NVQJ 3KLOA 5D5WB 3WGIA 3SEZA 2DOAA 1SMYF 3E0JB 2V4JC 3DV8A 2CH0A 2QSGX 1F43A 1WCMJ 2G9WA 3CJQB 3JAMK 3H35A 3PL8A 2ADUA 2DT6A 2DDAA 3W6VA 5F1RA 2E60A 2EZKA 3HKZA 4RS8A 2BW3A 3BR3A 1JHHA 2DA4A 2YX7A 2NXNB 1J7KA 2IVMA 3LOCA 3D1NI 4RLQA 5DCFA 4XLAA 4PDKA 3WTZA 2VJIA 1JUSA 1I50J 2ME6A 2OQRA 2XB5A 1I6XA 2WAEA 2MBFA 2HQRA 3S3OA 3CCUI 3BZ6A 4Q5SF 3LQRA 3GCMA 1MBJA 4Q47A 1IXCA 2F5EA 4B48A 5JFRA 4KMUX 3N05A 2K3PA 4PJMA 3K4CA 5LGNA 1W36C 3IH3A 2DK5A 5E1ZB 2FEZA 3K4NA 4IRGA 1HSTA 4AVZA 1H89C 4P55A 4RAZA
chains in the Genus database with same CATH topology
1VQ4I 3CC4I 1FOWA 3CCLI 1HC8A 5GADJ 3CCEI 3I55I 1VQ6I 3PIOF 5JVGF 2OTJI 1FOXA 5GAEJ 5DM7F 1S72I 2E35A 3CCRI 3G71I 1VQ7I 1ACIA 3DLLF 4V19K 2K3FA 2QEXI 2ZJQF 3CCSI 2QA4I 1YJWI 3PIPF 3CC2I 2E36A 3CMAI 1Y39A 1QA6A 2H8WA 1VQ5I 1YI2I 3CF5F 1VQLI 2FOWA 3CMEI 3CCJI 1VQNI 4IOAF 3CCQI 1VQ9I 1YJNI 5GAHJ 3CD6I 2ZJPF 1YJ9I 1YIJI 1YHQI 1VQOI 3I56I 2OTLI 3G6EI 1YITI 1VQPI 5GAGJ 5DM6F 4UY8I 3J7ZI 2NXNB 3CCVI 2E34A 1VQ8I 3J7YJ 3G4SI 3CCUI 1MMSA 3CC7I 2ZJRF 4IO9F 1VQKI 3CCMI 1FOYA 3CJTB 4IOCF 2JQ7A 1VQMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 I;  3CC4 I;  1FOW A;  3CCL I;  1HC8 A;  5GAD J;  3CCE I;  3I55 I;  1VQ6 I;  3PIO F;  5JVG F;  2OTJ I;  1FOX A;  5GAE J;  5DM7 F;  1S72 I;  2E35 A;  3CCR I;  3G71 I;  1VQ7 I;  1ACI A;  3DLL F;  4V19 K;  2K3F A;  2QEX I;  2ZJQ F;  3CCS I;  2QA4 I;  1YJW I;  3PIP F;  3CC2 I;  2E36 A;  3CMA I;  1Y39 A;  1QA6 A;  2H8W A;  1VQ5 I;  1YI2 I;  3CF5 F;  1VQL I;  2FOW A;  3CME I;  3CCJ I;  1VQN I;  4IOA F;  3CCQ I;  1VQ9 I;  1YJN I;  5GAH J;  3CD6 I;  2ZJP F;  1YJ9 I;  1YIJ I;  1YHQ I;  1VQO I;  3I56 I;  2OTL I;  3G6E I;  1YIT I;  1VQP I;  5GAG J;  5DM6 F;  4UY8 I;  3J7Z I;  2NXN B;  3CCV I;  2E34 A;  1VQ8 I;  3J7Y J;  3G4S I;  3CCU I;  1MMS A;  3CC7 I;  2ZJR F;  4IO9 F;  1VQK I;  3CCM I;  1FOY A;  3CJT B;  4IOC F;  2JQ7 A;  1VQM I; 
#chains in the Genus database with same CATH topology
 4GGG A;  3JTH A;  1GV2 A;  2YR2 A;  1LUJ B;  2IXS A;  4LB6 B;  1MW7 A;  2K9M A;  3R60 A;  2EIN H;  1G8X A;  4G8X A;  4CCN A;  3QPL A;  4B09 A;  2X9D A;  2IS1 A;  1YW7 A;  2EV5 A;  3OWT A;  2EA2 A;  1HKS A;  3E6M A;  5J6X A;  2KPM A;  3NWT A;  2PEX A;  5FD6 A;  3ASO H;  1OKR A;  5JLX A;  2OA4 A;  2QGU A;  3MZ8 A;  2CQK A;  1T39 A;  1N77 A;  2FE3 A;  3E6D A;  5DUI A;  2NOG A;  2A5W A;  2ZJQ F;  1KU3 A;  1PVE A;  3VOD A;  1IGN A;  3ZQI A;  1PYV A;  3S2D J;  4M6X A;  1ZLK A;  1Z1D A;  3WTY C;  1IN5 A;  2CMP A;  4C2T A;  2ZNY A;  3V7C A;  2KHM A;  2R92 J;  3I58 A;  2Y30 A;  1STZ A;  2F4I A;  1HBX G;  3S1R J;  3P9C A;  4A0X A;  2STW A;  1S9H A;  1YW8 A;  3ABL H;  4IQJ A;  3Q9S A;  4W1U A;  3F9K A;  2B7E A;  2CO5 A;  1KA8 A;  3BR6 A;  2CQX A;  5E3N A;  4OIP F;  1VQN I;  2Z3Y A;  1JKR C;  1RKT A;  1FP2 A;  1X58 A;  2ZSI B;  3GTG J;  2YX4 A;  4NC7 A;  4RGR A;  4UUS A;  2LOO A;  1YJ9 I;  1POG A;  4I0B A;  5FLV A;  4DIQ A;  1EH7 A;  1V5E A;  3OYN A;  3GZ6 A;  2OTL I;  3RYR A;  4P9U A;  3RI4 A;  3J80 Z;  5L3F A;  2RC4 A;  3IH2 A;  2JT1 A;  1Z9C A;  1TL8 A;  3BQZ A;  2ICW G;  5LD2 C;  3H9Q A;  1U8B A;  2ISY A;  2EV6 A;  2WV0 A;  3HTS B;  3V7R A;  3J7Z I;  2HU9 A;  4ZTJ A;  2FQ4 A;  2ZJ2 A;  2DA5 A;  3OYF A;  2P4W A;  3WHC A;  2XRO A;  4EJU A;  3FX3 A;  2FNA A;  4QPQ A;  5GP9 A;  3J7Y J;  2STT A;  1O57 A;  2XF7 A;  1KYZ A;  2PG4 A;  3DBL B;  5ICF A;  2FF4 A;  4QTR A;  1MBK A;  2Q1Z B;  1GXQ A;  3ABU A;  1DGW Y;  1UMQ A;  2Q2E B;  4GXO A;  3JRE A;  1Z67 A;  1ZN2 A;  2QEN A;  3PNY A;  5EF6 A;  3LA7 A;  1TNT A;  4CYC B;  1E3P A;  5BNG A;  2XAJ A;  4BS9 A;  3T8R A;  3J81 K;  5CQG A;  4CCJ A;  3A1Y A;  4BEH B;  5JI6 A;  2VON A;  1F5T A;  1A6I A;  4XLE A;  2EIL H;  1LVK A;  1RKW A;  1EA3 A;  4E7I A;  2X6O A;  4QIW N;  4A3K J;  3A0B C;  3F8B A;  5DCM A;  2PJP A;  4HV6 A;  3K7A J;  2HTJ A;  3E7L A;  2V1N A;  5E8G A;  3LAP A;  1P4X A;  