2FP4B

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gtp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
393
structure length
393
Chain Sequence
b'MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 131
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fp4B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fp4B02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fp4B03
1JLLA 4ZOLF 3KAKA 1WR2A 2SCUB 4FFOA 3AX6A 4HR7A 4HQ6A 4ME6A 4HNTA 1KJ8A 1AUVA 4HNVA 4O4JF 2FP4A 3JRXA 1EHIA 3AW8A 1GSOA 4MA0A 4O4LF 1KJQA 2CZGA 2VR1A 2YV2A 3ETHA 2DZDA 1PX2A 3VA7A 4O84A 5C8YF 1E4EA 2FPGA 3I12A 2HGSA 5H80A 4FU0A 1M0TA 1IOVA 1CS0A 4O7TA 3HBLA 3WO1A 1DV1A 2WYOA 3ETJA 3K3PA 4MV9A 4FFLA 1JKJA 2QK4A 4XX0B 1DIKA 5C1PA 4DIMA 2ZDHA 1W93A 3E5NA 4YAJB 3N6RA 5CB4F 1KUTA 2YZLA 2CNUA 2W6ZA 4YB8A 2YV1A 2NU7B 2OLSA 4MV6A 2W6NA 5LP6F 2XD4A 3N8DA 5K2MA 5CA0F 5DMXA 3R9RA 1M6VA 1CE8A 2GPWA 3KAJA 1CQJB 5HBRB 1KBLA 1KC7A 2FB9A 4O83A 5HV6A 2NU6A 2GPSA 3R5XA 2VPQA 1OBGA 5BPFA 2V59A 4ZHQF 4EG0A 1DV2A 1Z2NX 4O4HF 3RFCA 1Z2OX 3OUZA 2GQRA 3LWBA 3Q1KA 4Y8VB 2W71A 3RUPA 4FFMA 5JQGF 3TIGA 1BNCA 2PVPA 1B6RA 4MV8A 2W6OA 2Z04A 3G8DA 2NUAB 4YBZB 1CQIA 2DWCA 4HNUA 4ZI7F 4MV3A 4TV9F 4FFNA 2W6PA 3DMYA 2NU8B 2FPPA 5J2UF 1KJIA 2PN1A 5CA1F 5D8DA 3JZFA 3RV3A 2R85A 5JQWA 1JLLB 2NU9B 5LOVF 3BG5A 4YJ3F 4C5BA 1PK8A 2YS6A 5C1OA 4MAMA 1EUDB 4E4TA 3MWEA 1B6SA 2GQSA 5KX5F 2FP4B 2YYAA 4IIJF 4RZQA 1A48A 3Q2OA 2R84A 4WD3A 3MWDB 1IOWA 1UC9A 5FNVF 2R86A 4YAJA 4XZ3B 1VBGA 2YWVA 4IWXA 3U9TA 4O7WA 4YAKB 3ORRA 1KEEA 2NU7A 2R87A 2FPIA 1VBHA 2YW2A 2CQYA 4EGQA 3VOTA 4IHJF 2R7LA 1C30A 1GSHA 1BXRA 3UFXA 3TW6A 3KALA 1JDBB 3SE7A 3NUAA 4WBNF 3GIDA 4I50F 4EGJA 1OI7A 1ULZA 3TIIA 2W70A 4FE2A 5GONF 1UC8A 4O2AF 5BPHA 2R82A 2DLNA 4XYLA 1JDEA 1C3OA 4YB8B 5LA6F 1SCUA 4XYMB 1EUCB 4NYEA 4Y8VA 3DF7A 4O86A 3WO0A 4I4TF 5BMVF 3TINA 1W96A 3ORQA 4MV4A 2NUAA 2J9GA 2SCUA 3R5FA 2W6QA 4YBZA 4ZQIA 2YZMA 2NU6B 4MV7A 4QSHA 1A9XA 2W6MA 5CAEB 1GGOA 2YL2A 4DLKA 1OBDA 4C5AA 2YRXA 2YRWA 3U9SA 2R7MA 2ZDQA 4O7NA 2YZGA 2VQDA 1T36A 2NU9A 4IZOA 4L1KA 4FFPA 3QFFA 5JVDF 4TUYF 2X0SA 2DIKA 1EUDA 3VMMA 2GLTA 4O82A 3WNZA 2R7NA 1CQIB 5J2TF 5KKNB 5IYZF 5LXTF 4O7SA 4O4IF 2I8CA 1VKZA 3MWDA 2R6FA 1EZ1A 3JZIA 2FPPB 4XZ3A 3OUUA 4O2BF 4XX0A 2R7KA 1EYZA 1KJJA 4YAKA 3U55A 1KJ9A 1I7LA 5I47A 3TQTA 3PFFA 2I80A 3LP8A 2PBZA 3R23A 4O7LA 4O7RA 1E4EB 2YZNA 3MWEB 2V5AA 2FPGB 2QF7A 5EZYF 5JVLA 3VPDA 2Z02A 3G8CA 4FFRA 4YJ2F 4FGRA 1CQJA 2HJWA 5HBRA 3KREA 1AUXA 4O81A 2CSUA 3RV4A 3K5IA 1JKJB 1GSAA 1Z2PX 3V4ZA 3U54A 3HB9A 4O7VA 4O7ZA 5LYJF 3HO8A 4XYMA 1GLVA 3JRWA 1EUCA 2FPIB 3R5HA 2YS7A 2P0AA 2XCLA 3GLKA 4IWYA 4MA5A 3VPBA 1M0WA 3UFXB 3K5HA 4TV8F 5JH7F 2ZDGA 4MV1A 2C00A 2I87A 4C5CA 5CAEA 1I7NA 2V58A 3V4SA 2IP4A 4I55F 2CNQA 4M9UA 3VPCA 2CNVA 2NU8A 4XYLB 1SCUB 4O7YA 3MJFA
chains in the Genus database with same CATH superfamily
4UUOA 5LQRA 2ZIXA 3LSTA 3DF9A 4P80A 5FBWB 4KP7A 4D8UA 3DWFA 3F8NA 3KVOA 4MW7A 3MLAA 4D9CA 3BXPA 1HE3A 3HCBA 1PUIA 3GFBA 1KXJA 3EHEA 4ALMA 4K9LA 3CH5A 3UV6A 2BN4A 3UCEA 3TDMA 3GGJA 3QQMA 4GMFA 2Z30A 4POAA 1Z06A 1ADBA 3VTZA 2WAQE 4E12A 1NDQA 2KS6A 1I1QB 2BKAA 1XZ8A 1W29A 4CL0A 1L2TA 4YLGA 1XMJA 4FYWA 5B4TA 4UPVA 5AUNB 3L6CA 1N0WA 2I54A 3MMSA 1W36D 4KREA 1QVAA 2WJAA 5DV9A 2GK3A 3KT0A 5AMXA 3ICEA 1KUTA 3GPBA 4Z7OB 4C0WA 4I4NA 3EWNA 1PT5A 1R8XA 4NS1A 1T8PA 3L84A 4NFYA 1U7ZA 1YVRA 3KPVA 2X0NA 3VFDA 2IYPA 2ZQ5A 2BOVA 3PRKE 1E3DA 1A9YA 3BK2A 4LSXA 4ZCPA 5EJ8A 3KXPA 4TWIA 5C7IO 4XGNA 1T6NA 4I5EA 4CU2A 2PPLA 4UOEA 1QO0A 4OQPA 2FYTA 5GJCA 4HNUA 5HILA 5C1DA 3Q8WA 4H0NA 2YWJA 4URVR 5KUTA 4WADA 5HXAA 2A86A 3SYLA 4TTJA 3GPDG 4LVOA 4PZUA 3JZFA 1LLFA 4ACAA 1GUBA 3LUDA 4JS0A 3SXUA 3SGLA 3VOAA 4MIYA 2FPMA 2ODAA 3H5AA 3MWEA 1DP4A 1YULA 2IEYA 1MU0A 4TSFA 5KX5B 4IDFA 3OFKA 4MP3A 4P7GA 1E61A 1LW6E 2NT3A 2QAGC 2AFIB 2WU1A 2XMGA 2O23A 2MSNA 3SIXA 1KERA 5K3FB 3EFEA 1BE0A 3RIYA 3VR4H 1W25A 5L6LB 5GJVC 1U7UA 1ISHA 3MFQA 3PXXA 4PFKA 1OAAA 4GVXA 2QUAA 1UOPA 4HGPA 1KDTA 3CN9A 4MQEB 4MGIR 3C5VA 2P4EA 4YMSA 4P53A 3B8HA 2XVMA 4MQ6A 1X8LA 4ZAVA 2YV5A 2CMHA 5EWMB 2QBYB 3MOGA 4EA6A 4PYLA 4F8EA 5DNUA 4J4HA 3DD1A 4RQTA 4ECVA 1PFKA 3RASA 1VIYA 3OLZA 3ITKA 1R64A 4Q37A 3HLKA 5CXXA 4BO4A 1K6IA 5EIFA 2ZM6B 5IFLA 1X19A 2RHLA 2C2BA 2ORYA 3DV0B 3P4UA 4X93A 3P9YA 2YOGA 4QOIA 2BGMA 3AK4A 4JI6H 1KE1A 1EFRD 1Z4PX 1Y1SA 1OBOA 2VDOB 2EKZA 1KGDA 1VE3A 1TW3A 4RVHA 2I8LA 2P1ZA 3MRSA 1AHHA 2FX2A 2AQIA 3UJ9A 2PQMA 3L7KA 2J3EA 3GT0A 2OXTA 3PFIA 4BMXA 1NUPA 3UGKA 1I7PA 3W2EA 2D3TA 4NJEA 2AW3A 2VSNA 4LOAA 1L5YA 5G0WA 3DYVA 4K46A 3ZDZB 5JSYA 1OFGA 4KXYA 3LT2A 1FIUA 5REQA 3WAKA 4YY3B 3EJWA 4PQRA 3YASA 3EDYA 1ZQ7A 3WYCA 3R5HA 1L1RA 5LJLA 3MT8A 5KFZA 3IEUA 2ROQA 3BPSA 2MDTA 1SKYE 4JOCA 3Q8LA 4DEYA 3OQPA 1NP7A 3NP7A 1H4QA 3BABA 3VPCA 1YBVA 1WZIA 3M1IA 4TTRA 2IS4A 2NV0A 3PNOA 2L17A 1OBCA 5DE3A 4CTNA 4LE1A 1N2CE 4D45A 2IYUA 1RK5A 5KCZA 1RYZA 4N82A 1HQDA 1LPSA 4OKSA 4S1TA 5CVUA 3TJZA 1IWOA 5JATA 1KYYA 1U9YA 2G82A 2A0FA 4HQ0A 4Z9XA 4RHTA 3UMBA 1H3EA 4HWGA 4QHTA 1AKUA 1BKDR 4BN5A 