2FP2A

Secreted chorismate mutase from mycobacterium tuberculosis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
164
structure length
162
Chain Sequence
TSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chorismate mutase
publication title 1.6A Crystal Structure of the Secreted Chorismate Mutase from Mycobacterium tuberculosis: Novel Fold Topology Revealed
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 69
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.170 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 2fp2A00
2F6LA 2FP2A 2FP1A 2GBBA 2AO2A
chains in the Genus database with same CATH superfamily
1XG2B 1UKWA 1EGCA 4Q5CA 3OWAA 4JIZA 4LQQB 5GJVE 4L1FA 5B6BA 3C3LA 1WS9A 3B96A 2EBFX 2ZAFA 3Q24A 2YYGA 4MPNA 5K3JA 2R03A 3N0RA 4HR3A 4WJYA 2AO2A 4F0XA 3Q23A 3C46A 1OAHA 1FS7A 3CE2A 2JBTA 5K3HA 1SC5A 1K90A 1Y8OA 2BU8A 3AFFA 2CJ8A 1BUCA 1PK0A 5GJWE 4KTOA 2PNRA 1GJVA 1XFYA 1SIQA 3MPJA 1IVHA 1IS2A 2IX5A 2R0MA 2RFQA 2XQRB 2YGWA 2YYIA 4L3XA 3UBRA 2JIFA 5K3IA 3F29A 2EBAA 5M4PA 1FS9A 1Y8PA 3RKHA 4KS9A 4E02A 2DVLA 1T9GA 2A1TA 3P4TA 4L3ZA 4KCFA 3SCEA 3TZ4A 1R3BA 1XFXA 2XS8A 4L38A 2LFWA 3UU9A 1JM6A 1XFUA 4KSFA 4V25A 4MP7A 2D29A 2BTZA 4E01A 4FF2A 3TTBA 3MMOA 5B5VA 2CJ6A 2ZO5A 2CX9A 4HKSA 2CJ7A 3C2PA 4Q5BA 2YYLA 2IX6A 4XVXA 1RP3A 4Q1OA 2F6LA 1GU6A 3X29A 3NF4A 4G97A 4E00A 2E0AA 2DDHA 2EC5A 2J7AA 2R0NA 3BNHA 3OWMA 4H7QA 2Z1QA 4P79A 1X90A 3Q0AA 3EOMA 3LG1A 2BU5A 3EONA 3SWOA 2VR0A 1SIRA 4AI6A 4O5MA 1RX0A 2BU6A 3VADA 2QR4A 2JBRA 1XFVA 4NXLA 4DZYA 4U83A 3L1TA 1SK6A 5BRMA 2E80A 4IRNA 5J71A 3GQTA 4ZXVA 5B5WA 1S26A 2PO4A 2Q8GA 4J1VA 2VF1A 3BNJA 2Q8IA 1XFZA 3PFDA 1RJ4A 3D9EA 3Q22A 3TZ5A 4P13A 3FO3A 3MPIA 3MDDA 3D9GA 4H85A 1K8TA 1R2JA 4X28C 2WBIA 1K93A 1GKZA 2R05A 4FZ4A 3SXQA 3X0XA 4Q0TA 2OEVA 3CRLA 1LVCA 1PI1A 3TORA 3R7KA 1QDBA 2JBSA 2ZDXA 4H81A 2Q8HA 2BU7A 3X0YA 4FF3A 4FF1A 4LQSB 3OIBA 4L3YA 1JQIA 2C12A 4MPEA 3D6BA 4W9UA 4ZYJA 5J6AA 3VKHA 3BNFA 5M4KA 2ZDYA 1X91A 4IV6A 4X28A 3TZ0A 3BNGA 4MPCA 3HWCA 2OEXA 4M9AA 2GBBA 3TZ2A 4N5FA 4OO2A 1EGDA 2BU2A 2VIGA 4KSAA 1X8ZA 3AFEA 3II9A 4HKRA 3S7WA 4V26A 5M4MA 1EGEA 3SF6A 4Q17A 2OT4A 1U8VA 2C0UA 2EBHX 3D2RA 3D9FA 2OJQA 1GKXA 1XFWA 4AKHA 4FF4A 1W07A 2OR0A 4RM7A 2PG0A 2E81A 1RJ1A 3VKGA 4AKGA 2YYMA 3MDEA 2ZKJA 2RF7A 2YYKA 1Y0VA 2AZEA 2YYJA 3FCJA 1UDYA 1FS8A 1Y8NA 2CJ5A 2HJNA 2RDZA 2Q8FA 2R02A 2FP1A 3D9DA 3CRKA 3GNCA 2XS1A 3MXLA 5M4NA 3M9VA 3GM6A 4AKIA 2FONA 5BRKA 4Q4UA 3KMLA 2FP2A 4JEKA 3MKHA 4QICA 4DOYA 4MP2A 2REHA 3D1IA 4JIOA 2UXWA 5K3GA 2CJ4A 3LGQA 4G5EA