4MGR A;  1IXR C;  2E1M B;  3M3Y J;  3RKW A;  3DWL E;  1BI3 A;  4A2U A;  2HVQ A;  3RPQ A;  4PSW A;  2R5Y B;  4ITV A;  1D5V A;  5J47 A;  3MKZ A;  2LD5 A;  2KRF A;  3E6C C;  3BZK A;  2LR8 A;  2DFI A;  2DU9 A;  3LAJ A;  2BZT A;  5A2Q Z;  1YJW I;  2COB A;  2VKV A;  3A02 A;  2VAS A;  4IQ4 A;  3GO5 A;  4LIV A;  2KIQ A;  2MA3 A;  1LKX A;  1WJB A;  4A6E A;  4BL0 B;  4ESF A;  2OQG A;  5GTI C;  1K79 A;  2BY3 A;  1O3T A;  2ZNZ A;  4IF4 A;  1Z91 A;  1W7P A;  3BG7 A;  4PK4 A;  2VXD A;  2RV8 A;  3TP0 A;  1G3W A;  2YSR A;  5HOO A;  1DPU A;  1LDK B;  1XTA A;  4HX7 A;  2V7F A;  2RRE A;  3DU6 A;  1BR1 A;  2XAQ A;  1FEX A;  3DFG A;  2D1V A;  2DYS H;  3WG9 A;  3ZQ7 A;  1FIP A;  1P7I A;  1ENH A;  1IRF A;  1T8I A;  1N78 A;  1XC5 A;  2HFH A;  2VQH A;  3QP5 A;  1MJB A;  1M1E B;  3ML6 A;  3FIS A;  1JKP C;  3CMM A;  2K5C A;  4GCV A;  4PFO A;  1W0T A;  2MSY A;  2L3D A;  4BE1 A;  4A5N A;  1FBU A;  2KP6 A;  1WJA A;  5HOD A;  4GRI A;  2DTZ A;  3PFY A;  3VSK A;  3H3V K;  3E3V A;  1TW3 A;  2GXG A;  1QZZ A;  2DI3 A;  1BI2 A;  3K4B A;  1K4S A;  4PJJ A;  4D5F A;  4O3M A;  2Z2S B;  4Y7N J;  5FB2 A;  5F1J A;  3NRV A;  4A5M A;  3FDY A;  2XRL A;  3BP8 A;  4UUT A;  2BW3 B;  1OR7 C;  1U8R A;  4AIK A;  1J5Y A;  3RZO J;  3AG1 H;  2Y0S N;  2LG4 A;  3KYL A;  4HF0 A;  2NOJ B;  3ECO A;  4JYK A;  3RKY A;  3RYP A;  3KP6 A;  1K83 J;  3TOA A;  4P9F A;  4B3X A;  1PJR A;  3C2H A;  3MCZ A;  3H5N A;  4L9N A;  5FO5 A;  4A3G J;  4RA2 A;  4BJ6 C;  5BS6 A;  3CO6 C;  5CVI A;  3BTJ A;  2BVM A;  2H1L A;  2FML A;  4ZH4 F;  5LEK A;  3LST A;  2R5Z B;  1J9I A;  4WK8 F;  3L2V A;  1UJ8 A;  3NQO A;  3DCF A;  2WBM A;  2IGK A;  3PSF A;  2E1N A;  5FGM A;  1FBS A;  4R79 A;  2JVG A;  2XV4 S;  1D1A A;  1HC8 A;  4BY7 J;  4E7K A;  1KYW A;  2HPI A;  4B44 A;  1CQT A;  1S72 I;  1H8A C;  4HDV A;  4KIB A;  4G7Z F;  2HOA A;  1LQ1 A;  3VDX A;  1KQ0 A;  2KZG A;  1IXS B;  2WAQ A;  4BNC A;  4PJ0 C;  3HGY A;  2WY7 Q;  4V2G A;  1Z3X A;  5D8L B;  2VLA A;  2VIX A;  5AON A;  3QOE A;  2CSO A;  2P8T A;  1XN7 A;  2LYC A;  4DQ2 A;  4DBQ A;  3TED A;  3OYE A;  4RB0 A;  4XKW A;  3MZH A;  3M1C A;  1W7P D;  4GO1 A;  1XX5 A;  4PSX A;  1ETX A;  4OWR B;  4JBA A;  2KIU A;  2EIK H;  3PQJ A;  1Y39 A;  1E3H A;  1OJL A;  3K4M A;  3VOE A;  2UZK A;  1G59 A;  4IKF A;  2MAB A;  1OLT A;  2PQ8 A;  4M9Z A;  4XBF A;  3WE3 A;  2E1C A;  1SFE A;  3TDZ C;  4LK1 F;  1ODD A;  1WWX A;  3M8J A;  2M5W A;  4G6T B;  1Y6I A;  1P2F A;  4IHS A;  3IWF A;  3CCJ I;  3FK6 A;  1YX5 A;  3Q9V A;  5J1Y A;  4NB5 A;  3PFI A;  2GZW A;  3AL0 C;  3FM3 A;  3O3K A;  5HVQ C;  4XOT A;  4E4H A;  1QRY A;  3DKW A;  3HEF A;  3S17 J;  1ETO A;  4JP0 A;  4YEJ A;  4OOI A;  1Y8Q B;  1YIO A;  1ZHF A;  1WJ5 A;  3FBN B;  1S29 A;  3ROU A;  4AID A;  2XC7 A;  3G6E I;  4RGU A;  1YIT I;  2KL4 A;  4UUS B;  3OS1 A;  4GYG A;  3GLL A;  1B4A A;  2RAE A;  3WHB A;  1T95 A;  4BXF A;  3CCV I;  5HS8 A;  4S05 A;  4AYB N;  1W36 D;  3MVP A;  2W4S A;  1HW1 A;  2E34 A;  1RR7 A;  3DF8 A;  4HRI A;  5D6F A;  2JA6 J;  5LBQ A;  1PDN C;  4LLL A;  4BJT A;  1B6A A;  3HOZ J;  4LOC A;  4C2M J;  3I54 A;  1SVL A;  4DYC A;  1ZAO A;  2ZJR F;  2P7C B;  2M4K A;  2AS5 F;  1J59 A;  1MND A;  4G9Y A;  3AAF A;  4QPO A;  1FOY A;  3H1C A;  3OOU A;  1X3W B;  3TP3 A;  1Y56 A;  3I9V 2;  3OR2 C;  3E1S A;  1MNM C;  4KT6 A;  4RAF A;  3UR3 C;  4CZZ A;  3RJP A;  4A3M J;  3IC7 A;  3BR5 A;  3X2Q H;  4CCK A;  2ZSH B;  3U21 A;  3GME A;  4PJL A;  4HSR A;  5KNL A;  4G6Q A;  3FK7 A;  1S7O A;  5HS9 A;  1YW9 A;  3P9I A;  1AA7 A;  4LK0 F;  3ABK H;  4BQA A;  3FHZ A;  1MDM B;  3PIO F;  3KCC A;  4HOB A;  3G1O A;  5LGT A;  5EJC A;  1X3Z B;  1XDS A;  5E18 F;  2JVH A;  1W5T A;  3OYA A;  5IY5 H;  3PNV A;  4KT5 C;  3S1M J;  1MIJ A;  1Z7L A;  4ESJ A;  1J2X A;  3RPU A;  5D4S A;  2CYY A;  4R8H A;  4D7N A;  4H0E A;  4R1H A;  3BCB A;  5LHI A;  1X19 A;  2JSC A;  2L7K A;  3F3X A;  4GFB A;  