2FP4B

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gtp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
393
structure length
393
Chain Sequence
b'MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 131
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fp4B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fp4B02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fp4B03
4MV6A 1GGOA 2CQYA 3VPCA 1JDBB 1PK8A 4O2AF 2Z04A 2R86A 1KEEA 5C1OA 5FNVF 1AUVA 1KJ8A 2DWCA 5DMXA 2R82A 5C1PA 4YAJA 1DV1A 3MJFA 5JVLA 2ZDGA 2XD4A 1DV2A 4MV1A 3RV3A 2V59A 4YJ2F 4O82A 1E4EA 2FP4B 3K3PA 5BMVF 2W6QA 1A48A 4MV4A 3E5NA 2HJWA 1Z2OX 1JKJA 3R9RA 5BPHA 2NU7A 2R85A 1UC9A 1KBLA 2XCLA 4Y8VB 2WYOA 4HQ6A 2YZNA 3G8DA 4O7YA 2J9GA 4O7NA 3AX6A 5HBRA 2OLSA 2FPPB 2I8CA 2CSUA 4IZOA 2FP4A 2R87A 1CQJB 3R5HA 4ZQIA 2I87A 3RV4A 2YWVA 4O7VA 5LOVF 4Y8VA 2PN1A 4MAMA 4O7LA 3DF7A 4E4TA 1KJQA 2CNQA 2FPPA 5D8DA 5IYZF 3R23A 5H80A 1CQJA 4O83A 3JZFA 3N6RA 3V4ZA 1KJ9A 5CAEA 3KREA 4EGJA 4MV3A 2YRXA 3OUZA 4MV9A 1GLVA 1ULZA 3WO1A 3HO8A 4TV9F 3TINA 4IWXA 1VKZA 2YRWA 3GLKA 3MWEB 4ZI7F 5J2TF 2W6PA 2NUAB 4FU0A 4FFPA 3VOTA 3U55A 1KJIA 4O86A 1DIKA 5CA0F 3RUPA 3NUAA 2ZDHA 4HNVA 3U54A 5CB4F 4YAKB 2R7NA 1KC7A 3SE7A 2YZGA 3ORQA 4O4IF 1KUTA 2VPQA 5JVDF 5K2MA 3N8DA 4TV8F 5KKNB 2YV1A 4I4TF 2P0AA 1CE8A 3MWEA 1VBHA 1M0TA 2W6OA 5KX5F 4C5BA 2NUAA 5HV6A 3TIGA 2R7LA 2GLTA 2GQRA 3ETHA 2W6NA 1B6RA 2NU8B 2GQSA 1A9XA 2R6FA 3QFFA 2VQDA 2FPGB 4YAKA 4I55F 4M9UA 1JDEA 1IOWA 1OBDA 4XZ3B 4FGRA 4O4HF 3I12A 3PFFA 2Z02A 4MA0A 1I7LA 1UC8A 2DZDA 3WNZA 1SCUB 3V4SA 5BPFA 3TIIA 4DLKA 4ZOLF 3ORRA 3R5FA 4FFLA 4MV7A 1EUCB 2X0SA 2YS6A 2NU8A 5LA6F 3JRXA 3U9SA 4WD3A 2C00A 1EYZA 3AW8A 5JQGF 2R84A 4XYLB 1EZ1A 4YB8B 1VBGA 2W70A 3KALA 3TW6A 2YL2A 4HNTA 4YAJB 2ZDQA 1SCUA 5J2UF 5JH7F 2PVPA 1PX2A 4ZHQF 1OI7A 4O4LF 1GSHA 5LP6F 1W96A 1Z2NX 3R5XA 1EUCA 1KJJA 3LWBA 5CA1F 1IOVA 2YW2A 3JZIA 2NU6B 1OBGA 1T36A 2GPSA 5EZYF 4FFRA 4XYLA 1I7NA 4YJ3F 1EHIA 1CQIB 2CZGA 4YB8A 2YV2A 1BNCA 3ETJA 4O84A 2FPIB 1EUDB 4O7WA 2PBZA 4WBNF 5HBRB 3LP8A 2CNUA 3BG5A 2V5AA 2QF7A 1Z2PX 3TQTA 1M6VA 4O81A 3G8CA 2GPWA 1CS0A 3Q2OA 1WR2A 2YS7A 1W93A 2NU9B 1BXRA 3VPDA 4MA5A 4O7ZA 1GSAA 4FFOA 3K5HA 2NU6A 4O7SA 2SCUB 4FE2A 5LYJF 3K5IA 1CQIA 1GSOA 5C8YF 4IWYA 4ME6A 3VPBA 4QSHA 2FPIA 4XYMB 4O2BF 1EUDA 2W6ZA 3UFXB 2YYAA 2R7KA 1C30A 2YZLA 1AUXA 4HR7A 5I47A 4RZQA 3HB9A 4I50F 4IIJF 3KAKA 4YBZB 2NU9A 4TUYF 4L1KA 4NYEA 3RFCA 2W6MA 2HGSA 1JLLB 4C5CA 2SCUA 5CAEB 2QK4A 1M0WA 2DIKA 3MWDB 2I80A 2R7MA 4DIMA 5JQWA 4FFNA 4XX0B 3U9TA 3VMMA 4MV8A 2FPGA 4XYMA 3KAJA 5GONF 2YZMA 3Q1KA 2CNVA 2V58A 4XZ3A 3UFXA 4O7RA 2IP4A 4HNUA 2FB9A 3GIDA 2VR1A 1C3OA 4YBZA 4IHJF 3WO0A 4EGQA 5LXTF 3DMYA 1E4EB 1JLLA 3VA7A 4C5AA 4FFMA 2W71A 4O4JF 3OUUA 3MWDA 3HBLA 4EG0A 3JRWA 1B6SA 1JKJB 4XX0A 4O7TA 2DLNA 2NU7B
chains in the Genus database with same CATH superfamily
3N1UA 4MQ5A 2OXIA 3LYUA 2FZ4A 3THWA 3OLYA 1IPHA 3W1GA 3GLHA 1N6OA 5JAMA 2FP4B 4D81A 3W77A 4QTYA 4CKEB 2HCBA 3WA6A 5AKEA 4AN1A 2AOXA 3DO8A 4OG2A 4BBRG 1JQKA 4C7MA 2RGUA 2ACVA 2O20A 3EVCA 3U5ZB 3GJTA 2ACWA 4MQUA 4E5NA 1GNQA 4J0EA 1OZGA 5AJHA 1GSIA 4BO8A 3QVXA 2YWVA 3FDIA 1BU5A 3BXXA 2RH8A 3N76A 4FS8A 4I08A 4EHKA 1O3YA 3IAHA 4MRNA 4A2CA 2IE0A 4P5EA 4Y2HA 4GICA 4IIFA 1GFSA 1E6WA 3PTLA 4UUBA 3PL5A 4S1NA 4ZI5A 3UMRA 5C37A 1J97A 2VDWA 1DC4A 5DTRA 1V1RA 2C8JA 3AM1A 5D3MB 3H05A 1VLJA 1ZXXA 4EBCA 1ADBA 2F8TA 4WZ6A 2E85A 5EJGA 3WGHA 2RD2A 3U4HA 2QKYA 3PHBE 3G79A 1E0KA 4X7MA 4YK7A 4OGLA 2RF4A 1G9XA 2B78A 1OFTA 3VOTA 4PGGA 2GLXA 2ZB7A 4Y2RA 4BIMA 3ZJ5A 4C7KA 2Q41A 1CG6A 4KVZA 1MO2A 5ADWA 2PTGA 3EEFA 1IBCA 2HI0A 3MT7A 1UBUS 4MR7A 4ZCLA 4G97A 5ANRB 3EWSA 2UZ1A 2GQRA 1Z33A 3W2TA 3P8ZA 3WJ7A 2Q9AA 4HNHA 1BEEA 3FYCA 4RKRA 1BX0A 3DL4A 1G60A 4NK4A 2YNMC 4AZWA 1XTZA 5C7IO 1JQEA 4P3OA 2PKRA 1U6IA 1JQDA 4DLTA 4AZ0A 4QYXA 3L7JA 1Z17A 3MWGA 1BGVA 4QIWE 3OQHA 2FW9A 1V8PA 1X7GA 3I3SR 4DCTA 4XIYA 1VL5A 5EI5A 5F98A 2ZM6B 5JQGA 5AM5A 3ZTWA 3I6YA 4GBJA 1JZQA 1RM5A 2ZQZA 2B6NA 3QVOA 1JR4A 2BLLA 1Z26A 1LW6E 4KCGA 1SCUA 2PKYX 2AG1A 5KCZA 3ZLBA 1GFWA 4Z7OB 3CIOA 1MB9A 3RRFA 5K3BA 1ECCA 3W4JA 4J8PA 2R92G 1QAOA 1QX3A 2VJOA 2PAAA 3KQYA 2XZDA 1P2TA 4KC0A 1B16A 4ZC8A 1FNNA 4BWYA 4LRYA 1DWQA 5BRAA 1YD7A 2YS7A 1OKKA 5A6SB 5M29A 1L4MA 1IN5A 1XXLA 2B7BA 2F4VB 3ZXIA 4IWYA 1U4SA 3WLSA 1VIAA 3AHEA 2FPIA 1X1CA 4G5RA 1OXXK 4GI1A 2K7FA 2WFAA 4MVJP 3I62A 1YCGA 4OYRA 4KW7A 1OX5A 1R9JA 1ENPA 1AVTA 3FWNA 1JHMA 2GSWA 2GKSA 2ZM6H 1F3OA 4HL6A 4OFXA 5HK8A 4IIJF 2J4DA 1Z38A 4OI4A 4RSGA 1NUSA 3O3OB 2CHFA 3EPKA 1R5JA 2BFBB 3EODA 2G9NA 3ZVLA 3PUVA 2DFVA 4L4RA 3UCFA 3WL5A 1ZD5A 2OBNA 2ONYA 3JQCA 5DPMA 3B7WA 2BKEA 2ODPA 3HCAA 1FFXA 5KJCA 3QF4B 2H7VA 1QPGA 1ZRHA 4K6KA 4WIAA 2FTKE 3OI7A 2C1XA 1XXHE 4UVHA 1KO5A 4Q4LA 1M3SA 2R48A 3DDSA 2P1DA 2YJ6A 2PGIA 4Z51A 1S2OA 2G8NA 4RB0A 3G5UA 1ZG3A 5CW2A 2XVXA 1NWHA 5I9LA 3O31A 5EJ9A 4YV0A 4KVAA 3DFUA 3U3XA 1YIAA 3PQCA 5BSTA 4PQGA 1OKKD 3USZA 5AHWA 5ABPA 4IRDA 3WK5A 4WLNA 3NGXA 2UYHA 1YQEA 1R50A 5HE8A 1P8AA 3DBHB 4IUCS 1R0YA 5LQAA 1KK3A 