2FOWA

The rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, 26 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RNA binding domain of ribosomal protein L11: three-dimensional structure of the RNA-bound form of the protein and its interaction with 23 S rRNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosome
molecule keywords RIBOSOMAL PROTEIN L11
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2fowA00
1ACIA 3G4SI 3J7YJ 1VQKI 2E36A 4IOCF 1VQPI 1YJWI 3CD6I 1QA6A 2QA4I 2OTJI 3DLLF 5JVGF 2NXNB 3CMEI 5DM6F 3CCRI 1VQ9I 3G71I 3CCUI 3PIPF 2ZJPF 2OTLI 4IOAF 3CC4I 2H8WA 3CC2I 3G6EI 3CCVI 1FOXA 3CCLI 1VQ6I 5GADJ 1VQ7I 3CC7I 3CCEI 4UY8I 1VQ8I 1FOWA 3CCJI 1YJNI 1VQ5I 2FOWA 5GAEJ 2QEXI 1YI2I 1VQ4I 1MMSA 1FOYA 1YJ9I 1Y39A 1YITI 2E35A 2E34A 3CCQI 1VQMI 1S72I 3CCSI 1HC8A 2ZJRF 5GAGJ 3CMAI 3CCMI 1YHQI 1YIJI 3CJTB 1VQNI 3I55I 3PIOF 1VQOI 1VQLI 5GAHJ 3I56I 5DM7F 2K3FA 4IO9F 2JQ7A 3CF5F 4V19K 2ZJQF 3J7ZI
chains in the Genus database with same CATH superfamily
1ACIA 3HHGA 2WADA 5HOOA 1ZKGA 3IL2A 4I6ZA 2OAZA 1ZREA 3SFIA 3ZQQA 4LLGF 4CH7A 2K86A 3F9KA 2MD5A 3DU6A 3FMSA 3JRGA 1LVAA 2ELKA 3D5RC 1OJLA 4CZCA 2HOAA 2CU7A 1SFUA 3BLYA 5K1YA 3FF5A 4C2MJ 1IC8A 3K1NA 1OYYA 2HPMA 4KN7X 5FD6A 1T98A 3V7SA 1PUFA 2XGEA 1E0EA 4YIFA 2HDWA 3TBIA 1RZ4A 2FU4A 4MO7A 4M6YA 5GPAA 3BZKA 1FJLA 1HKQA 2OZ6A 3ZXSA 5FKKA 2CUEA 2Y9ZA 3W2WA 1FTZA 5D5WB 2XAQA 2FBIA 4QTRA 2BGCA 3E6MA 3OYGA 2R3SA 2EFQA 2NS0A 3KEOA 3J7ZI 3BP8A 4XN3A 1P7JA 4KJZA 4M3DA 3V8LA 3QQAA 3CMEI 2WAEA 5J1UA 3BTJA 3DU5A 2JA6J 3EUHC 5ILSA 2H8WA 4ZZLA 2O3FA 4IRGA 2J5PA 5LRRA 3FKJA 2QEXI 3P9IA 3T8RA 2XVCA 4W97A 2XAGA 2M5WA 1R22A 4Y7NJ 3Q5FA 1J7KA 1I5ZA 2L01A 2NNNA 1KONA 2X6XA 4F3QA 1ZR4A 2VBWA 3HGGA 2R7OA 4XKCA 5C4XJ 2D2WA 2LRDA 3LL7A 3W6JB 4LK1F 4BNCA 2DCEA 2L7FP 2P7CB 3PQJA 2O0YA 1NHAA 3R61A 2D1HA 2PMZN 3NWSA 1Z6TA 2VL8A 1WKMA 1LFBA 1WJEA 4NC8A 5KAIC 2K02A 4BEHB 2UWMA 1IN8A 2W00A 3RKWA 1F43A 5KCMA 3IKTA 2QLZA 4PJMA 3AL0B 1MGTA 5DCFA 3KLOA 3G1OA 3FX3A 2MSYA 4BDZA 3ML6A 4A3EJ 3CZ6A 2V1XA 1V54H 2L7MP 5E1WA 3QYEA 3JRIA 4LFUA 2KPMA 4A3FJ 1SD6A 3VDXA 2JRMA 3C1DA 2JSCA 1XSXA 3S93A 1BI1A 3H3UA 1GV5A 5IP9J 3L2WA 3G6EI 2M0MA 2K9QA 1VQ6I 1JUSA 3TL4X 1W5SA 2F5EA 2OJED 4RB0A 4HNTA 3CMYA 1Y0NA 1MNMC 2R0QC 3WE3A 2STWA 3EYYA 3H5RA 2F4OB 3RZOJ 3DEEA 2CFXA 4KITB 3HG9A 3WGHA 1LQ1A 4KMFA 1R23A 2MG4A 4G6DA 3FM3A 4ZDPA 3E7LA 2XV4S 4OINF 3KZZA 1STZA 5HLGA 2P7VB 1KZHA 3M8FA 2ZXWH 1YS6A 3JTGA 3V42A 3CMMA 4XLCA 2CS3A 4OU0A 5BNGA 2XKPA 4KYWA 3AG4H 3JW4A 3GFIA 5D5XB 2QZ8A 3GF2A 2O03A 2LLKA 2NVTJ 4WXHA 1PUEE 2IBDA 1XB4A 5GAGJ 2K40A 1B4AA 5DD4A 1U8BA 4WCGA 1R5HA 1FPQA 2E1MB 3QU6A 2KISA 2K3PA 1MKMA 2XRLA 1XS9A 2PJPA 1GXQA 1OISA 3CC4I 1DUXC 1J0RA 3QP5A 1KU7A 1GHCA 1X19A 2IAIA 1HBXG 2KMUA 2AXTC 3OOPA 1J75A 1S5LC 4C2UA 1DQUA 2ZKZA 4HG2A 3H3ZA 4XN0A 1RKWA 4HX8A 3VSLA 2RC4A 3HC7A 1LUJB 5ICFA 3CLQA 4L5EA 3S2WA 2WV1A 2E2JJ 1TWCJ 3BPVA 1OLTA 3JTHA 4U0VA 4Y3OA 2VKVA 5HS9A 3MD2A 5K7HA 2JMWA 4W1UA 4LLNA 1HOMA 3MZYA 5EZGA 1RESA 3W2AA 2LVSA 1MIJA 1JE8A 3H36A 2H8RA 4MNUA 4UV8A 1YI2I 3FKIJ 2R7RA 2KRFA 1X4PA 4FQGA 4HOBA 2XKOA 2X1EA 3BJ6A 4GYIA 5AONA 1BI0A 1GUUA 4I0BA 3RYRA 3OS2A 1HKSA 1U5TB 4L0ZB 1J59A 2AXLA 1VNDA 2EV0A 2GWRA 3ABLH 4P96A 2MFZA 5JI6A 5ILUA 1IUFA 1TNSA 2NVYJ 2ESHA 1R00A 2ZSHB 3BR5A 4B44A 2CYYA 3MWMA 1OPCA 1ZAOA 4WF2A 2OTLI 2M30A 2FBHA 1RIOH 1LDKB 2VKDA 4UV9A 2ZBKA 3NRVA 4BBRJ 5IP7J 4L5IA 2AHQA 2X4HA 3MCZA 3JRDA 1QBJA 2EFOA 4ZYHA 2RN7A 2MYSA 2H94A 3H9QA 3GZ5A 4HA8A 3ZCOA 3SFZA 4CCKA 1K7AA 3BG7A 4RGXA 4BJ5C 4HX7A 1DU6A 1MJ9A 1USTA 2WB1N 2PX9A 1R36A 2CW0F 3CCUI 3HDDA 3VYUB 3PNTA 2D5VA 2IS4A 3LSPA 3FK7A 2FBKA 1ON1A 2L7KA 2MBFA 1B9NA 2WAQN 4A6EA 3FDYA 2K9NA 3DXJF 4KICA 3O3KA 1USSA 4BAYA 2HOTA 2HKOA 5LHIA 2L9SA 4A6DA 2JA2A 2A3SA 2OC6A 1R5ID 3HL2A 3S1MJ 3KEQA 2XSDC 3U9GA 3QODA 4MEXF 2ZSIB 2G7HA 3R6SA 4LMYA 1P7IA 2PMHA 2KDOA 1VQKI 4O3MA 3CTAA 4B09A 2ZJ2A 3CJQB 1ZTRA 3ZR8X 3BTLA 2QQBA 5AIPA 4CICA 2Q2EA 4I76A 2JN6A 3FXOA 3CP2A 1WPKA 2X85A 1S8NA 3FK6A 3GFLA 1FOWA 4KN4X 2V6EA 3BTIA 5DS9A 4JBAA 5F0CA 1J9IA 1ZG1A 3ASOH 2E1NA 3LFUA 1B1BA 2DA3A 1T95A 4E70A 3CJTB 1UFMA 3Q0WA 3KPHA 5A2QZ 4UVBA 4V2FA 4O6JA 5FKMA 5HDGA 2XPUA 3KFWX 3ZMZA 3EETA 3S32A 2V26A 3E5XA 1BN5A 3BR3A 3VOEA 4B48A 2DT6A 2ZJPF 2ZO4A 1U6GA 4B1RA 1YW8A 1KQ8A 3HTSB 3A0HC 4BJTA 1YJ9I 1Y39A 1RR8C 3PO2J 4D5CA 2VKHA 4HNVA 4BXXJ 1IV8A 5GTHC 4RLQA 2MLGA 1IGNA 2HYJA 3PJRA 2ZCWA 3I0TA 5BMZA 4M6VA 2M1BA 2KP6A 2M9HA 2A6EF 2Z2SB 2W4SA 4OMZA 1FSHA 1IJWC 2RREA 2HVQA 5LGNA 2M8EA 3WTVC 3OL4A 1YG2A 3WU0A 2VBXA 2M45A 4BH9A 1MMAA 4Q48A 3SEQA 4JP0A 1Z3YA 4HF2A 2Q8KA 5L3EA 1T38A 2ZJQF 4Q5SF 3J7YJ 3F72A 1EA3A 3FBNB 2ZNYA 2B9SA 1OCCH 1YE9A 4M9XA 3LSGA 3W3CA 3N4MA 4PCQA 3I4MJ 1AHDP 2G7UA 4YFKF 2R7WA 3GTMJ 1B72A 3GVAA 2W82A 2EA2A 3LA2A 3BC8A 5L3BA 4HLYA 1HQCA 3F6OA 2M4GA 4XM3A 5HLIA 1Y8RB 1YTYA 3OYMA 2OZUA 1D1CA 4G12A 3HOWJ 1TTYA 3BR1A 4D7NA 5DM7F 4R79A 2FSWA 2DW4A 2G0EA 4EGYA 1AOYA 3IUOA 4D0PA 3OIPA 4HSTA 4GXOA 1R71A 3NEUA 3M9AA 2L4MA 2Q2EB 3F0CA 1RR7A 3E5QA 3ABKH 3CCYA 2OCCH 5BPIA 2DPUA 3DF8A 5DDGA 1IXRC 1J5YA 3CO6C 4IKFA 3OYIA 1MMGA 2XIGA 2BHZA 2YU3A 3JRHA 3H0GJ 1JKOC 4PFPA 4KNYA 1JGSA 3I59B 2RV8A 4NC7A 2FX0A 1G59A 2VODA 1E17A 1DGRM 3M07A 1IXCA 4A2UA 2OTJI 2XF6A 2DYSH 2PMZA 4UNOA 2HNHA 2PN6A 3DFGA 2KKOA 1T8IA 1JTXA 1OCOH 4NNJA 5F27A 3DBRB 4TV7A 4FT8A 5CQEA 2ISYA 4R8HA 1ZGJA 3S2HJ 1FOYA 3BJOA 1WSUA 2EZIA 1O3RA 3KIOA 2V1DA 1JHFA 4C3HJ 3UR3C 2ZMEA 2QQ8A 3SHFA 2QYOA 4KUMA 2Y69H 2IS1A 2Y31A 1T0FC 2GXGA 1BI2A 2DJNA 1U8RA 2WB1A 2CQXA 1I6HJ 1TWAJ 3OY9A 2V9PA 5EG0A 3S3MA 1YJWI 3TO9A 2XRNA 2EFPA 5D5VB 4FX4A 1FMVA 3RSNA 1R5GA 4YEJA 3VPRA 3B73A 1F1ZA 2HZDA 4ENNA 2KIQA 3HTUA 2GBYA 1U0JA 3ZN0A 3WU2C 5L3DA 4DIQA 1X3ZB 2DN0A 1MW7A 4Y52J 1LDJA 3GX4X 3MKYB 1OYIA 3RPUA 5J8FA 3MFKA 4F92B 5K5OA 1QNTA 3K70C 3CUQA 3L1PA 4IO9F 3M8EA 2CW7A 3J81Z 2L02A 1V55H 2QM3A 2M3AA 4HZFA 4EV0A 4RGUA 2EPFA 3CCRI 1MH3A 4MLOA 2VXZA 4PFOA 3BR0A 1K83J 4LIVA 3K4MA 3C18A 5J3LA 2RDPA 3L2CA 3CCVI 4RDUA 1WHUA 5BS6A 5EGOB 4UUVA 1SMYF 4BUPA 2WAFA 1FIPA 1ZARA 4QPOA 1NG7A 3L9FA 4X0GA 2L2OA 3A03A 4HYEA 1FBQA 2XB0X 2QENA 4LITA 1MMDA 2FMLA 4V19K 2XROA 3HZJA 1JI8A 4NQWA 2LF8A 3OYLA 3S17J 1IG7A 1DU0A 3C2BA 1KYZA 4QSHA 1R1VA 3J81K 3WHBA 1ENHA 4UB8C 2W57A 2HTJA 2IVMA 3FWEA 3OYBA 3F6VA 2MLKA 4BYYA 5KVRA 4IHXA 1KYWA 3GZNB 3DKWA 3LSTA 2R5YB 3B6AA 3KLNA 2AQEA 1FP2A 