3DPL C;  3K10 A;  4XNF A;  1KQ9 A;  4D0P A;  5JLW A;  2A6E F;  2VOD A;  4F3Q A;  1RIO H;  4WXC A;  5F6F A;  3L09 A;  2XAS A;  4MFE A;  5K7H A;  5ILS A;  3DTK A;  2IT0 A;  2XRN A;  3HUG A;  3K2A A;  2LTP A;  1DU0 A;  3NAR A;  4PFP A;  3DXJ F;  2HXO A;  5KCM A;  3HB9 A;  2K4B A;  4M6Y A;  4WXD A;  1A31 A;  3GTK J;  5E17 F;  3W2W A;  2OU2 A;  3HJE A;  4NUB A;  5KAF C;  2PMZ A;  1WI3 A;  2BE5 F;  2XUB A;  3ABT A;  2KDZ A;  2JA7 J;  1W7P B;  3HHH A;  3HHG A;  3CME I;  2VE8 A;  2X6W A;  2XPW A;  2CS3 A;  3FXU A;  2LBF B;  2WB1 N;  2RNG A;  4C3H J;  1BW6 A;  3MKY B;  4I0A A;  4ZYG A;  1QHG A;  3CD6 I;  5C3E J;  2CGP A;  4B47 A;  1IF1 A;  2I8D A;  3LSK A;  3WU1 B;  4KN7 X;  5AIP A;  4XMY A;  3COA C;  4L18 B;  4BAC A;  2EV0 A;  2K02 A;  3RIR A;  5BMZ A;  4DGW B;  2QVO A;  2FJ1 A;  5FJ8 J;  4UV9 A;  1RET A;  3WTU C;  3AFH A;  3B6A A;  5GAG J;  1U6G A;  4BXU A;  5ILU A;  4AIH A;  2HYG D;  1G6N A;  2DLL A;  1OR7 A;  1KU7 A;  2E2J J;  2VL8 A;  2R7V A;  4E7J A;  1OCT C;  1S7E A;  3FF5 A;  3KYC B;  5BPI A;  1SMT A;  1R23 A;  2LF7 A;  1AKH A;  1FSH A;  2CRG A;  1YFH A;  2VQL A;  4HF1 A;  3ASN H;  1BI0 A;  2M34 A;  1WI9 A;  2ISZ A;  1GVJ A;  1LFB A;  5KK1 A;  2VJ5 A;  5E79 C;  4M72 A;  5C4X J;  1TP4 A;  4KYW A;  2P5K A;  4EGY A;  1XPX A;  5BQT A;  4DZJ A;  1VZ0 A;  2EFO A;  2R3S A;  1T08 B;  3FWE A;  3L7W A;  2ZME B;  2ZXW H;  4IOC F;  4BBR J;  2TCT A;  1VQ4 I;  4Y4R A;  3JRG A;  3KZY A;  1GUU A;  1QU3 A;  1JKO C;  3I0T A;  2QM3 A;  1RES A;  2D45 A;  3QRF F;  1QZY A;  2DAO A;  1VQ6 I;  1OMI A;  4CYC A;  3BJ6 A;  3TQN A;  2CFX A;  4PCQ A;  3HYI A;  3A03 A;  2CUZ A;  3RZD J;  1MMG A;  3BDD A;  3F0C A;  4RM3 A;  1W4M A;  1TNS A;  3F6V A;  3GEZ A;  1ULY A;  2DCE A;  4EV0 A;  1ZRE A;  4KIG A;  2XAG A;  2CV1 A;  3FXQ A;  2XGE A;  3OIO A;  3JAM Z;  3RKQ A;  3CDH A;  1R9T J;  3CCS I;  1AHD P;  2O5R A;  5K7Z A;  1QGP A;  3F21 A;  3PIP F;  3TOB A;  3K4K A;  4A3I J;  5LHG A;  3CC2 I;  1ONV A;  2R5Y A;  2CQQ A;  2QF7 A;  3KP3 A;  2EIJ H;  2L9R A;  1YI2 I;  1GDT A;  3SZT A;  5BPD A;  5IYC J;  1VQL I;  2VOO A;  3GF2 A;  3P7N A;  3DEE A;  3BTI A;  4F93 B;  4HEA 2;  2K9S A;  4UB6 C;  2YS9 A;  5IT9 Z;  3QQA A;  3FIW A;  5M5Y J;  3WTS C;  1MH4 A;  4AIJ A;  2IGM A;  1EKE A;  1JE8 A;  3CCQ I;  3U9G A;  4CGZ A;  3LMM A;  4XM3 A;  1WJC A;  4BGD A;  1BIB A;  2DA6 A;  3QOP A;  4IHX A;  4G7O F;  4E7Z A;  2WV1 A;  2I5U A;  2ZFW A;  2BY2 A;  3HGG A;  1U3E M;  2IS6 A;  3GWZ A;  2ETH A;  2K40 A;  2A6T A;  5HDG A;  3CDL A;  2EWN A;  1WQ2 A;  5E8I A;  2QWW A;  1D5Y A;  3GFJ A;  2V9K A;  2HKO A;  3GTP J;  2JA5 J;  1TWH J;  1JHF A;  3LA3 A;  5DM6 F;  2FU4 A;  3BR0 A;  1IN4 A;  1A04 A;  3JRD A;  1XGM A;  4U7B A;  5M5W J;  1Z6R A;  3B73 A;  1ZH5 A;  2L02 A;  2VUM J;  2E71 A;  5IYD J;  2VJ4 A;  1K78 A;  2H6C A;  2F48 A;  4HQM A;  4NBQ A;  1S5L C;  5CVR A;  5D8K B;  1WJD A;  1TQI A;  5F0C A;  1SAN A;  3GVA A;  2DA7 A;  3ZRG A;  3RKX A;  4OU0 A;  2VB6 A;  4LIT A;  4XLH A;  4E6K G;  3L2C A;  4D5C A;  1BC7 C;  5BOX A;  1Y1W J;  1MJ9 A;  1U5T C;  4AC0 A;  3N97 A;  2FBH A;  2O9L A;  2RQQ A;  1ON1 A;  1YS7 A;  1VFC A;  1WH5 A;  4M6V A;  1QPI A;  2VKH A;  2O6G E;  4ENJ A;  2H1K A;  3CC4 I;  3VYS B;  1T33 A;  1IW7 F;  4BYY A;  3J7A O;  2HYJ A;  1VI0 A;  3HL2 A;  3CES A;  2W85 A;  3LFU A;  2M2E A;  1JTY A;  4KJZ A;  1FZP B;  4XR6 A;  5DUK A;  3RTR A;  4RB1 A;  2F5C A;  3OYD A;  4HDU A;  5L3B A;  2ACJ A;  3KP5 A;  4M9X A;  5HLT A;  1D8K A;  2KZV A;  1OQY A;  1MBG A;  2R5Z A;  2QBY A;  3LWF A;  3W2V A;  5F0F A;  3CUQ C;  1IRZ A;  1VQ7 I;  1FNN A;  3F8N A;  2HZT A;  3OIQ A;  5HNH A;  2ZME C;  4BHB A;  3ZMT A;  1U78 A;  5IT3 A;  2P5L C;  2X6Y A;  2K9Q A;  2DMT A;  3CDI A;  2VBZ A;  4HX4 A;  4A3F J;  4AYB A;  4A3E J;  3LQQ A;  2QA4 I;  1G2H A;  3E6B A;  5J8C A;  4F55 A;  3G2B A;  3KX2 A;  1Z05 A;  4XKB A;  1PP8 F;  1IDZ A;  