chains in the Genus database with same CATH topology
1XFUA 2GBBA 4KSAA 4KSFA 4FF2A 4HKRA 5GJVE 3C3LA 4HKSA 2EBFX 3Q24A 1K8TA 2EBHX 3N0RA 1XFWA 1K93A 1RP3A 2AO2A 4FZ4A 2F6LA 4F0XA 3X29A 3Q23A 4G97A 3C46A 4FF4A 1LVCA 3VKGA 3CE2A 3C2PA 2EC5A 4AKGA 1SC5A 1K90A 4P79A 3Q0AA 4AKHA 4FF3A 1Y0VA 2AZEA 1PK0A 4FF1A 4AI6A 5GJWE 1XFYA 2FP1A 2YGWA 2QR4A 1XFVA 4AKIA 3VKHA 1SK6A 3KMLA 2FP2A 4KS9A 4QICA 1S26A 2PO4A 1XFXA 2VF1A 2LFWA 1XFZA 3Q22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F6L A;  2FP2 A;  2FP1 A;  2GBB A;  2AO2 A; 
#chains in the Genus database with same CATH topology
 1XG2 B;  1UKW A;  1EGC A;  4Q5C A;  3OWA A;  4JIZ A;  4LQQ B;  5GJV E;  4L1F A;  5B6B A;  3C3L A;  1WS9 A;  3B96 A;  2EBF X;  2ZAF A;  3Q24 A;  2YYG A;  4MPN A;  5K3J A;  2R03 A;  3N0R A;  4HR3 A;  4WJY A;  2AO2 A;  4F0X A;  3Q23 A;  3C46 A;  1OAH A;  1FS7 A;  3CE2 A;  2JBT A;  5K3H A;  1SC5 A;  1K90 A;  1Y8O A;  2BU8 A;  3AFF A;  2CJ8 A;  1BUC A;  1PK0 A;  5GJW E;  4KTO A;  2PNR A;  1GJV A;  1XFY A;  1SIQ A;  3MPJ A;  1IVH A;  1IS2 A;  2IX5 A;  2R0M A;  2RFQ A;  2XQR B;  2YGW A;  2YYI A;  4L3X A;  3UBR A;  2JIF A;  5K3I A;  3F29 A;  2EBA A;  5M4P A;  1FS9 A;  1Y8P A;  3RKH A;  4KS9 A;  4E02 A;  2DVL A;  1T9G A;  2A1T A;  3P4T A;  4L3Z A;  4KCF A;  3SCE A;  3TZ4 A;  1R3B A;  1XFX A;  2XS8 A;  4L38 A;  2LFW A;  3UU9 A;  1JM6 A;  1XFU A;  4KSF A;  4V25 A;  4MP7 A;  2D29 A;  2BTZ A;  4E01 A;  4FF2 A;  3TTB A;  3MMO A;  5B5V A;  2CJ6 A;  2ZO5 A;  2CX9 A;  4HKS A;  2CJ7 A;  3C2P A;  4Q5B A;  2YYL A;  2IX6 A;  4XVX A;  1RP3 A;  4Q1O A;  2F6L A;  1GU6 A;  3X29 A;  3NF4 A;  4G97 A;  4E00 A;  2E0A A;  2DDH A;  2EC5 A;  2J7A A;  2R0N A;  3BNH A;  3OWM A;  4H7Q A;  2Z1Q A;  4P79 A;  1X90 A;  3Q0A A;  3EOM A;  3LG1 A;  2BU5 A;  3EON A;  3SWO A;  2VR0 A;  1SIR A;  4AI6 A;  4O5M A;  1RX0 A;  2BU6 A;  3VAD A;  2QR4 A;  2JBR A;  1XFV A;  