1KP9A 5KFHA 2IZ6A 3ER6A 4B47A 1RRFA 1CJCA 1XVTA 5K8LA 1JQBA 1Z39A 2A3NA 4RE5A 1U6IA 5A4FS 1UWVA 1VKNA 1E1RA 1N34H 5BVGA 2O5EA 1WF3A 2IPLA 2FQXA 2YU9A 2FLPA 3TOXA 4CM4A 1EUYA 1GD1O 2UXCH 3MJVA 1DTSA 1BCRB 3A2LA 4EEZA 2AQHA 5K2MA 1YI1A 1N57A 1XMOB 1N0VC 4GI7A 4O83A 2JLBA 5TMBA 2JAUA 3DV9A 2CNBA 5I6DA 3EG9B 2O2IA 4JEMA 3ETEA 2GXUA 5SY4A 2IXFA 5IT9A 2IEIA 3E9CA 1ZICA 3BA8A 5I3CA 3D7RA 3C6BA 3GLVA 3ZZNA 3SI8A 7MHTA 2WILA 1Q1EA 2RH5A 1EK5A 5F3DA 3PD0A 5J2TA 3ONVA 4U7CA 1WOYA 1NX9A 1UXOA 4TWZA 4AT1A 1DOAA 2ZANA 1EDZA 2CF6A 3UTDA 4CIXA 1UBTS 4WT7A 3GFOA 3KC2A 2C9MA 4YDQA 4URYR 1VCOA 2DERA 4P7FA 3EGXB 2VSOA 4D0NA 2FWPA 3GELA 1AA9A 2ZWOA 3PGVA 1UQUA 3PF8A 4H9GA 1C1DA 3EISA 1LZKA 3THWA 4KXFB 2RI6A 2FPXA 3ZGNA 1Z0AA 2CVOA 4X60A 1NOKA 5M04A 4XWOA 2E4VA 3K9NA 4Q16A 1G66A 1VMIA 4DCVA 4BAGA 3WKCA 4NCAA 2SECE 1PGNA 4PGAA 3GIDA 3WDSA 1XTVA 5DEIA 2PKEA 3A05A 3IKTA 3K94A 3I6MA 1LBIA 2DJIA 2Q0HA 2A57A 4QUJA 2JFNA 1WF6A 4XPZA 4W8GA 2Q9BA 1M2FA 4P22A 1XA4A 2H1FA 4Z0HO 1MTOA 4A5OA 3GGGA 4E7OA 3GJSA 4P4GA 3RUEA 2ZYGA 5J5VA 4YCLA 2R7ZA 3R75A 4KE6A 2NP6A 3LTEA 3PQ3A 1H85A 3WWEA 4BVLA 3DT8A 1P9LA 4R9UC 2NVWA 2D7CA 2E21A 3R3VA 1WMBA 4JVLA 3O31A 4NU6A 4MGHA 4ALIA 4ZEMA 4U2BA 1IYDA 3LF1A 4JC8A 1YJ5A 1QOZA 4FGKA 1T2NA 3JZIA 1TJNA 4X97A 5EMHA 4GI3A 1CNFA 2GA8A 1G5RA 4MLDA 2BELA 1OT3A 3SK0A 2QRJA 3M9XA 5FBLB 2F17A 4RVUA 2BEUB 5ER6A 1LTQA 3VNAA 3KTAA 4C3UA 2FE3A 3OSNA 5A6SB 3K3VA 4Q0YA 4RA6A 4JIGA 5CYGA 1GQ2A 2HEGA 1Y9AA 5KYGA 5FAKA 1Z73A 2P0AA 2A5FA 2PPVA 3JAMA 1G9TA 2JLAA 2VLBA 4FKBA 1G42A 3HKZA 4IJWA 3ROXA 3TQOA 3RVKA 1UXKA 1X1SA 3TYXA 1I6UA 5DNDA 4IO0A 3ODPA 2BKEA 3QX8A 2H0RA 1DX4A 1YFZA 4U7DA 1ISGA 1X9IA 1OI2A 4J1QA 4MEBA 4F06A 2IEZA 3UKDA 1MX1A 4YIHA 3REGA 4DQ0A 4NMXB 4X3PA 4B85A 1X8XA 2GESA 4MR7A 2XTZA 2AK2A 3C6ZA 3PW5A 4JI4B 1EX1A 3PFHA 5H9WA 4ZJPA 3N75A 2WYOA 3FNEA 1MQSA 4EQ6B 2F6RA 1U63A 1IQ0A 4WCFA 4UUBA 3JSLA 1F8UA 2BJVA 5IWCA 5KWJA 2H1OA 4ERNA 2VSXA 3S1AB 3UVEA 2C59A 2X19A 2YV1A 1ZHQA 3GOQA 2CDCA 2D1SA 3UZOA 4TXLA 2GPWA 1YCFA 4M88A 4C7BA 4UBIA 3COYA 3HGTA 4CBVA 5AOVA 1TYAE 3Q1KA 2FEXA 1Y14B 1EFVA 2J7PD 1C0EA 1GCAA 2HMUA 4HRAA 3HTXA 1UFRA 2HL6A 3DE2X 2D0OB 4W1SA 1JIJA 5AHRA 4MW4A 3IP9A 5LD2C 2P9ZA 5K0CA 1FEZA 1P1JA 2ZT5A 3PUVA 3TY5A 2H3EA 1DDGA 3PUWA 3KUXA 4J16A 3U7QA 3TG2A 1Z8NA 2QHXA 3RIMA 2XC9A 1RJWA 5CLJA 2ZRJA 1R0BA 1QHGA 4DQLA 1BE8A 2OESA 4KWCA 4RIEA 1GHTA 2V3WA 1L5RA 1ZXLA 5C5CA 2O4CA 3PLNA 2A9PA 3ETCA 1CKNA 2CQYA 3A6GA 2Z3WA 2GHIA 4ZTBA 1M2OB 4FDTA 4J29A 2P2LA 2EFHB 4OYYA 4M7OA 4AX4A 5E6UA 3GLFB 4JXXA 4WBNF 1GNSA 3F6CA 5BSMA 3QKSA 5DNYB 3FM9A 1B0UA 3JXEA 1E3MA 1IHXA 1QF6A 1CZNA 2JG3A 1TNDA 2ZRMA 3Q7RA 5JLJA 3PFCA 4A7PA 1V4BA 4D96A 4E2ZA 4DILA 3JWPA 3HKDB 5K03A 2G67A 3BXGA 2XGMA 1OYYA 2ZAYA 2QSYA 1EB9A 4QELA 4LI3X 2YRXA 4R71A 1E1CB 1RC8A 3MINA 1G38A 2FPKA 3H5NA 3VNVA 4AY4A 2XMZA 2OBFA 2VLIA 4XOIA 2FZEA 3V1LA 3DL4A 4G84A 4HDNA 3PC3A 4FONA 2HU8A 2HUPA 2Z4TA 2G7ZA 3M34A 3GTKA 5TPZD 4TKUB 4NYMQ 4H0CA 1UBNA 4LE2A 4G63A 2COUA 3K30A 3NOVA 4AL4A 2J5QA 1CHNA 2HDKA 4HH3C 2W2KB 2BFAA 4DDKA 1A9TA 2DXIA 4JI3H 3K4QA 3RC9A 1M1YE 2L18A 5U9CA 4YRCA 4FMDF 1NVAA 4CEJB 3AFOA 4V0KA 2HYIC 5KNDA 2R44A 4CMJA 2QLFA 4AM8A 3OTOH 3I9JA 1GR0A 2L42A 1SVOA 1K0FA 1SELA 1D4ZA 5B2ZA 4FMCF 3HUDA 2F3PA 1AO3A 4A91A 4OLJA 1N2HA 3NWOA 4U3JB 4E88A 3SFVA 3DVAB 4GR4A 2VAWA 3N2NA 1I80A 1YVEI 1T43A 1EKFA 7ADHA 1P74A 1HG1A 5CDHA 3UFBA 5GAJA 4YQYA 3QPBA 5A9RA 3RRMA 2WHRA 3D7NA 3FMVA 4Q66C 5CX1B 4DJ5X 3COSA 1CDDA 3TQCA 5IXJA 2H4WA 2W8BA 2X2PA 3CE6A 2HIHA 4DJFC 1WBBA 5DKFA 2PUWA 2OBBA 5D1OB 4YUWA 4CTOA 4YCNA 1T9DA 2WWRA 1K1SA 1JVBA 3R6TA 4QT0A 4ARZB 3MQFA 3PC8C 4QDOA 1OUMA 4OVKA 4MIKA 3TNDA 4PBRA 2JCXA 1QVWA 3JQAD 1JFFB 1YSCA 4N7JA 4A16A 4BNZA 3WBKA 5CHEA 1Z5WA 3KAQA 2QWXA 3TZ6A 3TQ1A 4FGWA 5FWXA 5IEJA 1USWA 1AXRA 1IBKH 2QZJA 2FMFA 1JFTA 3NBMA 3I9NA 4YPOA 3ZWAA 1NHWA 4GKVA 1E3LA 5LYYA 4OHPA 1WDKA 3KCQA 3WI7A 3LBHA 1VHLA 4DG8A 4J1NA 3F7NA 1E1YA 4YMGA 5CD9A 5KYYB 3VGJA 3HCOA 4BLSA 5F76A 2RGAA 3CIFA 1A5TA 4GD3Q 3EUAA 1RXVA 3SGIA 1KAMA 4OX9Y 1KFKB 3LBNA 3MJDA 2V96A 3K2BA 5F5LA 4YBZB 1Q7BA 2BWJA 3PWZA 2E7ZA 3MS4A 1P1CA 4FFNA 4PX3A 2CFRA 5G02A 4ZI7B 3ISJA 4GX2A 1QTIA 5G3YA 1OROA 4DCMA 2B1JA 3GJ4A 3CZ5A 3WKBA 4HYTA 4I9NA 4LF8B 1EVEA 4E1VA 1SUBA 1E5DA 5BW8A 1CUCA 4RAZA 1XNJA 3L6DA 3AKCA 3SJCA 3PJEA 1DAFA 5JARA 4AB1A 4BWVA 4MUNA 2AYZA 2O48X 2GM4A 1WCIA 3ORSA 1DBVO 3JW8A 4NBNA 1IOZA 4DZZA 2FEOA 4OHOA 5EWGA 1VBGA 1ACLA 4EW3A 3ADBA 5FFMA 2JJ1D 2MHCA 1SR8A 2C8LA 2CEAA 4JI7H 1CZUA 1R9NA 3QE9Y 4RTSA 5KYWA 2XDWA 4H1WA 3VOTA 1U0OC 4TYMA 3MW8A 3G5TA 1XK5A 1KZ7B 3EZ7A 4ER5A 3UT5B 4TZ6A 1SBHA 3JD1A 1A8QA 1QZ3A 4N54A 5JRJA 2AI2A 1Q44A 4KV9A 5AIBA 4EP1A 1II9A 3NM6B 1ZX1A 4Y9UA 2JEYA 3QMVA 1K86A 3TM4A 3I6ZA 3DBOB 1XEAA 3WO0A 2WIKA 2NUAA 4R9RA 1LBTA 1YKGA 2CF5A 4K6MA 2VQEB 1IUKA 3TKLA 4Y0VA 5FKJA 1IPHA 2B4RO 3RT1A 4U4AA 4O2RA 4ECSA 3QVGB 3NDIA 2VPIA 4LE0A 3SCZA 4FBLA 4J7UA 1H1LB 2QUIA 2ZIZA 1THTA 2WD7B 3AIMA 2XRZA 4KFTA 1CR6A 3DOJA 4DCJA 2XODA 3IBFA 4UMVA 3BRCA 3BJYA 4OFXA 2VYCA 1R4NA 