4X1E A;  1G3Y A;  5KAI C;  3L2R A;  1LB2 A;  1JTX A;  2DDB A;  1LFP A;  3I64 A;  2F5F A;  3WTV C;  3I59 A;  2QSF X;  4Q48 A;  2R0Q C;  2K85 A;  1D3Y A;  3B6C A;  2GBY A;  3HUG B;  3KP4 A;  4EJV A;  1X3U A;  3H0G J;  3KEQ A;  4OAY A;  1ZRF A;  1WPK A;  4Y15 A;  4I09 A;  2KDO A;  1Y8R B;  3DBR B;  1EH6 A;  3JSP A;  4AM3 A;  1A5J A;  2W84 A;  1XS9 A;  2Y9Y A;  6PAX A;  1U0J A;  3ECH A;  2RN7 A;  3M8F A;  3LSH A;  2KMU A;  1F1Z A;  2H94 A;  4JOM A;  4F52 A;  3HPH A;  4MLO A;  5M3F J;  3OS2 A;  1VQP I;  4L9V A;  1K6O A;  3K1P A;  2BY1 A;  1V54 H;  2OV7 A;  3IWZ A;  1IUF A;  5FLX Z;  3HXL A;  4EAT A;  1EV7 A;  3SDG A;  3JRA A;  2TDX A;  3C18 A;  3I53 A;  2A07 F;  1MMN A;  3HOU J;  4D9J A;  2NVU B;  4KIC A;  1IDY A;  2OZ6 A;  1F9N A;  3K6G A;  4IXA A;  2V6C A;  2AQE A;  2ZFU A;  1AKH B;  5L3D A;  3DLA A;  4ZJZ A;  1MBH A;  4ABZ A;  3FHN A;  4YIF A;  1MZB A;  4LJZ F;  3ERM A;  3WG7 H;  1DUX C;  1NH3 A;  1G3T A;  1FTZ A;  2H8R A;  4QLC U;  3EUA A;  2EQR A;  5CYV A;  3S1Q J;  2IAI A;  3HZJ A;  5EG0 A;  3ZR8 X;  1TWF J;  3BLY A;  2WB1 A;  2DA2 A;  4YG2 F;  3IP4 B;  2NS8 A;  1O3S A;  2E2H J;  3SEQ A;  2ZO4 A;  3ZCO A;  1UCR A;  4BUP A;  3E5X A;  1JGG A;  1RZ4 A;  1LVA A;  2JUG A;  4UXN A;  1BL0 A;  1TW2 A;  3L2W A;  3IL2 A;  2HR3 A;  3BR2 A;  2HWV A;  2Z99 A;  2ZXJ A;  2K86 A;  2LDU A;  3QOD A;  2EFW A;  4KIT B;  1REP C;  3VYT B;  3FXJ A;  3O8H A;  3JRB A;  3OV8 A;  1IN6 A;  3HPG A;  1MDM A;  4EVI A;  1Y1V J;  3OYL A;  4C2U A;  3K4J A;  3K70 C;  3DKY A;  1B8I A;  4A3C J;  1ORK A;  5EDN A;  4EJW A;  1HKT A;  5FKL A;  1OIS A;  2A61 A;  2M0C A;  4G94 A;  2F4O B;  2KT0 A;  2P5V A;  3DPT A;  2YU9 J;  4PUS A;  1FMW A;  1OCR H;  2OJE D;  4ZC3 A;  2HVS A;  1UHS A;  5TJJ A;  1BIA A;  5EYR A;  1FBQ A;  3JRI A;  3R0A A;  1LDD A;  2ZCW A;  2BYV E;  1JJ8 C;  4D1Q A;  2BHY A;  2QUF A;  2B63 J;  1ZGW A;  1ZLJ A;  2L7F P;  3FXO A;  3AL0 B;  2BGC A;  2O61 A;  4MNU A;  1W5C C;  4P5O A;  4X0G A;  5JR3 A;  1LDJ A;  1D0Z A;  4EM0 B;  1DDN A;  4CCO A;  3I56 I;  2HOT A;  1EF4 A;  2ESH A;  3WOD F;  2LF8 A;  2M8G X;  2X85 A;  5J8F A;  1FT9 A;  2LBF A;  3FXR A;  4ENN A;  2F2E A;  4PGG A;  4PGH A;  3SYT A;  3TDU C;  4Y52 J;  1SVO A;  5TIS C;  1BM9 A;  2IS4 A;  5EGO A;  2AO9 A;  1HSJ A;  2QQA A;  3H5A A;  3CQZ J;  1VQ8 I;  3PJR A;  4M73 A;  3VB2 A;  5J40 A;  4K2E A;  2JRT A;  1U5T A;  1D8J A;  4L9J A;  5TGT A;  2ZB9 A;  4N4O B;  5LGU A;  1K78 B;  5DD8 A;  1YTY A;  1WFX A;  3DPU A;  1O4X A;  4IHT A;  3H3U A;  1HA8 A;  3TMO A;  3L2Q A;  2DMU A;  2FX0 A;  1T38 A;  3ZMZ A;  2OCC H;  2YU3 A;  3ABM H;  4UVC A;  4ZYD A;  1PP7 U;  2PJR A;  2X1E A;  3I4M J;  3MD2 A;  1BW5 A;  4NDL A;  2F6C A;  2GA2 A;  1B59 A;  2BBY A;  4LFU A;  3QPS A;  3OY9 A;  1AWC A;  3SFZ A;  4XN0 A;  1RNL A;  2UXX A;  1U9N A;  3V42 A;  4KDP A;  2D2W A;  3CUQ A;  1SD7 A;  3OSG A;  2GXB A;  2R4G A;  3ZMV A;  2ZME A;  4RLF A;  5B1B H;  2JA2 A;  2V6E A;  3HIF A;  2J5P A;  3U2R A;  4XRS G;  1IC8 A;  2R7S A;  3CP8 A;  2MG4 A;  2P0W A;  3WU2 C;  3S14 J;  3W2A A;  4FCY A;  2IS2 A;  2YUS A;  2CFO A;  4BQQ A;  2H6B A;  5E3L A;  4BQN A;  1ACI A;  5DDG A;  4C3I J;  3MEX A;  4ZYH A;  4ETS A;  1OCP A;  3ZQL A;  2QBY B;  1NK3 P;  2CW0 F;  5D5X B;  4M3B A;  4N9I A;  3GUD A;  5D6E A;  4Q4Z F;  3H3Z A;  4LG3 A;  2FSW A;  2WTE A;  3Q0V A;  4FIS A;  3MZY A;  5ICG A;  1ZG1 A;  2K7L A;  2O8K A;  3C2B A;  3ZP5 A;  3E97 A;  3EQL F;  5FRN A;  5J4V A;  3U1D A;  2R93 J;  4XKV A;  4HNV A;  1EJ9 A;  3P5J A;  1ZAR A;  3ZN1 A;  5CVV A;  5A2Q K;  3AKZ A;  2VT3 A;  1Z21 A;  1O7F A;  2JTV A;  3O6B B;  4GYI A;  4L9T A;  4MTD A;  3KET A;  1UHM A;  3IHU A;  4AD9 A;  2QQ9 A;  1ITY A;  3ZMU A;  3TGN A;  2FBI A;  2V9V A;  4CCL A;  1BR4 A;  3I59 B;  4OMZ A;  3ZN0 A;  3QWL A;  4XON A;  5B1A H;  2N8G A;  1IZ1 A;  3KZI C;  1FP1 D;  4HLX A;  4ZDO A;  2HNH A;  2VBX A;  2XKO A;  