4NXL A;  4DZY A;  4U83 A;  3L1T A;  1SK6 A;  5BRM A;  2E80 A;  4IRN A;  5J71 A;  3GQT A;  4ZXV A;  5B5W A;  1S26 A;  2PO4 A;  2Q8G A;  4J1V A;  2VF1 A;  3BNJ A;  2Q8I A;  1XFZ A;  3PFD A;  1RJ4 A;  3D9E A;  3Q22 A;  3TZ5 A;  4P13 A;  3FO3 A;  3MPI A;  3MDD A;  3D9G A;  4H85 A;  1K8T A;  1R2J A;  4X28 C;  2WBI A;  1K93 A;  1GKZ A;  2R05 A;  4FZ4 A;  3SXQ A;  3X0X A;  4Q0T A;  2OEV A;  3CRL A;  1LVC A;  1PI1 A;  3TOR A;  3R7K A;  1QDB A;  2JBS A;  2ZDX A;  4H81 A;  2Q8H A;  2BU7 A;  3X0Y A;  4FF3 A;  4FF1 A;  4LQS B;  3OIB A;  4L3Y A;  1JQI A;  2C12 A;  4MPE A;  3D6B A;  4W9U A;  4ZYJ A;  5J6A A;  3VKH A;  3BNF A;  5M4K A;  2ZDY A;  1X91 A;  4IV6 A;  4X28 A;  3TZ0 A;  3BNG A;  4MPC A;  3HWC A;  2OEX A;  4M9A A;  2GBB A;  3TZ2 A;  4N5F A;  4OO2 A;  1EGD A;  2BU2 A;  2VIG A;  4KSA A;  1X8Z A;  3AFE A;  3II9 A;  4HKR A;  3S7W A;  4V26 A;  5M4M A;  1EGE A;  3SF6 A;  4Q17 A;  2OT4 A;  1U8V A;  2C0U A;  2EBH X;  3D2R A;  3D9F A;  2OJQ A;  1GKX A;  1XFW A;  4AKH A;  4FF4 A;  1W07 A;  2OR0 A;  4RM7 A;  2PG0 A;  2E81 A;  1RJ1 A;  3VKG A;  4AKG A;  2YYM A;  3MDE A;  2ZKJ A;  2RF7 A;  2YYK A;  1Y0V A;  2AZE A;  2YYJ A;  3FCJ A;  1UDY A;  1FS8 A;  1Y8N A;  2CJ5 A;  2HJN A;  2RDZ A;  2Q8F A;  2R02 A;  2FP1 A;  3D9D A;  3CRK A;  3GNC A;  2XS1 A;  3MXL A;  5M4N A;  3M9V A;  3GM6 A;  4AKI A;  2FON A;  5BRK A;  4Q4U A;  3KML A;  2FP2 A;  4JEK A;  3MKH A;  4QIC A;  4DOY A;  4MP2 A;  2REH A;  3D1I A;  4JIO A;  2UXW A;  5K3G A;  2CJ4 A;  3LGQ A;  4G5E A; 
#chains in the Genus database with same CATH homology
 1XFU A;  2GBB A;  4KSA A;  4KSF A;  4FF2 A;  4HKR A;  5GJV E;  3C3L A;  4HKS A;  2EBF X;  3Q24 A;  1K8T A;  2EBH X;  3N0R A;  1XFW A;  1K93 A;  1RP3 A;  2AO2 A;  4FZ4 A;  2F6L A;  4F0X A;  3X29 A;  3Q23 A;  4G97 A;  3C46 A;  4FF4 A;  1LVC A;  3VKG A;  3CE2 A;  3C2P A;  2EC5 A;  4AKG A;  1SC5 A;  1K90 A;  4P79 A;  3Q0A A;  4AKH A;  4FF3 A;  1Y0V A;  2AZE A;  1PK0 A;  4FF1 A;  4AI6 A;  5GJW E;  1XFY A;  2FP1 A;  2YGW A;  2QR4 A;  1XFV A;  4AKI A;  3VKH A;  1SK6 A;  3KML A;  2FP2 A;  4KS9 A;  4QIC A;  1S26 A;  2PO4 A;  1XFX A;  2VF1 A;  2LFW A;  1XFZ A;  3Q22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...