3LLUA 1QJCA 3UQYS 1JLKA 3HVHA 1LFDB 2WKQA 4M6WA 2PUWA 3NB0A 1P5FA 3HVIA 2PS1A 2YVQA 3OO1A 3RTAA 5K6AA 5AVYA 3JZMA 1SELA 2OENG 3D7SA 1P39A 2WWHA 1RQPA 5JMOA 3OLCX 2GH1A 3GJZA 4ZCSA 1J5EB 1DXOA 1NHWA 3IIJA 1YF3A 2VNSA 1GDTA 1JLRA 2JLQA 3L7YA 4JJAA 4X44A 4R8MA 3SK0A 2WAXA 4RORA 4D80A 1KJZA 4RY0A 1ZJZA 1H5QA 2IYSA 4DQKA 2OXFA 5JCXA 3QMMA 4M8LA 3SZUA 1RADA 2VK1A 3EJWA 3KSAC 1A8QA 4FWIB 3H1FA 5KU1A 2B35A 5AW3A 1NYLA 1DIKA 1G98A 1EGAA 2AG0A 4MRPA 1I2KA 1TJ4A 3GNTA 3UWPA 4BFTA 2GO1A 1LGYA 5AO9A 3W6PA 5EJFA 3OQIA 4DUGA 2YH2A 1T2VA 2P4HX 3WLIA 5JJIA 5FWDA 5A4KA 5DHRA 5FDFA 2ZREA 1V95A 1TTHA 4K9NA 3VXKA 2DT8A 1FYXA 4K46A 4OHMA 4CBVA 1XCOA 3JD4A 5KT5A 2JZOA 2VQDA 1XB2A 5C7OO 2J5KA 3QJYA 4ZJZA 1R74A 2V6MA 4JFRA 1GAXA 2WSIA 3NALA 3CTMA 1C8VB 1J5EH 4GX2A 4PGAA 2P4SA 1W4RA 3DLIA 4ZQBA 1YQQA 3GJ6A 5M5BA 3UTDA 2B6HA 3IBGA 3UBTA 3KSUA 1SD1A 3FOZA 5EJAA 5IANA 2JLWA 4LRXA 3ZDZB 4NYMR 1ND5A 1KDYA 1RI1A 1SVUA 4FMCB 2PAFA 3NBYC 5KKCA 2WJZB 4OJNA 1BH6A 3I2JA 1RS0A 1Y8QA 1T26A 2DR2A 4M0CA 1H85A 4OMUA 5ALRA 3ADKA 4YB8A 3INGA 3G0HA 3GMDA 5FD5A 3IUSA 3H4IA 2W2NA 3TMAA 1JUDA 1O4WA 2RG1A 1JYEA 3RS5A 1CDEA 3I9OA 3NCHA 5F1OA 1KDPA 3ZHVA 3KD2A 1ZHHA 1I3KA 4WESB 2G07A 2UZIR 5D7BA 4EUSA 4DUGD 2QXTA 4LF6B 4U7WA 1PLJA 2JLAA 1TXGA 3ENWA 1LPOA 3O2SB 3W8EA 2PL3A 3QX9A 1A1VA 4Q7LA 1Y33E 3VR4A 4I50F 3FRHA 3L8CA 5G02A 5CFPA 4TQUS 1SO8A 5DP1A 4IX9A 2FFHA 4LC1A 3OMLA 1UK9A 4UDXX 2JFUA 5ADUS 4J29A 2X9VA 2EFYA 3Q1KA 2W8ZA 4NV3A 4LN1A 2FYTA 1N77A 5T14A 3U0VA 3R9XB 1Z5UA 1YRAA 2Q5QA 5LMZA 4Z1MD 2R0QC 3EEYA 3OE5A 5KAMA 1HT0A 1J2YA 3K0AA 4CIWA 2O7QA 3KNZA 2XT0A 1BMQA 3F4LA 3DMHA 3G2KA 4IKEA 4BTLA 1X2EA 2ZDGA 3HCCA 2GDJA 3YASA 4M9SA 4LF6H 1FVHA 4NICA 2ILTA 3RYCB 4AJLA 5EP4A 5I5GA 5L1JA 2EP8A 3PBKA 3VYVA 4J9QA 2QVBA 3GMIA 3B1XA 4R2XA 4DL7A 4N8EA 1GGMA 3AJAA 4WLUA 5FTWA 4OQXA 2DCMA 1E9VA 2GFHA 3UJDA 4S3MA 3A6PC 2XUKA 4BPRA 2VG8A 2DWPA 4H7IA 3QMPA 4FBTA 3AWIA 5EA2A 1J6UA 1O0SA 1XXHA 3DZGA 2CNKA 3VR4D 1EWVA 1E6EA 4X3PA 2FSGA 5TQ0B 1B93A 1K68A 4RGQA 3KO8A 5K3WA 5A4IS 4YGYA 4QICA 3OM1A 2JA5A 1JR2A 4HQ0A 2B2CA 4QBGB 2J41A 5LIRA 1GTL1 3IAM1 1PFGA 1P60A 2FF7A 2YY7A 1W6UA 2BFDB 4Y2VA 3G59A 3O75A 1RHQA 4HAZA 4MV9A 3K15A 3F5DA 2FMUA 4QNNA 1ULZA 2PKXA 1ZUHA 4KXXA 2Q2TA 3H9EO 2WJ6A 4FW9A 3V1LA 1LV8A 3PNQA 4N18A 3DDOA 2C3YA 4JI2H 2FPWA 1L1EA 2BGTA 4PO1A 4Z5XA 4C7VA 1J0AA 2BMVA 3QUAA 2GD2A 3T3GA 1QIDA 4FYWA 2V9CA 5DK4A 4O2BB 1YZHA 2BUAA 4ISBA 5KCMA 4GYWA 4D0NA 3FMGA 3NH6A 1U5BA 3MIZA 4Q9NA 3QG1A 5LL6b 2V74B 4HFNA 4LFBB 3QV1A 4BKPA 1JI3A 2QZJA 2E6UX 4QWMA 2QLFA 1Q2XA 3H6GA 5I7OA 4Q8FA 1A5SB 1OWLA 5EP3A 4QUEA 2H29A 3LTEA 3GLTA 1VRWA 4AL4A 5IVDA 4F5WA 4BJHB 2PMBA 5I7WA 4CTMA 4PG7A 5CDYA 3N9IA 1Q1NA 1XRQA 4NXMH 2VJMB 3AT1A 1QZUA 4Q93A 1R16A 1DQSA 4TTQA 4I1IA 2FSUA 3ZCXA 1DX6A 4PC2A 1UBNA 3ZG6A 4BX3A 3SJZA 4E2WA 2AZTA 1D9ZA 1SBIA 3BORA 3LQKA 1QTIA 3DHWC 3SBXA 4FONA 1BOOA 1DCTA 1PJTA 1T9CA 1ZOIA 3P4XA 4EBEA 4KMRA 1AQUA 4D8XA 5GJWC 4YAEA 3VR0A 2UUPA 3K3VA 4KN9S 1SCQA 4BL5A 2YY5A 3U80A 3OF2A 1WD7A 1I7DA 1IMJA 2GA8A 1L5NA 3U62A 3B52X 2ZUWA 1NX9A 3OAAA 3L82B 2A9PA 4KITB 1FS4A 4Y2QA 5F33A 2WAQE 1DT3A 2J30A 2W9CB 2VSYA 4US2R 1WETA 4XQ9A 3MRSA 4A0SA 2DJ5A 1QE5A 4M1YA 2RBGA 4RXUA 3WJAA 3MQ4A 3S5JA 3K71B 4K3UA 2ETVA 2GT1A 2UVWA 2BH9A 2WTEA 1LLFA 3E5RA 5IN5A 3H5RA 4ES6A 1N2HA 2DKOA 1VS0A 2R8HA 4CCYA 1D04A 2HDHA 3V8EA 1MX1A 1OTHA 3QFSA 4DLSA 3T1HB 4X24A 2B30A 2DFPA 4D9FA 3UYKA 3Q0EA 3BT7A 4IHJF 5K3OA 3DEIA 2H5LA 1T0UA 1R9MA 4YJFA 2ZGIA 3SAJA 4DEYA 4CM3A 2GSDA 3OQNA 4O29A 1TMYA 2XRYA 3MBOA 4WL0A 4WACA 3W5CA 2RMKA 4EVRA 2TYSB 5FWAA 1ZGBA 5JSZB 4K0KH 1YR1A 2JJ1A 3S5UA 5ALEA 5KTNA 4YAWA 2YWXA 3C45A 4DZRA 4OA5A 4NZZA 4GO1A 1H69A 1ELOA 2WZCA 2DPMA 3NASA 3UMJA 4KK4A 3DZ8A 2I9PA 1C41A 1R6VA 2HWKA 1PWHA 4LMPA 1RWWA 4R1NA 3NBQA 1I1OA 3R3XA 1VGQA 3OAAD 3NWJA 4H7EA 3L9XA 1DIGA 4D4LA 4D92A 2PNJA 5FLYA 4EHAA 4Q9KA 5JHHB 1JU9A 3X2EA 5TGDA 3THYA 4GLFA 1Z5VA 2XCOA 4BBSG 3I2FA 2PUCA 3H1GA 4TVBA 4IVNA 2XNSA 2J5RA 4PYRA 2EEZA 5BOSA 1KEUA 4B8ZA 4JJGA 5FLMG 1G8FA 2R00A 2CFTA 3G9ZA 5J9FA 1CPYA 4IF4A 4IJQA 1ISIA 1TL7C 5ESDA 2H1SA 1K4YA 3GU3A 1T3LA 3AI1A 3JQ8B 3UHOA 5HTOA 3RAGA 4DN6A 1K06A 3ZC3A 5BYBA 2IHKA 2B8TA 4YRGA 2XUAA 2NN3C 3RRMA 5HEKA 4MV3A 4WA8A 4JI0B 5KJEA 3CNOA 3DWGA 5K05A 4Y6SA 1XZAA 2QE6A 3M3PA 3ELDA 3G88A 4M0EA 4WHXA 3CFYA 1Y3BE 2ZG6A 3GUYA 1Z16A 4ECRA 3W3ZB 4DUYB 3PF9A 3JVUA 2BFFB 4HRVA 1XMIA 4FYIA 5DBOA 5CA0A 1XVVA 1KC7A 2JJ1D 3QYAA 1I3LA 5FWXB 3CRW1 1IJFA 4YRBA 4W82A 4YA6A 1MVOA 4RX1A 5P21A 2H5JA 2DM6A 2XTAA 1C4OA 4UXHA 4BVHA 2H16A 3Q11A 2CLKB 1Q22A 5CJJA 1VE6A 3S99A 4WAUA 1P5RA 4R8VA 3WWHA 2A7QA 1QFMA 1CUHA 1NF3A 1PZFA 2QS9A 3NONA 1X8LA 2GJ4A 1R6UA 5I5SA 3VQTA 2DZDA 2OQRA 4JNKA 3BRWD 2GYUA 2YFHA 2CZCA 3WWEA 1W52X 2JGMA 1XNRH 3I1IA 5KTPA 3ZWPA 2AFHB 1U0GA 3ANLA 5CPFA 1P0PA 3A9WA 3IQXA 3TVTA 4JI7B 4WD3A 1G2IA 5AOVA 2I4RA 1PQYA 4MUMA 1KPGA 2EDAA 2BT4A 2I2AA 1VQ1A 4CDNA 2Q2NA 4C9BA 4YHBA 2FEAA 3VNAA 4DUYH 3BL6A 1V3UA 2ERCA 5GIPE 1RYSA 2HXYA 1X0VA 1ZAKA 4OQEA 1WWKA 1MFPA 1KJJA 4XPIA 3F8SA 5KWEA 