4QPNA 1FVFA 4D92A 5KFLA 3OTHA 1KO4A 4ZVTA 5LCXA 5JD3A 3E61A 4IDCA 1PG5A 4D4IA 4N12A 3I42A 2VHZA 1OJLA 2DR2A 3FPLA 2CLEB 3NOQA 4BB5A 1PHPA 4ND5A 1KO8A 1J56A 421PA 5B1IA 1RACA 2X5OA 3UEOA 1NP6A 3VXKA 4FYYA 4WFQA 1IXKA 3MUNA 4LY9A 2BKXA 2YFYA 3MRVA 3OQJA 3VPHA 3JVUA 1Q6YA 2VJNA 1YA8A 2IPXA 3NKVA 4OHYA 2AF3C 3BZUA 1ZVVA 2VN8A 2GUGA 2IIBA 5JJLA 3IAEA 4RA9A 4DBLC 3CW8X 3N6XA 1K98A 4R1QA 4QW8A 4JA0A 8ATCA 4N3GA 3DE1X 1N3BA 3BMXA 2PU7A 4JP5A 2XUKA 1Z83A 3Q2IA 3DEYX 1NN3A 4JB8A 2PIAA 1OYOA 4RSGA 4QO8A 4J2HA 3NI2A 2PWBA 3J80A 1UKCA 4B3CA 2JA6A 3CWCA 3KQHA 2WWWA 1IN8A 1XZAA 2ZKLA 3FZEA 3NH6A 4S1PA 5DISC 3F1LA 1VB3A 1ISSA 3ANYB 4O1MA 1G7TA 4X54A 5HZHA 2C2DA 1RM4A 3MOIA 4J0QA 3WKAA 3HRIA 1ZQ1A 4EYGA 2PRIA 3KOMA 1HV8A 1UPBA 1QCDA 1DIGA 2BZGA 2VOJA 2I34A 3TOZA 4ZQGA 1NVVQ 5E9WA 5CYPA 4EVIA 3T7KA 1EBBA 2WT9A 4B3DA 4XX0B 4U0KA 1ZCJA 3RVBA 1K6MA 4ZAFA 3RU7A 1A76A 3O5AA 1POWA 1B33N 4QPCA 2OEPA 5H59A 1KI7A 2Q6KA 3U44B 3E7WA 1XKTA 2GJ8A 2JJMA 4WXPA 5EFOA 5LP6B 2YFKA 4OQLA 3EQ6A 1UBRS 3I72A 3IAS6 3QPCA 4H77A 2P40A 5DGHA 1PR2A 1I14A 1XFAA 3T7EA 4AO7A 1D07A 1S2LA 3F2IA 1SHJA 1J20A 3LHDA 1CV2A 3P2MA 3RT7A 4PZ6A 1Y6RA 3IILA 5COAA 4D26A 2X9NA 3THSA 3FHOA 5C5IA 4A3GG 5AKHA 4R2WA 4HPXB 2QUBA 1TO2E 2NACA 5KOIA 1A97A 3QHAA 4CV1A 3DQPA 4TV9B 4WK6A 2ZFUA 4YT8A 4MR9B 2K87A 4A0FA 1C7JA 5CPBA 3ANMA 4XAQA 4B79A 3QE3A 2WTBA 5TE9A 3G8AA 2CHQA 3KHRA 1OGJA 3DLPX 3UGQA 1W48A 1BXKA 3HM2A 5FLKA 4WVLA 3R7SA 5L95A 1TTPB 2R1VB 3MWDB 3O7MA 4DPMA 3BQ2A 5H02A 2PZAA 2A5DA 3QJ5A 3TMKA 1ZAYA 4W6ZA 5KYXA 5LDHA 4LXGA 3R41A 5CCXA 3F49S 2VP5A 1IXYA 2NVXA 1V3QE 5I7UA 3T5AA 1UIMA 2EC5A 4M0DA 4WKGA 4B87A 1W36C 5LR6A 1BXGA 4FX2A 3DHWC 1TAGA 5BW6B 4BYMA 1HT3A 4KQMA 1IBLB 3AOEA 3IUEA 4OFWA 3VU1A 4IVNA 4O86A 2Z6QA 2RHRA 5KNBD 2CXUA 3AEQB 4M6WA 3LIPA 2FSPA 2OV1A 4R8LA 4W5RA 1XAIA 4LSAA 3BAFA 3MMZA 5IUKC 4B84A 5IVDA 3VNUA 1CY4A 3P9QA 1Q74A 3DMGA 3M1AA 2GBGA 2DMRA 3U1TA 2XT0A 1JLMA 2XMPA 2C7GA 4BEWA 2ZSFA 3A1VA 2P5UA 3SJ7A 1I5EA 2MWMA 4OL9A 3VV2A 5AVRA 1A5BB 2BR5A 1IB6A 1NQWA 1ONBA 1DX9A 1ZHSA 4D0SA 4R8UA 4W8OA 4JB2A 3ES9A 1J1IA 2FN4A 3OZDA 2QD3A 1K7SN 2AXPA 4JGBA 4FHCA 4YCDA 1VFPA 1EP9A 5D87A 2FK8A 1TJPB 1S3FA 3MPOA 3R20A 4HLCA 4PQYA 3GIWA 1JR3D 2X58A 2AR0A 1EP2B 4C1BA 3KSDO 4QDXA 5D2CA 2RIRA 4EHFA 4AU1A 1GTMA 4ISCA 1QU3A 5GGXA 4QQKA 4HDOB 1T24A 3BGWA 3ZOKA 4MKXA 4HXFB 3O94A 5G3ZA 4JX8A 5IBCA 5LJIA 5K3AA 3VQTA 1GUDA 3L0BA 4KEAA 1C4KA 1FS4A 4NJOA 3OM9A 4PHTA 3T52A 5JROA 1ECCA 3OIWA 3TXYA 1LU9A 3KHKA 3LS2A 4F04A 3HR7A 4D9KA 1FDUA 1FQOA 4E6NA 1DC7A 4L6AA 2AS0A 1PZNA 4C7VA 3SM9A 1AB6A 4NMMA 1U3TA 4BO1A 2JFYA 2OGZA 3NEAA 2H1HA 5TGTA 2F00A 2Q3LA 4QUGA 5LXTA 3LECA 3Q0EA 3FPGA 5TEVA 4CV2A 5AXBA 3P5BA 1EFLA 2YCHA 4ZO7A 1CJBA 2RCYA 3FMIA 1KA9H 2C57A 3PIIA 3M33A 4C3OB 1MVOA 4YMUA 1KNXA 2Q6TA 4ZCSA 1FRNA 5KFNA 1V2HE 2OECA 3K70B 4DA4A 4OA8A 2DT8A 1T91A 2OXEA 1Z0DA 3EXAA 4W9MC 2XNDA 3N2GB 2NUTA 1WAMA 4II2A 5JSHA 4UDNA 3BIJA 1MJGA 3W78A 1YK0A 3RGZA 2X8WA 2YH2A 2IFTA 2MSWA 1JPVA 3KHUA 5A5DA 4BKOA 1JHUA 5A3QA 2FCRA 4D9JA 2F59A 3DYIA 4DA0A 1RJ9B 1G20E 1M34E 5CDUA 1DWQA 1T35A 1GT6A 3I28A 3HPQA 4F8YA 4GU5A 1E32A 2V59A 2FQWA 4EY4A 2ID9A 2INGX 2QZPA 1UOOA 5KVQA 1QHSA 2NZXA 3LPAA 3F6PA 5JQGF 3U4QA 1BNCA 3FHCB 2P9CA 2Z04A 1EH5A 4QGGA 4PO8A 5KTOA 3QOFA 2BRUC 1F38A 2GXQA 5JSKA 4ZVMA 4JI6B 5HQJA 3AR9A 4D3FA 4UCUA 4LF4H 2FPPA 5F2OA 5AH0A 3A4LA 4C7JA 2H92A 1CC1S 4H7FA 5JQWA 5IZ4A 1L9KA 4ER7A 2ZCVA 3FSEA 4WZBE 1THZA 1SD5A 1OQAA 1U8YA 2EG5A 3ZKWA 3GN2A 2HX1A 2GFQA 3NHRA 3T34A 3B13B 1QS0A 2E82A 3NYQA 4Q6WA 1RLMA 1XTUA 3SEAA 2VTEA 4P4SB 3WB0A 5AM4A 3C7CB 3KT3A 1RP7A 2QRMA 4DYHA 3GCXA 5C5DA 2NU7A 5EWJA 3W9YA 4GYWA 3DOEA 1K8RA 2VWQA 4TKZA 3H9QA 2K5UA 1G63A 2QUHA 2AFVA 2EX1A 2W37A 2ZJ7A 3CTMA 1GGKA 2RGNC 4IDDA 2ID7A 5ALFA 2E5FA 1WB6A 5AW9A 5AW1A 3KQQA 3T5PA 4JLKA 4Z5XA 3EXHC 2D0DA 4OFBA 2XQIA 2YUTA 1CEEA 3OU7A 1RFLA 4BNKA 4G1EB 1SHKA 4FINA 2YNMA 4ZVUA 2IHYA 3ACCA 3BB3A 4MHTA 2CLFB 1US8B 4G4SP 2QTAA 3KUUA 2WHPA 3QV1A 3DAAA 4KBFA 4BV3A 2OSBA 4INJA 1TVMA 2XQKA 4L15A 3RLIA 5TXGA 5AM5A 3TTWA 1NMSA 3C2QA 3O84A 5A3JA 1I3KA 1X7HA 3FI0A 1B3BA 4RXMA 3ZQ4A 3GUZA 1SVLA 4GPEA 3S7ZA 3K05A 3KR9A 4GC9A 5JO0A 1E9CA 3DJYA 2YXNA 3GCWA 2JANA 5K0LA 4H0FA 1GAJA 2J59A 1E2QA 1VZ3A 3WNVA 5ALWA 4LYAA 5K3OA 1VPTA 1N34B 1EYZA 3LFTA 2B35A 2CE2X 3JARA 3W9SA 1LRJA 3UJ7A 4NBKA 2UXCB 1OREA 3QYPA 4FSHA 1TQDA 3OWXA 1GYQA 1Z0ZA 2EIXA 3VH1A 3AUUA 1E4EB 2YZNA 1YBAA 1AF4A 2V3VA 1JJAA 1GZVA 4XI9A 4I1YA 1XHEA 2YHSA 4QC2A 3DHVA 5JBIA 3SHFA 1C4WA 3JQFA 4PG8A 1KSHA 4J1TC 1OF1A 3Q8KA 4HTFA 1PGJA 4JL8A 2XIQA 4KQEA 4BFZA 4BP9A 5COQA 1X1EA 3SZ3A 4S12A 3CGWA 1F8FA 5FBKA 1PJZA 3EIOA 4DL2A 4WI1A 1CUEA 5TPWA 3RUAA 2OBXA 2YICA 4QUHA 2JHCA 5BR4A 1VI6A 2QVYX 2R2AA 1S03G 3Q7QA 4NL4H 4LY3A 3K2QA 1THGA 2DFNA 2H4ZA 3BH6A 4EATA 1KPGA 4OQMA 2WTAA 4KDCA 2OCBA 1IEXA 4Z4CA 3SR0A 3CCFA 4HATA 2XEXA 4UCFA 4L5JA 4FDLA 2TMGA 2PZJA 1GPWB 4ZVNA 3RTDA 1YI0A 4MA0A 1VP3A 5FRDA 5KG5A 1GU1A 3U40A 3NHSA 4RC9A 2ZROA 2D1QA 4EHBA 3W7VA 2X9VA 4UPDA 4YDHB 4EW2A 3W5HA 4TMYA 1EUZA 2FWBA 