3BTC A;  3DEU A;  3TO6 A;  2O03 A;  3ZQG A;  4B3A A;  1FPQ A;  1R00 A;  4J01 A;  5J4Y A;  1ETW A;  1BI1 A;  1QZE A;  1YG2 A;  5GPA A;  1P4A A;  1L3L A;  2O3F A;  5CVU A;  1JUP A;  3TW7 A;  1R1U A;  2PMH A;  3S2H J;  5B5E C;  4A69 C;  5DS9 A;  1YO5 C;  2M4G A;  2R7W A;  4A3D J;  1ZTR A;  2X0L A;  3GTO J;  3H9J A;  4CUG A;  5LLQ A;  4TV7 A;  2L9S A;  2M9H A;  3KEO A;  2IA0 A;  1FX7 A;  2LY2 A;  3L2U A;  2LP0 A;  1WHU A;  4C3J J;  2JN6 A;  3JCU C;  2M45 A;  3C7J A;  2FMY A;  3SDB A;  3HKZ N;  1R5G A;  3CJT B;  3AG3 H;  5CKT A;  3SXY A;  2CQN A;  4MEX F;  2CQ7 A;  5LRS A;  3TL4 X;  3D5R C;  3L00 A;  3I71 A;  1FOW A;  5CQE A;  4FT8 A;  4DYR A;  2LVS A;  3TKY A;  3I55 I;  1SD6 A;  3FMR A;  2VKD A;  3ONQ A;  1R5H A;  1JJ6 C;  5EG0 B;  2L7M P;  4IHY A;  4BJ5 C;  1B1B A;  5FKO A;  2XDV A;  4JX6 A;  3BPX A;  3V8J A;  4IX7 A;  1BOA A;  2X1D A;  4LD5 A;  5EEA A;  1TQM A;  4Z6Y A;  2VPL A;  4MHG A;  4DYQ A;  2Y69 H;  3OYC A;  1XD7 A;  4BDZ A;  2OCE A;  4CA0 A;  4MEY F;  2M30 A;  3Q3S A;  4J00 A;  2DOF A;  3WU0 A;  1D1C A;  3BC8 A;  2JJ7 A;  4NNJ A;  1E17 A;  4I6Z A;  2NVY J;  3QYE A;  2E36 A;  2MC3 A;  3SFI A;  3S15 J;  5C4J J;  4ZTF A;  2M7A A;  2ZXH A;  5LHH A;  3H36 A;  2CU7 A;  2IJL A;  1L0O C;  1ZRD A;  2Z9O A;  4UVB A;  4EJO A;  1B8I B;  4EM2 A;  2LRE A;  1IAW A;  1XB4 A;  4XLN F;  5J3L A;  1IV8 A;  4N0B A;  2VC1 A;  1C0W A;  1SFX A;  3S3N A;  1Z77 A;  1FLI A;  3PUB A;  4ZYE A;  3HRU A;  3D0S A;  3PSI A;  4IOA F;  1G3S A;  1S7A A;  2MH2 A;  2W7N A;  1GLN A;  4I01 A;  4JK1 X;  3M4O J;  5FKM A;  1R58 A;  4HST A;  2IRF G;  1TBX A;  2ELJ A;  2LSO A;  3FXM A;  2ZXI A;  1VQO I;  2QYO A;  4BKX A;  5D5V B;  3KE2 A;  1TTY A;  4AWX B;  3W3C A;  4KUM A;  2FXA A;  3CZ6 A;  4L5E A;  1GHC A;  4ZZL A;  2PFB A;  4YFK F;  5M3M J;  4RGX A;  2HVR A;  4B4C A;  2DW4 A;  5JHU A;  1T56 A;  1I27 A;  1KGS A;  1SC7 A;  1NK2 P;  3F72 A;  2VBY A;  2L0K A;  3K1M A;  3KP7 A;  4BQO A;  2F5D A;  2GOM A;  2BXY A;  4Y17 A;  1V5F A;  3NAU A;  4F92 B;  3DTI A;  1TWG J;  1X4O A;  1TLH B;  5EGO B;  4BAY A;  2RGV A;  2HI3 A;  3JRF A;  1UFM A;  4U0V A;  1X1B A;  4RAG A;  1PUF A;  2L9V A;  4BHP A;  3BG6 A;  3VWB A;  1G4D A;  3U1K A;  4ZYA A;  1U5T B;  2XF6 A;  1ETV A;  4HZF A;  2J5O A;  4ASN A;  3JW4 A;  2XB0 X;  2HDW A;  3LSR A;  3RSN A;  3FMQ A;  2MW8 A;  3HSE A;  3BJA A;  1I3A A;  2JSP A;  2E7X A;  4I76 A;  2OD5 A;  3HM5 A;  1ETY A;  1MNE A;  2B9S A;  2PJR B;  4MFD A;  3OMY A;  3ZMD A;  2AQF A;  3LSG A;  4MIM A;  3VSL A;  5FKN A;  5J1R A;  3K70 D;  3OIP A;  2LLK A;  2V26 A;  4L5J A;  3S93 A;  1BOB A;  4F7Z A;  3D5L A;  4AU7 A;  1BBY A;  2W25 A;  2M3A A;  2HQA A;  3CUQ B;  2VT2 A;  1ZGJ A;  1YOV B;  2LY1 A;  5FFZ A;  2NNN A;  1FSE A;  3UNG C;  4NC6 A;  2K3F A;  4I98 B;  2HDC A;  2CUJ A;  2VQC A;  4C30 A;  5IYB J;  3WGG A;  4Z2Y A;  3CMA I;  1KZH A;  5D5U B;  4PZJ A;  2PI0 A;  1XSV A;  4OIQ F;  2HPM A;  2JA8 J;  5ED4 A;  5E1W A;  3V8L A;  1B72 A;  3F6O A;  4XLF A;  4FAS D;  3CF5 F;  1MGT A;  2IPQ X;  1XGO A;  4FE4 A;  3Q5F A;  2VJJ A;  4EM1 A;  1OCZ H;  1X1P A;  2DA3 A;  2R7Q A;  1USS A;  4BE2 A;  2IEK A;  1ZR2 A;  1R22 A;  3BY6 A;  4YFN F;  2W24 A;  4NQW B;  2KJC A;  1P4W A;  4RB3 C;  3KLN A;  1TWA J;  2XIG A;  2L9N A;  3HOT A;  3AG2 H;  4IJA A;  1JKQ C;  3DP7 A;  4YIR X;  3HOW J;  3FXK A;  2ZJP F;  2DN0 A;  4C9Y A;  1IRX A;  3HBL A;  4JQF A;  3PQK A;  3IRR A;  2Y0S A;  2QKL B;  2NRA C;  3CLO A;  2WAF A;  2IA2 A;  4BHC A;  4II3 A;  1TZL A;  4BU2 A;  1JXS A;  2GOX B;  1IV6 A;  1ZG5 A;  5K7F A;  4DOZ A;  1IG7 A;  2RVC A;  1ETK A;  2VN2 A;  4E7H A;  2RQP A;  3MMY B;  1TWC J;  2CUE A;  3LFK A;  3PO3 J;  2VC0 A;  4JX5 A;  1SEU A;  2RNJ A;  2XAF A;  1HF0 A;  1ETQ A;  3BZC A;  3OL4 A;  1FIA A;  1A35 A;  1SD5 A;  2EBI A;  3N4M A;  1MMD A;  1WSU A;  2DK8 A;  1FC3 A;  1XSD A;  4KIS A;  3ISP A;  4U88 A;  1IJW C;  