2XNDA 3O2NA 5G0UA 2O2DA 3C4JA 4CLXA 4QW9A 3DZKA 4U2DA 5DM70 5HZKA 3KAPA 2AF4C 4YJ3A 2P30A 4QGAA 4U7PB 1EUDB 1RAGA 3PLNA 2C7RA 1SAYA 4HNAB 3BG5A 2BLNA 3ZY6A 3MGCA 3AILA 3I9JA 3MHTA 1NULA 2Q4DA 2QTHA 1O1YA 2PANA 2AHRA 2BEUA 4DRZA 3HNOA 4UFNA 1E92A 2DERA 4QHTA 4FHDA 1FBTA 3W5AA 4ME6A 4J4BA 4RCYA 3KQOA 5EIEA 2FZGA 3EY4A 2HHFB 4A6XA 1YBVA 1JG1A 2NSHA 4LYYA 4QO7A 4KE7A 3C2QA 3AM5A 4Q7MB 4V02A 2FPOA 2X5OA 3K0FB 4OAPA 5JMTA 5JZVA 2AEFA 2GBLA 3ELWA 3WGLA 3J80A 4A4DA 2EGGA 1QU2A 1UAAA 4TV9B 5GONF 2WI8A 3A6JA 1ISMA 4H1UA 3T5HA 1YCDA 2WWRA 2XQVA 4F8JA 3T1VA 2AOWA 1C0PA 1C8LA 4JI5B 4BQIA 2WAQA 1KH1A 2ZR7A 4M8NE 3CLRD 4XQCA 1U6JA 3PUKA 1BFDA 1H0HA 5AW7A 3PXCX 3K20A 2H65A 2VC2B 4CEJA 3Q3VA 4DG9A 2P91A 3GIIA 2GO7A 4EJFA 2IQIA 4IHAA 1AUVA 1KJ8A 1YVRA 2HT1A 2XNDD 5SYMA 3NAMA 4MR8A 5ALSA 1IDOA 4QDUA 2DHDA 5KQRA 5EHGA 4MS4A 2HMWA 4RO0A 1SOAA 1TYBE 3Q8WA 2FX2A 5B1EA 3QVLA 4B2PA 1XRRA 1KI6B 2MYTA 2PMWB 2EBHX 1LS1A 1NVAA 4Y6GB 4CM4A 3TTXA 3PUJA 2X9NA 4ED6A 2NUPB 4YDSA 5HM8A 2GKOA 1WO8A 1FVOA 4QUKA 1YUBA 4HY3A 4AUEA 4OXNA 4YWHA 1U4NA 1NF8A 4BQQA 1V5GA 2H1LA 2REQA 3VDRA 3WGIA 2CK3A 2ZI9A 1FX1A 3FSRA 4R01A 4HUQB 4LK2A 5DBFA 4B7CA 2ABJA 4ZVQA 4H1WA 4BATA 5I6DA 1RYBA 3RIMA 3IPRA 1OXTA 1NI4B 2JAPA 3BWXA 1V47A 5J23A 4IP0A 2D5IA 2CLLB 1CY6A 2D62A 5GAJA 4HNSA 5B6PA 2JEIA 5K3EA 3QI7A 4QFBA 3IA2A 3HA7A 3FMFA 4UQLA 1ZO8A 2ET6A 2ZXUA 5BWRA 3LLMA 3AEQA 4CKYA 4XYGA 3VGPA 2PLFA 3HJUA 1L2TA 4YRMA 3AP1A 4RQTA 5TLSA 4TKLA 3VZPA 1O03A 4MLPA 4W5WA 1BWQA 2C4MA 2P6NA 4UFZA 2ZRFA 3TGWA 2A9VA 4AROA 3KEOA 4NCBA 3KT3A 2K2WA 2J5BA 1SOUA 5DQIA 5EXSA 2DBZA 4MMXB 1SUFA 1SUSA 1ET0A 2EP7A 2OV1A 3U7RA 1V16A 4GU5A 3PYXA 2BKUA 1PHRA 2K4MA 1MV5A 1JHUA 3RJ9A 1Z6QA 2Q2OA 2C0PA 5JSQA 5L3SA 1RWBA 2VHVA 1H2YA 3PDIB 3T5CA 3DC7A 5I4IA 1M1NA 2CK3D 5DBIA 4HEHA 1XCBA 4PC1A 4IFTA 4RA6B 3T0FA 4WCFB 2KBFA 3NV7A 3HKEB 1ZH6A 3EWAA 5GJBA 4IBOA 2EKBA 3TEJA 5EHIA 4HXGA 5E6SA 2LR0A 3Q3CA 4MI3A 4BMDA 4NNJA 2OYSA 4UVIA 4DY6A 2OR3A 2JD2A 4CWAA 3GYBA 3JWIA 3I5XA 1E2NA 1JJBA 4BZXA 4JITA 4KQ2A 3E3AA 5BUSA 4OI1A 4RHYA 5DLDA 3DO5A 4JLNA 2WIGA 4U00A 4LZNA 1EFVA 1WV0A 4X64B 1I6LA 3MTIA 1Y3FE 3BTVA 2NVBA 4OLFA 3L0OA 4AJ1A 1JWLA 4FI3C 1U11A 3FY4A 3LBNA 4FMDB 4PTYA 4EW1A 5EIHA 2PLRA 4IAOA 5GV8A 5E2IA 4H6XA 4B3DA 3S1AA 2CLDX 3TR0A 3JARA 3PPWA 5K0JA 3JPWA 1PW5A 5KFNA 5EXEA 4LDNA 1MW9X 3OESA 5FADA 3FSJX 5INTA 1E2EA 4WKGA 1YJ5A 1C7FA 4XIGS 2CF6A 4G1MB 2AD5A 3RLFA 1X7ZA 3A1NA 4FDVA 1NE2A 2IEDA 2HF2A 2WHPA 1QHEA 3F47A 3R3ZA 2GHIA 3T7IA 4M60A 2NQ8A 4RPKA 3QZ7A 4D8VA 5LU9A 2ZJFA 1VBKA 1BDIA 3OZ7A 3RUFA 2VAXA 1AKMA 4LZOA 2X58A 7MDHA 4X64H 2E5WA 3T3IA 2R00C 1FJXA 2FW1A 1RMYA 2DKNA 2IDMA 1JVBA 2JIZD 4IIGA 1ACMA 1TAQA 4P4NA 3MOSA 4AN0A 2F4NA 4HLNA 3KEGA 1T8TA 3PNMA 3VPHA 1CTQA 2G17A 3O1HB 3GFQA 4CIYA 4QODA 1NR5A 5DW0A 1VP3A 4EQZA 5AM1A 2B63G 5G41A 3NIFB 4BJ5A 1C5KA 4MUXA 5KQMA 3PE4A 3UJ7A 3BFPA 1FDIA 2OAGA 2FFJA 2R4QA 2O52A 1NUPA 3CG0A 3IDAA 2I29A 7MHTA 3DBLA 3TCXB 1KK2A 5I01A 1E4VA 1KMQA 2QMZA 2GPTA 2KYRA 1W88B 2PWAA 4RADA 3FAZA 3H5TA 3TW0A 4PCUA 5IAAA 2IHZA 3OPQA 5I45A 1WUYA 1QTNA 5EKTA 3R7AA 2HIXA 5A04A 4D26A 1W0KA 5BOVA 3JWEA 4L9AA 4CKBA 1PR1A 3BE5A 2GHQA 2V0GA 3R23A 1DAAA 4CU2A 4MV0A 1V9CA 1BDJA 4D2IA 1IXSB 1IULA 4GNKA 3HYSA 1THMA 5KT2A 3RPEA 4V3CA 4K2HA 1G1AA 2X7JA 1LSUA 4V0LA 3KJEA 3MRVA 2WE6A 2W6CX 3OOWA 4V1CA 1G8GA 1X92A 3EVFA 1PJSA 2FPSA 3ES9A 4KACA 4RHUA 3CLRC 3EBPA 1QR2A 2JHPA 1Y3AA 3RU9A 2QM3A 3FNGA 1SWVA 2VNIA 2P27A 2ZJ1A 1L9XA 3O2JA 2YZGA 4UATA 1V8BA 3PVZA 3UWKA 2I99A 3W7BA 4CMIB 3MS7A 1RFGE 1M0TA 4K9RA 3GA0A 4HBGA 1O5TA 4TROA 4LSWA 5JRJA 2CLFB 3AUFA 2V65A 1U8XX 3G7SA 3ZH2A 3ZX4A 1CK4A 1E1DA 1ODKA 5IWCA 5JFGA 3SICE 5T4EA 5IF3A 2WUVA 1UODA 3AC0A 4C7OA 3WWPA 4WJZA 1WU8A 2DMRA 4IIVA 4XARA 4X94A 3T5GA 4Q4CA 5JRDS 2VWPA 3F9IA 4P1ZA 3CSDA 3K8ZA 1USWA 1UKAA 1FJ2A 4I9HA 1AO0A 4PX3A 1JKXA 4L0MA 2MTBA 4ER7A 3RS9A 3EGWA 4ALMA 1Y5IA 3CUKA 1UPXA 2PS0A 1KGDA 3ID6C 1XCPA 3LD9A 3KVVA 1U2SA 3HNRA 1FDWA 2YN0A 3SI8A 1V7ZA 4UEQA 3KKLA 1IVSA 2WDPA 3WIBA 2YQ4A 5DSZA 4B84A 2R7ZA 3CCFA 1L4NA 1QP4A 2YHIA 5AICA 2HFJA 5CX1B 2CNUA 1AY0A 3ANMA 3DO6A 1S0OA 5EXTA 2VHEA 1O0CA 3HXQA 1C4WA 1NW9B 4BAUA 1Q1EA 1EGMB 5KJ6A 1AHPA 1WB6A 1JMYA 4OQQA 5JNLA 4RSHA 9ATCA 3HHPA 4EPTA 4MVJF 4ROSA 1XLUA 2XSZA 4RY9A 1D2CA 1GAJA 2G9VA 3A1WA 3ENKA 2DSNA 4C08A 3QU5A 1IJKA 3K4PA 3RJTA 1J21A 4DREA 1F0NA 4DQ0A 2O0JA 4ZK6A 4F5ZA 1YSCA 2P68A 1O75A 4CCAA 2EXXA 5BNZA 1GDDA 3MS2A 4UJ5A 1WBBA 4DARA 4DMRA 2BV3A 3W5OA 1PSZA 2CY0A 3FCOA 5A3SA 2B1JA 4BPBA 3U9TA 1NMSA 3T4PA 4MV8A 1XL0A 5AKXA 2BGUA 2EWMA 1ZOSA 2C3PA 2AB0A 4LFAB 4FYKA 4O7RA 3HXKA 1KS2A 2IXFA 4BVEA 1AV6A 4Q47A 1G64A 5D85A 1LVGA 2X1VA 3GFFA 3IQZA 3ZKWB 1HE8B 1ZN9A 3C3AA 5CVVA 1XDSA 3I2IA 3OUUA 2WIKA 1SOWA 3PE3A 3OTIA 4LYDA 2UYOA 1Z3IX 2IBMA 2XKBA 2HHCA 3PNKA 3W34A 2J3DA 4GS5A 2QN6A 4JXJA 2EJTA 5MDHA 2G8LA 2OD2A 3MMSA 5I8PA 3U9LA 2Y4NA 1W1WA 1S10A 4PO8A 5PGMA 3FFAA 3JD2A 1L6RA 3M9MB 3CVOA 2ZUDA 1PG0A 1YJXA 1S0NA 4UQOA 1N8KA 3QTTA 2IYNA 2B69A 3ZGNA 4WLEA 2JH3A 2FDRA 4JL5A 4S05A 2YWEA 3UVEA 1BQEA 