2QR3A 3H4IA 4FR5A 1AKEA 1JDNA 3C8ZA 2X23A 3L7IA 4QHSA 3WLJA 4YO7A 2OXRA 4M9RA 2XAUA 5KFSA 2WICA 4KDRA 1ABEA 4X41A 3EXIB 3SYNA 3E8SA 4F12A 3NWEA 2D4HA 4WBNA 4NAUA 1Y8QB 5EP4A 1N1GA 1E2GA 1IL0A 4ZV7A 1Z74A 1KI6A 2QIPA 1ANKA 2OV4A 5M34A 1SZJG 5HFAA 1KSGA 1S3SA 3C3YA 5HBRB 1RC0A 4K88A 4MUFA 4XIIA 2PTGA 3P9KA 1QDUA 3REQB 5DYWA 3WA6A 2QTBA 1QGAA 2KWIA 3MLBA 3C7DB 3G8DA 3QMMA 5A0VA 1RE1A 3WJ2A 3RSOA 3N7AA 1EGHA 4TMXA 4C6SA 2X77A 1V11A 2NO7A 4ZVRA 2C97A 1JKXA 2B9VA 3KPJA 3PJRA 1JWLA 2PN1A 5J2UB 2ZTVA 4GL4A 3PBKA 4GG1A 3FNHA 1ZI8A 2COKA 5EFZA 3UK2A 4EEXA 4OXKA 1B6SA 3SX0A 4H3HB 3B53X 4P32A 3IP5A 4J94A 4MRMB 3HGQA 1TUGA 1OKKD 4XVRA 4QYIA 3DHNA 4MQ4A 2I6TA 5DM2A 2RF4A 3MBIA 1L2ZA 3DTVD 2NUBA 5FNVB 1LPBB 3UYYA 3G8YA 2F3UA 4CFYA 1IWPB 2P6MA 5CB4B 1CKEA 4NBLA 1H6CA 3MCWA 3U80A 1XPOA 3GK3A 1DIHA 2JH8A 1WZEA 5ALSA 1FNNA 2EIHA 4ZGGA 4H35A 1L7AA 3AHGA 1MHPA 4IAJA 5BV2P 2JI4A 1MB2A 1Q0QA 3JALA 2YHIB 1X9GA 1UZLA 3MJRA 5E7MA 3UXEA 2IZOA 2PKXA 1M5UA 3D8UA 2Q50A 2IYFA 5JSZA 4TS1A 4KQ2A 3T0GA 2XVZA 4Q9AA 3VZCA 5HIKA 3OM8A 1H2BA 5AKEA 4Q7MB 2Q8NA 1FPMA 5CNIA 5J4YA 4UM8B 5CFOA 5BR7A 3FPAA 2FZ4A 3MR6A 5KQGA 1ZEMA 3K0EA 1KOLA 3OCZA 5JJKA 5IT9W 4GKJH 1CQIB 3BWBA 2XQGA 3MB5A 2YCBA 3MGBA 1GQFA 3A3OA 3RFFA 3N59A 4RELA 3QELB 4ITRC 1NU8A 3ORYA 3K0AB 3F8WA 3LX8A 1C0LA 4MO2A 1TGYA 3ZD8A 5IDQA 1NBMD 1Y1RA 3UMJA 1YL6A 2BV3A 2VEDA 2BDEA 2ZUSA 1TVKA 1EFTA 4KC0A 5JNWA 2Q5FA 4MMXB 1XAGA 4B71A 5AK0A 1QFSA 2YXDA 4L4UA 4YR2A 1Y3DE 1ZUNB 3WYDA 3NH9A 2HRRA 2R8IA 2R9VA 1LDNA 1KY4A 3B8EA 4R7TA 1U9IC 4G1FA 2ZR0A 5KC8A 4B74A 5CJPA 4HQKA 4R2IA 4EA9A 4I9GA 5FOXA 2HWUA 3AQ4A 2ZYIA 4RDHA 4O25A 4WERA 1JLLA 4ZOLF 1SXQA 2FR8C 1GDHA 1C1XA 2RHWA 4KAAA 4NF2A 4PQEA 1OXMA 4BKMA 1TA4A 4J2TA 1ZNXA 2FW9A 4O4JB 5DQIA 4GOLD 3DPUA 1GG9A 5MN6A 1R0RE 1Z18A 3UXMA 3W6PA 5JFGA 3N0WA 1RPZA 4X44A 3L1KA 3M49A 2XNHA 1SCBA 5JD4A 4O84A 2AWOA 4HGQA 4DMUB 1LI7A 3LNCA 4RIFA 1FYDA 5IM4F 4A1FA 1VMEA 2PMEA 2FLNA 3S2GA 4TKVB 2O1WA 4MW6A 3H1FA 3DMDA 1ZRNA 1RT9A 4S24A 3LQYA 1E9DA 3IBTA 4C22A 3PPIA 4U6PA 4INPA 5L7WA 2HXGA 3KZMA 3FSGA 3TLGA 5BWBA 1NL3A 4MNTA 2GARA 4ZYVA 3KRTA 2PEZA 1IEWA 5AM0A 2FSVA 2BMJA 4C05A 2F43B 4FN5A 4EVSA 5HW0A 4KDEA 1WB5A 1HO3A 4G85A 3KOUA 1E4OA 2F9MA 2OHHA 3STUA 1T5DX 2O3RA 4EBFA 2V4MA 3IUJA 4QATA 2UUBH 1MFPA 1XCLA 1RQLA 1S9HA 4LWOA 2QP3A 2LRHA 2QVZX 1RVV1 3L02A 1RJDA 2R93G 3N8KA 2HHFB 1SFOA 3QVUA 2DOKA 3SHWA 3JAMW 1P4SA 4ASUD 1J5EH 3V8EA 1NG1A 1M1YB 4URXR 1K7EB 4RFSA 5GOZA 3HB5X 1R6AA 3A3NA 3AKEA 1SKUA 1VZ2A 4Y1EA 2JAWA 2ZVDA 3TSWA 4UPEA 3IR7A 3FBTA 3TR6A 4LNAA 1XN1A 3PL5A 4JI3B 2FP4B 2D8AA 3FDXA 3SMQA 4R4JA 3A28A 2CNKA 2NAFA 1QRDA 5KT2A 1JR4A 3G0OA 3V5NA 1GRCA 5CFPA 3OTOB 1RRVA 3VRHA 5BWUA 2ZSBA 1D1SA 5HHTA 3DBRA 2ZIGA 2NZWA 2QL5A 3S81A 1F5NA 3H8VA 4BMZA 4S1NA 5KOYA 4B34A 4EBCA 4ZV9A 1X7ZA 4QWWA 3I76A 3NIDB 4LHXA 2V7EA 4JKIA 2IP2A 4WXMA 4YJFA 5IX8A 3GWZA 1D6MA 1H3NA 4CL2A 2JPDA 1ST3A 3RFTA 4LAFA 3SDSA 2GFIA 4JEIA 5KTNA 2IV7A 1QYVA 3RD5A 5KG0A 2HFJA 2AGPA 2OCXA 1E2KA 1JW9B 3A9RA 1M8JA 4MLPA 1YHZA 5I01A 3LMKA 3N2KB 4V0RA 2YMLA 1X1DA 3DLIA 1A8UA 2GEUA 3D5TA 1F2VA 2VWPA 4BNTA 4PNZA 3ZDXB 1MTZA 2PLFA 2X0IA 5IJ0A 3OQNA 5FIUA 1IDN1 2QM7A 3A9CA 2D54A 2OPHA 4RH0A 4I19A 4QXAA 3NBUA 3KOXA 3HP1A 7YASA 3R5JA 4HSEA 1V8DA 4BQRA 2UUOA 4D9MA 2I4LA 3DDCA 4PU0A 2HJHA 5T4EA 4LRYA 2CUNA 3TCXB 4JQZA 4R8SA 1NMZA 4MRPA 1IG3A 4XQ0A 3N8NA 3Q7EA 2FETA 1COWA 3K96A 1Z4OA 2QRZA 2DRIA 5CEFA 4KQIA 3MK31 1IBKB 2X2OA 3AUTA 3ZN2A 5JLAA 4DMRA 3W1EA 3N5CA 1K6XA 2QZ4A 3G88A 4M9XA 5I4CA 1QK5A 1E89A 2VHWA 4WH0A 1KQGA 1W4AA 3SD7A 1NMEA 4MRSA 2G5TA 4BNMA 4KN8A 3EVGA 1LPAB 5DCUA 3VKVA 3T9BA 2FCAA 2ZB8A 1DRVA 4NCXA 1RFGE 1J06A 3DFZA 1AKRA 4IXWA 2GD1O 1YR9A 1L0BA 4P0QB 2J8ZA 1G5HA 1UP7A 2OD2A 3X1JA 3TMAA 2ID8A 1QG0A 4DR2H 3LMLA 2ZWAA 1ILWA 2O5CA 4ZQHA 4BE9A 2SCUB 2VCYA 4O33A 2ATIA 3LX4A 4YRTA 1K63A 3IP3A 2YUIA 1RDFA 2QE7D 3EGEA 3JQPA 4WY5A 3KQLA 1XE3A 1WXQA 1JZTA 5ITSA 5ELXA 4QJIA 2NXNA 1XU7A 4U7FA 5KDLA 4NWIA 1TGVA 4J6EA 4JI7B 5AUPB 1HFWA 4OP3A 5KVVA 1T13A 4OXIA 1QIJA 3FZNA 2FTKE 3A27A 5L53A 2ZCUA 3GD5A 1LDYA 2WWVD 1NJ5A 1U4OA 2VXCA 3N6RA 4WLUA 1KQOA 4R98A 1U2SA 2BP7B 1P5HA 3HU2A 1EVIA 1G8KA 3JD0A 3QX9A 2IH2A 1YV9A 3WWPA 2JIOA 1OT5A 4JP2A 1MJ5A 1JHZA 3KWMA 1MNAA 3O2NA 4IPTA 4LWQA 1PFQA 1MDFA 2QN3A 4S04A 3PZBA 2WABA 4Y8VB 3I3SR 3NT4A 4A23A 3K71B 1FDVA 5AW8A 3FPJA 5CP8A 1RYHA 2R25B 2P3QA 1M10A 1ZLXA 3ASUA 2O8NA 3A6EA 3ORFA 1W5TA 3LPCA 2Y2UA 1CY7A 3BAAA 2W83A 1WCMG 4KQ9A 1QG6A 3UAZA 1Z8HA 3DZGA 4UD6A 2WJPA 4LMYA 1NKTA 1RAFA 3C8UA 4IHAA 4EWLA 1V9PA 4A15A 1KVUA 2WP8J 4UE2A 4QASA 3OA2A 3M9OB 3GRCA 2Y4RA 4B76A 2VS1A 2O5RA 3VYWA 3SY8A 4ILEA 5K4AA 4P3NA 4DIKA 4F0JA 4TN1A 3I39X 3I4LA 3IPLA 3Q5EA 3ZDQA 3VR3A 1IN5A 2R00C 3I01M 4XRRA 3VHQA 4UREA 2QYOA 1FFDA 1XTZA 2JARA 3ZCTA 1SXHA 4JJZA 2PGLA 4GYKA 4J1SA 3BE4A 1I1MA 4A3CG 2ZZNA 1BWRA 3FNIA 4OI4A 3SWWA 4IG9A 2DLNA 3WL3A 4Q8EA 1FFXA 5AXAA 1WMSA 3STTA 2O3UA 2YIDA 1Y1VA 1RWNA 4NV3A 2I4IA 1XDDA 1ORRA 3ZU4A 4EY5A 2CXNA 4FKMA 4RY0A 3O4VA 3BJEA 4M8IA 1EM8B 1ZJJA 5I7HA 4R1TA 