3C3W A;  4RGS A;  2XGC A;  4IO9 F;  2R7Z J;  1LEB A;  1DP3 A;  3DBH B;  5CPR B;  2L4M A;  2Y31 A;  2JQ7 A;  4E70 A;  3DLL F;  1SVM A;  1QPM A;  1Y0U A;  3HOS A;  4HYE A;  3F23 A;  3FKJ A;  3HRM A;  3JRH A;  4IRI A;  3PO2 J;  4RB2 C;  2IW5 A;  2MGQ A;  3TO7 A;  3JRC A;  2BHZ A;  3HSR A;  4UUV A;  5FRM A;  4CHU A;  4OIO F;  3BR1 A;  1KON A;  1UZC A;  4EMS A;  4YEL A;  1DPR A;  3OSF A;  4IRH A;  1P6R A;  2KLO A;  4WWC A;  5J1U A;  2LK2 A;  4V2F A;  4HX8 A;  5DEQ A;  1MJA A;  3JTG A;  1TC3 C;  3OYH A;  4QWQ A;  2LH9 A;  1V55 H;  2UUZ A;  5GPC A;  2EFN A;  1BJA A;  1OCO H;  1GVD A;  4BE0 A;  2W48 A;  3KZZ A;  4OIR F;  3W6K B;  1JI8 A;  2M8E A;  2KIM A;  5K5Q A;  1FWZ A;  2DT7 B;  4OAZ A;  1YQA A;  1R4M B;  2HYF A;  2NVX J;  2V1D A;  3REO A;  2DQR A;  3HDD A;  2PLY A;  1GXP A;  3V8K A;  4EJT A;  1LEA A;  2R7X A;  2V9P A;  4L0Y B;  4IVN A;  3T8T A;  2ELH A;  3G1L A;  3VYR B;  1QA6 A;  3S16 J;  3FBI B;  2H8W A;  2MYS A;  1ZQ3 P;  3A0H C;  1HW5 A;  5K5R A;  3D5S C;  3CJR B;  3PNT A;  2CG4 A;  2WAQ N;  4XSZ F;  1VF9 A;  3MWM A;  3QP6 A;  2FOW A;  2CW7 A;  3FXL A;  5HS7 A;  1YRN A;  2EA4 A;  1I1G A;  2Z5U A;  2W57 A;  2Q8K A;  2HEO A;  2WA0 A;  4MQ9 F;  2IGO A;  2A5Y B;  3LSI A;  3QU6 A;  1O3Q A;  1XMA A;  1QNT A;  2DMQ A;  3SZP A;  2EJR A;  5JHF A;  3H92 A;  1XGS A;  2CJJ A;  2VBW A;  2HTS A;  2E19 A;  3H5R A;  3BOQ A;  3QYF A;  1HKQ A;  5EEG A;  1I3Q J;  5IT9 K;  1ERD A;  5HLI A;  2L01 A;  1ZK8 A;  2KFD A;  5LRR A;  2Y2Z A;  1RPW A;  5L3C A;  1DU6 A;  3O2P E;  2DMN A;  3GFI A;  3A2K A;  2GLO A;  3OYM A;  4CSW A;  1RUO A;  1V4R A;  1N75 A;  3OYG A;  5DV5 A;  3FKI J;  1Z6T A;  3OR1 C;  1TT0 A;  1WJE A;  2DPD A;  2O8X A;  3KPH A;  3LSP A;  3J81 Z;  5E20 A;  3O8G A;  4O6J A;  2OUM A;  2VQG A;  1DGR M;  4LLN A;  2PN6 A;  2X48 A;  5HLG A;  1T0F C;  1T6S A;  4CH7 A;  1R4N B;  2AXT C;  2VOP A;  2EB7 A;  3EET A;  4MTE A;  1R5I D;  3MQ0 A;  4RM2 A;  5ILV A;  2XSD C;  1LE8 A;  2VE9 A;  2DTR A;  5K1Y A;  2G0E A;  4Y13 A;  1V3F A;  1P7J A;  1R7J A;  1ZRC A;  1DQU A;  1PUF B;  3V7S A;  3S2W A;  1ON2 A;  4MQV A;  1W5S A;  3CMY A;  5EEH A;  1QO0 D;  4UB8 C;  4NHJ A;  4LLG F;  3BRO A;  3GTL J;  5EZG A;  2RKH A;  4RBO A;  2JK3 A;  2IGN A;  2JZY A;  4OIN F;  1Y0N A;  5E1X A;  2IBD A;  4BY1 J;  1WH7 A;  3DEW A;  4UNO A;  5ICC A;  2E35 A;  3GTM J;  2EK5 A;  3E5U A;  4ON0 A;  3TBI A;  2M87 A;  2ZBK A;  2LRD A;  1R1T A;  4W97 A;  2MLK A;  4UV8 A;  3M07 A;  3LNQ A;  4WCG A;  5HDK A;  5F08 A;  2NAZ A;  3ZXS A;  1UEL B;  5L3G A;  3IV5 A;  3BTL A;  1HDD C;  4N4N B;  4FET A;  1CF7 B;  2DA1 A;  3OYK A;  2D1H A;  5AIQ A;  2DFE A;  4H4K C;  1U2W A;  2LC2 A;  4EQQ A;  2P81 A;  5H2F C;  4IHV A;  4ZDP A;  3OYB A;  2XVC A;  2BY0 A;  2E1O A;  1YX3 A;  5EZH A;  4HG2 A;  4P96 A;  5DTD A;  5IOY A;  1H9G A;  3WTT C;  4A0Z A;  1K4T A;  1FJL A;  1R36 A;  2GA1 A;  4LGW A;  1UG0 A;  5GTH C;  1YE9 A;  2QQ8 A;  5K5O A;  3F8M A;  1H9T A;  4AVP A;  3BCA A;  2WAD A;  4XRS A;  1B72 B;  1JUM A;  3EPZ A;  1E0E A;  4XRM A;  2ID6 A;  3MAJ A;  4ANJ A;  3W6J B;  3ZQH A;  4CIC A;  1QHH D;  3RCO A;  1ZG3 A;  2NS0 A;  1UG2 A;  3K2Z A;  1CGP A;  2QCO A;  4G7H F;  4AUX A;  3SZG A;  1MSF C;  1MSE C;  4I02 A;  1QVU A;  4IPA A;  1MBF A;  2PMZ N;  2L2O A;  4CXF A;  3P9K A;  3OL3 A;  4N9H A;  2E5Z A;  4KIF A;  2VXZ A;  2NYX A;  3CLQ A;  3R6S A;  2QKM B;  5F0H A;  2DYR H;  1QQI A;  1MH3 A;  4UVA A;  4UY8 I;  3HRS A;  3EUH C;  5FLM J;  2LNB A;  3M9A A;  5HDN A;  2OAZ A;  3BG3 A;  3MKW B;  2M1B A;  3G4S I;  2NVT J;  1UB9 A;  3JSO A;  2FD5 A;  4KNY A;  2IA1 A;  3QU3 A;  5HNF A;  2Y9Z A;  3HTU A;  2YPR A;  3K9T A;  2JPC A;  3CC7 I;  1NG6 A;  5FLX K;  1XCV A;  1IRG A;  2OPT A;  2P6T A;  2OZU A;  1F4K A;  3DKX A;  2MD0 A;  1HDP A;  2EPF A;  2FNP A;  5H6Q A;  1MKM A;  3T5X A;  3OS0 A;  3F22 A;  2NS7 A;  4FTH A;  2UXN A;  3KFW X;  2W1O A;  