1YU6A 1NXWA 3H3JA 2R87A 2XSZD 4BB6A 3ZY3A 2P67A 2WPDA 1GQSA 2FEMA 1W4BA 2GRUA 4IYJA 2HA6A 1FW6A 3TY9A 4B80A 4ISCA 2WHXA 1RYHA 4F72A 1P0FA 3G8YA 1IONA 1Z13A 1AGPA 3RRNA 3L7CA 1UUFA 5JZMA 4Z9AA 4YCSA 4ER6A 4OHBA 3PNBA 4YRJA 1RC1A 3WGMA 1ZCAA 3WGUA 1E77A 3IXLA 3PQ2A 3KYIB 1JFRA 1VIYA 1E8NA 1BQ3A 3T3MB 2O54A 2YHAA 2OPBA 3D6TB 3GFSA 5E7JA 1CJCA 1GLVA 4JC0A 4HGOA 3Q5EA 3X1JA 4KOEC 2O2JA 2HPZA 4H7DA 2I4MA 4B3RH 4MMZB 4B47A 2O8VA 1USKA 1ECLA 3IIKA 2W6PA 4C6HA 3IDFA 3IOYA 3DNFA 5KEIA 3FYDA 1I5OA 3ORSA 3UIEA 4GNRA 4NBTA 1OH8A 3ZU4A 4OQFA 3P52A 4KQMA 1FVXA 1E1NA 2B25A 1BHQ1 1A9OA 3N0VA 1PL0A 4TV8F 2IHBA 1TW3A 3H2JA 3MBIA 4YYZA 4BNUA 4EA8A 1U94A 4G5HA 2A1IA 3RAXA 4BQRA 4OGFA 1R0RE 4QRHA 4U5XA 1U3UA 4JLJA 3FNBA 1N92A 3SX4A 4RPJA 1V11B 1QLJA 5LMNB 4OUKX 2OK7A 4HDMA 3BGSA 4BX0A 4K0RA 3E2IA 2WU4A 4XKJA 2C2ZA 3KTFA 2N0SA 3NOQA 4RLFA 2UZ0A 3SP1A 3AH8A 7REQA 4QO8A 3HXMA 1B0UA 4MW7A 4RC9A 4I1VA 3NTQA 1VI2A 4PYJA 2VIIA 3SD7A 3HACA 1EB8A 1P6UA 2ONKA 3TR6A 3VPGA 2Y1EA 3BL8A 1VB5A 1CZLA 1KRWA 4PLYA 2FMFA 1M0EA 4Y2XA 5BWCA 4OFBA 1Y6QA 3SEAA 2Q45A 1Q1GA 1YDWA 2I2FA 1I2DA 3HKDB 3DTTA 3AIOA 2MMGA 3TZKA 2OZEA 4M2LA 5A1TA 2XUFA 2XDYA 1L1QA 3V1NA 2O19A 1I3OA 2XUOA 3HTXA 1TA9A 1OXKB 1Q0RA 1CUSA 1A5TA 4DJDC 1FDSA 5LMNH 1G17A 1ZH2A 4OQDA 5F2KA 1Y5LA 1ZQ9A 2GDZA 3MR2A 4E70A 1M7JA 5EUMA 3KSRA 4JQYA 3L04A 4U39A 1FP4A 4OGKA 1Z2AA 4DR1B 2X0IA 1Y6JA 4E6EA 1JQ5A 3SDBA 2RHHA 4KQHA 4RULA 1MD9A 2Z5GA 3REQB 2Z5FA 4RZ3A 2WDZA 1T5BA 3WGOA 1KOLA 3W04A 5EG5A 1M6NA 2HAEA 1HE2A 2QSUA 5L9AA 1HE5A 4TXHA 1U7XA 3WO0A 1YGYA 4GG1A 4JQSA 4GWGA 1L8OA 3P2KA 4F6RA 3QU2A 4FEYA 2IUTA 3BACA 2NG1A 3MJ4A 3C1UA 1AKTA 3FUCA 3FB4A 1Y3HA 4RNMA 1R5OA 4GMFA 4KRYA 4MEJA 5TIIA 4KPYA 2CDRA 3QFCA 3OM9A 1RLUA 4TM5A 3ELBA 1U8EA 2BUCA 2IZZA 1ZRMA 5IJXA 1AUQA 1HI9A 3Q8XB 4YI5A 2V3VA 3IVAA 1VPLA 1J90A 4I1SA 1J70A 5I4CA 3WLMA 1CR4A 1XKLA 1MQ9A 2PS3A 4RUKA 2YICA 4K9QA 5ALKA 3G6KA 2JA6G 2C92A 5IXSA 2VTVA 2Z58A 5IULC 1MJGM 2ASDA 3IEVA 5JR3A 1L4EA 5LC1A 4WZBE 3OZRA 2MSNA 5FPSA 5A5EA 2BFEB 1M83A 2CT8A 1CFJA 1EFRD 1NDUA 5B58C 5DF1A 2IF2A 4YAUA 4LPKA 2V3CC 3HJAA 2O50A 2V7QA 4DQXA 1K7SN 5IYZF 3PQ8A 4C3VA 2PBRA 4XLLA 3WIEA 4CNBA 1WCMA 3AUXA 2W2KA 3PNPA 4JZYA 1GL3A 3P45A 1UINA 4KYTA 1JE1A 4UVDA 4ZT5A 3IAS1 4I9NA 2JI6A 2YCLA 3D6FA 1QBGA 1GZ7A 2RE8A 3U3DA 4XFDA 4RD1A 1XUOA 2H0QA 4IUDS 5EYPB 3COVA 1Z35A 2SKCA 5D3KA 4G5FA 1FNCA 3ZE8A 3E7XA 4Y0AA 2KLHA 2OCXA 5D84A 2WWIA 1GQ2A 2EFEB 2Z83A 1UH5A 4JV1A 1SG9A 3V4PB 4PR3A 3G9XA 1F38A 3LDFA 3S29A 1JKIA 2XH8A 4NHEA 2Z9DA 5IT9W 3EWIA 1BX1A 2LVBA 1SVOA 3U7EB 4UBOA 4EUEA 2RGAA 1UR5A 3NFRA 4X9XA 5FV7A 5HQ3B 1H4VB 2A9OA 4BE4A 3K70D 4QXRA 5JZ9A 2XZLA 1I7LA 1UC8A 1LB1B 5H3LA 2WAAA 3EC2A 5D6OA 3D8BA 2QA5A 1EINA 1OT5A 4KLZA 2AQ8A 3UYYA 2YS6A 2OV6A 3T35A 4COOA 4WXHA 2F90A 2LIPA 4ED8A 4ZARA 5BO5A 5KNBA 2JGDA 4DLXA 1C2YA 3RFFA 2V7QD 3ABOB 3GLUA 5J2UA 4MGYR 4BEJA 2K7ZA 2HJGA 1ZM7A 5EZSA 5KFDA 3ZHXA 4WN9A 4QA9A 5BWXA 4L8FA 3UZUA 1MAHA 4PLCA 2BFMA 4X00A 2YW2A 5KNDD 3SPXA 3SQOA 3RDPA 5ESXA 3TRIA 3LFUA 3RS3A 1J4AA 2P5YA 4CU5A 4TVIA 4HLQB 3BF7A 4MUJA 4RD4A 5JD3A 4UMFA 4O2AA 1M2OB 2EW8A 3TOVA 4ARZA 4ZA2A 3LBHA 3MNFA 2F4VH 1NQVA 2O05A 2AQ4A 4CIAA 3SNOA 5KS8A 1VLMA 4GR5A 1LLCA 2WJWA 4C6RA 4RIEA 2RAUA 1L7PA 1FYWA 1J8MF 5DNEA 4A1OA 2PSEA 3IURA 3EC1A 1ZGZA 3ZHZA 4X71A 1RM4A 7AT1A 2B4AA 1ZD3A 4QVIA 3EOZA 3RVQA 4B74A 5TR9A 2PIAA 4MUYA 1H2BA 1A8UA 3MIIA 1GARA 4G65A 3DEHA 1JS1X 2JK1A 4QQFA 1TWCA 1I2AA 4B6SA 3GR6A 2IZ0A 4E07A 4O6VA 3OP4A 2X8AA 3I9LA 3FVTA 1E4FT 1T1JA 2YWHA 4DIFA 4UUPA 4Y7CA 3R9WA 2JJ2D 5KNBD 1SIOA 1RXIA 2HREA 2WSMA 3KLNA 3PZPA 3IDOA 4YPOA 1RKVA 5L53A 1QFJA 1KO8A 1UDXA 3AM3A 2CLCX 1CJTC 3IPCA 5JAHA 5FEMA 1YVEI 3CUWA 2X7XA 1QG0A 4R6XA 1ZESA 3AEKB 4PGMA 4CEHB 3CA8A 3S4YA 4OVKA 4OFZA 5H82A 3SEFA 2WP0A 1FXUA 4PG4A 1CU1A 3FJYA 2EVWX 1NUHA 1ATZA 1UQUA 2WG0A 2YN2A 2FMTA 1NMYA 3MAAC 5J4KA 1XD2A 2W98A 2ZJYA 2F1KA 5AM4A 3U0BA 4UNIA 1RP1A 5JG7A 5KAPA 4N40A 3QLTA 4MKZA 2W8BA 2D2IA 4AMYA 5BSWA 2HJSA 1NFQA 2ZRNA 2IYYA 1NXQA 3ENVA 1XJ0A 3HADA 1NW4A 1JDBC 1DI0A 2CUKA 4TLBA 4J91A 1X80A 3UGJA 1NONA 1ENOA 1VHTA 4C0WA 4Z1MA 4JGIA 2R1VB 3QWUA 1U2DA 5K0CA 1E9RA 2E4WA 1Q1BA 2J3KA 2VUSA 5AW9A 1JQ3A 1UDBA 3QV2A 3IN5A 1GEGA 3BWVA 4BVAA 1LZKA 1P5JA 3ZDEA 1R4NB 4BMZA 2I55A 1KVSA 1FYDA 4XPZA 4PYMA 4UHBA 2J4FA 4WZBA 1VL8A 4UDYX 2PXHA 4UKDA 2Q1WA 4IRCA 1UM8A 1FS5A 2CXPA 1D4ZA 2X5XA 4IDBA 1TZMA 1TIKA 4WXRA 4MIYA 3EF1A 5CYFA 1N1DA 5IAEA 3UMFA 1G2WA 5BN1A 1P9RA 2VK4A 2C2MA 3S7TA 5BN5A 2AF3C 1B8VA 3M9XA 2QUKA 2W6OA 1ZMXA 4NFLA 1J5PA 3FOFC 4NK5A 2E4VA 3IBYA 2DTDA 1Q3KA 1SKQA 5LU8A 4Q9HA 4GMKA 1N0WA 1ZA1A 2PO5A 5C4MA 2JEZA 2PWZA 1GP2A 3I1JA 5EUBA 1PYGA 5BPFA 1E6MA 4GI5A 4URYR 4WERA 2V7UA 3TM4A 2FQQA 2ZATA 4KQCA 5ISMA 5IC5A 1YRHA 4ENVA 3AW8A 3SOZA 3KETA 1GZUA 3IEXA 3WQHA 1UZLA 4QOIA 2X8LA 4QPJC 2Z9BA 4N49A 4HGYA 6NULA 4UMEA 5CA1F 2YVLA 3RVRA 5T67A 3Q3HA 2A78A 2REXB 3B3AA 4ZVPA 4HADA 3FUXA 2QPAA 4F4UA 3RVJA 5KJ1A 4B87A 1AMNA 4ND4A 3R3VA 1OWPA 4AF7A 3OQPA 1I3NA 3CZPA 1LQTA 2CBGA 4A3MG 3M6WA 1UP7A 5A0FA 