3CNOA 3R7WA 2JGDB 2XCSB 5A4MS 2VHVA 3R2JA 4O0LA 1YO6A 2ONCA 4IQ8A 2HSDA 1E5TA 3GNSA 3AV3A 4ND3A 4RADA 1AKYA 3VZPA 2C2KA 1J2RA 2R6GA 3B3JA 2BCEA 1KXZA 4HEHA 2MU1A 2AE1A 2YASA 4Z99A 4EAAA 1Z4IA 2I3DA 3K72B 1SOVA 4R05A 2PRYA 1NUQA 4J9OA 1NX6A 2GKOA 5UKDA 1S2MA 1TA9A 4O63O 1M1UA 1JT9A 2LPMA 3DCJA 4LY6A 3I23A 1Q1BA 2ZOSA 1FSSA 2IY8A 1V1RB 2NW6A 1AZSC 3ICWA 4MS3B 2EKPA 5IYCG 3QK7A 4X1OA 3ND9A 1QSGA 4M99A 2QVCA 5TMEA 4H31A 4ECAA 4KXLA 3UBMA 2R68A 3UY4A 2J87A 3DEHA 4U1RA 4XJXA 1F8XA 2LVBA 3IURA 4IVPA 4QDKA 2QL6A 2AYYA 3EE6A 3ZHQA 4UHBA 3E5HA 1W85B 1ZH8A 4FFDA 1O6GA 5JQGA 4PLPA 5KG3A 5E6RB 3L7BA 3L4EA 4N6NA 4CHTA 4AZ0A 4GNRA 2JIRA 4DARA 2GZ3A 1U0BB 1T29A 1FK8A 4DKXA 5IBRA 2XYVA 3GLIA 1IK6A 1KT8A 1MZVA 3L40A 4BNJA 4IMPA 4LCJA 3BX1A 3WHKA 4CCWA 4NCNA 4EGCB 4B7XA 4DLZA 1ESZA 3HOWG 3O9MA 4RL4A 5ICMA 1NJ6A 3RIHA 1RHKA 2OQRA 4QLAA 1OFTA 3PEEA 1EXNA 1D2NA 1X7WA 3THXA 4QPDA 1YJ8A 1HWYA 4RHXA 2VNHA 4L76A 1GVNB 4PDBA 1OI3A 4YFYA 1FVIA 4MI3A 3HKZE 2CFTA 2ATLA 3C3EA 3C41J 2QRPA 5D6OA 5JEEA 2FMKA 2OZVA 1RQPA 2Z6VA 5GADl 5GIPE 1DQRA 1XKLA 3O4IA 2B7LA 3G13A 1U1GA 3EGDA 1DXHA 3Q3JB 5KYUB 3HRHA 1P0QA 4PXYA 2CVHA 3RYFB 2PUCA 4ZVOA 1B41A 3U9LA 1P2GA 2OO5C 1NJ1A 2IY9A 5A4DA 1K4YA 3L7DA 1TA0A 3LE8A 4XSHA 3M89A 2MYTA 1U0SY 3V1YA 1Z6YA 1EHCA 4UCXA 1UKYA 3I1IA 3EW9A 3C1OA 2C2EA 5BRJA 3TSAA 2JAQA 2O03A 4MR8B 1LRLA 2NU8B 3OPNA 3IPXA 3NIGB 4E13A 3U3MA 3RIGA 5D51S 3UHPA 2XUFA 1TQHA 3AONB 3O4HA 1QBGA 5CNKA 3RJTA 1ZCBA 4UNNA 1VPLA 2HSZA 4LGVA 3ICVA 2O2JA 2HMVA 4EW1A 5MGNA 1HYGA 3J80W 1JU4A 4BQFA 2QRVB 1BH6A 3MIZA 4OHBA 3EC2A 3VO1A 2DQ4A 4M1ZA 1JHVA 3P94A 1JDVA 4N7BA 5FI0B 4H7IA 1OFUX 5AK6A 4QQNA 1JP7A 1F1JA 1VKHA 1PP4A 1VS0A 4IHJF 4MI9A 3UFXA 1GTRA 3F5DA 1GZDA 1KDVA 3ADOA 3VM6A 2XIJA 3FWYA 1YR8A 1NJGA 4QJ3A 2VJOA 2Z8YM 1TKCA 3QGMA 4YB8B 1PGPA 3S2UA 4E6PA 2N0SA 5BMVF 4RWZA 2GHTA 3H11B 2LGJA 1ZGHA 3L6OO 1L8OA 2XNCA 5F35A 4I4LA 2E5LH 3OMWA 2V7VA 3SEQA 2W2LD 2XKAA 1ZBDA 3K2EA 2ON6A 3NHPA 3O2QB 4IX1A 2VQDA 3OZBA 4ZDWA 3TLKA 1SVIA 2QYTA 5AD1A 3N07A 1A69A 2P9HA 4OV6B 5EVCA 4JVOA 1CZKA 5B7GA 1EX6A 4DRYA 1CQPA 1DRJA 5EWEA 1T8YA 4HD8A 4PYIA 2Q6LA 1PLJA 2NUPB 2R7KA 4ZTUB 5AJUA 2C4UA 4KH1A 1EG2A 4N3BA 1S2OA 4PGMA 4ZGWA 1DC5A 2I78A 3R0IA 5I4IA 4EGFA 3VBEA 3RUHA 3I9KA 1VXRA 4IV5A 4UM9D 3LTNC 1X3LA 1U8ZA 3VDNB 3TKYA 4C0BA 3HDGA 3C3JA 1ODCA 1B1AA 4W5HA 3U3DA 2RK3A 1OA1A 2E4UA 5F77A 2ZRQA 1KI8A 2AN9A 5AK5A 2JI8A 1JI3A 1NQVA 2OV6A 5B55A 4G4SO 3ZJUA 1SKMA 3I9LA 4XPIA 3DE3X 1QO7A 2R7AA 3CG0A 2MT9A 5JALA 2QT1A 4X3CA 2Q28A 5KNDH 4I5IA 4X24A 3S2YA 2EQ5A 4OI0A 1E2MA 1N92A 4LF4B 4GAEA 3KEFA 4JXZA 3PU6A 3O4JA 1OXUA 3KAKA 1ODKA 2WMDA 4Z1MA 2B3DA 1FP6A 2Q5JA 4B8WA 1YUNA 3N3AC 1YJQA 3SS9X 2X7XA 1H4SA 1M5RA 1K5HA 4KLRA 2NTYC 4MJ3A 2QN9A 3RG8A 3G79A 5T6BA 3ENKA 5A5EA 3V7WA 4C14A 3B82A 3M6WA 1PZGA 2FRVA 2PTHA 3S2IA 3LCMA 2CDBA 2YWCA 2FSUA 1V5WA 3HR8A 5FHQA 3RHFA 3EIUA 2GERA 3A1WA 5HZMA 3PC6A 4EYEA 3D6NB 2P35A 3V2IA 3R7DA 2HRBA 1F5SA 2DHRA 3SC3A 2XWQA 4LDNA 4FI3C 1AHIA 2WWXA 1JG3A 5JNSA 5HJ5A 1MUUA 1S2GA 2C9ZA 2V9PA 1QQ6A 4D57A 3A25A 4UULA 4DEVA 4P58A 3U4MA 5F9FA 1XAHA 5JMOA 3QY0A 3QOXA 2FWIA 3QWAA 1X8JA 5JS8A 3COWA 1T5IA 4RH3A 3QOWA 4UUQA 3RS0A 1SVUA 2BC9A 4L16A 2ZBEA 3GMIA 3MRTA 2VBGA 2ZJTA 3GTJA 2DVMA 4BNGA 1CK4A 1UL1X 4HV4A 3PC4A 1GRRA 2CXSA 4ZQCB 1ZK3A 1GA4A 2LD4A 5L3QA 3PFBA 3E8MA 5C37A 2QQ0A 1EZ4A 5CT5A 2H1VA 3CKKA 3MSCA 3OG9A 3O9ZA 1KYXA 2ZRHA 3KFVA 3SM3A 4WK4B 4BE7B 3X1KA 4ZT4A 3AM4A 3QKRB 3GR6A 2D59A 4BBAA 5BQPA 2QPOA 4M1MA 3OZUA 4WXEA 4M4SA 4L8VA 2CL0X 1IC6A 2ZIUB 3NZEA 3SF8B 3L1JA 2DWPA 2A92A 2G5GX 2DTXA 1EXVA 3T9DA 2I3AA 3VZQA 4TVBA 5KJ1A 2OFFA 2IVZA 2F9FA 4ZAWA 2EKLA 3FIUA 3HYNA 2QEQA 5EMKA 2VYQA 5CK5A 3RH0A 1ZN8A 4MAAA 4EGJA 4K9NA 5EKDA 5HKOA 4OB8A 1FQKA 2FK7A 2FZKA 3EVBA 3T95A 2H4JA 3OZAA 1HG0A 4KSCA 1WY7A 1RI2A 4IR1A 4FYKA 4X7MA 3K1JA 4N5NA 2W6MA 1POXA 5HF5A 3Q8QB 3ABQB 3I2HA 3UAGA 4KTVE 4YCJA 1VCMA 4FYIA 2PYIA 2JA7G 2O8FA 2MTBA 2NG1A 4ISBA 4F9GA 2HA3A 4N8SA 3VSAA 5JAUA 1QM5A 1A04A 5B53A 1X42A 4D8TA 3K32A 3TRKA 4KXXA 1EI9A 1RU3A 5G53C 5IM4A 1Z2CA 5DT9A 2H11A 4ETWA 3I2KA 1R3DA 1G3QA 4PX2A 2VDQB 5E8JA 4O2BB 4NABA 1R12A 3VJKA 1L4BA 1D5CA 4QU9A 3IEIA 2L2QA 4OK5A 5H8WA 5CTAA 5C7LO 1RVDA 3PXBA 3MVEA 3BXFA 2JLVA 1T0HB 3K0HA 2PV0A 2A4MA 2RH8A 3U1BA 1JDZA 3MTQA 3FOAA 1T2FA 5KFRA 2PKCA 5BNTA 3TQIA 2EW8A 1SQ5A 3FDFA 2WB4A 4Y2GA 4NFSA 1PJCA 4XUGB 1KEKA 3LWDA 1O08A 1U8AA 3NTOA 3FTFA 2ENUA 4QOHA 3SJBA 2H5EA 2ESRA 2XCTB 3FRIA 4CFZA 5IZCC 2DGDA 1R6UA 5FX2A 1IY9A 1SBNE 2A0KA 2C2RA 3OA0A 3ZCQA 5D84A 4GM0A 3AX6A 2RDIA 5KBYA 1E1KA 4FCCA 4AURA 5EPUA 3HZHA 1ORWA 2GD0A 4ECUA 2IIQA 1EJ6A 2H2WA 5GM2A 2QX7A 5JSQA 3SP1A 2JA5A 2X5RA 1T4CB 1WMFA 4F85A 2Y1CA 1PX2A 3CSUA 1NMQA 3QLVA 4ZJYA 5EIHA 3OHPA 2ZZMA 2PSHA 5LL6P 3WO1A 3O2JA 3KQWA 3OAAD 2LW7A 1U8EA 1FRVA 1MW8X 2QK4A 1VHQA 2IPNA 1U3CA 2M6RA 3WB1A 5IK2D 1KAHA 1G5IA 3IAM1 5T8KA 3NW9A 4Y2HA 1Z5PA 1TYZA 3QJYA 4RE6A 1UFOA 1YFLA 4LTMA 4J75A 3CLTD 3TRDA 2NSJA 5AVTA 2FZ5A 4CUKA 4NU0A 2FSIA 3ECCA 2J4DA 3EAGA 3GEDA 2VUTA 1OBGA 1N6PA 1J23A 4MQFB 