4OIQF 3T5XA 3GTQJ 2VBYA 1RKTA 5KNLA 1VQPI 3K9TA 4ZYEA 4IHVA 3RPQA 1UMQA 3QPTA 2CQNA 2M7AA 2OPTA 4EM2A 1O57A 1XDUA 3Q0VA 2Z33A 4XLHA 1HW2A 3BQYA 3BJAA 2FNAA 1OCPA 3OR2C 1P4XA 4LD5A 1U9NA 5FD5A 1YYVA 3C7JA 2H6CA 3KE2A 1CF7B 3BG9A 4UB6C 1K6YA 2X1DA 2PFBA 2QF7A 2IA2A 3OYAA 3HOZJ 3CF2A 4ZYDA 4UUSA 4EJUA 5JLXA 5DTDA 5EDNA 4BEHA 1EKEA 1WCMJ 3VODA 2HQNA 3KEYA 5D6FA 1A04A 3LQQA 3RQ4A 3IRRA 1VQ7I 1LE8A 2XASA 1APLC 1EH7A 3RCOA 3F8BA 1WJCA 5BQTA 4H0EA 4BGDA 3K4JA 4N9HA 3SDGA 2DJIA 2EFNA 3F8CA 3FIWA 3KYCB 1W4MA 3ECHA 3NWTA 1ZLJA 1SFKA 1NK2P 2ZNZA 1AA7A 1BW6A 4P5OA 4MHGA 5J1RA 4ENKA 3HSFA 2P6SA 2Y0SA 4XKBA 5K7ZA 2QBYB 1QHGA 3WU1B 2HOEA 1U2WA 1V4RA 1XGNA 1R7JA 3T1BA 1SFOJ 3D0SA 2M34A 1KU3A 1D1AA 1I1GA 2A5YB 2V7FA 5F0FA 1QQIA 4A12A 4I7HA 2D45A 2COBA 3KYLA 2EILH 5F1JA 3QU3A 3PO3J 4IJAA 1MJAA 3ZQGA 4XOTA 1FYMA 3ROUA 1BIAA 4IHTA 1QZZA 3F3XA 4PUSA 2CO5A 3MKZA 4J00A 2IT0A 4BY1J 5K7FA 2MH2A 1PJRA 3TP0A 4L18B 3NARA 3PSIA 4CDGA 2K4JA 5HDKA 2OUMA 3ZMUA 4DYRA 5M5WJ 1T56A 4N4NB 3HSRA 3K70D 2V9VA 2JSPA 1VQOI 1XMKA 1ZYRF 4S05A 3I56I 3RI4A 3I58A 1A31A 3GLXA 1RUOA 2E5NA 3IC7A 3CD6I 1ZK8A 2VPLA 3F22A 3WTUC 4A0XA 4NHJA 2DO7A 1RNLA 2H1LA 4BHBA 3CLOA 1TC3C 2O5RA 3DKXA 3JAMK 1ZGAA 1SFEA 1S29A 5LEJA 2ACJA 2NVXJ 3H0DA 2ESNA 5TRDA 2WY7Q 1MZBA 3W6VA 4RGSA 1WZ2A 2AQFA 4DW6A 3WTTC 3G4SI 1ZG5A 1PP7U 3DTKA 3BOQA 1YFHA 2WY8Q 2V9KA 2W48A 4F52A 1LFPA 3T8TA 5EZHA 4Z2YA 3TW7A 3WTZA 2HXIA 3K4CA 2F5VA 4E7IA 1FTTA 1D0YA 1LEBA 3S3OA 2Y0SN 3K7AJ 3N05A 4M3BA 2R5ZB 1RUNA 3KZYA 2KFDA 4P55A 5FKOA 3X2QH 4CUGA 2E7WA 1YRNB 3DLAA 5LGTA 3LSMA 3U21A 1IDYA 1BC7C 3GW2A 3H35A 2VJ5A 1FZPB 2HQAA 2M4KA 2JTVA 5E79C 2GLOA 2MC4A 4BHPA 4RB1A 3OWTA 5HNHA 1D1BA 1GVJA 3BTCA 4YG2F 2EA4A 3F23A 3ZPLA 1NH3A 4X6AJ 4AIHA 1AKHB 5FFXA 2DPDA 2LP0A 4J01A 1G3TA 1P92A 2M0CA 2VKEA 2X0LA 1MNDA 1HSTA 4IHWA 4L9TA 4RAFA 2KQRA 1N25A 1D0XA 4HLXA 4AC0A 3U2RA 2E7XA 3ZQHA 1O3SA 2D1VA 4HEA2 4Q47A 5E18F 2DDAA 3OYHA 3Q3SA 2EV5A 1V5GA 2O7OA 2PQ8A 4PJLA 3M1EA 5L3GA 4IQ4A 3W6KB 1BA5A 3J7AO 3CDHA 5J6XA 3S1QJ 2YPRA 1R49A 1Z3XA 4R1HA 2QQAA 3OYFA 4N4OB 2DXIA 5F64A 3L09A 1U5TC 3IH4A 4G94A 3PFYA 1X2NA 3DPUA 4EJTA 3S2DJ 3M7GA 5IOYA 2P6TA 1UZCA 2HI3A 5DUKA 5FROA 2H1KA 2DMUA 3H5NA 3JRCA 5JHUA 5ED4A 3NQOA 4BHCA 2EINH 4RS8A 3IWFA 1DPRA 3P9CA 4S04A 4IRIA 3WTWC 2CUFA 4HRIA 4LGWA 1QPMA 2PG4A 3S3NA 2RQPA 1ULYA 3CCQI 2M8GX 1IW7F 4LB6B 2BBYA 4G8XA 4OIPF 3Q0UA 4A3DJ 3WE2A 3GTPJ 3K4BA 5FLMJ 2W24A 1WH5A 3C3WA 3FMRA 9ANTA 2KLOA 1H9GA 2OQRA 5C3EJ 1ONVA 4BACA 1G3YA 3P7NA 4A5MA 4Z6YA 5J47A 2CWEA 2Z1DA 1HA8A 3FXQA 4CCNA 3JSPA 1T39A 4U7BA 4XRFA 2V1UA 3HB9A 1ZRCA 4UUTA 3E97A 1DP7P 4I0AA 3ZP5A 5EJCA 2ZJRF 1QU3A 5FO5A 3G1LA 3TKYA 3QYBA 3CESA 5FB2A 1LPQA 3ZQCA 1LDDA 3CUQC 1JGGA 4IF4A 1POGA 2ELJA 5TISC 1BM9A 5EF6A 1ZR2A 2GOMA 2V1NA 3EUKL 2XGXA 2VQHA 5HNFA 1BOAA 3RKYA 1MJBA 5LEKA 3HUGA 2TCTA 4IHYA 2M2EA 4LLLA 4GYGA 1FNNA 5H6QA 2BOLA 5LHHA 1FIAA 2ICWG 1BJAA 3HIFA 1FC3A 1YQAA 1F4KA 2LG4A 1HW1A 4ESFA 3J7AY 4Y33A 2L7ZA 5K5RA 4A0ZA 2HWVA 1TT5B 4QLCU 5K5QA 3AG1H 4XICA 3KP6A 1IXSB 2EBIA 3LA7A 3WHCA 2DA6A 4CCMA 2DMPA 1D5VA 4CCJA 2A5WA 1QZYA 2DODA 3OSFA 1CQTA 2HKXA 2LDUA 1A35A 1Y1WJ 5CYVA 1MDMB 2XGDA 2LMDA 1A6IA 3GBGA 2BZTA 3S16J 2F5DA 1BOBA 1WI9A 2FXAA 2BE5F 1QRYA 2BW3A 2K27A 2LH9A 5B3SH 3LNQA 1AWCA 2FEZA 4JOMA 5CJ9A 5DV5A 4WXCA 3J80Z 1RRJA 2MGQA 3ZQ7A 2IP2A 2VE8A 2VQGA 3ZMVA 1IZ1A 3LQRA 2RNGA 4G6QA 4KISA 1IN6A 1Z1DA 2OBPA 2QA4I 2BW3B 3DLLF 4UXNA 5IYBJ 3S15J 3F8MA 3FM5A 2UXNA 3P5JA 3OYDA 3JAMZ 1KQ9A 1KU2A 2DFIA 2EIKH 4CO8A 1LB2A 2EK5A 4ZYAA 2PLYA 4IQJA 4F93B 1F5TA 4E7SA 4BQAA 4PSXA 4E7ZA 4WWCA 3R0JA 4AD9A 4BS9A 3OYJA 4MFDA 4FHTA 2BVLA 2XAJA 3CUQB 3WTYC 4M74A 2IA0A 1JKQC 2GXBA 1WFXA 1SD5A 3ZQIA 5JHFA 2VJIA 4QPQA 4IL6C 5AIQA 3HKZN 1XD7A 1UHWA 3H9GA 3C2GA 1ZQ3P 3OMYA 3SZTA 2DA7A 1YIOA 5CVJA 3CDIA 1Y1VJ 4IHSA 3ZQLA 3FZVA 2X48A 3VFZA 4PJNA 3HRTA 2IGNA 2K9MA 2VOPA 3DWLE 3ABTA 4V2GA 1R4MB 2EIMH 5F0HA 3FHNA 5J4VA 1XGOA 2KJCA 3E5UA 4OWRB 3OIQA 4J19A 3I4NJ 3L2RA 4AUXA 3LOCA 3RKQA 1LE8B 1F9NA 1WH7A 3L2QA 3WODF 1BR2A 3CUOA 3M4OJ 1E3OC 2MD0A 3S1NJ 2HXOA 4G9YA 5EG0B 2VPRA 1Y56A 2JWTA 2M7BA 1XC5A 4II3A 5JR3A 1FOXA 5M5YJ 1WJFA 2WBMA 3HPHA 4IXAA 2LC2A 4MEYF 3MN2A 2OQGA 2BXYA 2DQLA 3G3ZA 2GA2A 3EUHA 1XCVA 3GO5A 1CF7A 2HU9A 2QVOA 5HS7A 1BBYA 1Y0UA 1MDMA 2MA3A 2E2IJ 3DV8A 2ID6A 2HZTA 1I50J 3PUFA 4L9VA 3ABUA 2G9WA 5B5EC 4QWQA 4HSRA 3TEDA 2A6TA 4M71A 3WGGA 2NXNB 3FISA 4E7JA 1HW5A 3SXYA 4I09A 2O61A 2X51A 4RAZA 1LFUP 2GIZA 2H09A 3CDLA 2CSOA 1FSEA 2VT2A 4HDUA 5ICCA 2DMNA 4AU7A 1VQ4I 2Z16A 2Y48A 2VC1A 4IX7A 3ERED 2VASA 1E3HA 2JK3A 3UNGC 1EH8A 4HF0A 2DT7B 1G8XA 1O7FA 3BR2A 2HYGD 4DZPA 1JT6A 3GCMA 4U87A 2DFHA 1Z7LA 1W5TA 1ETOA 2E36A 3EYIA 2BVMA 3L7WA 2K9SA 1L0OC 2QBYA 3HGYA 4AIDA 3SEZA 1XDSA 3TO6A 4F55A 4YRVA 5FRMA 2HVSA 1A5JA 2NNYA 5D8LB 4HW0A 3RZDJ 2GZWA 2XB5A 4XNFA 1MMNA 2I10A 3GUDA 1FP1D 1VFCA 1WWXA 1ZG3A 1K78A 2R7SA 4HPQA 5EEHA 4BY7J 1IDZA 1XPXA 3NAUA 2KZGA 2M87A 2QSFX 3BZ6A 3G1MA 1F36A 2Y30A 2L4AA 1D8JA 3I5UA 4C9YA 1QO0D 2CW8A 2V79A 3TGNA 5HODA 4FCYA 2XGCA 2YX7A 4XMYA 3TO7A 2YX4A 3OIOA 1W36D 5CVUA 5E20A 1SANA 5FFZA 3WG9A 5HVQC 4MTEA 3LSHA 1QPIA 3O2PE 4U0WA 3HOYJ 3E6DA 3H1CA 4UY8I 2GQQA 2IRFG 2YR2A 5GAEJ 2CG4A 5J1YA 1I39A 3M3YJ 1YO5C 4XRSG 2RGVA 1T33A 3R60A 4UVCA 3WTSC 1ZGWA 1MBEA 1OKRA 4HNUA 5B1AH 2OA4A 1FT9A 2IW5A 3IP4B 3SDBA 3LSJA 2CH0A 3D5LA 4HX4A 2IGMA 3TDZC 1DDNA 4XORA 3RJPA 4K2EA 4C30A 3BG5A 2FE3A 2R7QA 4L9JA 1K4SA 1JJ8C 5DYMA 1H8AC 1IRGA 2BY3A 3E0JB 2BY0A 3HXLA 5D4SA 4A3CJ 3LFKA 2ZFWA 4M73A 4DBRA 1W5CC 3I53A 4XLPF 2QSHX 3COAC 2LBFB 4CYCB 1MH4A 2DLLA 3K1PA 2F2EA 4HQEA 2W7NA 2Y75A 1MNEA 2DAOA 1SFXA 3DBHB 4A93J 3VSKA 3QP6A 1S3JA 1S6LA 1X1AA 3M1CA 1X3UA 4E6KG 1IO2A 5CPRB 3GTKJ 4JYKA 4WK8F 1GXPA 3KZIC 1TW2A 1X4OA 3HHHA 5LGUA 1QA6A 1G4DA 2CRGA 1PVEA 1VI0A 3ISPA 3IRQA 4A0YA 1ETXA 2XHKA 3K10A 5CLSA 5D5UB 2O6GE 3A4CA 3HPGA 1FMWA 4IVNA 1L3LA 1QZEA 4AIKA 4D7MA 2RAEA 3SQNA 2LREA 2F6CA 2W25A 4ZZDA 5DUIA 1WJBA 1GT0C 1SD7A 4MQ9F 1KQ0A 3GYHX 1X1BA 3LA3A 3LAPA 4ZH4F 4EATA 5HLHA 1S7EA 2QWWA 4A3IJ 1O3QA 4YFXF 3MKWB 2E1MC 3V7RA 3GFJA 4LG0B 2N8GA 1OR7A 1FYLA 2JPBA 2KIUA 3L2VA 1V3FA 4ASNA 3EDPA 1FBUA 2HR3A 2Q0OA 3CQZJ 4BU2A 1SC7A 3MZHA 3QPHA 2A69F 1FLIA 1OCTC 3HKZA 2DK8A 2F48A 3DPTA 2NVQJ 3O8GA 3JCUC 1XSDA 1R58A 4HQMA 1VZ0A 1Z67A 4I2OA 2P4WA 1S7AA 4XKVA 4GRIA 1U3EM 4M3EA 5DCMB 2ZMEC 3D5SC 2XUBA 2STTA 2DMQA 