4CLEA 1ZAUA 1H2EA 4IGIA 3THXB 2F48A 3HCFA 3UJ6A 5JD4A 5DW3A 1ZC4A 3PLRA 3IO3A 2BFAA 2HR1A 3PJDA 1JRLA 1XN1A 3IKMB 3IAAA 4OGGA 2V7PA 2XZPA 3W5VA 1OB2A 2CFRA 1DAMA 4NOMA 1NN5A 5IJAA 5FPYA 1Q7GA 3OCWA 1X42A 3H4MA 1QIGA 3OPYB 2UZ4A 4GFDA 5B12A 3WDKA 3MWDB 3FZGA 2HMYB 2XRFA 3AFHA 3CB4A 5EZ5A 3DE2X 4JKOA 2DUUA 3K70C 1QV7A 1P1FA 3D3QA 4AJ4A 4PV7A 1J09A 3L84A 1IE3A 4UULA 2ANCA 1NR7A 1CS4C 1V6CA 1ZHQA 1W85B 1YRBA 1Z4IA 3LSTA 1UPUA 2GEJA 2WUGA 3I61A 3V7FA 2J5XA 1XQ6A 3ZXYA 2BL4A 2Y1FA 2QYOA 4W9MC 3MR5A 1NMZA 1RMQA 4NJMB 5C8VA 4O3OA 3HBNA 5BMVF 3VR5H 1N6IA 3L7OA 1PT5A 4GI7A 4F71A 3CINA 1S1MA 1Y1SA 2YWCA 2YMMA 2I7DA 5BPHA 3VU8A 5DOZA 1OLUB 3AINA 2FH5B 4K9DA 4MI9A 3B1YA 3QXSA 1ZLXA 1YJAA 5IT4A 3W6UA 1B14A 4TKMA 2QUBA 2ZRBA 5KOHB 2CLSA 5I8WA 3IKTA 1UZAA 3H5LA 3ACDA 4GMHA 2A5LA 4KHZA 3WLEA 2VT6A 6ADHA 4P9NA 4B3GA 4E2ZA 5THQA 3PI7A 4RK1A 3K73O 1RPTA 1XTPA 5ALOA 3G6XA 3X1XA 2QLBA 2Z43A 1LC0A 4ZVUA 3DMFA 3GLIB 2WTXA 1KBQA 1R0XA 3I2KA 4S1OA 1PFKA 1JHQA 1HDRA 1ZGAA 3EZ2A 1YE8A 1H1LA 4YI3A 4DEVA 2Y92A 1QH1B 3G2LA 2R8ZA 4NMMA 2I8LA 2YC4C 5JUWA 1PFVA 3H5VA 4D4KA 5HKKD 4XQ0A 1GTJ1 1P81A 3C7CB 4ABTA 3HO8A 4A3FG 1QNLA 2AUNA 1HLGA 1IWBB 1GR0A 3FGOA 1E8MA 4MJ3A 3HJNA 5ICGA 1N56A 4HVCA 5K0TA 4F45A 5B55A 3IUPA 5IKXA 1NYRA 2PT9A 4L85A 2EL7A 1JEYA 4GQAA 2M6SA 1FRNA 4LFBH 5CB4F 4MGIR 2ZB4A 3ORQA 3V48A 3R7WA 1LNSA 3IQIX 2AL7A 1UJ5A 2J0UB 1E2FA 4QULA 5DHSA 2EQAA 4EUKA 2PUDA 5KG5A 1NHGA 3UWOA 3ROPA 4IDQA 2B21A 2IEZA 4LVNA 4YXWA 3H75A 3WNDA 3LQRA 3R7BA 1AX9A 2HOQA 3ER9A 4DR3B 3PFFA 1TOAA 4OYLA 5BR7A 5ULLA 5D5PA 3QPVA 1CUIA 3L40A 1XDGA 4NLGA 2FR0A 1QJ4A 2MSKA 2YOGA 5JROA 2ZUSA 2GLUA 3RNLA 5B36A 2R84A 2BSAA 5B30A 4H4DA 1E3SA 3ZNQA 3KALA 3RYFA 3AR7A 3U7JA 1Z37A 1EM6A 3DLAA 5EN4A 1KK1A 2ZDQA 2XGSA 4EYOA 1PZNA 5IH7A 2YIVX 4Q9IA 5JH7F 3TOZA 5ICMA 3H2ZA 2YWGA 3DVAB 4A3GG 3NHSA 2IYZA 2ID9A 1GPAA 5KFOA 2PZKA 5BV7A 4KSYA 1BKDR 2A4MA 4NR0A 4BQOA 3V8BA 1GKIA 4D6XA 4W9RA 3NC4A 5JLAA 3UV6A 5EQFA 5B1HA 3IIEA 4GH5A 2V8BA 1OH6A 5HKBA 5SZKB 1V9LA 5HIIA 2V0CA 1NWCA 1ZJ5A 3AZQA 4P3NA 5LZ5A 2D54A 4DR3H 1NM5A 4LUCA 4HDAA 1DCMA 4CMDA 3AV0B 2ZSKA 2ASEA 4RK4A 3CVVA 1A8SA 1YB6A 4FN4A 4IGKA 4RPCA 1IBSA 3B6MA 1D1PA 2D2FA 4PZ7A 2DOKA 2RC6A 5DCLA 5IXYA 1MHPA 1DJQA 3BRWA 1WCYA 2VAWA 3IOCA 2NU9A 3F97A 4YXWD 3D8RA 4ZMSA 3T1HH 1OILA 4DLYA 2H00A 5K3AA 1VPEA 4YP0A 3B3QA 3LQ4A 4D8YA 2XTNA 3GDHA 3IDZA 1IZ9A 4N8SA 4WGGA 4GLBA 2CNVA 5GZ3A 2CDAA 5F3RA 3FCYA 1JX6A 4F1KA 2O7NA 2RK4A 3F67A 4PO3X 2YQ5A 5FBLB 3UANA 4YQZA 1U2ZA 3IQFA 1RAEA 4TLCA 2H3HA 3KKZA 1W5TA 5IK2A 4PQYA 1NJ1A 1RYEA 4X66B 1U63A 1ZVKA 1BGWA 1D6SA 4E15A 2WMYA 4B17A 4NI5A 1CDDA 1OPXA 1R0LA 1SC1A 3WXBA 2E87A 4QTTB 3UO8B 1Z56C 3RVPA 2XYHA 2C29D 5H0IA 1U2DC 1VI5A 2R6DA 5IW8A 1A2KC 2WJPA 3TM5A 4IYRA 4MVJG 2CVHA 2OHXA 1RABA 3PYLA 4TWAA 5D1OB 1CRWG 1QVAA 2DABA 3MGKA 3PJRA 4RVUA 4RTLA 3KT8A 2ADMA 1VCMA 2IC5A 1W5BA 4JT2A 3PC4A 2ZAGA 4RNCA 2OCYC 1EFPA 1GCOA 3UEOA 3E82A 1K83A 3FWYA 2C5FA 2NLOA 2GVZC 5DQHA 4YRDA 1O95D 4JI0H 2DAAA 1V1MB 2HY7A 4P4LA 1X13A 1F48A 1U02A 1NFFA 1Z82A 4O1HA 5F5LA 3S2ZA 4I2NA 2J9YB 4BCCA 1IUNA 2YCHA 2ZWMA 4GQBA 5TGTA 1KYVA 1ADCA 4IWXA 2F64A 2XOKA 1P2DA 5JD5A 1U2RA 3BTOA 1Q0UA 4JX8A 4KV9A 1TFUA 4D45A 5J1TB 4DIKA 3K09A 4GSYA 5IK2D 3I8SA 4LK3A 1G3MA 4TXJA 5LYJB 2OLEA 4BLUA 5DN9A 5KYUA 5D1HA 1H2ZA 1T4CB 3SDZA 3G23A 2ZWOA 1JB9A 4P3XA 3WLJA 4DNQA 2HHLA 1Y4ZA 2N1MA 2O3QA 3QQ5A 1U8UA 4HDNB 2DBVO 4ID3A 4M1EA 4RZUA 4TMVA 2BMJA 1E62A 4Y2TA 4DF3A 5JAZA 3I23A 3OC0A 1KQ3A 2B1IA 5TX7A 5C8ZA 1VLZA 4MUAA 5E2BA 1GN9A 4TRJA 4WI1A 2GD1O 4L9RA 4H17A 1TMKA 4EGSA 4BBJA 2F59A 4JI7H 2R68A 5IAOA 2HQRA 3A3PA 1UBRS 3QBTA 4EITA 4X95A 5LXTB 1LBTA 2XCAA 2NVWA 3LZ6A 3CX6A 4L8VA 2IT1A 3OSZA 1U9ZA 3AF2A 1CKEA 4Z2AA 5CDHA 3GEEA 2AQIA 3IERA 4DM3A 2R6GA 2ROQA 3FPKA 4CEIB 3OBBA 1II0A 1CYEA 3H9GA 4Q6BA 4W5NA 1J0XO 2R7ZG 1ZM3A 2VPYA 1M6YA 3NPAA 3F8NA 4PANA 4YLEA 3C6MA 4ZALA 3BHMA 5FOXA 1XN4A 2PG3A 2XW6A 3LWBA 3FHJA 2VAPA 4BFZA 3HXPA 1Q7BA 3V1YA 1OIWA 5H3HA 4KDEA 2XOKD 1PGPA 3A1VA 3SXPA 2CHQA 3SVZA 3IILA 3SGIA 4LQ4A 4AVYA 5DHFA 3CWZA 2X41A 3X1YA 4XR9A 3G8CA 2RCNA 3UAOA 4Y30A 1G4UR 1VE1A 4ID9A 3V7UA 4FEEA 2Q50A 1QH8B 1E20A 4BB0A 2XUGA 1GNSA 1TIPA 3UMGA 1UMDB 2YC2C 1J06A 3UFXB 3CB2A 1A77A 1C3XA 2NVUB 1ZUWA 5FP0A 4B85A 2E5LB 4KN5A 1GT91 2ZCJA 4ALKA 1F60A 2FUG1 3REGA 2UU9B 4RVCA 4K9OA 4JI5H 3C7KA 4K6FA 3MCVA 6Q21A 5LIPA 4I3HA 1JLSA 1QF9A 1CQPA 1XRLA 3Q8LA 3NDJA 1PR6A 3GZTB 3E3NA 3AEUB 4CM7A 4EQ6A 2ZUVA 2Q3HA 3WWOA 3R3YA 5EMHA 4EG5A 2VNAA 2VYCA 4AO7A 4J0FA 4DVJA 2QT1A 4LOIA 2B3TA 4M0DA 1KT8A 1T1GA 2Z4TA 5JVDB 4YMSA 3ACBA 1AC5A 4NNOA 4IOKA 2QQGA 3K31A 2ZWIA 1P75A 2P1ZA 2P8SA 4J9KA 5YASA 5KFHA 4KU4A 2G5CA 4RPHA 2P3SA 4H2DA 2XTJA 4Z4IA 3HUFA 5FFNA 4FD3A 2UUAB 3H3FA 3KOOA 4E5PA 4OHKA 4EFDA 2ZYWX 4O4HB 3GDOA 2NUTA 2A30A 2E5LH 2Q7XA 4BNDB 4YRKA 2J67A 1B2LA 1HE3A 1GPUA 4GWKA 3JASA 2W9BB 2UU9H 1PR4A 3GBSA 4RU9A 4WNYA 2HCTA 5LA6B 1SUCA 4MSUA 9ABPA 3SF0A 3WWIA 3RYTC 3PPXA 2QR5A 4D41A 4EAQA 3IR7A 4Q1FA 2ABWA 3FHCB 5DT9A 3RS0A 4ZKDA 3M1AA 2M05A 3D3KA 2AU0A 5DCUA 