1LRKA 5CUQA 2PQ2A 5CW2A 1KORA 4G3IA 4IP0A 1TLTA 4NSNA 1Z5UA 4CM3A 3VSEA 2VJMB 4YMTA 2ZR9A 4H60A 3UYKA 1T10A 3AI7A 1N2GA 1X7DA 2B36A 2A0WA 3GFGA 5F3WB 1J8DA 4YMIA 1O6BA 4GKJB 4DLRA 3IODA 4BY7G 1VLLA 1LF0A 4QARA 4Q00A 3L0PA 5TDHA 3E6AA 3NOOA 2DPHA 3D3KA 3QFTA 4KR7A 4MP8A 4I8IA 3LXMA 5DI3A 1WD5A 3RYHA 2FPOA 2XUQA 3E1GA 3D2AA 3LRPA 3MD0A 4DV6H 2XJ9A 5IF9A 3PXAA 1CTQA 2BH9A 1M72A 4FFBA 3TDNA 5DU2A 2J6HA 4DCNA 5ALIA 3LT4A 5A0TA 4BFVA 1PWZA 4OXQA 1FPQA 4YAJA 4DR5H 4FZ3A 2CNNA 2VF4X 3O90A 1UBGA 5DVZA 1LNZA 2ISQA 1K9VF 1YRHA 3PFWO 1VBHA 3TZKA 1E9AA 1L7NA 4CKYA 3O0TA 1UBCA 2ZUTA 4RTMA 4QQ8A 4RM3A 2EW2A 2EZ8A 4PCUA 4EKYA 3LZ6A 4N0MA 4CT0A 2DCMA 5AVVA 4KJXA 3R6WA 2H7CA 1K8XB 2XWBF 5LA6B 2VG8A 3KETA 4QW9A 1RPTA 4JODA 4DR3H 2AJTA 3ROPA 2H7YA 2QTZA 1SBYA 1XCBA 4CKWB 1G0NA 2JEJA 3K70D 1IY0A 1UC5B 3SKVA 3GRAA 4EBBA 1XPRA 1UMCB 2QYSA 5BNWA 3PSAA 2O57A 1GPUA 1NBAA 1GXSA 4EX7A 4PSAA 2AXEA 4EHLA 3F74A 3SHVA 4TWJA 3A1FA 5F21A 4DJJA 4FOLA 1X2EA 4DIUA 2YWXA 3ENZA 5A1JA 3LLVA 5JCJA 2OE2A 1XTJA 3D6UA 4JLMA 3N44B 3ZLVA 2FE4A 3TTUA 4Q1VA 2BQ3A 2CJYA 3WYNA 4K9QA 4DKJA 3WQBA 2W2TA 1X13A 3EXG2 2FH5B 3RGWS 3LRTA 1XKQA 2WJGA 1Z8FA 3IT1A 5EZYB 4OQYA 3BMCA 3TFOA 1R66A 5L3SB 2V6BA 5HOEA 4Y67A 4CE6A 1QNFA 3IQDB 1GUAA 2BEWA 5EAIA 1LWNA 2O59A 4U8HA 3B7PA 3B9RA 2OM6A 2TECE 3N8IA 5K01A 2UUBB 3TGLA 1L1QA 1LSUA 4AUKA 4YVFA 4QBGB 5B3KA 5CLHA 4QUEA 2C7VA 1FP2A 2FWJA 2RBGA 2YIJA 2QGZA 5ULLA 1RNLA 1J5EB 3GT3A 2I7DA 2B1IA 4MB2A 3C70A 4A8JA 1RWXA 3C87A 5FP0A 4QRIA 4RESA 1R0WA 2V0NA 1ODSA 2CXTA 1ZNQO 4QULA 3GOHA 2YY6A 1X3SA 1ZK2A 1GNPA 2P2NA 3KKPA 4MGZR 3RB6A 3NKLA 3PR2B 1EXMA 4PSUA 4YAEA 2QMEA 1UP6A 2C4TA 3V4OA 1PRYA 2B8JA 3HMKA 3ZGYA 2SKEA 3AM3A 4H1TA 2R6JA 4O59O 4REOA 3OZFA 3HCNA 3RARA 2PY6A 2VCEA 3SXUB 1EWYA 4E08A 4FS2A 3NHUA 3QY9A 5C8YB 3IQHX 1DARA 2P1RA 1U2GA 3DAYA 1J8VA 1T0JB 1P4JA 4E21A 5INTA 3R8FA 3FX2A 4HWSA 3QYFA 2VIIA 2UXDH 1SKYB 2IT1A 2J45A 4UDYX 3VJMA 1UUFA 4N41A 3OQIA 1P29A 3MJTA 1O2DA 1LC3A 2YZLA 5DQGA 3INTA 1HDCA 3V2UA 1KZGB 3DBHB 5KOHB 5KG6A 2WWHA 2OLSA 1FW6A 5GQSA 2GCPA 1N2CB 3SZGA 5KQRA 1Y3IA 1DKNA 1NT2A 2PO7A 2OYCA 1JEQA 1WXEA 1ZLYA 3QEAZ 1VDMA 4BXOA 4YONB 3L7CA 4U7JA 4C04A 2B8WA 2PJDA 3UA4A 1XZKA 4MKHA 2O7VA 4MKGA 1QWOA 5CNJA 4TTIA 2ZS8A 3RHTA 1AV7A 4IW3B 4UXHA 4EJSA 3RK0A 1AO0A 2HF9A 2PUVA 1C2TA 1S68A 4LQ4A 3GJQA 4A0SA 1ABBA 3PNPA 4TYYA 2RGCA 5AIAA 3IAUA 5DN6A 6PFKA 1Y1PA 2C9BA 4XQEA 5E25A 1J97A 2QVXX 5LOVF 3RSSA 1HXHA 5CM9C 3GQBB 4C5BA 3QM1A 4W1QA 3LM8A 4LYYA 3OLVA 2W93A 1C3LA 1OXKB 4JBGA 3SXJA 3JVEA 4IDGA 1JIUA 4DUYH 1Z35A 5A4IS 4CI0B 2BFDA 2Z5LA 4ETSA 1ZW6A 3PCTA 1LTHR 1NM5A 2BMEA 4I2NA 3Q3VA 5ITZA 2O2EA 5EOVA 2HHCA 3NDJA 4U2FA 1BXRA 4Y2SA 5SYAA 4BV8A 3SE7A 1MF7A 3KZNA 5IAKA 2R8ZA 3RBEA 5REQB 4KK3A 1IVSA 5E7IA 3G5LA 4KYTA 2IOYA 1SCDA 2R6CA 4D6XA 4DR2B 1R8JA 3LUKA 4NH0A 3ZIAD 3O95A 5B37A 2P4HX 2JA2A 2HRDA 2A33A 1A9PA 5HUHA 3AFNA 1RHQA 1VI5A 2N47A 3L9WA 1GYPA 4CR6A 3U60B 3GFPA 2AD5A 4W6QA 4RVGA 1PDVA 4CG3A 2J0SA 4D42A 1T0UA 5KNCA 2A1UA 4YALA 1JNXX 2W0MA 5BWWA 2FZVA 2I2FA 1QH8B 1JG1A 3E0XA 3WSWA 3Q4GA 3R0QA 2CKMA 3PFKA 4V0QA 3L1IA 3JQ9C 3COJA 1QVRA 4Y2TA 2I8CA 4CG0A 2RC6A 2P2GA 1X94A 3V6HA 4NATA 4XLLA 1R6TA 3IS3A 2X6RA 3M6VA 4FUTA 5CW1A 3H9CA 1H2HA 3ZJ5A 4EHJA 1KK1A 3BJIC 3DAGA 1CUBA 2W5UA 4LRWA 3UB2A 2ZIFA 2FHSA 3PO2G 4MUAA 1U5CA 2Z4RA 4YJ2F 4EEKA 1R0YA 4W9NC 5IM5A 2YMMA 2XDYA 4Q3DA 2XUJA 2QM0A 1BDHA 2QTLA 2QD4A 3V8PA 2J6BA 3LV8A 5JV5A 4QUDA 4CM4B 4IJ5A 2KLHA 1NONA 3BSFA 5EHZA 4B6GA 2QN8A 4XR4A 3AUKA 5ELMA 2NV2B 5C9ZA 1YHYA 1GPLA 3EZFA 3P2YA 5F1OA 4XWAA 2Y1DA 2VBIA 3W6NA 1MPTA 4GP6A 4II3A 4EELA 4NOJA 1M2EA 2AEEA 2VXBA 1XEXB 1DDOA 2HU7A 2ZUBA 2VKTA 5IYBG 2QDXA 2CFOA 1LBEA 3L7MA 4OPMA 4R84A 1OJ7A 1IMOA 3A0UA 2ALJA 1CG6A 4Q1BA 5EQFA 1H42A 4PG6A 3H87A 3PPWA 1JS1X 3OIDA 4X91A 2J3JA 3T4XA 3IBSA 2MYNA 2ERXA 4HDSA 4KKVA 5CEJA 5KTKA 4OB7A 5IKOA 4R3NA 3UB4A 4Q3KA 4G25A 3FYTA 3L79A 2Q3MA 4KR0A 1IOVA 4YA6A 3ZZUA 1EPUA 2BM1A 1I30A 2FZGA 4KR6A 5E1MA 5AKIA 3FFTA 1ZN2A 2FVXA 4RZ2A 4OQ4A 2ZLBA 2I76A 4P98A 5KJEA 1C1DB 1PL7A 4D9BA 4O3QA 4Q01A 1WVMA 1ZVMA 2I66A 1R2QA 4X66H 4MS4A 1JQDA 3S1LA 3WGGA 3AEUA 1MH9A 3QEBZ 3MM4A 4HDKA 5CT8A 3R5KA 4HGZA 3LVQE 6YASA 1SMKA 2BMDA 1XCJA 5BMVA 3BIOA 3SZOA 3VR5H 4L73A 2IU4A 5JXJA 1J2JA 3W2GA 2B78A 1I51A 4H6WA 4BO2A 1Y3HA 2F3TA 4P92A 2XB9A 1KJNA 4CM8B 4FUQA 5CGQB 4YYEA 2R1TA 1T26A 3EK2A 4ZPXA 4G5SA 4GMKA 5GP1A 4P0TA 3DE7X 3GAMA 2OMEA 1XQ1A 4MVYA 1M2GA 3ZY5A 4AKIA 2WYIA 4BO5A 2ILTA 2ZB7A 4QM6A 4HLQB 3Q6MA 4WECA 5H81A 3DFKA 2FMTA 5CA1F 2B7BA 2O1XA 4KRXA 5ILOA 4H7HA 3H13A 1VLJA 1Z0FA 1AQUA 3PNMA 3BXHA 3QXJA 1JJ7A 4YPFA 1W9HA 2JH3A 2IXEA 2YDXA 3R6LA 2C78A 3DOHA 4UU0A 1FS6A 1ACMA 3ZY2A 3FJYA 2C3PA 5G4LA 3ZCRA 1WMAA 2H1CA 4EL0A 2AOUA 1KC1A 4E31A 2O8CA 3NG1A 4RM2A 3PDCA 5D1PA 3AFGA 3L06A 1YB7A 1EFKA 2G3YA 3TTTA 5AHKA 3VKWA 4JB0A 1R8YA 1WCV1 3BDVA 1HMPA 4RA6B 4S0XA 3CT4A 4A0QA 4JOSA 3TW0A 3QG5A 4RCZA 2MSCB 1AS0A 4IR7A 1G64A 5ALHA 5DPMA 2HDWA 4XWTA 3R5FA 3GA0A 4E03A 2DPJA 2O2YA 4MB0A 4DZRA 5K99A 1TJYA 2PBLA 5BV1A 3RU2A 3LC7O 