1HXDA 2E2HJ 4ENJA 4M3FA 3ULQB 4M9ZA 2EWNA 4L0YB 1FBSA 3CC2I 1IN7A 2GAUA 4GO1A 1W7PA 1SD4A 2A07F 4EGZA 3HBLA 5DCMA 1TQPA 3SYTA 3U1KA 2E19A 4GGGA 3BY6A 5C44J 1YITI 2VUMJ 2ZMEB 2UV1A 3BPXA 3KYDB 1Z05A 3JRAA 1JJ6C 5KHDA 2Q1ZB 1B9MA 5E17F 4RA2A 2JPCA 3DP7A 5EYRA 2XAFA 5IOZA 1W7PB 4HBLA 1SAXA 1T08B 3GLLA 1U5TA 2DTZA 5M3FJ 1E3PA 2QGUA 2E71A 1W36C 2DQRA 1MBGA 1RI7A 1SAUA 1H9TA 3ELKA 3BG3A 3K69A 2NOJB 1Y6IA 3V8KA 5TJJA 3KCCA 1GDTA 2V6CA 2LOOA 1RC9A 3CJRB 5E3NA 3K4LA 3LSIA 2EZHA 4JX6A 4ON0A 2EV6A 1YLFA 2BYVE 1VQNI 3P9KA 1YW7A 5BPDA 2GM4A 2R5YA 1GLNA 1XX5A 1SEUA 2QSGX 3KP5A 2JA7J 2RQQA 2XSJC 3RIRA 3K2ZA 5E3OA 2KL4A 3ZRGA 4RMNA 2ID3A 5LBQA 3HOXJ 4GDFA 2MW8A 2IS2A 2RNJA 1D0ZA 3K4NA 3KP7A 4H4KC 1U9OA 1N77A 3FXKA 3OOUA 1XTAA 4P9UA 2DFFA 2XAUA 1G3WA 2VJJA 3QOEA 2EFWA 3BDDA 1D8KA 3TW6A 2L54A 2TRTA 1MBKA 1WI3A 4XIDA 1N78A 4L9NA 1LNWA 2V4JC 3CO7C 1W0UA 3ZMSA 5GAHJ 1J2XA 3I54A 4DYCA 4EVIA 2ZXJA 5F1RA 2WV0A 2R7VA 4CXFA 1A36A 2VI6A 1IAWA 1K4TA 3MZ8A 1NK3P 2DOEA 2NAZA 1BI3A 1R1TA 2JJ7A 5H6RA 5ICGA 2DYRH 3JREA 1REPC 2ETHA 5F6FA 1ERDA 4BKXA 2WTEA 1X1DA 3MKLA 1PYVA 4N9IA 2CV0A 2E60A 5IPAA 1U78A 4JK1X 4ZJZA 3HEFA 2OU2A 1P6RA 3SJMA 4BE1A 4XR6A 2ECCA 4ZDLA 3I71A 4OIRF 1BW5A 5J40A 1V5FA 1W7PD 3K0LA 2P5KA 3PIPF 3A0BC 2LY1A 1YX5A 2QKMB 2O8KA 1WRJA 1HKTA 2FF4A 2HVRA 2LSOA 3OS1A 4XSZF 4C2TA 4PGGA 5LHGA 4BQQA 5E3MA 3KETA 4PK4A 3E3VA 2LK2A 2TDXA 5LLQA 3QPSA 3GTGJ 2DU9A 2EZKA 2XPWA 1T6SA 3V7CA 4JQFA 4OAZA 2HOSA 5IYDJ 1QVTA 3K6GA 1OFCX 2P8TA 2DK5A 4KT6A 5F04A 1EF4A 4ZYGA 5FRNA 2LFBA 1BJZA 2VQLA 2X6OA 5EEAA 1JKPC 1H88C 1R4NB 2CQKA 2IJLA 2WWYA 1BR1A 4G7ZF 1TWFJ 3IH2A 4LB5A 2Y0MA 3ZN1A 1XMXA 1EV7A 4PZJA 4P9FA 1Z91A 5CVRA 3MEXA 2FMYA 1TZLA 3GMEA 4OAYA 3GTOJ 3CMAI 4DNCA 1IRFA 2P0WA 4D9JA 5TGTA 5H20A 2NOGA 2Y2ZA 2P5LC 4IEJA 1D3YA 4E7HA 2EB7A 1K6OA 1I1SA 1WQ2A 3DTIA 2OV7A 4EJWA 4LIUA 1ZRFA 2JUCA 4EM0B 4HAMA 3BROA 1R6RA 1ETWA 2E1CA 1HF0A 3ONQA 1IV6A 4B3AA 3PM1A 2KHMA 1MMSA 3I4PA 1JHHA 2VB6A 4BQOA 1DPUA 2QCOA 2XPVA 1FYKA 1JXSA 3PQKA 2LF7A 3MMYB 4PGHA 3I55I 1IRZA 1DP3A 2HQ5A 4RLFA 1MSFC 2MH9A 3AG3H 3CF5F 4YIRX 4XRMA 4M6XA 1W1WE 4KMUX 3ZMTA 1TQMA 3PNYA 3HUGB 3G71I 3D1NI 1IRXA 3IAM2 1I27A 1PUFB 1WJAA 3L2UA 2NRAC 2OF7A 2R93J 4KT5C 1S7OA 1PDNC 1LEAA 2W85A 3BT9A 2BXZA 1JT0A 4D1QA 3HM5A 5IP6A 2VIXA 3DEUA 3FHZA 2JQ7A 1FY7A 3BR6A 3R0AA 2VE9A 4CHUA 1K78B 4Y13A 2HEOA 4UVAA 3RYPA 3K4KA 3E6CC 2CJJA 4X1EA 2HGCA 1FX7A 3GXOA 2Z3YA 3GWZA 3FBIB 3E6BA 4UUSB 5BOXA 1TNTA 2DFEA 2DBBA 5FJ8J 2O8XA 4BXUA 3KP2A 5LFAA 2VQCA 2C6YA 5FKNA 2BHYA 2E35A 3FXJA 2BEOA 1P4AA 1Y8QB 3E1SA 4MQVA 3ZGKA 1VF9A 1ODDA 1M1EB 3GFMA 3HOUJ 3U1DA 1QHHD 3JR9A 2JZYA 4U7DA 3RQIA 5CVVA 4DOZA 5J8CA 1V5EA 5FGMA 2KRCA 2YUSA 3JRBA 3DQVC 2QKLB 4B8XA 3QPLA 4BDYA 3S1RJ 1X3WB 4I99C 5CVIA 4I02A 4BE0A 3HOSA 2LY9A 3N97A 2F4IA 4OMYA 1IN4A 2Z5UA 1O7LA 4MTDA 4ZTFA 2LTPA 1HSJA 4L5JA 4WXDA 1VQ8I 1TWGJ 2NS8A 1Z7UA 3WGIA 1ON2A 2R7FA 4IPAA 4G7OF 2LR8A 1ITYA 2X6YA 3PUBA 3K2AA 4EJOA 5JFRA 2PI0A 3OYNA 3I9V2 1YHQI 1TLHB 2YU9J 4B43A 3OYEA 1B8IB 2CFOA 4AVZA 4QIWN 2AO9A 2VN2A 3TQNA 1XCBA 2VXDA 2DI3A 1HDDC 1VQ9I 1LJ9A 2BV6A 2QQ9A 4NQWB 5GADJ 2PEXA 3B6CA 2VOOA 5M3MJ 2F4MB 4HDVA 1B72B 4XL9A 5EGOA 3VYRB 4F7ZA 2CQQA 2E1OA 2MABA 2XDVA 4CZZA 2A68F 4XKWA 4ZTJA 1IF1A 2FJ1A 2PJRA 3WG7H 2GIVA 1YIJI 1O3TA 4EEFG 3RPUD 4ZDOA 2ZXIA 2DA1A 4CGZA 1Q1VA 2HFHA 2UUZA 3ZOBA 1VQLI 1MSEC 3AL0C 4A3GJ 4OIOF 5CKTA 4LK0F 5E3LA 1N75A 4ENMA 3DCFA 2NYXA 2CUJA 2KRHA 3SZGA 3VEPA 5FKLA 2AS5F 3HRMA 5H2FC 3ESWB 4XRSA 2WAQA 2ME6A 2CUZA 1JKRC 1AU7A 1MBHA 2EIJH 2COMA 5L3CA 4CA0A 1UCRA 2F5CA 4BQNA 1ZRDA 2IS6A 2JVHA 2HPIA 1YRNA 2L9RA 3OL3A 3RDIA 4A3JJ 2LNBA 3DBLB 2EJRA 2HS5A 3OR1C 4MIMA 4E4HA 2LD5A 2K85A 3AG2H 2HQRA 1ETVA 3IAS2 4E7LA 2EQRA 4M9SA 3H92A 4CSWA 1XN7A 2ADUA 2PMUA 2DMTA 2Z9OA 3A02A 1X2MA 4FE4A 4LG3A 3BWGA 4O5VA 5JVGF 1T2KA 1OCZH 1C0WA 5DM6F 3S14J 2LKPA 3ZMDA 4B3XA 3ECOA 4XLEA 3GTLJ 2FQ3A 3JRFA 1OQYA 3BZCA 2FOKA 5HLTA 1Q1HA 3HJEA 1YOVB 4EM1A 1UAAA 1SVOA 1P2FA 2X1CA 3J80K 2YSRA 2H27A 1GVDA 1JUPA 3EQLF 1ZLKA 3GEZA 2R92J 3CCSI 4A3LJ 3F21A 1IUYA 2VLAA 3CCMI 4E7KA 3ASNH 2VC0A 1EH6A 4KIGA 1B59A 3CP8A 4DZJA 2CV1A 1ZH5A 4HV5A 2K4BA 3LSRA 4IOCF 4ABZA 4AVPA 1FEXA 2HTSA 4A3KJ 1K61A 4GCVA 3A01A 3F8FA 1RETA 4I01A 3TOAA 1NTCA 4U0YA 4YFNF 1DGWY 3GZ6A 1JUMA 1MBFA 2PBIA 1XGMA 5C4JJ 4KDPA 2L9VA 4B4CA 4C3JJ 3HOTA 1O4XA 1ZHFA 2LKSA 1UELB 2B63J 2HYFA 5GP9A 1UHSA 2R7TA 4ESJA 3V8JA 3ABMH 5JLWA 1I6XA 2JRTA 2R7DA 3I59A 3IWZA 2XC7A 5IT3A 1X1PA 4FE7A 4XLFA 1B6AA 1G6NA 2A61A 5DD8A 6PAXA 2JUGA 1SVLA 3VB2A 4D5FA 3KP3A 4XQFA 2W84A 2KJBA 3CC7I 3FXRA 2Y9YA 5FLXZ 1VQ5I 2K9LA 1T0FA 1MBJA 4MGRA 2F5FA 4P1WA 3DEWA 4PJJA 1VTNC 4RGRA 2KIMA 3QAHA 3K1MA 4B47A 1CGPA 3GTJJ 3F8NA 2P5VA 3G2BA 1Z6RA 3PIOF 3AKZA 2LY2A 2PJRB 3OYKA 2VJ4A 2WC2A 3MVPA 3TDUC 3LSKA 2EH3A 4M72A 3HSEA 1YX3A 5E1ZB 2KDZA 4NDLA 5IYCJ 3LAJA 2HDDA 1J09A 3OS0A 2FRHA 4RAYA 1P4WA 4Y15A 2DT5A 2LBFA 5HDNA 3CCEI 4A5NA 1XSVA 2I8DA 3KP4A 4XLNF 4CYDA 4BXFA 5ILVA 2CMPA 4WX9A 2H6BA 2K5CA 2KZVA 3A1YA 1UG2A 1D5YA 5D8KB 3VWBA 1OMIA 2DOFA 5IT9K 2W1OA 3UKGA 5E8GA 2DDBA 3IV5A 4G7HF 2VONA 4U88A 2ISZA 4YELA 4OOIA 3PNVA 3H9JA 2QUFA 2WA0A 1TL8A 1BR4A 4BJ6C 1YJNI 4CCOA 5L3FA 2O9LA 1UG0A 1SMTA 1H0MA 2ELHA 3SZPA 3LMMA 5FLVA 4AM3A 2MC3A 4RM2A 1I3AA 2NS7A 4LJZF 1ORKA 4Y17A 4DYQA 5GTIC 1BL0A 2FQ4A 2ECBA 5B1BH 3JSOA 4LOCA 4A3MJ 3OSGA 3BCAA 5DEQA 5D4RA 4XSXF 1JTYA 3TOBA 4XK4A 4KFCA 4HV6A 2IXSA 4IRHA 2VBZA 4AYBA 1FWZA 3QOPA 4Y4RA 3HRSA 4XBFA 4I98B 4PDKA 1TWHJ 2K7LA 4EJVA 3VYSB 2CGPA 3CCJI 3EUAA 5KK1A 3FXMA 2HDCA 2EZLA 2DA5A 1X1CA 4EMSA 3MQ0A 5J4YA 1ETYA 4DJAA 2A05A 3OV8A 1Z21A 3FXLA 1B8IA 4FISA 1W0TA 2ME0A 1GV2A 2X6WA 4ANJA 2E5ZA 3MAJA 3OYCA 4IOAF 3DKYA 1OCRH 2X9DA 3W2VA 3M8JA 5F08A 3QYFA 4KA4A 1OR7C 1QGPA 1A6QA 2ZB9A 2YS9A 1ZN2A 1G3SA 1TP4A 1UHMA 2DOAA 2KT0A 1VQMI 1I3QJ 1UB9A 5M5XJ 1KGSA 3O6BB 4JX5A 4FTHA 1LKXA 2OD5A 4ESBA 4M3GA 1HC8A 1XGSA 5KAFC 4N0BA 4ETSA 4IZZA 2LKXA 3IHUA 2ZFUA 3CJNA 3DPLC 5E1XA 4UHTA 1Z0XA 1TBXA 2CQ7A 1QVUA 4ITVA 2IEKA 2L9NA 1KU9A 5HS8A 2FA5A 5ERIA 4XOPA 4NC6A 1TT0A 3EPZA 4NBQA 3KX2A 1P9QC 2Z99A 3A01B 2DA4A 1TQIA 2GA1A 4KIBA 3ERMA 4RAGA 4RBOA 5GPCA 1WVRA 3S8PA 1WGXA 3QWLA 3HYIA 4BE2A 2BY2A 4JX4A 4CYCA 2FUG2 4RM3A 4PJ0C 2P81A 3PL8A 5CQGA 4XLAA 5E8IA 2DTRA 2J5OA 2FD5A 2ZC2A 1TW3A 4YIIA 4EQQA 3H5AA 3TP3A 3HRUA 3FMQA 4HF1A 1PP8F 4CCLA 2RVCA 2IA1A 2K3FA 2LYCA 3BG6A 2JVGA 1HDPA 1NG6A 1R1UA 3TMOA 2R7ZJ 3AAFA 4ZC3A 4DBQA 2FNPA 2GXAA 3IKVA 5D6EA 1LVKA 2CV2A 2ZXHA 4DQ2A 3A2KA 2JA5J 4GFBA 1YS7A 2JT1A 3RTRA 1BIBA 4LG0A 2R7UA 3VYTB 3WTXC 1HLVA 1E2XA 1KA8A 4PSWA 4F91B 2E34A 3T0YA 1ETKA 4XONA 3H3VK 3PFIA 4G6TB 5JVTA 2XAHA 3FXUA 4KIFA 1Z77A 2XF5A 2B0LA 2GOXB 2L3DA 4NUBA 2NVUB 4Q4ZF 2R7XA 1WJDA 2IPQX 3Q9VA 4NB5A 5ICEA 1BC8C 3DTEA 1ZELA 1UJ8A 3R4KA 1MD0A 3HOVJ 3ZQFA 3G73A 4DGWB 1IN5A 4A3BJ 4II2A 2L5QA 1ETQA 1K79A 4BL0B 3I64A 4RB3C 5A2QK 2OCEA 2XF7A 1YW9A 4FASD 2A6HF 3C2HA 4BBSJ 2UXXA 3I3LA 1Z9CA 3IH3A 1WJ5A 4FX0A 3REOA 2KIFA 1H89C 3B02A 2R4GA 3Q9SA 2L0KA 5IT9Z 3QRFF 2JA8J 1OYWA 1XMAA 3L00A 3BCBA 3CCLI 2BY1A 4FETA 3AFHA 2DA2A 2UZKA 1AKHA 4AWXB 4C3IJ 5B66C 1HCRA 2I5UA 1XG1A 3RKXA 5FLXK 2B7EA 5EEGA 1SVMA 2IGKA 3LWFA 4AIJA 1S9HA 2RKHA 4AYBN 2VT3A 4RB2C 1R9TJ 1G2HA 1X58A 3O8HA 5LRSA 2FOWA 4MFEA 5LD2C 1S72I 4S0HB 4A69C 2R5ZA 2IGOA 1RPWA 5IY5H 1FOKA 3PSFA 1EJ9A 3BQZA 3V4GA
