2FP2A

Secreted chorismate mutase from mycobacterium tuberculosis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
164
structure length
162
Chain Sequence
TSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chorismate mutase
publication title 1.6A Crystal Structure of the Secreted Chorismate Mutase from Mycobacterium tuberculosis: Novel Fold Topology Revealed
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 69
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.170 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 2fp2A00
2AO2A 2F6LA 2FP2A 2GBBA 2FP1A
chains in the Genus database with same CATH superfamily
4P79A 3LGQA 4MPCA 2ZAFA 4WJYA 3MKHA 1LVCA 3X0XA 4FF3A 2BU2A 1FS7A 1XFWA 3VKHA 3TORA 3SF6A 3D9FA 1QDBA 2GBBA 3BNJA 1X8ZA 1XFYA 1EGCA 1OAHA 3OIBA 2PG0A 2FP2A 2VR0A 2XS1A 1IS2A 3D2RA 2WBIA 3R7KA 1XFVA 1JQIA 5K3JA 4AKIA 5K3IA 3TZ0A 2F6LA 2YYJA 1RP3A 5BRMA 2R0MA 3BNGA 3P4TA 2HJNA 3D1IA 3VADA 3TZ4A 5GJWE 4JEKA 3S7WA 1BUCA 5K3HA 4AKHA 2VIGA 2Z1QA 2E80A 3EONA 3X0YA 4E00A 2CX9A 4V25A 3CRLA 3D6BA 3UU9A 1UKWA 3MPIA 1X91A 2YYKA 4O5MA 4L3ZA 3EOMA 3UBRA 2DDHA 2JIFA 4MPNA 3C3LA 1XFZA 2R03A 2YYLA 2CJ6A 4W9UA 1RJ4A 2PNRA 4Q1OA 2C12A 2ZDXA 3AFFA 2C0UA 3M9VA 4MP2A 4M9AA 2Q8HA 4X28C 4H81A 2REHA 2ZKJA 4N5FA 4MP7A 4J1VA 1Y8OA 3TZ2A 4LQSB 2OEVA 3OWAA 4KSFA 1EGDA 1SIQA 1XFUA 3OWMA 2CJ4A 4HKSA 4P13A 5GJVE 4FF1A 3F29A 3SXQA 3TTBA 1X90A 2CJ7A 3GM6A 2EC5A 1S26A 1Y8NA 4H85A 3CE2A 1K8TA 1XG2B 1SIRA 5B5WA 4FZ4A 5B5VA 3RKHA 5BRKA 2BTZA 3L1TA 1R3BA 1Y8PA 2OT4A 3C2PA 4L3YA 4OO2A 4AKGA 4L38A 2AZEA 4JIOA 2EBAA 1R2JA 4DZYA 3MMOA 5M4MA 3HWCA 4ZXVA 4KSAA 3X29A 4FF2A 1PK0A 2EBHX 2BU7A 4QICA 3TZ5A 1JM6A 5J6AA 4G97A 2AO2A 4L3XA 1FS9A 2OJQA 1PI1A 2XQRB 3D9DA 3MDEA 4L1FA 4MPEA 1SC5A 1GKZA 2OEXA 4HKRA 4NXLA 1T9GA 3II9A 5B6BA 4X28A 4RM7A 3GQTA 3B96A 3N0RA 2FONA 2PO4A 2ZDYA 4Q0TA 4Q17A 1IVHA 4IV6A 2Q8IA 2ZO5A 2Q8FA 5M4KA 2BU5A 1RX0A 2CJ8A 3NF4A 3Q23A 4ZYJA 2LFWA 3Q0AA 3BNHA 3FCJA 2RFQA 3MPJA 4G5EA 2OR0A 4Q5CA 2BU8A 5M4NA 1RJ1A 2IX6A 1FS8A 2FP1A 4KCFA 4XVXA 4JIZA 2CJ5A 3D9EA 3CRKA 4U83A 1UDYA 2JBTA 2BU6A 2JBSA 1K90A 5K3GA 2JBRA 1GJVA 2A1TA 4IRNA 2RDZA 2R05A 3AFEA 4HR3A 2QR4A 5J71A 4AI6A 1WS9A 3MXLA 2XS8A 4KTOA 2DVLA 4E02A 4FF4A 2UXWA 1EGEA 1GU6A 3C46A 3SWOA 3KMLA 1XFXA 1W07A 4KS9A 5M4PA 3LG1A 3MDDA 4E01A 4DOYA 2VF1A 2EBFX 4Q5BA 4H7QA 3VKGA 4Q4UA 1K93A 3SCEA 3GNCA 2YGWA 2R02A 3Q24A 2J7AA 2D29A 2YYIA 2R0NA 2YYMA 3PFDA 2E0AA 2YYGA 2E81A 1Y0VA 3FO3A 4F0XA 1U8VA 2RF7A 4LQQB 2Q8GA 3Q22A 1SK6A 1GKXA 4V26A 2IX5A 3BNFA 3D9GA