3HVJA 1SBQA 2QZPA 4O7LA 1AB5A 5THKA 1QZXA 4O0LA 4C20A 4WFQA 1I7QB 3S0JA 1ISPA 3D4IA 4QPPA 5A7GA 3OOEA 1QZTA 1X2BA 4N4AA 1DTWA 3KU1A 2LE0A 2AX4A 3LPMA 2GA9A 3PWKA 1RQXA 1RWPA 4IV8A 5DWVA 2JIZA 2ZIFA 1VE9A 3V6KA 3NU1A 1BHJA 2CCGA 3GG2A 1L4BA 4WOJA 2Y4OA 2K5UA 3OJFA 3FNQA 1FRQA 5DN6D 3MWJA 1GZSA 3PP8A 5KKNB 3ZJTA 5GM1A 4I4TA 5UKDA 3A3KA 4G8DA 1R8SA 1DMRA 5AKHA 1JYFA 1C9MA 2XIGA 2CVFA 5FUWA 1KXZA 4PYLA 1Q6ZA 1ODCA 2BMWA 4BFYA 4EMTA 3BHJA 5C5JA 2WKSA 4QFDA 3IL2A 1K8ZB 1JPVA 3HR4A 4Q3BA 1SU8A 4GLWA 4Z3DA 1C8BA 1YQXA 2IOYA 4DPMA 1HEUA 1DP4A 5J5CA 1NM5C 2Q6TA 1DC8A 2EKLA 4MYDA 3Q15C 4KYIB 2Y3IA 3RYHA 3KBOA 1NC1A 3M2TA 3OKCA 3QFRA 4FTWA 5B53A 4DEXA 5E7QA 2BN4A 1WXWA 3GH3A 1IN7A 3UKOA 4XD7A 2QYSA 4JROA 3NP9A 4RY2A 2P9JA 1DUSA 3EXHB 4ZN6A 3VDMA 1O95C 3SZMA 3Q7IA 1VGRA 2FUEA 1X1EA 1OC4A 3O84A 4WFIA 1DIRA 2BR3A 2WD7B 2PBZA 5DTEA 4CZ2A 3FJ1A 4KLCA 4K86A 5A03A 2ZT6A 3STTA 5BN4A 4IIDA 2A5DA 3KB2A 5ALPA 3CKLA 3ESXA 4K6GA 1SVSA 4ALIA 3GCZA 4C2BA 2EF0A 4HZIA 1DBSA 1JE0A 4IQ8A 1ISFA 1QZZA 4EH1A 2VYNA 2AYYA 2O48X 4HDSA 2E89A 5DRYA 3RTGA 2EZ8A 3M7IA 3A6ZA 3KVOA 1WCV1 2JCGA 4Y7DA 2FWIA 4DA4A 4DIBA 1T9KA 5MGNA 1YDEA 1N2GA 4DKXA 3VISA 1W36B 5ADHA 1KNXA 2FPGA 3DMRA 4MS1B 2FJUA 1I1LA 4KR2A 3RB3A 2PQ2A 2Y99A 2Q8QA 5FUBA 1EFCA 2ZTVA 5CITA 2BI4A 1R88A 4Y2PA 4MVYA 1LJ8A 1NRJB 4KTVE 5KMGB 4GT1A 3LT1A 3DZDA 1DWOA 1V8DA 1YVUA 2R5WA 4DQLA 2AOTA 3P32A 4WZAB 4P38A 3IUMA 3TRHA 1VJRA 4XD7D 1MB2A 4LAFA 4UMDA 1TQ2A 1M5UA 2N47A 4LQLA 4PNEA 4IHKA 3PEWA 4CMJA 3ZNPA 1OI3A 3ZIDA 5C1OA 1YKFA 3PC7A 3OFJA 3C3BA 1GNLA 3ZJUA 2R8OA 1NSTA 1TWFA 1LRLA 3VTAA 1Z28A 1GFIA 4NU8X 3WIDA 1JA1A 2PJDA 3BDAA 1W9MA 3WYNA 2OKCA 3L8ZA 3FDZB 5TDHA 3F0TA 2Q3MA 4ED7A 2ST1A 2NU7A 4L5YA 1BJTA 1V7QA 2QRVB 3KHLA 2ZIAA 5CNJA 2DQSA 3GROA 3DUWA 3ND9A 4LDZA 3K09C 2VXBA 2V3WA 3H8JA 3AESB 1NXTA 1ITZA 4GI3A 1GZ4A 3NTUA 4KSCA 1HQKA 4DYDA 2VYND 4TKVA 4K6MA 4KBFA 3NHLA 3SY8A 3Q3IA 5LOVA 4QE3A 5K09A 1EVKA 1E5XA 3BSFA 3H9CA 1UAGA 2JVIA 1P1BA 4OIFA 2HGWA 3A58B 3NAGA 3UJPA 5LZ9A 2CNQA 1B15A 4FKMA 4YRSA 1ZW1A 1E0JA 4JVLA 2X0EA 3OJ0A 3T7TA 4DABA 3ZVRA 5J58A 4EGJA 3PX7A 3B53X 4L2IB 1KMHA 3ROFA 4WBNB 4JB8A 3IRVA 4D57A 1P1IA 4RUAA 2O2CA 3UICA 4K05A 2HLPA 1F2TA 2B36A 2ALZA 4X63A 2ORED 1E1QD 5FLEX 3RIXA 4ZMBA 3SHVA 5AUQA 3L02A 3RW9A 1CZUA 3AETB 3OX2A 1EFKA 4OLBA 2YHBA 4TN1A 1C4KA 1HKHA 3M1LA 4Q7KA 5IJ0B 1NZJA 1XRPA 2B3DA 4COKA 5AI5A 4PG5A 3L0ZA 5KSYA 4O2LA 1M2EA 4JSYA 3N74A 1Z7YA 1VIVA 1XKXA 5F7ZA 2WFLB 4M1QA 4NKRA 3L18A 4C03A 5E6UB 4W5QA 2PH7A 1KE1A 2XXAA 4BJ6A 1Z7WA 2VTKA 4IXMA 5KNCD 2K6GA 3GRAA 1CB7A 3KYDA 4YBRA 3IQHX 3DE1X 3LBAA 5J59A 4DDWA 4F6LA 4BBZA 1UBOS 1X7HA 1P8JA 3ORRA 1UXHA 1H1DA 2Q5CA 3HJGA 3OHSX 4KXQA 2BMAA 3Q8PB 1UDWA 3QFTA 2FZKA 1WDWB 4IZIA 4NMHA 2QTFA 2RGGA 2CEKA 1KY3A 1HFKA 2G1AA 2PXAA 2Y4RA 3R3JA 1O87A 5BMOA 4ND6A 3LBYA 3A1CA 3CPSA 2OVFA 3HP4A 5F2NA 1WHTB 4QX6A 1JQBA 2MSDB 1JTVA 1U5AA 3DLCA 3V6LA 4YJKA 3B7PA 2JLXA 4AX4A 4FSXA 5FA5A 5JUMA 3SXUA 4EKDA 3P96A 1NAHA 3OWHA 2D59A 4L0QA 1U2PA 1D2AA 2QF7A 2I7TA 1P3DA 4KQGA 2YYZA 5BWBA 3LHSA 4F97A 1VRVA 1ZCZA 4TLLB 1SRRA 1PD0A 3DAHA 4FE3A 3CH7A 4I1YA 3I0NA 2PLWA 2O1EA 3AY7A 4PDBA 1J8VA 4O7SA 2G9ZA 4YRIA 3EQZA 1GKLA 4B5KA 4M9RA 1JHDA 2VUMA 3RWBA 4TMFA 5A5FA 4A3IG 3PXXA 4HGPA 3J7AC 5COBA 3U4QA 3AG6A 4QOSA 3RJZA 4NYEA 5DX0A 5E4TA 4LFAH 3H2HA 3AVXA 1NJGA 2C8VA 5K8IA 3GTLA 2OILA 2PNFA 1THTA 4IR7A 3S70A 2ZUEA 2ADFA 4G0YA 1H2FA 4KPUA 1IMOA 1B0ZA 5AJUA 1H0SA 1F8FA 4JSTA 2BBWA 5L8VA 2Q21A 3SC3A 4BX8A 2EFGA 2C5SA 4AJ9A 3EXG2 2E7ZA 3SF8A 1P19A 3DAPA 5LWHA 3VSDA 1E6UA 3ZGXA 1E4EB 1EZ4A 4QL3A 4KXYA 1L9KA 1HWYA 2DB3A 1VG8A 3IP1A 2J6BA 5BN3A 4PLFA 2WICA 1MH9A 5DT2A 1CEYA 4UNPA 1JHAA 3RS7A 3D7NA 4ZMRA 4YJ2F 4XSHA 5TMDA 4L5CA 2QL6A 2ZIXB 4ACAA 4YJDA 3P9ZA 1L5RA 4FS2A 3PTZA 1JHPA 5DB4A 3E23A 5GJCA 1NLFA 4JXUA 3LC2O 1JH9A 4JASB 3HY4A 1H93A 1UXOA 2WB4A 3TY5A 1XTUA 1Z6ZA 2AN4A 5FXMA 4LY0A 1N25A 4GECA 2I7XA 4KXMA 4FOLA 5HGXA 4UBIA 3N70A 3MB8A 4GF5A 3N8GA 4A91A 4RCZA 4ZGWA 3CUTA 3RIGA 3ZK8A 3JYOA 4OHVA 4C6SA 1LDNA 1VJDA 2VK2A 1ZDMA 4G4JA 3O92A 4AIRA 3ICEA 4N5NA 1J8DA 5FTMA 3NANA 1UJNA 4AMUA 3F9CA 5JNVA 2ZS8A 2HUPA 5MGBA 2YBEA 4D9MA 3P7MA 1VSVA 4AYWA 2I2XB 4KUGA 4O1MA 3A1SA 3HJTA 1BS1A 1LH0A 2G9RA 3CURA 3C7AA 5GJVC 3A9TA 1OWNA 1X94A 1U7WA 2JNWA 3PB3A 1ZD4A 3UOGA 2NUAB 4PCLA 5JIBA 3BZBA 3IMGA 3WAGA 1UWVA 4WOBA 3K9NA 1Z0JA 3A2NA 2ATLA 2JFNA 4BB9A 1DCKA 5KFEA 4JHLA 1AURA 1PI3A 4IR9A 5CFRA 3PQDA 5AW2A 3A26A 5JBQA 5BSRA 3UXYA 4RXTA 3IOMA 4D1YA 2WILA 1GITA 3NW9A 4TLEA 1G291 3O38A 5BVGA 3LG2A 3KJIA 3TLGA 3JVEA 1KL7A 4JH0A 4AP9A 3DWIA 3EYYA 2PD4A 1Q7RA 2EIHA 4X3OA 5J4YA 5C8YA 3ZWBA 1ENYA 4OH7A 2H2FA 4CCWA 1EI9A 3CEHA 1IBMB 2RGXA 3DTVB 3N2GB 4Y9DA 1M34B 2B5OA 4J6FA 4DSZA 1EFRA 1HRKA 5HIJA 2OHGA 5JT1A 3FBWA 3QKRA 3PXDA 3DMGA 3OQOA 1ONOA 2X9QA 1B33N 4KPGA 4DIDA 3G8BA 3A28A 3V8MA 4D9BA 2Q2VA 4G0UA 2YL2A 4DQUA 3U09A 4YJGB 2PDAA 2YQZA 3OFKA 2DR0A 2YYYA 3VZDA 1JDJA 2C2GA 3E6AA 3SC2B 2AR7A 2ZJ4A 1WVMA 1JSLA 3BXGA 2B20A 3HP1A 1TCUA 1WHSA 3I30X 4MARA 3TK1A 1ZA2A 4ECUA 1WP9A 4G0VA 