chains in the Genus database with same CATH topology
1ACIA 3G4SI 3J7YJ 1VQKI 2E36A 4IOCF 1VQPI 1YJWI 3CD6I 1QA6A 2QA4I 2OTJI 3DLLF 5JVGF 2NXNB 3CMEI 5DM6F 3CCRI 1VQ9I 3G71I 3CCUI 3PIPF 2ZJPF 2OTLI 4IOAF 3CC4I 2H8WA 3CC2I 3G6EI 3CCVI 1FOXA 3CCLI 1VQ6I 5GADJ 1VQ7I 3CC7I 3CCEI 4UY8I 1VQ8I 1FOWA 3CCJI 1YJNI 1VQ5I 2FOWA 5GAEJ 2QEXI 1YI2I 1VQ4I 1MMSA 1FOYA 1YJ9I 1Y39A 1YITI 2E35A 2E34A 3CCQI 1VQMI 1S72I 3CCSI 1HC8A 2ZJRF 5GAGJ 3CMAI 3CCMI 1YHQI 1YIJI 3CJTB 1VQNI 3I55I 3PIOF 1VQOI 1VQLI 5GAHJ 3I56I 5DM7F 2K3FA 4IO9F 2JQ7A 3CF5F 4V19K 2ZJQF 3J7ZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ACI A;  3G4S I;  3J7Y J;  1VQK I;  2E36 A;  4IOC F;  1VQP I;  1YJW I;  3CD6 I;  1QA6 A;  2QA4 I;  2OTJ I;  3DLL F;  5JVG F;  2NXN B;  3CME I;  5DM6 F;  3CCR I;  1VQ9 I;  3G71 I;  3CCU I;  3PIP F;  2ZJP F;  2OTL I;  4IOA F;  3CC4 I;  2H8W A;  3CC2 I;  3G6E I;  3CCV I;  1FOX A;  3CCL I;  1VQ6 I;  5GAD J;  1VQ7 I;  3CC7 I;  3CCE I;  4UY8 I;  1VQ8 I;  1FOW A;  3CCJ I;  1YJN I;  1VQ5 I;  2FOW A;  5GAE J;  2QEX I;  1YI2 I;  1VQ4 I;  1MMS A;  1FOY A;  1YJ9 I;  1Y39 A;  1YIT I;  2E35 A;  2E34 A;  3CCQ I;  1VQM I;  1S72 I;  3CCS I;  1HC8 A;  2ZJR F;  5GAG J;  3CMA I;  3CCM I;  1YHQ I;  1YIJ I;  3CJT B;  1VQN I;  3I55 I;  3PIO F;  1VQO I;  1VQL I;  5GAH J;  3I56 I;  5DM7 F;  2K3F A;  4IO9 F;  2JQ7 A;  3CF5 F;  4V19 K;  2ZJQ F;  3J7Z I; 
#chains in the Genus database with same CATH topology
 1ACI A;  3HHG A;  2WAD A;  5HOO A;  1ZKG A;  3IL2 A;  4I6Z A;  2OAZ A;  1ZRE A;  3SFI A;  3ZQQ A;  4LLG F;  4CH7 A;  2K86 A;  3F9K A;  2MD5 A;  3DU6 A;  3FMS A;  3JRG A;  1LVA A;  2ELK A;  3D5R C;  1OJL A;  4CZC A;  2HOA A;  2CU7 A;  1SFU A;  3BLY A;  5K1Y A;  3FF5 A;  4C2M J;  1IC8 A;  3K1N A;  1OYY A;  2HPM A;  4KN7 X;  5FD6 A;  1T98 A;  3V7S A;  1PUF A;  2XGE A;  1E0E A;  4YIF A;  2HDW A;  3TBI A;  1RZ4 A;  2FU4 A;  4MO7 A;  4M6Y A;  5GPA A;  3BZK A;  1FJL A;  1HKQ A;  2OZ6 A;  3ZXS A;  5FKK A;  2CUE A;  2Y9Z A;  3W2W A;  1FTZ A;  5D5W B;  2XAQ A;  2FBI A;  4QTR A;  2BGC A;  3E6M A;  3OYG A;  2R3S A;  2EFQ A;  2NS0 A;  3KEO A;  3J7Z I;  3BP8 A;  4XN3 A;  1P7J A;  4KJZ A;  4M3D A;  3V8L A;  3QQA A;  3CME I;  2WAE A;  5J1U A;  3BTJ A;  3DU5 A;  2JA6 J;  3EUH C;  5ILS A;  2H8W A;  4ZZL A;  2O3F A;  4IRG A;  2J5P A;  5LRR A;  3FKJ A;  2QEX I;  3P9I A;  3T8R A;  2XVC A;  4W97 A;  2XAG A;  2M5W A;  1R22 A;  4Y7N J;  3Q5F A;  1J7K A;  1I5Z A;  2L01 A;  2NNN A;  1KON A;  2X6X A;  4F3Q A;  1ZR4 A;  2VBW A;  3HGG A;  2R7O A;  4XKC A;  5C4X J;  2D2W A;  2LRD A;  3LL7 A;  3W6J B;  4LK1 F;  4BNC A;  2DCE A;  2L7F P;  2P7C B;  3PQJ A;  2O0Y A;  1NHA A;  3R61 A;  2D1H A;  2PMZ N;  3NWS A;  1Z6T A;  2VL8 A;  1WKM A;  1LFB A;  1WJE A;  4NC8 A;  5KAI C;  2K02 A;  4BEH B;  2UWM A;  1IN8 A;  2W00 A;  3RKW A;  1F43 A;  5KCM A;  3IKT A;  2QLZ A;  4PJM A;  3AL0 B;  1MGT A;  5DCF A;  3KLO A;  3G1O A;  3FX3 A;  2MSY A;  4BDZ A;  3ML6 A;  4A3E J;  3CZ6 A;  2V1X A;  1V54 H;  2L7M P;  5E1W A;  3QYE A;  3JRI A;  4LFU A;  2KPM A;  4A3F J;  1SD6 A;  3VDX A;  2JRM A;  3C1D A;  2JSC A;  1XSX A;  3S93 A;  1BI1 A;  3H3U A;  1GV5 A;  5IP9 J;  3L2W A;  3G6E I;  2M0M A;  2K9Q A;  1VQ6 I;  1JUS A;  3TL4 X;  1W5S A;  2F5E A;  2OJE D;  4RB0 A;  4HNT A;  3CMY A;  1Y0N A;  1MNM C;  2R0Q C;  3WE3 A;  2STW A;  3EYY A;  3H5R A;  2F4O B;  3RZO J;  3DEE A;  2CFX A;  4KIT B;  3HG9 A;  3WGH A;  1LQ1 A;  4KMF A;  1R23 A;  2MG4 A;  4G6D A;  3FM3 A;  4ZDP A;  3E7L A;  2XV4 S;  4OIN F;  3KZZ A;  1STZ A;  5HLG A;  2P7V B;  1KZH A;  3M8F A;  2ZXW H;  1YS6 A;  3JTG A;  3V42 A;  3CMM A;  4XLC A;  2CS3 A;  4OU0 A;  5BNG A;  2XKP A;  4KYW A;  3AG4 H;  3JW4 A;  3GFI A;  5D5X B;  2QZ8 A;  3GF2 A;  2O03 A;  2LLK A;  2NVT J;  4WXH A;  1PUE E;  2IBD A;  1XB4 A;  5GAG J;  2K40 A;  1B4A A;  5DD4 A;  1U8B A;  4WCG A;  1R5H A;  1FPQ A;  2E1M B;  3QU6 A;  2KIS A;  2K3P A;  1MKM A;  2XRL A;  1XS9 A;  2PJP A;  1GXQ A;  1OIS A;  3CC4 I;  1DUX C;  1J0R A;  3QP5 A;  1KU7 A;  1GHC A;  1X19 A;  2IAI A;  1HBX G;  2KMU A;  2AXT C;  3OOP A;  1J75 A;  1S5L C;  4C2U A;  1DQU A;  2ZKZ A;  4HG2 A;  3H3Z A;  4XN0 A;  1RKW A;  4HX8 A;  3VSL A;  2RC4 A;  3HC7 A;  1LUJ B;  5ICF A;  3CLQ A;  4L5E A;  3S2W A;  2WV1 A;  2E2J J;  1TWC J;  3BPV A;  1OLT A;  3JTH A;  4U0V A;  4Y3O A;  2VKV A;  5HS9 A;  3MD2 A;  5K7H A;  2JMW A;  4W1U A;  4LLN A;  1HOM A;  3MZY A;  5EZG A;  1RES A;  3W2A A;  2LVS A;  1MIJ A;  1JE8 A;  3H36 A;  2H8R A;  4MNU A;  4UV8 A;  1YI2 I;  3FKI J;  2R7R A;  2KRF A;  1X4P A;  4FQG A;  4HOB A;  2XKO A;  2X1E A;  3BJ6 A;  4GYI A;  5AON A;  1BI0 A;  1GUU A;  4I0B A;  3RYR A;  3OS2 A;  1HKS A;  1U5T B;  4L0Z B;  1J59 A;  2AXL A;  1VND A;  2EV0 A;  2GWR A;  3ABL H;  4P96 A;  2MFZ A;  5JI6 A;  5ILU A;  1IUF A;  1TNS A;  2NVY J;  2ESH A;  1R00 A;  2ZSH B;  3BR5 A;  4B44 A;  2CYY A;  3MWM A;  1OPC A;  1ZAO A;  4WF2 A;  2OTL I;  2M30 A;  2FBH A;  1RIO H;  1LDK B;  2VKD A;  4UV9 A;  2ZBK A;  3NRV A;  4BBR J;  5IP7 J;  4L5I A;  2AHQ A;  2X4H A;  3MCZ A;  3JRD A;  1QBJ A;  2EFO A;  4ZYH A;  2RN7 A;  2MYS A;  2H94 A;  3H9Q A;  3GZ5 A;  4HA8 A;  3ZCO A;  3SFZ A;  4CCK A;  1K7A A;  3BG7 A;  4RGX A;  4BJ5 C;  4HX7 A;  1DU6 A;  1MJ9 A;  1UST A;  2WB1 N;  2PX9 A;  1R36 A;  2CW0 F;  3CCU I;  3HDD A;  3VYU B;  3PNT A;  2D5V A;  2IS4 A;  3LSP A;  3FK7 A;  2FBK A;  1ON1 A;  