3S8P A;  3A01 A;  3GTJ J;  2FA5 A;  4HBL A;  1B9N A;  4EEF G;  1E3O C;  1X4P A;  2HXI A;  3J80 K;  1W1W E;  3OYI A;  1OYI A;  3GW2 A;  3K4L A;  1XSX A;  3IKT A;  1JT0 A;  2I10 A;  4CCM A;  2TRT A;  5DM7 F;  1XG1 A;  1AOY A;  1QBJ A;  4RAY A;  4LG0 A;  4HLY A;  4OMY A;  4XIC A;  3UKG A;  1WRJ A;  2DFH A;  2MH9 A;  3GTQ J;  2HS5 A;  1H0M A;  4V19 K;  2DJI A;  3ELK A;  4XRF A;  1LPQ A;  4JX4 A;  1K61 A;  3GLX A;  2AHQ A;  4DNC A;  2X6X A;  2K27 A;  2VKE A;  2MFZ A;  1RR8 C;  4QSH A;  2OC6 A;  5FRO A;  1JGS A;  2ELK A;  4Y3O A;  1JT6 A;  3T0Y A;  4FX4 A;  2KIF A;  4FQG A;  1TQP A;  2EZL A;  5LFA A;  3LSJ A;  5LEJ A;  3I5U A;  1WZ2 A;  3G73 A;  2WWY A;  1BR2 A;  3MFK A;  3A4C A;  1IN7 A;  3NWS A;  2ESN A;  4WX9 A;  2DQL A;  5ICE A;  5IP6 A;  2X51 A;  4M74 A;  3VEP A;  4B8X A;  1Q1V A;  3VYU B;  3F8C A;  4L5I A;  1LNW A;  2X1C A;  3K69 A;  1J0R A;  3VPR A;  2PBI A;  4HA8 A;  2FQ3 A;  2XHK A;  1VND A;  5GAH J;  3JR9 A;  2NNY A;  2KIS A;  3BQY A;  3H0D A;  1FMV A;  2L5Q A;  1R1V A;  2QQB A;  3WE2 A;  1YRN B;  1N25 A;  1X1A A;  4BDY A;  2V1U A;  4DZP A;  1YHQ I;  4XOR A;  1LFU P;  2F4M B;  4NQW A;  1I1S A;  1I5Z A;  2GWR A;  1FY7 A;  1NHA A;  1I6H J;  2R7U A;  1X2M A;  2RDP A;  4IEJ A;  1HW2 A;  3QPT A;  2GAU A;  3OYJ A;  1UHW A;  3OOP A;  3BJO A;  4MO7 A;  3G1M A;  1MMA A;  2GIZ A;  1O3R A;  4YFX F;  1T0F A;  1WVR A;  3L1P A;  1R71 A;  1W0U A;  1H88 C;  2A3S A;  4A93 J;  4P1W A;  1S6L A;  1U9O A;  2C6Y A;  4U0Y A;  3PM1 A;  2XSJ C;  4B1R A;  2PMU A;  3M7G A;  1FYL A;  3IAS 2;  4A6D A;  2HQN A;  2AXL A;  1MMS A;  1OYY A;  1YLF A;  1I39 A;  2E7W A;  2DO7 A;  3FMS A;  5KVR A;  3GFM A;  4G12 A;  4WF2 A;  1VQK I;  4E7S A;  2L7Z A;  5D4R A;  4HNT A;  2LFB A;  1T98 A;  1BJZ A;  1UST A;  1XDU A;  2Z16 A;  4DBR A;  3R0J A;  3DTE A;  3KYD B;  1NTC A;  1LE8 B;  3C1D A;  2BVL A;  1SAX A;  1HQC A;  1DP7 P;  3SQN A;  5TRD A;  1FYK A;  1X1D A;  5FD5 A;  2G7U A;  4II2 A;  4FHT A;  2M0M A;  2DBB A;  4ESB A;  3TW6 A;  1AU7 A;  1BN5 A;  2E1M C;  4BBS J;  2B0L A;  2OTJ I;  2ZKZ A;  3TO9 A;  4RDU A;  2K4J A;  2MC4 A;  3I4N J;  1IN8 A;  2E5N A;  4CZC A;  3BPV A;  1KU9 A;  3G71 I;  2HOS A;  2A68 F;  3ZOB A;  4A3B J;  1K6Y A;  2LMD A;  1Z3Y A;  3CP2 A;  3CCY A;  3VFZ A;  3WTX C;  2OF7 A;  4O5V A;  5H20 A;  3Q0W A;  4E7L A;  3GXO A;  2DMP A;  2XAU A;  2HZD A;  1PUE E;  4FX0 A;  2KRC A;  2EFP A;  2O0Y A;  2V1X A;  3EDP A;  2CV2 A;  2QSH X;  1Z7U A;  2Y0M A;  1ZKG A;  2ECB A;  5IP9 J;  2R7T A;  3PUF A;  3IUO A;  3SHF A;  1VQ5 I;  4U0W A;  2ZC2 A;  1D1B A;  2MLG A;  4XOP A;  4ENM A;  3GYH X;  3K1N A;  5ERI A;  1D0Y A;  4KN4 X;  4HAM A;  1Q1H A;  5C44 J;  1F36 A;  1NG7 A;  2HDD A;  2H09 A;  1O7L A;  2JMW A;  2R7D A;  1OPC A;  1VQ9 I;  3FZV A;  4PJN A;  1IO2 A;  3ULQ B;  3BG9 A;  1OCC H;  1MBE A;  1S8N A;  1X1C A;  5CLS A;  2G7H A;  5JVT A;  3CO7 C;  1YIJ I;  4LB5 A;  4WXH A;  2JPB A;  3ZGK A;  5B3S H;  4ENK A;  2LKX A;  1K7A A;  2XGD A;  3I4P A;  2XPV A;  2DT5 A;  3BG5 A;  3EUH A;  4I7H A;  2R7O A;  4B43 A;  3CJN A;  2HGC A;  4HNU A;  4U7D A;  2DPU A;  3EYY A;  1WKM A;  1A36 A;  1OFC X;  1EH8 A;  3BWG A;  3S3M A;  3V4G A;  2Y48 A;  1ZEL A;  2ME0 A;  2P6S A;  4X6A J;  5IPA A;  4I2O A;  3KEY A;  4HW0 A;  1B9M A;  3HC7 A;  3LA2 A;  1KQ8 A;  3IAM 2;  3HOV J;  2O7O A;  1BA5 A;  2HOE A;  3DU5 A;  1T2K A;  2H27 A;  2GIV A;  3L9F A;  5F04 A;  3ZQC A;  2Z33 A;  4S04 A;  2LKP A;  3MKL A;  1ZYR F;  5DCM B;  1RC9 A;  3HRT A;  4ZDL A;  4XL9 A;  1LJ9 A;  4L0Z B;  3CCM I;  3QAH A;  4HPQ A;  3KP2 A;  5FKK A;  4I99 C;  2XKP A;  3BT9 A;  2WY8 Q;  4M3F A;  4CYD A;  2VPR A;  1S3J A;  1GT0 C;  4M3E A;  2VI6 A;  1D0X A;  3GZ5 A;  1MD0 A;  3IRQ A;  1HCR A;  3F8F A;  4XN3 A;  3IKV A;  1APL C;  4LIU A;  4KFC A;  4KA4 A;  5E3M A;  4G6D A;  5F27 A;  2LY9 A;  5GAD J;  2BXZ A;  3HOX J;  3GFL A;  4J19 A;  3GBG A;  5KHD A;  