chains in the Genus database with same CATH topology
4P79A 3C3LA 1XFZA 4KSAA 3X29A 1LVCA 4FF2A 1PK0A 2EBHX 4QICA 4FF3A 1XFWA 3VKHA 1K90A 2GBBA 4G97A 2AO2A 2QR4A 1XFYA 4AI6A 4FF4A 1SC5A 2FP2A 4HKRA 4KSFA 1XFVA 3C46A 3KMLA 4AKIA 1XFXA 4KS9A 5GJVE 1XFUA 3N0RA 2F6LA 2PO4A 1RP3A 4HKSA 4FF1A 2VF1A 2EBFX 3VKGA 1K93A 2EC5A 1S26A 2YGWA 3CE2A 5GJWE 4AKHA 1K8TA 3Q23A 3Q24A 4FZ4A 2LFWA 3Q0AA 4F0XA 3Q22A 1Y0VA 3C2PA 4AKGA 1SK6A 2AZEA 2FP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AO2 A;  2F6L A;  2FP2 A;  2GBB A;  2FP1 A; 
#chains in the Genus database with same CATH topology
 4P79 A;  3LGQ A;  4MPC A;  2ZAF A;  4WJY A;  3MKH A;  1LVC A;  3X0X A;  4FF3 A;  2BU2 A;  1FS7 A;  1XFW A;  3VKH A;  3TOR A;  3SF6 A;  3D9F A;  1QDB A;  2GBB A;  3BNJ A;  1X8Z A;  1XFY A;  1EGC A;  1OAH A;  3OIB A;  2PG0 A;  2FP2 A;  2VR0 A;  2XS1 A;  1IS2 A;  3D2R A;  2WBI A;  3R7K A;  1XFV A;  1JQI A;  5K3J A;  4AKI A;  5K3I A;  3TZ0 A;  2F6L A;  2YYJ A;  1RP3 A;  5BRM A;  2R0M A;  3BNG A;  3P4T A;  2HJN A;  3D1I A;  3VAD A;  3TZ4 A;  5GJW E;  4JEK A;  3S7W A;  1BUC A;  5K3H A;  4AKH A;  2VIG A;  2Z1Q A;  2E80 A;  3EON A;  3X0Y A;  4E00 A;  2CX9 A;  4V25 A;  3CRL A;  3D6B A;  3UU9 A;  1UKW A;  3MPI A;  1X91 A;  2YYK A;  4O5M A;  4L3Z A;  3EOM A;  3UBR A;  2DDH A;  2JIF A;  4MPN A;  3C3L A;  1XFZ A;  2R03 A;  2YYL A;  2CJ6 A;  4W9U A;  1RJ4 A;  2PNR A;  4Q1O A;  2C12 A;  2ZDX A;  3AFF A;  2C0U A;  3M9V A;  4MP2 A;  4M9A A;  2Q8H A;  4X28 C;  4H81 A;  2REH A;  2ZKJ A;  4N5F A;  4MP7 A;  4J1V A;  1Y8O A;  3TZ2 A;  4LQS B;  2OEV A;  3OWA A;  4KSF A;  1EGD A;  1SIQ A;  1XFU A;  3OWM A;  2CJ4 A;  4HKS A;  4P13 A;  5GJV E;  4FF1 A;  3F29 A;  3SXQ A;  3TTB A;  1X90 A;  2CJ7 A;  3GM6 A;  2EC5 A;  1S26 A;  1Y8N A;  4H85 A;  3CE2 A;  1K8T A;  1XG2 B;  1SIR A;  5B5W A;  4FZ4 A;  5B5V A;  3RKH A;  5BRK A;  2BTZ A;  3L1T A;  1R3B A;  