3HVHA 1S7GA 3PEVA 3DKPA 4LQDA 5I5TA 4X95A 2HTEA 3CSSA 3HKCA 2IEBA 3HJCA 1V8BA 5CDFA 4A73A 4V1CA 2HI0A 3UJAA 1LXCA 3N76A 5KSZA 2QAIA 5A06A 3MTEA 3PE6A 5K0NA 2NV6A 4G5XA 4XA8A 2IGBA 5DYTA 4A3KG 3UGJA 3OZRA 3NO4A 3H1TA 3FG9A 4MR7B 3GGOA 1FLVA 2Y66A 3M9NB 3ELBA 1WWKA 4FZJA 3BK1A 4AUMA 5ERXA 4C0JA 2C4VA 1ZQ9A 2C8JA 4HEJA 4RKFA 1RAIA 4F60A 4M9SA 1TZBA 2A4KA 1A8IA 3NX4A 2ZSEA 3A58B 1IY2A 3V2HA 3WFJA 1WX1A 3WYGA 2XNKA 3ME5A 3BGDA 4QG7A 3HCRA 2W9CB 3FFBA 5B3LA 4IIBA 1KETA 4TV8F 2FQQA 2QE6A 1UJNA 2ETVA 4V38A 5EYPA 1B1CA 3PDUA 5FL7D 2BM0A 4RIHA 1K7XB 3F6YA 1QR2A 4HJXA 1YQDA 2OAP1 3LWNA 4D02A 3GDEA 3AVQA 2WT8A 4UCQA 4ZAGA 3PT5A 2Y27A 1EFVB 4G2TA 3WSTA 4P7BA 4A4DA 1RMYA 5ALRA 5FWNA 3AIKA 3FKIA 4UAGA 1RJFA 3D6JA 3BGVA 5KFEA 2V1XA 1W75A 3GJTA 3TOCA 1T36B 2QVBA 2FR1A 5IMSA 2WPDA 3HJUA 4AF8A 1B3RA 1J09A 1VIMA 3AHDA 3IAXA 2C4HA 2RGGA 2CY0A 2OCPA 4DQNA 5H80A 4Y6RA 3RTXA 1MB4A 4DVJA 2Z2ZA 3E58A 5CVJA 3AI1A 2V8BA 5BQXA 4X1KA 1WPXA 4BIMA 1XIVA 1GV1A 4XYBA 5ISMA 4JYBA 4ZP1A 1YJXA 4J4TA 3NHAA 4OMFG 1LPMA 1DBQA 2DH5A 3H16A 2BQUA 1MX3A 4YAIA 2AI1A 1U9ZA 4IQGA 3R9RA 2CHFA 3ZWDA 4REMA 3X44A 4K6OA 1AD2A 3NM5A 3A31A 3ESAA 3QKSB 4E2YA 1Z08A 2P9YA 2O14A 3RFXA 1LTKA 2YCLA 3VPAA 1L3CA 4FHFA 2MJLA 2GUWA 2GEDA 3EG5A 4US0R 2JAOA 1JFVA 1Q20A 2YFQA 4O02B 4ANFA 3D1VA 3CNQS 3HWWA 3CVUA 3MINB 4DV4H 3ESQA 2XKJE 1ZGZA 1NXVA 2NO6A 4BB0A 1E1DA 5H70A 3GJYA 4RNDB 1GZ3A 2AHRA 2XITA 3V3TA 2FGKA 5J47A 4HDNB 3U0GA 3OFJA 4JXUA 2IQIA 3OTWA 1GVHA 3HXOA 5LBUA 3HY3A 1KYVA 1RCTE 2QMQA 1AUQA 2D3WA 5A0FA 3VPSA 5EGSA 1I1KA 3DUFA 2C4WA 4N39A 3BSWA 4WNYA 3LCVB 1JFRA 2XCOA 5L9XA 3JSXA 4G36A 2WHQA 1T34A 4D4GA 1CJTC 2UAGA 3O8QA 1XNRH 2R8OA 5JSFA 1XCPA 2HK9A 2QI9C 1GG2A 1NY6A 3UZBA 1I6MA 4GLXA 3KSBC 5H82A 1IAQA 1NIJA 4G09A 3HC7A 1WLSA 2W6CX 3A1UA 2ZJZA 3OC0A 1E2PA 4L2IA 2YJNA 4PHGA 5FEUA 3NATA 3NJRA 3OM1A 1JXOA 4GX5A 2D13A 2V4ZA 1OYVA 1WETA 1P5JA 4OYRA 3CUYA 1OIVA 2ERCA 4ZZIA 4W5QA 5FEMA 3CR7A 3RK4A 5JVDF 3A14A 4LZLA 3GZJA 3EIEA 4XDGA 1EUDA 3VMMA 5AKZA 1V37A 1X9HA 2VT7A 1ECFA 1RLUA 2O1EA 1YVPA 1CULC 3EVFA 3H0GG 3EPJA 4K6NA 1D7AA 2Q8PA 1OIXA 3O6VA 2I3BA 1BD3A 1XZFA 1M83A 3H5LA 5B57C 4F3TA 3LIIA 4EJ2A 2NZVG 5IXSA 4Z7JA 4BO8A 5JPCA 3HWX1 2XCAA 2I80A 2H8KA 1N32H 2H4HA 5J40A 2VZEA 1K88A 2V5AA 1ZMBA 3PNLA 4CLRB 1P1HA 1ORTA 1Q0PA 3OCUA 4RV5A 1FSPA 3AR3A 1CLUA 1QFZA 1IE3A 5EWLA 3UC5A 1L5VA 3H5OA 5LYJF 3GWGA 1T0PA 4BNUA 5FWXB 1E9RA 3NWPA 3O3MB 3ZHBA 1RWOA 1KI1A 1NFRA 4QTZA 2ZRNA 3VPBA 1CJVC 1IJFA 5AKXA 1Y1WA 5J1TB 3AIIA 1TF2A 5U1PA 4ZREA 3D6FA 3V4SA 4OBBA 5L4NA 3OPMA 3K8OE 1JAIA 1UPCA 4OQEA 1JLKA 4RDIA 2AQ4A 2OPBA 3TJMA 1IJBA 3ICQB 2E85A 1E79D 2B1RA 1LLCA 3JQBC 4P4LA 5EQJB 5CH3A 2IYOA 2C5SA 4BU0A 5BRNA 3S3TA 2I65A 1Z4QA 1KQNA 2ZEJA 3G9TA 1O5TA 3VA7A 2JW5A 4O8CA 4CLOA 3W06A 1JHDA 2VTKA 1ZZEA 1XROA 2ZQZA 3GROA 5LP6C 4MWSA 4F21A 3OZVA 5DWVA 2Q4OA 1XO1A 3GEMA 4EW6A 3E9NA 3L07A 1WCIB 2YYZA 5L4LA 2BFOA 1C9NA 5KFXA 4HI0E 4LK3A 3CF0A 3N3BC 5TIIA 4IRDA 4FGSA 1JEDA 1CWUA 3JWGA 4UMEA 5KYWB 2KHZA 2BGKA 3P0JA 1FSZA 1H1TA 5ARDA 1XMIA 1B42A 3KHGA 5D3MA 2PGJA 3QBEA 5LZ7A 4Y6GB 4RF3A 5KQSA 5TQJA 3CRNA 1B0ZA 2UZ4A 2V03A 4KAXA 3AUXA 3WWJA 1Y7IA 3C98A 4PGHA 3R3XA 1M3SA 2JGKA 3KZCA 4FTWA 3E8XA 3QI2A 5I7EA 4NS4A 2NUAB 3DXFA 5KKAA 3I64A 1E2JA 5B1YA 1TT7A 4GW3A 1LBHA 2JFOA 3ZUPA 3S8YA 4NX2A 5IN4A 3IDOA 2YZ7A 4M9CA 1BMFA 5P8WA 1U0HC 2Z4SA 2QX9A 5HJEA 1CU1A 3BUSA 3IERA 3SEFA 1ZU5A 1MO3A 4GGPA 4XUEA 5BVHA 2BFMA 3L43A 3PPYA 4L28A 4JXKA 2C82A 2OCAA 1V3TA 4AKGA 2JCVA 4QTXA 4M0FA 4IWXA 1IG0A 5FA6A 2NO0A 3JAWA 2Y3IA 3ZG6A 2HA7A 4EGQA 3TSYA 3RS2A 3VHRA 2W2NA 2C2MA 3EMKA 1SBIA 3T3IA 4EB8A 1ENZA 4EO7A 1ETUA 2RAPA 2Z43A 2Y1FA 4G4JA 1ULZA 2PG3A 1B15A 3VO9A 5AVZA 5DSZA 2O8DB 4O2AF 3E48A 4MINA 5JDCC 2BJWA 4PPGA 4WKBA 3DV2A 2CVFA 3CLTC 3DF7A 1RWMA 3PP8A 3BKXA 3QEMA 2V9WA 4YT2A 3ONNA 3KKZA 4H08A 1Z4MA 4BLUA 4X8OA 4QDJA 2GF0A 1N48A 3AETB 3MCUA 4OTZA 4C20A 2PKRA 2C5HA 2WJ3A 4BMYA 1SKAA 5JRZA 1MH1A 3TL3A 1GKYA 1K8YB 4FZ5A 1CZOA 1RIIA 2WSBA 2P9TA 1UMDB 3NDBB 1HQCA 4MDHA 3PGA1 4OREX 4F4HA 1Y1TA 2K7ZA 3LX6A 2ZTUA 3G6XA 4BZPA 1SO8A 1EFDN 1R5OA 221PA 1BRTA 3AC0A 5FJJA 3TQHA 5E3IA 3JD3A 5FOUA 4RZRA 1Y48E 3SBOA 3I9OA 4US2R 4ZOBA 4EHAA 3H5TA 3JQGA 5L4SA 4PG5A 3PX2A 1HYBA 3ZYZA 1ML3A 1R4MA 3QE2A 3JRWA 4DIBA 3PWTA 1XN4A 3OO0A 3E22A 3CW9A 4MA5A 3S7TA 4RCYA 4MV1A 5TMDA 2G07A 1R5JA 2P6OA 1J1UA 1E3JA 3OE7D 1QV7A 4TL8A 1VA4A 3HVUA 1TEXA 4NMHA 2HBZA 1VYVA 4F97A 4NAVA 1LJLA 4OM8A 3BWDD 4NHEA 4DV6B 2BFFA 2J9YB 3I9V6 3DKIA 1BH2A 4R5HA 5DM70 2AZMA 2VXYA 2YQ5A 4EJ6A 3B78A 2OK7A 5A03A 3OCVA 4Q34A 4EY7A 1NNI1 3EYAA 3DMTA 1WTCA 3JZAA 2OOKA 3TX2A 2VR1A 2ORED 1B8UA 2WKSA 3FUTA 1BYUA 4DR5B 2C2YA 3DTTA 2DPLA 4KACA 4XYEA 1F3OA 4YCMA 1SZPA 1VXOA 4WTOA 1I50A 3Q8PB 1IONA 5KQMA 4ZQFA 3TZBA 1QIEA 4ACBA 3QW4B 1EA7A 3EXFB 6REQA 2B2CA 4U2DA 1NT4A 2I2AA 2YHAA 5ARCA 4G26A 3SQXA 2EF0A 2HNAA 3PHLA 4M49A 1ZK1A 3SKYA 3ZXUB 1P44A 4ZYYA 2Q1WA 3DONA 1QF9A 3RKSA 4Q4AA 2VF7A 4D4MA 2J33A 3WNDA 3GLIE 3PE3A 2P9BA 4W5JA 5ALZA 1B2LA 1GA1A 5T41A 3L4SO 3IMKA 3VOSA 1E2FA 