2L7K A;  2MBF A;  1B9N A;  2WAQ N;  4A6E A;  3FDY A;  2K9N A;  3DXJ F;  4KIC A;  3O3K A;  1USS A;  4BAY A;  2HOT A;  2HKO A;  5LHI A;  2L9S A;  4A6D A;  2JA2 A;  2A3S A;  2OC6 A;  1R5I D;  3HL2 A;  3S1M J;  3KEQ A;  2XSD C;  3U9G A;  3QOD A;  4MEX F;  2ZSI B;  2G7H A;  3R6S A;  4LMY A;  1P7I A;  2PMH A;  2KDO A;  1VQK I;  4O3M A;  3CTA A;  4B09 A;  2ZJ2 A;  3CJQ B;  1ZTR A;  3ZR8 X;  3BTL A;  2QQB A;  5AIP A;  4CIC A;  2Q2E A;  4I76 A;  2JN6 A;  3FXO A;  3CP2 A;  1WPK A;  2X85 A;  1S8N A;  3FK6 A;  3GFL A;  1FOW A;  4KN4 X;  2V6E A;  3BTI A;  5DS9 A;  4JBA A;  5F0C A;  1J9I A;  1ZG1 A;  3ASO H;  2E1N A;  3LFU A;  1B1B A;  2DA3 A;  1T95 A;  4E70 A;  3CJT B;  1UFM A;  3Q0W A;  3KPH A;  5A2Q Z;  4UVB A;  4V2F A;  4O6J A;  5FKM A;  5HDG A;  2XPU A;  3KFW X;  3ZMZ A;  3EET A;  3S32 A;  2V26 A;  3E5X A;  1BN5 A;  3BR3 A;  3VOE A;  4B48 A;  2DT6 A;  2ZJP F;  2ZO4 A;  1U6G A;  4B1R A;  1YW8 A;  1KQ8 A;  3HTS B;  3A0H C;  4BJT A;  1YJ9 I;  1Y39 A;  1RR8 C;  3PO2 J;  4D5C A;  2VKH A;  4HNV A;  4BXX J;  1IV8 A;  5GTH C;  4RLQ A;  2MLG A;  1IGN A;  2HYJ A;  3PJR A;  2ZCW A;  3I0T A;  5BMZ A;  4M6V A;  2M1B A;  2KP6 A;  2M9H A;  2A6E F;  2Z2S B;  2W4S A;  4OMZ A;  1FSH A;  1IJW C;  2RRE A;  2HVQ A;  5LGN A;  2M8E A;  3WTV C;  3OL4 A;  1YG2 A;  3WU0 A;  2VBX A;  2M45 A;  4BH9 A;  1MMA A;  4Q48 A;  3SEQ A;  4JP0 A;  1Z3Y A;  4HF2 A;  2Q8K A;  5L3E A;  1T38 A;  2ZJQ F;  4Q5S F;  3J7Y J;  3F72 A;  1EA3 A;  3FBN B;  2ZNY A;  2B9S A;  1OCC H;  1YE9 A;  4M9X A;  3LSG A;  3W3C A;  3N4M A;  4PCQ A;  3I4M J;  1AHD P;  2G7U A;  4YFK F;  2R7W A;  3GTM J;  1B72 A;  3GVA A;  2W82 A;  2EA2 A;  3LA2 A;  3BC8 A;  5L3B A;  4HLY A;  1HQC A;  3F6O A;  2M4G A;  4XM3 A;  5HLI A;  1Y8R B;  1YTY A;  3OYM A;  2OZU A;  1D1C A;  4G12 A;  3HOW J;  1TTY A;  3BR1 A;  4D7N A;  5DM7 F;  4R79 A;  2FSW A;  2DW4 A;  2G0E A;  4EGY A;  1AOY A;  3IUO A;  4D0P A;  3OIP A;  4HST A;  4GXO A;  1R71 A;  3NEU A;  3M9A A;  2L4M A;  2Q2E B;  3F0C A;  1RR7 A;  3E5Q A;  3ABK H;  3CCY A;  2OCC H;  5BPI A;  2DPU A;  3DF8 A;  5DDG A;  1IXR C;  1J5Y A;  3CO6 C;  4IKF A;  3OYI A;  1MMG A;  2XIG A;  2BHZ A;  2YU3 A;  3JRH A;  3H0G J;  1JKO C;  4PFP A;  4KNY A;  1JGS A;  3I59 B;  2RV8 A;  4NC7 A;  2FX0 A;  1G59 A;  2VOD A;  1E17 A;  1DGR M;  3M07 A;  1IXC A;  4A2U A;  2OTJ I;  2XF6 A;  2DYS H;  2PMZ A;  4UNO A;  2HNH A;  2PN6 A;  3DFG A;  2KKO A;  1T8I A;  1JTX A;  1OCO H;  4NNJ A;  5F27 A;  3DBR B;  4TV7 A;  4FT8 A;  5CQE A;  2ISY A;  4R8H A;  1ZGJ A;  3S2H J;  1FOY A;  3BJO A;  1WSU A;  2EZI A;  1O3R A;  3KIO A;  2V1D A;  1JHF A;  4C3H J;  3UR3 C;  2ZME A;  2QQ8 A;  3SHF A;  2QYO A;  4KUM A;  2Y69 H;  2IS1 A;  2Y31 A;  1T0F C;  2GXG A;  1BI2 A;  2DJN A;  1U8R A;  2WB1 A;  2CQX A;  1I6H J;  1TWA J;  3OY9 A;  2V9P A;  5EG0 A;  3S3M A;  1YJW I;  3TO9 A;  2XRN A;  2EFP A;  5D5V B;  4FX4 A;  1FMV A;  3RSN A;  1R5G A;  4YEJ A;  3VPR A;  3B73 A;  1F1Z A;  2HZD A;  4ENN A;  2KIQ A;  3HTU A;  2GBY A;  1U0J A;  3ZN0 A;  3WU2 C;  5L3D A;  4DIQ A;  1X3Z B;  2DN0 A;  1MW7 A;  4Y52 J;  1LDJ A;  3GX4 X;  3MKY B;  1OYI A;  3RPU A;  5J8F A;  3MFK A;  4F92 B;  5K5O A;  1QNT A;  3K70 C;  3CUQ A;  3L1P A;  4IO9 F;  3M8E A;  2CW7 A;  3J81 Z;  2L02 A;  1V55 H;  2QM3 A;  2M3A A;  4HZF A;  4EV0 A;  4RGU A;  2EPF A;  3CCR I;  1MH3 A;  4MLO A;  2VXZ A;  4PFO A;  3BR0 A;  1K83 J;  4LIV A;  3K4M A;  3C18 A;  5J3L A;  2RDP A;  3L2C A;  3CCV I;  4RDU A;  1WHU A;  5BS6 A;  5EGO B;  4UUV A;  1SMY F;  4BUP A;  2WAF A;  1FIP A;  1ZAR A;  4QPO A;  1NG7 A;  3L9F A;  4X0G A;  2L2O A;  3A03 A;  4HYE A;  1FBQ A;  2XB0 X;  2QEN A;  4LIT A;  1MMD A;  2FML A;  4V19 K;  2XRO A;  3HZJ A;  1JI8 A;  4NQW A;  2LF8 A;  3OYL A;  3S17 J;  1IG7 A;  1DU0 A;  3C2B A;  1KYZ A;  4QSH A;  1R1V A;  3J81 K;  3WHB A;  1ENH A;  4UB8 C;  2W57 A;  2HTJ A;  2IVM A;  3FWE A;  3OYB A;  3F6V A;  2MLK A;  4BYY A;  5KVR A;  4IHX A;  1KYW A;  3GZN B;  3DKW A;  3LST A;  2R5Y B;  3B6A A;  3KLN A;  2AQE A;  1FP2 A;  4OIQ F;  3T5X A;  3GTQ J;  2VBY A;  1RKT A;  5KNL A;  1VQP I;  3K9T A;  4ZYE A;  4IHV A;  3RPQ A;  1UMQ A;  3QPT A;  2CQN A;  2M7A A;  2OPT A;  4EM2 A;  1O57 A;  1XDU A;  3Q0V A;  2Z33 A;  4XLH A;  1HW2 A;  3BQY A;  3BJA A;  2FNA A;  1OCP A;  3OR2 C;  1P4X A;  4LD5 A;  1U9N A;  5FD5 A;  1YYV A;  3C7J A;  2H6C A;  3KE2 A;  1CF7 B;  3BG9 A;  4UB6 C;  1K6Y A;  2X1D A;  2PFB A;  2QF7 A;  2IA2 A;  3OYA A;  3HOZ J;  3CF2 A;  4ZYD A;  4UUS A;  4EJU A;  5JLX A;  5DTD A;  5EDN A;  4BEH A;  1EKE A;  1WCM J;  3VOD A;  2HQN A;  3KEY A;  5D6F A;  1A04 A;  3LQQ A;  3RQ4 A;  3IRR A;  1VQ7 I;  1LE8 A;  2XAS A;  1APL C;  1EH7 A;  3RCO A;  3F8B A;  1WJC A;  5BQT A;  4H0E A;  4BGD A;  3K4J A;  4N9H A;  3SDG A;  2DJI A;  2EFN A;  3F8C A;  3FIW A;  3KYC B;  1W4M A;  3ECH A;  3NWT A;  1ZLJ A;  1SFK A;  1NK2 P;  2ZNZ A;  1AA7 A;  1BW6 A;  4P5O A;  4MHG A;  5J1R A;  4ENK A;  3HSF A;  2P6S A;  2Y0S A;  4XKB A;  5K7Z A;  2QBY B;  1QHG A;  3WU1 B;  2HOE A;  1U2W A;  1V4R A;  1XGN A;  1R7J A;  3T1B A;  1SFO J;  3D0S A;  2M34 A;  1KU3 A;  1D1A A;  1I1G A;  2A5Y B;  2V7F A;  5F0F A;  1QQI A;  4A12 A;  4I7H A;  2D45 A;  2COB A;  3KYL A;  2EIL H;  5F1J A;  3QU3 A;  3PO3 J;  4IJA A;  1MJA A;  3ZQG A;  4XOT A;  1FYM A;  3ROU A;  1BIA A;  4IHT A;  1QZZ A;  3F3X A;  4PUS A;  2CO5 A;  3MKZ A;  4J00 A;  2IT0 A;  4BY1 J;  5K7F A;  2MH2 A;  1PJR A;  3TP0 A;  4L18 B;  3NAR A;  3PSI A;  4CDG A;  2K4J A;  5HDK A;  2OUM A;  3ZMU A;  4DYR A;  5M5W J;  1T56 A;  4N4N B;  3HSR A;  3K70 D;  2V9V A;  2JSP A;  1VQO I;  1XMK A;  1ZYR F;  4S05 A;  3I56 I;  3RI4 A;  3I58 A;  1A31 A;  3GLX A;  1RUO A;  2E5N A;  3IC7 A;  3CD6 I;  1ZK8 A;  2VPL A;  3F22 A;  3WTU C;  4A0X A;  4NHJ A;  2DO7 A;  1RNL A;  2H1L A;  4BHB A;  3CLO A;  1TC3 C;  2O5R A;  3DKX A;  3JAM K;  1ZGA A;  1SFE A;  1S29 A;  5LEJ A;  2ACJ A;  2NVX J;  3H0D A;  2ESN A;  5TRD A;  2WY7 Q;  1MZB A;  3W6V A;  4RGS A;  1WZ2 A;  2AQF A;  4DW6 A;  3WTT C;  3G4S I;  1ZG5 A;  1PP7 U;  3DTK A;  3BOQ A;  1YFH A;  2WY8 Q;  2V9K A;  2W48 A;  4F52 A;  1LFP A;  3T8T A;  5EZH A;  4Z2Y A;  3TW7 A;  3WTZ A;  2HXI A;  3K4C A;  2F5V A;  4E7I A;  1FTT A;  1D0Y A;  1LEB A;  3S3O A;  2Y0S N;  3K7A J;  3N05 A;  4M3B A;  2R5Z B;  1RUN A;  3KZY A;  2KFD A;  4P55 A;  5FKO