4W99A 1VCOA 3M5DA 2JIBA 3L07A 1E9EA 3QWFA 4RL4A 3BIOA 1W581 2Z6AA 3OJCA 1V9SA 4V2UA 3TLZA 3RC1A 1SKYB 4BP1A 4TLMB 2PMEA 2ASJA 3NVMB 2GWRA 4DR1H 4RELA 3CTPA 1T9GS 1U81A 1QP7A 4KE6A 1RCUA 1DKRA 4Q15A 1AUXA 4JP2A 4G25A 3WHKA 1UPCA 1OFHA 2R8PA 1C3EA 1F1BA 4IVPA 5CH5A 2X8JA 1JDSA 3PICA 4KWTA 4Y2UA 2JA5G 1KEVA 4XJVA 5SYNA 2ISSD 3IE0A 3MK31 3VC7A 4PM4A 4GOKA 3WHLA 4FCVA 4EF5A 2H92A 2BTEA 4BN4A 4Q16A 3NRBA 1QVRA 3BFXA 4MRRA 3OCCA 1X1QA 4GMDA 2GPNA 3VA7A 1Y1VA 3ZWKA 4CLOB 4IVQA 4Z4FA 1M2VA 3WADA 3CKMA 5KNDA 2G0NA 4GKVA 1V6SA 4QWEA 1VPVA 2QRGA 2I4LA 4XUEA 3RB8A 2YWRA 3DD5A 2J6CA 1ZVMA 2VVTA 3VO1A 2NZYA 3PN1A 3GZNA 1T8PA 2J3QA 4B3IA 4PIVA 5KTYA 1VLHA 1TVMA 4HWOA 4RSRA 4YVFA 3PKJA 1KRXA 4U7HA 2P8JA 3TIFA 3D7LA 2WWGA 3CE9A 4LQDA 4OMCA 5M04A 4DZTA 1MPTA 4RB2C 1DX9A 3TB6A 1QFYA 2Y71A 3IEKA 1Z6AA 1EK2A 2I8CA 1FDOA 4JMLA 1PVDA 1SH7A 3RFVA 4JR0A 3T1TA 3IBCA 2J08A 1LDGA 5HRCA 5TQ2B 2DBRA 4BHTA 2OHJA 4J9VA 5JS2A 4PQEA 4CTOA 3H5AA 3KTAB 4QGGA 1MGOA 4O8CA 1U28A 3ER6A 3RBEA 2Y0DA 4ZDKA 4X20A 2GERA 5EMKA 3CW8X 3KJXA 1NG9A 2I6XA 2H4XA 4HRYA 2JJ2A 2ZIWB 3TIXB 3ZXSA 1I3MA 2ZVDA 2RH9B 3HO6A 1XA4A 5CGQB 2IYFA 1MO3A 3PDCA 2Y0PA 4HAIA 5E3IA 2C2YA 1I4EB 5BV2P 3DGFC 4Q45A 1UJBA 1E3WA 4MCHA 1NVVQ 3PW0A 3BMOB 1E2HA 3MZ0A 1BEZA 4MEBA 2CXTA 2QN8A 3DAYA 4EHDA 3W4IA 4P98A 3SE7A 4N47A 1A96A 1I6MA 1QYRA 4G0NA 3PDUA 3DZJA 1A2BA 3UXMA 2Z1MA 2PL5A 4JOQA 2UYCA 4NF2A 3NORA 4HQOA 2QJRA 1P1JA 4DCOA 4QD3A 2IEIA 3QEMA 1I2LA 4MWTA 1E1LA 2H1HA 4PZEA 2QRZA 3KZ1E 2ZKLA 1IOWA 4KAXA 1X7YA 3H4BA 2CXXA 1HPLA 2V55B 3R5FA 1RI4A 5DEOA 4JOSA 2FPRA 3ZBUA 3RGZA 1AB6A 4PX2A 1WRVA 1DINA 1UKYA 5JQGF 4AP5A 1R9GA 3QW2A 2JLRA 2RC5A 5J47A 1O4VA 4GI2A 5FNVB 1OUMA 4NYJQ 2PX3A 3M1IA 4MR9B 1QQ6A 4JA0A 2RK3A 1VL0A 3NYRA 4GBGA 5KFZA 3K1AA 1GSHA 2GZSA 4O4JA 4IW3B 1TZJA 2I62A 1K7XB 1F6DA 1ODFA 3HYLA 3FTQA 4FXPA 1C3VA 5T3UA 5JD6A 2PIDA 4S35A 1IHDA 2GAOA 2WJHA 1ZZEA 4R7RA 2YIDA 2VDLB 3JWJA 2R93A 3RC8A 2R6CA 2ZPAA 1FUUA 3HMQA 2O57A 4ZQFA 3I64A 2XBUA 4JLMA 4OU4A 3PKZA 4C4ZA 4HDOB 4J94A 2Y68A 3H99A 4LJ8A 2CHEA 2SBTA 1XMPA 3SLKA 5EUQB 1OY1A 5A02A 3TKLA 5IT5A 1C7RA 4N5LA 3CW9A 4JL6A 4YECA 3TMYA 1G9TA 3MILA 4RV9A 1QORA 3OH8A 4TUYA 5HIMA 5HG0A 2W6JD 4RAOA 1NRWA 3TQFA 2HGSA 1C7ZA 3KUDA 4AJEA 3COYA 1Z5OA 1RXUA 4N0DA 4NZ9A 3FOEC 1BIFA 3VU9A 5NULA 1FFHA 4FZJA 4JN6B 4D42A 2R3SA 1S8NA 2C1ZA 4JDPA 4J2HA 1Z8FA 3BIFA 4LDRA 4I4NA 4RUCA 1B6GA 3GT0A 1EKPA 3OZXA 4KIUA 2IF0A 2PXXA 1MDFA 3HL0A 2R6JA 3ZI7A 4RJKA 3H86A 5LB2A 2DFNA 2QJTA 2YWFA 3PQEA 4RKFA 1ACJA 4O2AF 1LBHA 1FFSA 1VLVA 5CURA 1FQWA 2YDYA 1N8TA 4YASA 5DOVA 2XGOA 3BX1A 1EWRA 3F8TA 4TZKA 4HI0E 4PPGA 1P9OA 1M1UA 1GYPA 2F1OA 5ALLA 4J0DA 3R3UA 3S2GA 4RKYA 1SFOA 2ZSIA 2WWFA 4MRVA 4B4KA 3ND7A 4QDKA 2UUBB 2XQFA 4R2IA 2CUNA 3EVGA 5ELLA 4GW3A 3L5OA 4ERNA 4HXFB 1UMBA 1B4DA 1H4TA 1KVUA 1BJRE 2R4TA 4Q00A 1XCMA 1L7XA 4RDCA 3T95A 3K9FC 3REFA 3BJIC 3TB4A 4HD8A 2AKYA 1YRWA 1FX0B 4W8GA 4L74A 3MFIA 2XZOA 4M99A 3HY6A 4ER3A 2H52A 3B89A 1WMFA 4NONA 5M7EA 5DM0A 2X19A 2JA7A 4PNHA 1KKUA 3DZCA 3OTWA 1D2GA 3EFBA 3P1JA 2JAQA 3N7AA 3QHPA 1WUTA 1FSGA 3A9CA 5DCWA 4YCJA 3KS9A 3TNYA 4IVRA 3NKFA 1GNPA 3A05A 1UKVY 2IHVA 1NW3A 4KGDA 2IKQA 3U55A 1RTTA 4ECAA 1AS3A 3DSRA 5I48A 4Q1AA 1RI5A 5C32A 3L05A 2UUBH 2FKNA 3KHRA 1RPNA 2BDUA 3NUGA 1FY2A 4MRMA 1WQ1R 3OE7A 4LF8B 1PZMA 3L8DA 4CM6A 1BKYA 1CE8A 3KEMA 2PYDA 1PYOA 4HZUB 3ZK7A 1COZA 4FMPA 3R5TA 2WEKA 4IY1A 3FPCA 1WZUA 3EAQA 4CKCB 5L51A 1KZYC 3LGAA 3PJGA 5LQUA 2QT9A 1M5RA 3NEPX 3ILXA 1KZ9A 4ECZA 2HSJA 1GYQA 4ER5A 4FOSA 3ZZNA 3KM0A 5KOYA 2BYTA 3AMVA 3UT5B 4X6YA 1MT0A 2BTQA 2HQ1A 1B43A 4M7RA 4IAJA 2XYQA 1FNMA 4KYUA 3C7TA 3RIHA 3WLAA 5HKKA 1XLWA 4DV5B 3T8YA 1B74A 4FOTA 2W93A 2R8XA 3P9XA 3N86A 3H5WA 3PQFA 3SZOA 2IWHA 4CJXA 2P2ZA 3BQ1A 2LXNA 4LF8H 3ED1A 4YUXA 5JPIA 3AF6A 1P3JA 1UP4A 2AGQA 1LFAA 1ID8A 2VO1A 3WLTA 1GTG1 4W5TA 4RIHA 2I34A 3VZQA 1AXEA 3M9OB 1W73A 4ZODA 1V25A 3UZBA 4AQ7A 5AKYA 3TG2A 1UKZA 5B2ZA 4OKSA 1IK6A 4XW2A 3RHSA 2EJ3A 3JRNA 1JNYA 3NKVA 1EBBA 4EZIA 5EERA 3OE7D 4ED1A 1M2HA 4NS1A 1VL6A 1WL8A 2PWYA 3O8DA 1XTSA 3PVSA 3FRJA 5A2QA 4F4WA 3VUFA 3R7NA 3N2KA 1SQ5A 1XAGA 2MOKA 1QIJA 2MR5A 2OP0A 3KDSE 4IDGA 5AT1A 5IEBA 4KOAA 1O94D 4DCCA 1M66A 2PLNA 3ZWOA 1M76A 3LHKA 4LCEA 2IL1A 1E9FA 2H48A 5HFNA 3N87A 4DV5H 1QIHA 2CNBA 3GV5B 1TQ4A 1ZZGA 2A92A 4PWQA 3FJOA 5CXQA 2W2PA 2Q4BA 3RM3A 2GN9A 2WIJA 4WCVA 1U7PA 1A8HA 2XPCA 4AKSA 1ZMRA 2F1RA 1PJRA 1A72A 3X44A 2WQ7A 1Q0PA 2OGSA 4K2AA 4JLPA 4LYHA 3JRWA 4MCIA 1GWNA 1T3ZA 2D0IA 3DTNA 4QGFA 2BKAA 1Q2UA 1PQUA 1NT2A 2DPGA 1G1MA 4Q9AA 3CU5A 3ZV3A 1US8A 2W37A 2CVOA 1GQQA 2JCXA 2PX8A 3AF5A 4JGGA 4DCGA 5KVCA 1A8IA 1U28C 4B81A 3KWMA 4CM8A 1VTKA 1UEJA 2RKOA 4R69A 5HJ5A 1T6XA 3TL6A 3D7MA 4R1OA 2ODAA 4TSFA 1J49A 4NBVA 4IGEA 2H11A 3QPDA 3HB1A 1S03G 2NUBA 2C7GA 5DV9A 2YVAA 1MU0A 4C3OB 3OJEA 3H8VA 3KLPX 2R1TA 1PCXA 2OMKA 4RSMA 5U4QA 3SBOA 5SY4A 3O8NA 1TB4A 1GPKA 2HSDA 2A0XA 2XMSA 4NCXA 1CT9A 4KWHA 3GP5A 2W0MA 1B1AA 2HU8A 4LNUA 2IOFA 2P4UA 4K88A 3DZIA 2GEVA 5I3ZA 3SHWA 2JA2A 3I4LA 2J7KA 5L3QB 1OROA 2FQYA 2HIGA 