4CDG A;  3T1B A;  1QVT A;  3RQ4 A;  3A01 B;  3M8E A;  1KU2 A;  5HLH A;  2FOK A;  3K0L A;  4A0Y A;  3J7A Y;  2HKX A;  3RDI A;  3ERE D;  2CW8 A;  2WC2 A;  4XKC A;  4FE7 A;  4LG0 B;  4XQF A;  4XSX F;  2DFF A;  4DJA A;  1P92 A;  9ANT A;  1YS6 A;  2UWM A;  1XMK A;  3B02 A;  2JWT A;  1X2N A;  2ID3 A;  4HF2 A;  1WJF A;  2Y75 A;  3C2G A;  1J09 A;  1ZGA A;  3WGH A;  2QZ8 A;  3ZQQ A;  4RMN A;  2UV1 A;  4DW6 A;  3GZN B;  2OBP A;  2BOL A;  4UHT A;  1XMX A;  2GM4 A;  1ZR4 A;  2L4A A;  2KQR A;  2P7V B;  1CF7 A;  3S32 A;  1SFK A;  5DD4 A;  1XGN A;  2A6H F;  2W82 A;  3E5Q A;  2EFQ A;  1BC8 C;  2EIM H;  4EGZ A;  3HG9 A;  2D5V A;  1TT5 B;  3EUK L;  4CO8 A;  2PX9 A;  1YJN I;  1SFO J;  2CWE A;  1WGX A;  2E2I J;  1Z0X A;  2QLZ A;  3IH4 A;  1HOM A;  1XCB A;  5M5X J;  4IZZ A;  1SAU A;  1IUY A;  2MD5 A;  2KJB A;  3CF2 A;  1OYW A;  4A3L J;  2W00 A;  2EH3 A;  4Y33 A;  5F64 A;  2IP2 A;  4M9S A;  3ZQF A;  3ZMS A;  4U87 A;  3S1N J;  2K9N A;  2JUC A;  1P9Q C;  2Q2E A;  3HOY J;  3WTW C;  1A6Q A;  2R7R A;  2R7F A;  5H6R A;  4XLP F;  3Q0U A;  3RPU D;  4XK4 A;  4D7M A;  3KIO A;  4XLC A;  4ZZD A;  4BEH A;  1UAA A;  3FM5 A;  2DOE A;  4GDF A;  4A3J J;  1SD4 A;  2HQ5 A;  4BXX J;  5B66 C;  3R61 A;  2FBK A;  1VQM I;  1HLV A;  1RUN A;  2X4H A;  2EZI A;  5DYM A;  4S0H B;  2M7B A;  1FOK A;  2DOD A;  2LKS A;  4YII A;  1R49 A;  3CCL I;  3DQV C;  5FFX A;  2Q0O A;  2A69 F;  4YRV A;  3RQI A;  4BH9 A;  3CCE I;  5L3E A;  3LL7 A;  2V79 A;  4NC8 A;  5JVG F;  3QPH A;  1FOX A;  3ZPL A;  1FYM A;  5GAE J;  1R6R A;  5IP7 J;  2XPU A;  3LSM A;  3G3Z A;  3CCR I;  2DJN A;  2COM A;  2XF5 A;  2GXA A;  4M71 A;  1SFU A;  2EZH A;  1GV5 A;  1V5G A;  5CVJ A;  4KMF A;  4IHW A;  1J75 A;  3AG4 H;  2QEX I;  2JRM A;  3NEU A;  3SJM A;  3I3L A;  4HQE A;  2KRH A;  3R4K A;  1RI7 A;  3M1E A;  2ECC A;  2CV0 A;  3ESW B;  2XAH A;  4M3D A;  2K9L A;  4HV5 A;  5IOZ A;  2DXI A;  4A12 A;  1HXD A;  2Z1D A;  3CUO A;  2KKO A;  1RRJ A;  2BEO A;  4M3G A;  4F91 B;  5CJ9 A;  1FTT A;  2FUG 2;  2F5V A;  2FRH A;  2CUF A;  3EYI A;  2L54 A;  1VTN C;  2XGX A;  3CTA A;  3HSF A;  3MN2 A;  4LMY A;  2BV6 A;  3QYB A;  1E2X A;  3GX4 X;  4IL6 C;  2A05 A;  3H9G A;  5E3O A;  4XID A;  1YYV A;  2GQQ A;  2NVQ J;  3KLO A;  5D5W B;  3WGI A;  3SEZ A;  2DOA A;  1SMY F;  3E0J B;  2V4J C;  3DV8 A;  2CH0 A;  2QSG X;  1F43 A;  1WCM J;  2G9W A;  3CJQ B;  3JAM K;  3H35 A;  3PL8 A;  2ADU A;  2DT6 A;  2DDA A;  3W6V A;  5F1R A;  2E60 A;  2EZK A;  3HKZ A;  4RS8 A;  2BW3 A;  3BR3 A;  1JHH A;  2DA4 A;  2YX7 A;  2NXN B;  1J7K A;  2IVM A;  3LOC A;  3D1N I;  4RLQ A;  5DCF A;  4XLA A;  4PDK A;  3WTZ A;  2VJI A;  1JUS A;  1I50 J;  2ME6 A;  2OQR A;  2XB5 A;  1I6X A;  2WAE A;  2MBF A;  2HQR A;  3S3O A;  3CCU I;  3BZ6 A;  4Q5S F;  3LQR A;  3GCM A;  1MBJ A;  4Q47 A;  1IXC A;  2F5E A;  4B48 A;  5JFR A;  4KMU X;  3N05 A;  2K3P A;  4PJM A;  3K4C A;  5LGN A;  1W36 C;  3IH3 A;  2DK5 A;  5E1Z B;  2FEZ A;  3K4N A;  4IRG A;  1HST A;  4AVZ A;  1H89 C;  4P55 A;  4RAZ A; 
#chains in the Genus database with same CATH homology
 1VQ4 I;  3CC4 I;  1FOW A;  3CCL I;  1HC8 A;  5GAD J;  3CCE I;  3I55 I;  1VQ6 I;  3PIO F;  5JVG F;  2OTJ I;  1FOX A;  5GAE J;  5DM7 F;  1S72 I;  2E35 A;  3CCR I;  3G71 I;  1VQ7 I;  1ACI A;  3DLL F;  4V19 K;  2K3F A;  2QEX I;  2ZJQ F;  3CCS I;  2QA4 I;  1YJW I;  3PIP F;  3CC2 I;  2E36 A;  3CMA I;  1Y39 A;  1QA6 A;  2H8W A;  1VQ5 I;  1YI2 I;  3CF5 F;  1VQL I;  2FOW A;  3CME I;  3CCJ I;  1VQN I;  4IOA F;  3CCQ I;  1VQ9 I;  1YJN I;  5GAH J;  3CD6 I;  2ZJP F;  1YJ9 I;  1YIJ I;  1YHQ I;  1VQO I;  3I56 I;  2OTL I;  3G6E I;  1YIT I;  1VQP I;  5GAG J;  5DM6 F;  4UY8 I;  3J7Z I;  2NXN B;  3CCV I;  2E34 A;  1VQ8 I;  3J7Y J;  3G4S I;  3CCU I;  1MMS A;  3CC7 I;  2ZJR F;  4IO9 F;  1VQK I;  3CCM I;  1FOY A;  3CJT B;  4IOC F;  2JQ7 A;  1VQM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...