A;  3X2Q H;  4CUG A;  2E7W A;  1YRN B;  3DLA A;  5LGT A;  3LSM A;  3U21 A;  1IDY A;  1BC7 C;  3GW2 A;  3H35 A;  2VJ5 A;  1FZP B;  2HQA A;  2M4K A;  2JTV A;  5E79 C;  2GLO A;  2MC4 A;  4BHP A;  4RB1 A;  3OWT A;  5HNH A;  1D1B A;  1GVJ A;  3BTC A;  4YG2 F;  2EA4 A;  3F23 A;  3ZPL A;  1NH3 A;  4X6A J;  4AIH A;  1AKH B;  5FFX A;  2DPD A;  2LP0 A;  4J01 A;  1G3T A;  1P92 A;  2M0C A;  2VKE A;  2X0L A;  1MND A;  1HST A;  4IHW A;  4L9T A;  4RAF A;  2KQR A;  1N25 A;  1D0X A;  4HLX A;  4AC0 A;  3U2R A;  2E7X A;  3ZQH A;  1O3S A;  2D1V A;  4HEA 2;  4Q47 A;  5E18 F;  2DDA A;  3OYH A;  3Q3S A;  2EV5 A;  1V5G A;  2O7O A;  2PQ8 A;  4PJL A;  3M1E A;  5L3G A;  4IQ4 A;  3W6K B;  1BA5 A;  3J7A O;  3CDH A;  5J6X A;  3S1Q J;  2YPR A;  1R49 A;  1Z3X A;  4R1H A;  2QQA A;  3OYF A;  4N4O B;  2DXI A;  5F64 A;  3L09 A;  1U5T C;  3IH4 A;  4G94 A;  3PFY A;  1X2N A;  3DPU A;  4EJT A;  3S2D J;  3M7G A;  5IOY A;  2P6T A;  1UZC A;  2HI3 A;  5DUK A;  5FRO A;  2H1K A;  2DMU A;  3H5N A;  3JRC A;  5JHU A;  5ED4 A;  3NQO A;  4BHC A;  2EIN H;  4RS8 A;  3IWF A;  1DPR A;  3P9C A;  4S04 A;  4IRI A;  3WTW C;  2CUF A;  4HRI A;  4LGW A;  1QPM A;  2PG4 A;  3S3N A;  2RQP A;  1ULY A;  3CCQ I;  2M8G X;  1IW7 F;  4LB6 B;  2BBY A;  4G8X A;  4OIP F;  3Q0U A;  4A3D J;  3WE2 A;  3GTP J;  3K4B A;  5FLM J;  2W24 A;  1WH5 A;  3C3W A;  3FMR A;  9ANT A;  2KLO A;  1H9G A;  2OQR A;  5C3E J;  1ONV A;  4BAC A;  1G3Y A;  3P7N A;  4A5M A;  4Z6Y A;  5J47 A;  2CWE A;  2Z1D A;  1HA8 A;  3FXQ A;  4CCN A;  3JSP A;  1T39 A;  4U7B A;  4XRF A;  2V1U A;  3HB9 A;  1ZRC A;  4UUT A;  3E97 A;  1DP7 P;  4I0A A;  3ZP5 A;  5EJC A;  2ZJR F;  1QU3 A;  5FO5 A;  3G1L A;  3TKY A;  3QYB A;  3CES A;  5FB2 A;  1LPQ A;  3ZQC A;  1LDD A;  3CUQ C;  1JGG A;  4IF4 A;  1POG A;  2ELJ A;  5TIS C;  1BM9 A;  5EF6 A;  1ZR2 A;  2GOM A;  2V1N A;  3EUK L;  2XGX A;  2VQH A;  5HNF A;  1BOA A;  3RKY A;  1MJB A;  5LEK A;  3HUG A;  2TCT A;  4IHY A;  2M2E A;  4LLL A;  4GYG A;  1FNN A;  5H6Q A;  2BOL A;  5LHH A;  1FIA A;  2ICW G;  1BJA A;  3HIF A;  1FC3 A;  1YQA A;  1F4K A;  2LG4 A;  1HW1 A;  4ESF A;  3J7A Y;  4Y33 A;  2L7Z A;  5K5R A;  4A0Z A;  2HWV A;  1TT5 B;  4QLC U;  5K5Q A;  3AG1 H;  4XIC A;  3KP6 A;  1IXS B;  2EBI A;  3LA7 A;  3WHC A;  2DA6 A;  4CCM A;  2DMP A;  1D5V A;  4CCJ A;  2A5W A;  1QZY A;  2DOD A;  3OSF A;  1CQT A;  2HKX A;  2LDU A;  1A35 A;  1Y1W J;  5CYV A;  1MDM B;  2XGD A;  2LMD A;  1A6I A;  3GBG A;  2BZT A;  3S16 J;  2F5D A;  1BOB A;  1WI9 A;  2FXA A;  2BE5 F;  1QRY A;  2BW3 A;  2K27 A;  2LH9 A;  5B3S H;  3LNQ A;  1AWC A;  2FEZ A;  4JOM A;  5CJ9 A;  5DV5 A;  4WXC A;  3J80 Z;  1RRJ A;  2MGQ A;  3ZQ7 A;  2IP2 A;  2VE8 A;  2VQG A;  3ZMV A;  1IZ1 A;  3LQR A;  2RNG A;  4G6Q A;  4KIS A;  1IN6 A;  1Z1D A;  2OBP A;  2QA4 I;  2BW3 B;  3DLL F;  4UXN A;  5IYB J;  3S15 J;  3F8M A;  3FM5 A;  2UXN A;  3P5J A;  3OYD A;  3JAM Z;  1KQ9 A;  1KU2 A;  2DFI A;  2EIK H;  4CO8 A;  1LB2 A;  2EK5 A;  4ZYA A;  2PLY A;  4IQJ A;  4F93 B;  1F5T A;  4E7S A;  4BQA A;  4PSX A;  4E7Z A;  4WWC A;  3R0J A;  4AD9 A;  4BS9 A;  3OYJ A;  4MFD A;  4FHT A;  2BVL A;  2XAJ A;  3CUQ B;  3WTY C;  4M74 A;  2IA0 A;  1JKQ C;  2GXB A;  1WFX A;  1SD5 A;  3ZQI A;  5JHF A;  2VJI A;  4QPQ A;  4IL6 C;  5AIQ A;  3HKZ N;  1XD7 A;  1UHW A;  3H9G A;  3C2G A;  1ZQ3 P;  3OMY A;  3SZT A;  2DA7 A;  1YIO A;  5CVJ A;  3CDI A;  1Y1V J;  4IHS A;  3ZQL A;  3FZV A;  2X48 A;  3VFZ A;  4PJN A;  3HRT A;  2IGN A;  2K9M A;  2VOP A;  3DWL E;  3ABT A;  4V2G A;  1R4M B;  2EIM H;  5F0H A;  3FHN A;  5J4V A;  1XGO A;  2KJC A;  3E5U A;  4OWR B;  3OIQ A;  4J19 A;  3I4N J;  3L2R A;  4AUX A;  3LOC A;  3RKQ A;  1LE8 B;  1F9N A;  1WH7 A;  3L2Q A;  3WOD F;  1BR2 A;  3CUO A;  3M4O J;  1E3O C;  2MD0 A;  3S1N J;  2HXO A;  4G9Y A;  5EG0 B;  2VPR A;  1Y56 A;  2JWT A;  2M7B A;  1XC5 A;  4II3 A;  5JR3 A;  1FOX A;  5M5Y J;  1WJF A;  2WBM A;  3HPH A;  4IXA A;  2LC2 A;  4MEY F;  3MN2 A;  2OQG A;  2BXY A;  2DQL A;  3G3Z A;  2GA2 A;  3EUH A;  1XCV A;  3GO5 A;  1CF7 A;  2HU9 A;  2QVO A;  5HS7 A;  1BBY A;  1Y0U A;  1MDM A;  2MA3 A;  2E2I J;  3DV8 A;  2ID6 A;  2HZT A;  1I50 J;  3PUF A;  4L9V A;  3ABU A;  2G9W A;  5B5E C;  4QWQ A;  4HSR A;  3TED A;  2A6T A;  4M71 A;  3WGG A;  2NXN B;  3FIS A;  4E7J A;  1HW5 A;  3SXY A;  4I09 A;  2O61 A;  2X51 A;  4RAZ A;  1LFU P;  2GIZ A;  2H09 A;  3CDL A;  2CSO A;  1FSE A;  2VT2 A;  4HDU A;  5ICC A;  2DMN A;  4AU7 A;  1VQ4 I;  2Z16 A;  2Y48 A;  2VC1 A;  4IX7 A;  3ERE D;  2VAS A;  1E3H A;  2JK3 A;  3UNG C;  1EH8 A;  4HF0 A;  2DT7 B;  1G8X A;  1O7F A;  3BR2 A;  2HYG D;  4DZP A;  1JT6 A;  3GCM A;  4U87 A;  2DFH A;  1Z7L A;  1W5T A;  1ETO A;  2E36 A;  3EYI A;  2BVM A;  3L7W A;  2K9S A;  1L0O C;  2QBY A;  3HGY A;  4AID A;  3SEZ A;  1XDS A;  3TO6 A;  4F55 A;  4YRV A;  5FRM A;  2HVS A;  1A5J A;  2NNY A;  5D8L B;  4HW0 A;  3RZD J;  2GZW A;  2XB5 A;  4XNF A;  1MMN A;  2I10 A;  3GUD A;  1FP1 D;  1VFC A;  1WWX A;  1ZG3 A;  1K78 A;  2R7S A;  4HPQ A;  5EEH A;  4BY7 J;  1IDZ A;  1XPX A;  3NAU A;  2KZG A;  2M87 A;  2QSF X;  3BZ6 A;  3G1M A;  1F36 A;  2Y30 A;  2L4A A;  1D8J A;  3I5U A;  4C9Y A;  1QO0 D;  2CW8 A;  2V79 A;  3TGN A;  5HOD A;  4FCY A;  2XGC A;  2YX7 A;  4XMY A;  3TO7 A;  2YX4 A;  3OIO A;  1W36 D;  5CVU A;  5E20 A;  1SAN A;  5FFZ A;  3WG9 A;  5HVQ C;  4MTE A;  3LSH A;  1QPI A;  3O2P E;  4U0W A;  3HOY J;  3E6D A;  3H1C A;  4UY8 I;  2GQQ A;  2IRF G;  2YR2 A;  5GAE J;  2CG4 A;  5J1Y A;  1I39 A;  3M3Y J;  1YO5 C;  4XRS G;  2RGV A;  1T33 A;  3R60 A;  4UVC A;  3WTS C;  1ZGW A;  1MBE A;  1OKR A;  4HNU A;  5B1A H;  2OA4 A;  1FT9 A;  2IW5 A;  3IP4 B;  3SDB A;  3LSJ A;  2CH0 A;  3D5L A;  4HX4 A;  2IGM A;  3TDZ C;  1DDN A;  4XOR A;  3RJP A;  4K2E A;  4C30 A;  3BG5 A;  2FE3 A;  2R7Q A;  4L9J A;  1K4S A;  1JJ8 C;  5DYM A;  1H8A C;  1IRG A;  2BY3 A;  3E0J B;  2BY0 A;  3HXL A;  5D4S A;  4A3C J;  3LFK A;  2ZFW A;  4M73 A;  4DBR A;  1W5C C;  3I53 A;  4XLP F;  2QSH X;  3COA C;  2LBF B;  4CYC B;  1MH4 A;  2DLL A;  3K1P A;  2F2E A;  4HQE A;  2W7N A;  2Y75 A;  1MNE A;  2DAO A;  1SFX A;  3DBH B;  4A93 J;  3VSK A;  3QP6 A;  1S3J A;  1S6L A;  1X1A A;  3M1C A;  1X3U A;  4E6K G;  1IO2 A;  5CPR B;  3GTK J;  4JYK A;  4WK8 F;  1GXP A;  3KZI C;  1TW2 A;  1X4O A;  3HHH A;  5LGU A;  1QA6 A;  1G4D A;  2CRG A;  1PVE A;  