1Y8P A;  2OT4 A;  3C2P A;  4L3Y A;  4OO2 A;  4AKG A;  4L38 A;  2AZE A;  4JIO A;  2EBA A;  1R2J A;  4DZY A;  3MMO A;  5M4M A;  3HWC A;  4ZXV A;  4KSA A;  3X29 A;  4FF2 A;  1PK0 A;  2EBH X;  2BU7 A;  4QIC A;  3TZ5 A;  1JM6 A;  5J6A A;  4G97 A;  2AO2 A;  4L3X A;  1FS9 A;  2OJQ A;  1PI1 A;  2XQR B;  3D9D A;  3MDE A;  4L1F A;  4MPE A;  1SC5 A;  1GKZ A;  2OEX A;  4HKR A;  4NXL A;  1T9G A;  3II9 A;  5B6B A;  4X28 A;  4RM7 A;  3GQT A;  3B96 A;  3N0R A;  2FON A;  2PO4 A;  2ZDY A;  4Q0T A;  4Q17 A;  1IVH A;  4IV6 A;  2Q8I A;  2ZO5 A;  2Q8F A;  5M4K A;  2BU5 A;  1RX0 A;  2CJ8 A;  3NF4 A;  3Q23 A;  4ZYJ A;  2LFW A;  3Q0A A;  3BNH A;  3FCJ A;  2RFQ A;  3MPJ A;  4G5E A;  2OR0 A;  4Q5C A;  2BU8 A;  5M4N A;  1RJ1 A;  2IX6 A;  1FS8 A;  2FP1 A;  4KCF A;  4XVX A;  4JIZ A;  2CJ5 A;  3D9E A;  3CRK A;  4U83 A;  1UDY A;  2JBT A;  2BU6 A;  2JBS A;  1K90 A;  5K3G A;  2JBR A;  1GJV A;  2A1T A;  4IRN A;  2RDZ A;  2R05 A;  3AFE A;  4HR3 A;  2QR4 A;  5J71 A;  4AI6 A;  1WS9 A;  3MXL A;  2XS8 A;  4KTO A;  2DVL A;  4E02 A;  4FF4 A;  2UXW A;  1EGE A;  1GU6 A;  3C46 A;  3SWO A;  3KML A;  1XFX A;  1W07 A;  4KS9 A;  5M4P A;  3LG1 A;  3MDD A;  4E01 A;  4DOY A;  2VF1 A;  2EBF X;  4Q5B A;  4H7Q A;  3VKG A;  4Q4U A;  1K93 A;  3SCE A;  3GNC A;  2YGW A;  2R02 A;  3Q24 A;  2J7A A;  2D29 A;  2YYI A;  2R0N A;  2YYM A;  3PFD A;  2E0A A;  2YYG A;  2E81 A;  1Y0V A;  3FO3 A;  4F0X A;  1U8V A;  2RF7 A;  4LQQ B;  2Q8G A;  3Q22 A;  1SK6 A;  1GKX A;  4V26 A;  2IX5 A;  3BNF A;  3D9G A; 
#chains in the Genus database with same CATH homology
 4P79 A;  3C3L A;  1XFZ A;  4KSA A;  3X29 A;  1LVC A;  4FF2 A;  1PK0 A;  2EBH X;  4QIC A;  4FF3 A;  1XFW A;  3VKH A;  1K90 A;  2GBB A;  4G97 A;  2AO2 A;  2QR4 A;  1XFY A;  4AI6 A;  4FF4 A;  1SC5 A;  2FP2 A;  4HKR A;  4KSF A;  1XFV A;  3C46 A;  3KML A;  4AKI A;  1XFX A;  4KS9 A;  5GJV E;  1XFU A;  3N0R A;  2F6L A;  2PO4 A;  1RP3 A;  4HKS A;  4FF1 A;  2VF1 A;  2EBF X;  3VKG A;  1K93 A;  2EC5 A;  1S26 A;  2YGW A;  3CE2 A;  5GJW E;  4AKH A;  1K8T A;  3Q23 A;  3Q24 A;  4FZ4 A;  2LFW A;  3Q0A A;  4F0X A;  3Q22 A;  1Y0V A;  3C2P A;  4AKG A;  1SK6 A;  2AZE A;  2FP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...