2F9LA 3R5JA 4M9CA 3FA2A 2P6RA 4D4HA 1P3Y1 2QRNA 3NTOA 4PNZA 3OT1A 3R6GA 5ALYA 3T0IA 3N42B 3FZYA 4WXYB 3UAXA 2GFIA 3GRUA 3DVLA 3KSMA 5KSWB 1E5TA 4GC6A 1YZ3A 3C8HA 4ZT7A 4R8LA 3L4EA 4N7MA 4U7FA 4AK9A 3KU4A 1ONSA 2E4UA 1QGUB 2VZLA 3AP2A 1L5HB 4LZAA 1JDPA 3AJ9A 1CC1S 5IP5A 2WFZA 2XITA 1U1GA 1EX1A 4EYSA 1FRZA 3UC5A 2IXAA 2HO4A 4MUFA 3EGCA 1ODIA 3QVTA 1PEDA 3EQ2A 3N44B 2OFOA 4TSFD 3QPBA 1JPNA 4OV6B 4M0KA 1SUPA 3IVGA 3PF8A 5KSOA 3Q40A 2Q29A 5BQ3A 1NQXA 2WSLA 3RFXA 1WNFA 3HDJA 3ZCUA 3BMCB 5KFTA 2ONZA 3O9VA 1NP6A 3O1LA 1E3JA 1X7WB 3IYLW 1P29A 4LYGA 4OM8A 5CFOA 4BASA 5H83A 1O95A 1EUCB 4LJ6A 4JBHA 2EYUA 1U3CA 4MTCA 5DNAA 4APMA 1I6KA 1AD2A 3MMXA 4HVAA 1RJGA 3F7TA 3H9QA 2G1KA 1XK7A 3AR4A 4I1PA 1O8CA 1Z8DA 2FW6A 3CUVA 2WFMA 3AQIA 3ZGLA 2PV7A 4I3FA 2Z1DA 1PFQA 2ZRLA 4ZHQA 1VXRA 3G5LA 3BXFA 2KSQA 3FMVA 4ENQA 2YUTA 4MKHA 2QTVB 1M10A 1I51A 4RM3A 5B3LA 1I7NA 3DOJA 2HU7A 2XX3A 1KH3A 5TPWA 2FW7A 5AW5A 1K2VN 3ZHUA 2WW8A 3ZPXA 2ZYVX 3WX0A 1NYQA 1PR2A 3D6NB 1KQPA 3H8SA 5HBGA 1RR6A 1T13A 4LSAA 4BMYA 1EHYA 1ZR2A 3F96A 3EBOA 3GLGB 1RJFA 2SCUB 4UHHA 1G3RA 5AK4A 3E1SA 3GJXB 2QMUA 4UHEA 4L3WA 3WGNA 2Q5HA 3PNLA 1N0HA 5H16A 1TI7A 3BWYA 1G8MA 1U4OA 4I5GA 2CMFA 4JEUA 4QZVA 2I1WA 1WPQA 1L1RA 4Q3NA 1SPBS 3E9ZA 3O4RA 5IM5A 1KYQA 3Q9LA 3AJEA 2E55A 2BPOA 4YPVA 2R1UA 2OMEA 3GYGA 4U2FA 1SKAA 4RIIA 4X66H 4NCIA 3GD7A 2QD4A 3RFTA 2QX4A 3V8PA 4AZSA 1WXGA 3J81A 3B3FA 3PFIA 4KFRA 4FI3F 3QEOA 1L5MA 4IQFA 4PW0A 4H9GA 3ORHA 3H87A 1T0PA 2UVDA 3NEYA 2OOSA 1JR6A 5CYPA 3TNFA 3F90A 4PFJA 3WHIA 2MDTA 2WHEA 1QDLB 5I7FA 4URFA 4Q02A 4X0EA 3OZVA 3QX7A 3ZY2A 1HNNA 3HB7A 4EX7A 4KN6A 2DT5A 3K8YA 4YROA 3DB2A 2O7SA 3BJMA 3U56A 3B8EA 3I4MG 3MCTA 3KB6A 4O7YA 2Z6UA 2A1TS 3BMNB 2APJA 1N7JA 2WYWA 1DQPA 5JAUA 3I4CA 2V4MA 2OLSA 4NG4A 4FBLA 3UAYA 1K9SA 4UC0A 4MUNA 1Z6PA 1IIBA 4BKMA 5DGAA 1N3LA 5D3QA 1JXMA 3P27A 5REQB 2ZKIA 4XVHA 1F2UB 2WWTA 1DXYA 1Z0FA 2WIAA 4IDHA 1WD5A 3VU3A 3ZDBA 4D3ZA 1TCAA 1WE2A 1OFGA 2OCIA 4G1VA 2VRBA 4J7XA 4X1IB 3RUCA 4HEA1 1YDMA 1KPIA 1NKVA 3UUEA 4DAAA 2OCAA 2D1QA 1LD3A 4NZYA 3MJDA 2GAJA 2A3RA 4AZ3B 1O94C 3K4HA 4LDAA 1UOOA 3GPIA 3G17A 2I6QA 4A8JC 5DO9A 4WSOA 4RVHA 4KIJA 1VKZA 1SVNA 4K6CA 1R8XA 5LJIA 2HPVA 4I5EA 1S0MA 5CA0F 3A3OA 4HQLA 2XUPA 3WZLA 2HLDD 3CPJB 5CVDA 4ESEA 1WKVA 4B76A 3MTQA 2DBYA 3KT0A 1ORVA 3I2YX 3EZ9A 3L7DA 2KW5A 4WJLA 1DIBA 1Z15A 3BJEA 5DI3A 4PY2A 5AVZA 1JZTA 2GPJA 2RGEA 3HH8A 1MVLA 3QWBA 4HC4A 4K26A 2I03A 2B8JA 4C4XA 3H3VH 2O8CA 3QQPA 1EVEA 2HA3A 4C30A 4OMFG 5KVVA 2FLNA 1IUOA 3P9NA 5K99A 2E2HA 1ANKA 1HK7A 1SIBE 4BKQA 2P2LA 5BR8B 1NGSA 3EARA 1T6NA 5TVKA 1PKXA 2XQJA 3TBKA 3BILA 3P2IA 5ESWA 1BDBA 3BWEA 5AVOA 3O8QB 1VKNA 1HG0A 3KJNA 1XVIA 1Z4NA 4LISA 3UWMA 5HGJA 1A3CA 5JAPA 1TADA 5KQGA 2ZRKA 1P73A 4BKRA 2TMDA 2B5VA 1RD4A 3K16A 4GOOD 4JB2A 1Y14B 2ZITA 2QSZA 4YJ3F 4ALLA 1QHHA 3W5SA 5E4YA 5DN6A 4H7FA 4MP3A 3EGIA 1EM8B 3MWYW 2XKKA 2P2NA 4EI9A 2PMDA 5K0SA 2H63A 2QV7A 2AE1A 1A5BB 2CJWB 4BQPA 3FHTA 3DS8A 4PSAA 3RTCA 4GE0A 1O57A 4WGFA 1HEYA 5E2AA 1BN6A 2YZ7A 3NWPA 2PSJA 5CE8A 2PSHA 1AKRA 2ZGVA 1ZP6A 4RLSA 2ETXA 2C0QA 2HGZA 4DUZB 4INOA 5C5EA 2ZJ2A 4YRLA 4CM1A 4PFSA 5BR8H 4OAQA 4E3ZA 4QQRA 3U39A 4Z0NA 3LCCA 4OYYA 3H3XA 4R2KA 1M2JA 2GYYA 4PCAA 3PX3A 3TQ1A 1S89A 5K9ZA 3CY6A 1N4DA 2WVHA 3UTCA 1UFQA 2AXNA 1XTQA 2IMWP 1BWRA 1TAUA 4RHEA 1PGJA 3WWZA 4A6PA 4OK6A 4YR2A 1SFRA 4EJ2A 2Z8XA 3ILYA 2GNAA 3HDTA 1GL7A 1I50A 2Z6VA 3P9QA 1NPDA 3HWX1 1XMOB 3HCNA 2Q49A 2FGJA 2RGBA 5A7HA 1CP2A 2UUAH 3C6YA 3VX3A 4FD2A 1ZK3A 3HKZE 1U8ZA 3LXMA 5ICFA 1TO2E 5CXSA 3C5WP 2CNLA 3V80A 3VSBA 1HXHA 3TRFA 4DSUA 1S1CA 3LMKA 2YWJA 2ERYA 1VBNA 2XUIA 4BU1A 4BRSA 4RU1A 2QORA 3WWDA 4DJEC 2UVPA 4CFSA 4FFWA 1JHRA 1B0PA 4GVXA 3LH5A 3COWA 1J99A 4CLRA 3LWNA 4X93A 5F5XA 5KYXB 1Y6ZA 3B2EA 3LBFA 2CNNA 4QBFA 1FMTA 3CVJA 5B7NA 2QAGA 3PHHA 4FR0A 4FUQA 2F43A 3BULA 3FFTA 4IICA 4DCPA 4Q4JB 1A76A 4EZBA 3Q3JB 4IIXA 5FKJA 4KQJA 2JL1A 1KARA 1SRQA 2IWRA 1T9ZA 2JBAA 1T5OA 2LD4A 1EJ2A 4EGFA 2OL4A 4ZCQA 2PX2A 2BHRA 5U9CA 4DA9A 1C9DB 3ASYA 2DG2A 3BB1A 3OIVA 1U2GC 3Q7RA 3LQSA 3NOXA 1NG1A 3BKWA 4TTSA 5JHGB 1W6RA 3KOMA 2L82A 3CIFA 2VWGA 1EVZA 1SZPA 1RXCA 4CMAA 4D9GA 1SXGA 1CF9A 5CYGA 4DMKA 1MZPA 2GK7A 5LDDC 3WQRA 2JJMA 3FMOB 5EL0A 2UYGA 4DJFC 1OI2A 2QBYA 1GO2A 4JUDX 1QPZA 4QQNA 3LUHA 4E46A 1NSFA 1AQ6A 3W5UA 2R66A 4PPYA 2OUKA 3KAQA 2WJYA 3FXAA 3OQVA 4NYIR 3HJRA 1V5WA 4JX9A 3M5CA 3SKVA 3FDSA 2RDIA 2WNIA 2HRRA 1EP2B 2FSHA 4BMVA 1S01A 2ZTUA 3DUFB 4GKKB 2H4YA 4XTRA 1AIPA 4N1AA 2NZVG 5GMOA 3TSOA 2DHCA 1LK5A 4ZZ2A 1C3LA 4EW2A 2COEA 2PBLA 2XQGA 2C07A 1OXSC 4GLXA 1CCWA 3PHIA 4KKVA 3CUUA 2XUJA 4FQ5A 3LK7A 4WH0A 5BP7A 4RXMA 2NO1A 4DMFA 3DD1A 5FUMA 4RD3A 3R2JA 2P3LA 4WECA 1XA0A 5AVUA 4XGRA 4A82A 4C6TA 1N3BA 4R2LA 4P5PA 2WSBA 3QKTA 4X62B 3HCPA 3N8KA 3QVJA 3B1KA 4PBRA 2G7MC 5AW6A 4K03A 1KI9A 2V45A 4W7IA 4LGYA 1VBGA 1LDEA 2R5FA 5A6VA 2DU8A 1T0BA 3MXTA 4ZIRB 1UF9A 4QLOA 2TMYA 2BMDA 5K03A 2Y1KA 4RH3A 1E1QA 4HN4B 2WPNA 5C9ZA 3FZNA 4GKKH 4CIBA 3GK3A 1CIJA 3KZVA 1Q92A 4JV5B 2OGTA 3SSMA 1LNQA 4WTOA 1WUIS 4E5YA 1XTJA 1GKKA 3HABA 3V8NA