1VI0 A;  3ISP A;  3IRQ A;  4A0Y A;  1ETX A;  2XHK A;  3K10 A;  5CLS A;  5D5U B;  2O6G E;  3A4C A;  3HPG A;  1FMW A;  4IVN A;  1L3L A;  1QZE A;  4AIK A;  4D7M A;  2RAE A;  3SQN A;  2LRE A;  2F6C A;  2W25 A;  4ZZD A;  5DUI A;  1WJB A;  1GT0 C;  1SD7 A;  4MQ9 F;  1KQ0 A;  3GYH X;  1X1B A;  3LA3 A;  3LAP A;  4ZH4 F;  4EAT A;  5HLH A;  1S7E A;  2QWW A;  4A3I J;  1O3Q A;  4YFX F;  3MKW B;  2E1M C;  3V7R A;  3GFJ A;  4LG0 B;  2N8G A;  1OR7 A;  1FYL A;  2JPB A;  2KIU A;  3L2V A;  1V3F A;  4ASN A;  3EDP A;  1FBU A;  2HR3 A;  2Q0O A;  3CQZ J;  4BU2 A;  1SC7 A;  3MZH A;  3QPH A;  2A69 F;  1FLI A;  1OCT C;  3HKZ A;  2DK8 A;  2F48 A;  3DPT A;  2NVQ J;  3O8G A;  3JCU C;  1XSD A;  1R58 A;  4HQM A;  1VZ0 A;  1Z67 A;  4I2O A;  2P4W A;  1S7A A;  4XKV A;  4GRI A;  1U3E M;  4M3E A;  5DCM B;  2ZME C;  3D5S C;  2XUB A;  2STT A;  2DMQ A;  1HXD A;  2E2H J;  4ENJ A;  4M3F A;  3ULQ B;  4M9Z A;  2EWN A;  4L0Y B;  1FBS A;  3CC2 I;  1IN7 A;  2GAU A;  4GO1 A;  1W7P A;  1SD4 A;  2A07 F;  4EGZ A;  3HBL A;  5DCM A;  1TQP A;  3SYT A;  3U1K A;  2E19 A;  4GGG A;  3BY6 A;  5C44 J;  1YIT I;  2VUM J;  2ZME B;  2UV1 A;  3BPX A;  3KYD B;  1Z05 A;  3JRA A;  1JJ6 C;  5KHD A;  2Q1Z B;  1B9M A;  5E17 F;  4RA2 A;  2JPC A;  3DP7 A;  5EYR A;  2XAF A;  5IOZ A;  1W7P B;  4HBL A;  1SAX A;  1T08 B;  3GLL A;  1U5T A;  2DTZ A;  5M3F J;  1E3P A;  2QGU A;  2E71 A;  1W36 C;  2DQR A;  1MBG A;  1RI7 A;  1SAU A;  1H9T A;  3ELK A;  3BG3 A;  3K69 A;  2NOJ B;  1Y6I A;  3V8K A;  5TJJ A;  3KCC A;  1GDT A;  2V6C A;  2LOO A;  1RC9 A;  3CJR B;  5E3N A;  3K4L A;  3LSI A;  2EZH A;  4JX6 A;  4ON0 A;  2EV6 A;  1YLF A;  2BYV E;  1VQN I;  3P9K A;  1YW7 A;  5BPD A;  2GM4 A;  2R5Y A;  1GLN A;  1XX5 A;  1SEU A;  2QSG X;  3KP5 A;  2JA7 J;  2RQQ A;  2XSJ C;  3RIR A;  3K2Z A;  5E3O A;  2KL4 A;  3ZRG A;  4RMN A;  2ID3 A;  5LBQ A;  3HOX J;  4GDF A;  2MW8 A;  2IS2 A;  2RNJ A;  1D0Z A;  3K4N A;  3KP7 A;  4H4K C;  1U9O A;  1N77 A;  3FXK A;  3OOU A;  1XTA A;  4P9U A;  2DFF A;  2XAU A;  1G3W A;  2VJJ A;  3QOE A;  2EFW A;  3BDD A;  1D8K A;  3TW6 A;  2L54 A;  2TRT A;  1MBK A;  1WI3 A;  4XID A;  1N78 A;  4L9N A;  1LNW A;  2V4J C;  3CO7 C;  1W0U A;  3ZMS A;  5GAH J;  1J2X A;  3I54 A;  4DYC A;  4EVI A;  2ZXJ A;  5F1R A;  2WV0 A;  2R7V A;  4CXF A;  1A36 A;  2VI6 A;  1IAW A;  1K4T A;  3MZ8 A;  1NK3 P;  2DOE A;  2NAZ A;  1BI3 A;  1R1T A;  2JJ7 A;  5H6R A;  5ICG A;  2DYR H;  3JRE A;  1REP C;  2ETH A;  5F6F A;  1ERD A;  4BKX A;  2WTE A;  1X1D A;  3MKL A;  1PYV A;  4N9I A;  2CV0 A;  2E60 A;  5IPA A;  1U78 A;  4JK1 X;  4ZJZ A;  3HEF A;  2OU2 A;  1P6R A;  3SJM A;  4BE1 A;  4XR6 A;  2ECC A;  4ZDL A;  3I71 A;  4OIR F;  1BW5 A;  5J40 A;  1V5F A;  1W7P D;  3K0L A;  2P5K A;  3PIP F;  3A0B C;  2LY1 A;  1YX5 A;  2QKM B;  2O8K A;  1WRJ A;  1HKT A;  2FF4 A;  2HVR A;  2LSO A;  3OS1 A;  4XSZ F;  4C2T A;  4PGG A;  5LHG A;  4BQQ A;  5E3M A;  3KET A;  4PK4 A;  3E3V A;  2LK2 A;  2TDX A;  5LLQ A;  3QPS A;  3GTG J;  2DU9 A;  2EZK A;  2XPW A;  1T6S A;  3V7C A;  4JQF A;  4OAZ A;  2HOS A;  5IYD J;  1QVT A;  3K6G A;  1OFC X;  2P8T A;  2DK5 A;  4KT6 A;  5F04 A;  1EF4 A;  4ZYG A;  5FRN A;  2LFB A;  1BJZ A;  2VQL A;  2X6O A;  5EEA A;  1JKP C;  1H88 C;  1R4N B;  2CQK A;  2IJL A;  2WWY A;  1BR1 A;  4G7Z F;  1TWF J;  3IH2 A;  4LB5 A;  2Y0M A;  3ZN1 A;  1XMX A;  1EV7 A;  4PZJ A;  4P9F A;  1Z91 A;  5CVR A;  3MEX A;  2FMY A;  1TZL A;  3GME A;  4OAY A;  3GTO J;  3CMA I;  4DNC A;  1IRF A;  2P0W A;  4D9J A;  5TGT A;  5H20 A;  2NOG A;  2Y2Z A;  2P5L C;  4IEJ A;  1D3Y A;  4E7H A;  2EB7 A;  1K6O A;  1I1S A;  1WQ2 A;  3DTI A;  2OV7 A;  4EJW A;  4LIU A;  1ZRF A;  2JUC A;  4EM0 B;  4HAM A;  3BRO A;  1R6R A;  1ETW A;  2E1C A;  1HF0 A;  3ONQ A;  1IV6 A;  4B3A A;  3PM1 A;  2KHM A;  1MMS A;  3I4P A;  1JHH A;  2VB6 A;  4BQO A;  1DPU A;  2QCO A;  2XPV A;  1FYK A;  1JXS A;  3PQK A;  2LF7 A;  3MMY B;  4PGH A;  3I55 I;  1IRZ A;  1DP3 A;  2HQ5 A;  4RLF A;  1MSF C;  2MH9 A;  3AG3 H;  3CF5 F;  4YIR X;  4XRM A;  4M6X A;  1W1W E;  4KMU X;  3ZMT A;  1TQM A;  3PNY A;  3HUG B;  3G71 I;  3D1N I;  1IRX A;  3IAM 2;  1I27 A;  1PUF B;  1WJA A;  3L2U A;  2NRA C;  2OF7 A;  2R93 J;  4KT5 C;  1S7O A;  1PDN C;  1LEA A;  2W85 A;  3BT9 A;  2BXZ A;  1JT0 A;  4D1Q A;  3HM5 A;  5IP6 A;  2VIX A;  3DEU A;  3FHZ A;  2JQ7 A;  1FY7 A;  3BR6 A;  3R0A A;  2VE9 A;  4CHU A;  1K78 B;  4Y13 A;  2HEO A;  4UVA A;  3RYP A;  3K4K A;  3E6C C;  2CJJ A;  4X1E A;  2HGC A;  1FX7 A;  3GXO A;  2Z3Y A;  3GWZ A;  3FBI B;  3E6B A;  4UUS B;  5BOX A;  1TNT A;  2DFE A;  2DBB A;  5FJ8 J;  2O8X A;  4BXU A;  3KP2 A;  5LFA A;  2VQC A;  2C6Y A;  5FKN A;  2BHY A;  2E35 A;  3FXJ A;  2BEO A;  1P4A A;  1Y8Q B;  3E1S A;  4MQV A;  3ZGK A;  1VF9 A;  1ODD A;  1M1E B;  3GFM A;  3HOU J;  3U1D A;  1QHH D;  3JR9 A;  2JZY A;  4U7D A;  3RQI A;  5CVV A;  4DOZ A;  5J8C A;  1V5E A;  5FGM A;  2KRC A;  2YUS A;  3JRB A;  3DQV C;  2QKL B;  4B8X A;  3QPL A;  4BDY A;  3S1R J;  1X3W B;  4I99 C;  5CVI A;  4I02 A;  4BE0 A;  3HOS A;  2LY9 A;  3N97 A;  2F4I A;  4OMY A;  1IN4 A;  2Z5U A;  1O7L A;  4MTD A;  4ZTF A;  2LTP A;  1HSJ A;  4L5J A;  4WXD A;  1VQ8 I;  1TWG J;  2NS8 A;  1Z7U A;  3WGI A;  1ON2 A;  2R7F A;  4IPA A;  4G7O F;  2LR8 A;  1ITY A;  2X6Y A;  3PUB A;  3K2A A;  4EJO A;  5JFR A;  2PI0 A;  3OYN A;  3I9V 2;  1YHQ I;  1TLH B;  2YU9 J;  4B43 A;  3OYE A;  1B8I B;  2CFO A;  4AVZ A;  4QIW N;  2AO9 A;  2VN2 A;  3TQN A;  1XCB A;  2VXD A;  2DI3 A;  1HDD C;  1VQ9 I;  1LJ9 A;  2BV6 A;  2QQ9 A;  4NQW B;  5GAD J;  2PEX A;  3B6C A;  2VOO A;  5M3M J;  2F4M B;  4HDV A;  1B72 B;  4XL9 A;  5EGO A;  3VYR B;  4F7Z A;  2CQQ A;  2E1O A;  2MAB A;  2XDV A;  4CZZ A;  2A68 F;  4XKW A;  4ZTJ A;  1IF1 A;  2FJ1 A;  2PJR A;  3WG7 H;  2GIV A;  1YIJ I;  1O3T A;  4EEF G;  3RPU D;  4ZDO A;  2ZXI A;  2DA1 A;  4CGZ A;  1Q1V A;  2HFH A;  2UUZ A;  3ZOB A;  1VQL I;  1MSE C;  3AL0 C;  4A3G J;  4OIO F;  5CKT A;  4LK0 F;  5E3L A;  1N75 A;  4ENM A;  3DCF A;  2NYX A;  2CUJ A;  2KRH A;  3SZG A;  3VEP A;  5FKL A;  2AS5 F;  3HRM A;  5H2F C;  3ESW B;  4XRS A;  2WAQ A;  2ME6 A;  2CUZ A;  1JKR C;  1AU7 A;  1MBH A;  2EIJ H;  2COM A;  5L3C A;  4CA0 A;  1UCR A;  2F5C A;  4BQN A;  1ZRD A;  2IS6 A;  2JVH A;  2HPI A;  1YRN A;  2L9R A;  3OL3 A;  3RDI A;  4A3J J;  2LNB A;  3DBL B;  2EJR A;  2HS5 A;  3OR1 