1EE1A 2NVOA 1CJUC 1AKWA 4DR3B 2HMAA 1X87A 2YHBA 1XUOA 5FR9A 4XWGA 2EQAA 1XR3A 2C83A 1GAEO 5BPFA 4UKDA 5FUQA 3BF7A 4A8HA 3S0JA 3Q0TA 2EKDA 4DUZH 1PQYA 3I30X 5ALUA 4ITUA 4I08A 3EARA 1QIFA 2OILA 5HKKD 3CT6A 2BMFA 3HOXG 1RADA 5JASA 3L0ZA 1KOFA 2L82A 2CBXA 2HCBA 1S2NA 1AQIA 4G07A 2IV3A 1Z75A 4MAFA 1RQNA 1REQB 5FI1B 1E18A 1AU9A 1DQPA 4RK5A 2BAGA 1XELA 1GQSA 1OOEA 4L3WA 3GIMA 2R84A 1G20B 1M34B 2DBRA 3P9NA 2CB9A 3I37X 4YJ2A 2IYEA 3D3EA 3H3XA 4LJ4A 2F1IA 4ZO4A 3FGPA 2NYRA 3PN1A 4MKIA 2JGMA 2QTHA 4M8NE 1TWHA 3WIBA 2YW2A 5JS2A 1CDZA 3A6DA 5JS7A 3QLJA 5BNIA 3W1WA 3RVMA 1YJBA 2E3JA 3HP4A 1CYEA 4U00A 5KAPA 3B3FA 1X7GA 4PC2A 4DLYA 1OHHA 3PC7A 3ZGZA 1E9FA 4F46A 2G04A 1QHFA 1ZNZA 2R47A 4RAOA 3DCYA 1P5ZB 4WZBB 1YQUA 3RUFA 2P9GA 4ZT2A 1CY2A 1QQAA 4KYIB 4QSHA 4LHEA 2HV9A 4JA2A 1RWVA 1SQ0A 3OOJA 3FKSD 2JIDA 3L2OB 2MYUA 3LF2A 1MFZA 1KP3A 3GHYA 2EHDA 3QQPA 2WJJA 3L4KA 4RV4A 3C16C 4URWR 1PR6A 1AKVA 1GRQA 4BS9A 5G0VA 1RXCA 5CVVA 3T38A 2G1UA 1LI5A 1VKZA 5LXTB 3KX2A 4MCJA 2UXDB 2IU0A 3WGZA 1QE5A 3WGOA 4ZCTA 1C9DB 2H16A 3D1LA 4BFCA 4F71A 4CYMA 3D59A 3T3OA 3RRBA 1NC1A 3HFJA 2CHVA 2OVFA 2CXOA 3LD9A 1FY2A 2Z9BA 2FI1A 2EJBA 3JASB 3O4FA 4LECA 2WV7A 1XTKA 4QNMA 2XB2A 3O74A 3H4DA 4KYUA 1XCGB 1YE3A 2NUTB 3IVAA 1JTEA 4WZ6A 4U2CA 3ND7A 3KT8A 2I9PA 1NRWA 3ZH9B 3W1GA 2AGOA 4BFUA 2RBEA 2XRYA 2ZULA 3OU2A 1BFUA 2CC2A 4CMDA 5MN4A 3AERA 2Q5OA 3I62A 5BRAA 2XE4A 4GX0A 1RKUA 1UZMA 5JW6A 4FLFA 5JJCA 1U2TA 4ZU1X 1DJOA 1HH4A 4OJYA 3DOUA 4CKCA 4NARA 1E9SA 1A2BA 1U0GA 4ETMA 1Z0UA 4ZGBA 2LUOA 1FDIA 3CVJA 1T2EA 5EJ9A 3RF2A 2DUWA 1YR7A 4Q44A 3GCGA 3HCFA 1FXSA 1R37A 3H8WA 4DSTA 3VU0A 1QR6A 3NEPX 4DUYB 3WL6A 3ZV7A 3R44A 1NYLA 4R0VA 2ZE7A 4PPYA 1NUUA 4JP3A 5K6TA 2A6PA 1JECA 2EXXA 2HMYB 1DBPA 2ZRIA 5C81A 2UVUA 5D85A 5EKSA 2YZ2A 2BM8A 4CG2A 4JCCA 2QW0X 1TMKA 2QLLA 3C85A 3EMBA 1JTFA 1I2LA 5FUYA 1QRSA 1QS0B 5C1PA 1H0SA 4NDAA 4IIUA 1SRRA 4G65A 4RQAA 2ZB3A 1PNRA 3P2KA 4TOIA 1QH9A 4DUGD 1JB9A 1DADA 2NU7B 2IA5A 5KYVA 4Q1EA 2WE6A 2VRBA 1XF9A 3DT9A 4CKZA 5DULA 3NBYB 2Z57A 5EIXA 2CMGA 5KU1A 2XUDA 1G7RA 4MS1A 3EJ6A 1H69A 1Z2NX 4PCAA 4LJSA 1FTSA 1H4VB 3GHHA 5FPQA 5KHAA 2CVPA 1E6CA 1NI3A 3IAFA 2XPCA 4ZOLA 4TZTA 2VNSA 1NXWA 2AK3A 4ABYA 4TM5A 4MV8A 2DAPA 3KS9A 4ED8A 5C8VA 2W2PA 3UKJA 2JLZA 1YI8A 2ZSIA 3IO5A 3D6TB 1GGEA 4RY2A 1J9EA 3FOFC 3FTEA 2AQKA 2IP1A 1R16A 3GIQA 2EJWA 5IJ9A 5DYGA 5JZMA 2F90A 4AJHA 4PN7A 2Q7OE 4QXQA 5ADHA 4CKEA 3HPRA 3OPQA 4E51A 2ZIVB 4KW7A 1IJEA 3E4DA 1WXHA 1E0DA 4MRAA 5DBFA 4PS1A 2N3ZA 2DWOA 1B8OA 4ZVKA 1CY1A 2I6GA 3FMFA 3JARB 1IXZA 4DZTA 4ARCA 1K7FB 1BWQA 4Q0MA 4MQ5A 2VSYA 3TLMA 5EG5A 4AY5A 1GPKA 3E1KA 3N2YA 4TV8A 1W0CA 1KY2A 4X8LA 1FFGA 4JX9A 5GONF 4MMYB 2C99A 1U90A 5FWYA 1GLNA 3A2NA 1JSZA 4M1WA 2V0CA 1G17A 3AIOA 1V16A 1L7BA 2GN2A 1AGYA 1JHAA 5IEBA 1XD8A 5ALNA 3EZYA 2Y9PB 2C1XA 4HYQA 1JEOA 3EFOB 1J0BA 2ZJAA 3DZIA 1YBFA 4DCOA 1HSZA 4GUAA 2XUPA 2HB6A 2WJIA 2NU9A 5CDTA 2EBUA 3EVCA 2DECA 2ABWA 4IOLA 3QEKA 3KLPX 1W44A 1P3Y1 3LUBA 3UHFA 4NZMA 5EXDA 3GA7A 5BO5A 4ES6A 2Q5IA 1I0LA 1Y98A 4EB6A 1LW7A 1UDXA 2H7XA 4EVRA 5K3DA 3VI3B 3QF4B 2X86A 3NT5A 3W34A 4H4DA 1IPFA 1VBFA 3FNGA 4CF6A 4LZAA 4X66B 5FOSA 1FU8A 5AI4A 5EIWA 5FUXA 4I2VA 4DAOA 1UQRA 5LVAA 2WUVA 1DAAA 4JQSA 4KWEA 1Z22A 1DWOA 1K5GA 3RYTC 4MVCA 5HA5A 4OHCA 5JWOA 1KEEB 3KQTA 1QXSA 1T6ZA 1KI6B 1MIHA 2XXBA 1RQ7A 2H00A 2ZDGA 4BMOB 2M6SA 4BLRA 4ZOQI 1B4DA 3DXZA 4YRPA 2OORA 1Q0UA 3IDSA 1LVGA 3OEED 5BV7A 2CBZA 2PHZA 1SCKA 3AKYA 2IKSA 5DP1A 4DMGA 2P90A 2P75A 1OWLA 5GV8A 2WOJA 4FFWA 4ZQBA 4QREA 3ROFA 2FOXA 4LPSA 4BV9A 2POCA 4JKYA 5FR1A 2DPYA 2PA0A 2WJ6A 3WBFA 3Q3IA 1RI1A 3AW8A 2XVXA 5KFPA 2GILA 4O4LF 1V11B 1YS4A 4EUKA 5CFZA 2GKGA 1OX6A 4QOGA 3TD2A 1SXJA 5CCEA 4UFNA 3IUMA 5K0BA 4XCXA 1DEXA 1UZNA 2IODA 4WLOA 5HCUA 1TIKA 3IL2A 1ND5A 2ZATA 1OZFA 1WVGA 2KYRA 2NGRA 4R6WA 5B7NA 3QUCA 2H07A 1GKKA 4UBLA 4DF3A 1RYBA 2QSUA 4FMDB 2CEKA 2M98A 4TQGA 2NSLA 5EIBD 4IX9A 2CHEA 3Q11A 5CA0F 2PYZA 1P61B 1M5TA 2JLXA 4OY3A 4BL5A 2JAXA 1F2TA 3ZE1B 5EI5A 3OPVA 1CIJA 3V9AA 3E3LA 1Z2OX 3PXEA 3IKMB 3MR3A 3B2NA 3JALB 3VR4D 1I1HA 3KXKA 5JVDA 2QZZA 3VKUA 4Q15A 4F45A 2JZNA 4ENUA 1GM5A 4WEQA 3PEUA 4L4RA 4B5KA 1XD2A 3A70A 1S2DA 3OQHA 2VUHB 4PSCA 2ZIXB 3RE1A 1FDSA 4P82A 3K4PA 4A82A 2H2GA 4B6FA 4BNXA 4H27A 3LHKA 4L3OA 3S2EA 5CM2Z 7ABPA 2REOA 1XPUA 4CIYA 3CEAA 1J99A 1JWAB 2D00A 2BBOA 1EU1A 1C8KA 1MD9A 2BD0A 1P4RA 4MTLA 2O7NA 3ZQKA 1PAUA 3LXRA 4RKYA 4YQZA 1WXWA 1I2BA 2L0XA 3TLZA 4A0RA 4QAQA 5IF3A 2RG1A 4OK3A 3TPCA 3UWOA 4WKCA 2G8LA 4LMAA 5K8UA 4ABTA 3WP1B 1PF7E 4LJ9A 4KODA 3E2MA 2OZLA 5HX7A 1JDEA 1LA2A 1YR6A 4B3RH 3OESA 3HA2A 1UWLA 3WOHA 5T6MA 1G9SA 3K0CA 1X14A 1Z7EA 2CMFA 2VZ0A 3QVWA 4OHWA 4LXUA 4GLOA 3UMFA 3Q88A 1NC3A 4I8DA 3OY2A 1HYQA 2P2CA 1ICEA 2BT4A 3E18A 2WWTA 4B6QA 4WGGA 1OFHA 3DMNA 3F7TA 3PQFA 1BEEA 5JMWA 3MJCA 1OFUA 3DZDA 3WQQA 2JJQA 3H3VH 1RZRA 3L1HA 5AI0A 1KMCA 1QTQA 1QCZA 3AM1A 1R8SA 2GJ9A 4ED6A 3VPXA 2CGEA 3WYBA 3MJ4A 1YDHA 3F4BA 2JFGA 3MWEB 3ABIA 5FB3A 1FDTA 2VYND 1ZJ6A 3ZK7A 1J00A 2ZYAA 5NULA 1UP4A 3R24A 4A8TA 7REQA 3SFZA 1VDZA 1KEWA 4MJ7A