C;  4MIM A;  4E4H A;  2LD5 A;  2K85 A;  3AG2 H;  2HQR A;  1ETV A;  3IAS 2;  4E7L A;  2EQR A;  4M9S A;  3H92 A;  4CSW A;  1XN7 A;  2ADU A;  2PMU A;  2DMT A;  2Z9O A;  3A02 A;  1X2M A;  4FE4 A;  4LG3 A;  3BWG A;  4O5V A;  5JVG F;  1T2K A;  1OCZ H;  1C0W A;  5DM6 F;  3S14 J;  2LKP A;  3ZMD A;  4B3X A;  3ECO A;  4XLE A;  3GTL J;  2FQ3 A;  3JRF A;  1OQY A;  3BZC A;  2FOK A;  5HLT A;  1Q1H A;  3HJE A;  1YOV B;  4EM1 A;  1UAA A;  1SVO A;  1P2F A;  2X1C A;  3J80 K;  2YSR A;  2H27 A;  1GVD A;  1JUP A;  3EQL F;  1ZLK A;  3GEZ A;  2R92 J;  3CCS I;  4A3L J;  3F21 A;  1IUY A;  2VLA A;  3CCM I;  4E7K A;  3ASN H;  2VC0 A;  1EH6 A;  4KIG A;  1B59 A;  3CP8 A;  4DZJ A;  2CV1 A;  1ZH5 A;  4HV5 A;  2K4B A;  3LSR A;  4IOC F;  4ABZ A;  4AVP A;  1FEX A;  2HTS A;  4A3K J;  1K61 A;  4GCV A;  3A01 A;  3F8F A;  1RET A;  4I01 A;  3TOA A;  1NTC A;  4U0Y A;  4YFN F;  1DGW Y;  3GZ6 A;  1JUM A;  1MBF A;  2PBI A;  1XGM A;  5C4J J;  4KDP A;  2L9V A;  4B4C A;  4C3J J;  3HOT A;  1O4X A;  1ZHF A;  2LKS A;  1UEL B;  2B63 J;  2HYF A;  5GP9 A;  1UHS A;  2R7T A;  4ESJ A;  3V8J A;  3ABM H;  5JLW A;  1I6X A;  2JRT A;  2R7D A;  3I59 A;  3IWZ A;  2XC7 A;  5IT3 A;  1X1P A;  4FE7 A;  4XLF A;  1B6A A;  1G6N A;  2A61 A;  5DD8 A;  6PAX A;  2JUG A;  1SVL A;  3VB2 A;  4D5F A;  3KP3 A;  4XQF A;  2W84 A;  2KJB A;  3CC7 I;  3FXR A;  2Y9Y A;  5FLX Z;  1VQ5 I;  2K9L A;  1T0F A;  1MBJ A;  4MGR A;  2F5F A;  4P1W A;  3DEW A;  4PJJ A;  1VTN C;  4RGR A;  2KIM A;  3QAH A;  3K1M A;  4B47 A;  1CGP A;  3GTJ J;  3F8N A;  2P5V A;  3G2B A;  1Z6R A;  3PIO F;  3AKZ A;  2LY2 A;  2PJR B;  3OYK A;  2VJ4 A;  2WC2 A;  3MVP A;  3TDU C;  3LSK A;  2EH3 A;  4M72 A;  3HSE A;  1YX3 A;  5E1Z B;  2KDZ A;  4NDL A;  5IYC J;  3LAJ A;  2HDD A;  1J09 A;  3OS0 A;  2FRH A;  4RAY A;  1P4W A;  4Y15 A;  2DT5 A;  2LBF A;  5HDN A;  3CCE I;  4A5N A;  1XSV A;  2I8D A;  3KP4 A;  4XLN F;  4CYD A;  4BXF A;  5ILV A;  2CMP A;  4WX9 A;  2H6B A;  2K5C A;  2KZV A;  3A1Y A;  1UG2 A;  1D5Y A;  5D8K B;  3VWB A;  1OMI A;  2DOF A;  5IT9 K;  2W1O A;  3UKG A;  5E8G A;  2DDB A;  3IV5 A;  4G7H F;  2VON A;  4U88 A;  2ISZ A;  4YEL A;  4OOI A;  3PNV A;  3H9J A;  2QUF A;  2WA0 A;  1TL8 A;  1BR4 A;  4BJ6 C;  1YJN I;  4CCO A;  5L3F A;  2O9L A;  1UG0 A;  1SMT A;  1H0M A;  2ELH A;  3SZP A;  3LMM A;  5FLV A;  4AM3 A;  2MC3 A;  4RM2 A;  1I3A A;  2NS7 A;  4LJZ F;  1ORK A;  4Y17 A;  4DYQ A;  5GTI C;  1BL0 A;  2FQ4 A;  2ECB A;  5B1B H;  3JSO A;  4LOC A;  4A3M J;  3OSG A;  3BCA A;  5DEQ A;  5D4R A;  4XSX F;  1JTY A;  3TOB A;  4XK4 A;  4KFC A;  4HV6 A;  2IXS A;  4IRH A;  2VBZ A;  4AYB A;  1FWZ A;  3QOP A;  4Y4R A;  3HRS A;  4XBF A;  4I98 B;  4PDK A;  1TWH J;  2K7L A;  4EJV A;  3VYS B;  2CGP A;  3CCJ I;  3EUA A;  5KK1 A;  3FXM A;  2HDC A;  2EZL A;  2DA5 A;  1X1C A;  4EMS A;  3MQ0 A;  5J4Y A;  1ETY A;  4DJA A;  2A05 A;  3OV8 A;  1Z21 A;  3FXL A;  1B8I A;  4FIS A;  1W0T A;  2ME0 A;  1GV2 A;  2X6W A;  4ANJ A;  2E5Z A;  3MAJ A;  3OYC A;  4IOA F;  3DKY A;  1OCR H;  2X9D A;  3W2V A;  3M8J A;  5F08 A;  3QYF A;  4KA4 A;  1OR7 C;  1QGP A;  1A6Q A;  2ZB9 A;  2YS9 A;  1ZN2 A;  1G3S A;  1TP4 A;  1UHM A;  2DOA A;  2KT0 A;  1VQM I;  1I3Q J;  1UB9 A;  5M5X J;  1KGS A;  3O6B B;  4JX5 A;  4FTH A;  1LKX A;  2OD5 A;  4ESB A;  4M3G A;  1HC8 A;  1XGS A;  5KAF C;  4N0B A;  4ETS A;  4IZZ A;  2LKX A;  3IHU A;  2ZFU A;  3CJN A;  3DPL C;  5E1X A;  4UHT A;  1Z0X A;  1TBX A;  2CQ7 A;  1QVU A;  4ITV A;  2IEK A;  2L9N A;  1KU9 A;  5HS8 A;  2FA5 A;  5ERI A;  4XOP A;  4NC6 A;  1TT0 A;  3EPZ A;  4NBQ A;  3KX2 A;  1P9Q C;  2Z99 A;  3A01 B;  2DA4 A;  1TQI A;  2GA1 A;  4KIB A;  3ERM A;  4RAG A;  4RBO A;  5GPC A;  1WVR A;  3S8P A;  1WGX A;  3QWL A;  3HYI A;  4BE2 A;  2BY2 A;  4JX4 A;  4CYC A;  2FUG 2;  4RM3 A;  4PJ0 C;  2P81 A;  3PL8 A;  5CQG A;  4XLA A;  5E8I A;  2DTR A;  2J5O A;  2FD5 A;  2ZC2 A;  1TW3 A;  4YII A;  4EQQ A;  3H5A A;  3TP3 A;  3HRU A;  3FMQ A;  4HF1 A;  1PP8 F;  4CCL A;  2RVC A;  2IA1 A;  2K3F A;  2LYC A;  3BG6 A;  2JVG A;  1HDP A;  1NG6 A;  1R1U A;  3TMO A;  2R7Z J;  3AAF A;  4ZC3 A;  4DBQ A;  2FNP A;  2GXA A;  3IKV A;  5D6E A;  1LVK A;  2CV2 A;  2ZXH A;  4DQ2 A;  3A2K A;  2JA5 J;  4GFB A;  1YS7 A;  2JT1 A;  3RTR A;  1BIB A;  4LG0 A;  2R7U A;  3VYT B;  3WTX C;  1HLV A;  1E2X A;  1KA8 A;  4PSW A;  4F91 B;  2E34 A;  3T0Y A;  1ETK A;  4XON A;  3H3V K;  3PFI A;  4G6T B;  5JVT A;  2XAH A;  3FXU A;  4KIF A;  1Z77 A;  2XF5 A;  2B0L A;  2GOX B;  2L3D A;  4NUB A;  2NVU B;  4Q4Z F;  2R7X A;  1WJD A;  2IPQ X;  3Q9V A;  4NB5 A;  5ICE A;  1BC8 C;  3DTE A;  1ZEL A;  1UJ8 A;  3R4K A;  1MD0 A;  3HOV J;  3ZQF A;  3G73 A;  4DGW B;  1IN5 A;  4A3B J;  4II2 A;  2L5Q A;  1ETQ A;  1K79 A;  4BL0 B;  3I64 A;  4RB3 C;  5A2Q K;  2OCE A;  2XF7 A;  1YW9 A;  4FAS D;  2A6H F;  3C2H A;  4BBS J;  2UXX A;  3I3L A;  1Z9C A;  3IH3 A;  1WJ5 A;  4FX0 A;  3REO A;  2KIF A;  1H89 C;  3B02 A;  2R4G A;  3Q9S A;  2L0K A;  5IT9 Z;  3QRF F;  2JA8 J;  1OYW A;  1XMA A;  3L00 A;  3BCB A;  3CCL I;  2BY1 A;  4FET A;  3AFH A;  2DA2 A;  2UZK A;  1AKH A;  4AWX B;  4C3I J;  5B66 C;  1HCR A;  2I5U A;  1XG1 A;  3RKX A;  5FLX K;  2B7E A;  5EEG A;  1SVM A;  2IGK A;  3LWF A;  4AIJ A;  1S9H A;  2RKH A;  4AYB N;  2VT3 A;  4RB2 C;  1R9T J;  1G2H A;  1X58 A;  3O8H A;  5LRS A;  2FOW A;  4MFE A;  5LD2 C;  1S72 I;  4S0H B;  4A69 C;  2R5Z A;  2IGO A;  1RPW A;  5IY5 H;  1FOK A;  3PSF A;  1EJ9 A;  3BQZ A;  3V4G A; 
#chains in the Genus database with same CATH homology
 1ACI A;  3G4S I;  3J7Y J;  1VQK I;  2E36 A;  4IOC F;  1VQP I;  1YJW I;  3CD6 I;  1QA6 A;  2QA4 I;  2OTJ I;  3DLL F;  5JVG F;  2NXN B;  3CME I;  5DM6 F;  3CCR I;  1VQ9 I;  3G71 I;  3CCU I;  3PIP F;  2ZJP F;  2OTL I;  4IOA F;  3CC4 I;  2H8W A;  3CC2 I;  3G6E I;  3CCV I;  1FOX A;  3CCL I;  1VQ6 I;  5GAD J;  1VQ7 I;  3CC7 I;  3CCE I;  4UY8 I;  1VQ8 I;  1FOW A;  3CCJ I;  1YJN I;  1VQ5 I;  2FOW A;  5GAE J;  2QEX I;  1YI2 I;  1VQ4 I;  1MMS A;  1FOY A;  1YJ9 I;  1Y39 A;  1YIT I;  2E35 A;  2E34 A;  3CCQ I;  1VQM I;  1S72 I;  3CCS I;  1HC8 A;  2ZJR F;  5GAG J;  3CMA I;  3CCM I;  1YHQ I;  1YIJ I;  3CJT B;  1VQN I;  3I55 I;  3PIO F;  1VQO I;  1VQL I;  5GAH J;  3I56 I;  5DM7 F;  2K3F A;  4IO9 F;  2JQ7 A;  3CF5 F;  4V19 K;  2ZJQ F;  3J7Z I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...