2FP4B

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gtp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 131
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fp4B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fp4B02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fp4B03
5DMXA 4ZI7F 4O7YA 3AW8A 2I8CA 4O7SA 2VPQA 2R7MA 4HNVA 2ZDHA 1PX2A 4MA5A 2NU7A 2C00A 2XCLA 4HNUA 2FPGA 3RV3A 1JDEA 1EUCA 2SCUA 3MJFA 4FFRA 4O82A 5LXTF 4XYMA 4HNTA 2DZDA 1JKJB 4YJ3F 2R82A 1JDBB 3Q2OA 5C1OA 1KEEA 2X0SA 4HR7A 2R7NA 1E4EA 2NUAA 4IHJF 1AUXA 3E5NA 5K2MA 1KJ9A 4XX0A 4XZ3A 5FNVF 2CSUA 4MV6A 3MWEB 2GPSA 3TINA 5CA1F 3DF7A 1C3OA 3BG5A 3UFXA 5LYJF 3OUUA 3DMYA 5J2TF 2YZGA 2CNVA 1B6SA 2NU9B 2YRXA 2W71A 5CAEA 4HQ6A 4YAJB 2V59A 2W6NA 2ZDGA 3ORRA 1A9XA 2GQSA 1EUDB 2PVPA 4XYLA 2W6ZA 2YZMA 1BXRA 3G8DA 1DIKA 3GIDA 3N8DA 4MA0A 1KJ8A 2CNUA 5JQWA 1GSAA 5LOVF 4O4JF 1A48A 2Z04A 2VR1A 1AUVA 4IZOA 4O7VA 3ETJA 2YYAA 2W70A 1CS0A 2YW2A 2YRWA 4IWYA 1OBDA 1SCUB 5D8DA 4TV9F 1KJQA 4L1KA 2FPIB 3VOTA 4FU0A 2V5AA 2FB9A 3KALA 3LP8A 2R7LA 3TQTA 1IOWA 3NUAA 4FGRA 2P0AA 5H80A 3VMMA 4E4TA 4Y8VA 3Q1KA 2HGSA 4O86A 1KBLA 4C5AA 1OI7A 1VBHA 3WO1A 2CQYA 4NYEA 4O7WA 4O4LF 4O7LA 2W6PA 1JLLA 5LA6F 1W96A 1CQJA 3TW6A 4M9UA 4C5BA 4C5CA 2J9GA 4YB8B 4O7ZA 4O2BF 1M0TA 2R6FA 1WR2A 3SE7A 3TIGA 1Z2PX 1CQIB 2YS6A 3U9TA 3MWDB 3N6RA 3JRWA 2WYOA 2R85A 2FP4B 2YWVA 3GLKA 1C30A 1DV2A 5HBRB 2ZDQA 3HO8A 4IWXA 4I55F 1B6RA 4I4TF 2OLSA 2PBZA 4YJ2F 1GLVA 3U9SA 3PFFA 2YV1A 1KJIA 2NU8A 4FFLA 2YS7A 4YAKA 4ME6A 2FPPB 3R5FA 4O83A 4MV4A 4MV7A 2YL2A 2GPWA 4YBZB 5JVLA 2I87A 2R84A 4IIJF 5GONF 4O7TA 2Z02A 4MAMA 3K5HA 2W6OA 4O84A 1KJJA 4ZHQF 5JVDF 2NU7B 5EZYF 1JKJA 4ZQIA 3V4ZA 4EG0A 1IOVA 3KAKA 4FE2A 3RUPA 3R5XA 3HB9A 2SCUB 5CA0F 3R23A 5C1PA 4TV8F 4XYMB 1DV1A 1M6VA 3AX6A 1I7LA 5KKNB 3MWEA 3OUZA 1E4EB 4QSHA 3VA7A 2VQDA 4O7NA 4XX0B 4XZ3B 3VPBA 3LWBA 2IP4A 3UFXB 4WBNF 2HJWA 3TIIA 1GGOA 2NU9A 1KUTA 5C8YF 3U54A 3U55A 1EZ1A 4YBZA 4YAJA 2YZNA 3K5IA 5JH7F 1EUDA 3I12A 3WNZA 1GSHA 3R5HA 5KX5F 3HBLA 2NU6B 2W6MA 1KC7A 5CAEB 1W93A 2YV2A 5IYZF 1GSOA 2XD4A 4FFOA 4XYLB 5LP6F 3VPCA 1T36A 3K3PA 2GQRA 4TUYF 3RV4A 5BPFA 2CZGA 5I47A 1CE8A 1SCUA 2R7KA 3KREA 3JRXA 2W6QA 3RFCA 2FPIA 1UC9A 2DWCA 4O4HF 1ULZA 1EYZA 4DLKA 2PN1A 4EGJA 2CNQA 3ETHA 1UC8A 2V58A 1OBGA 1Z2NX 5HV6A 2R87A 1VBGA 3VPDA 2QK4A 4Y8VB 5BPHA 4I50F 4MV9A 5J2UF 1BNCA 4RZQA 2R86A 4O81A 3WO0A 3G8CA 4YB8A 2NU6A 1EHIA 4O2AF 3KAJA 4MV1A 4EGQA 1M0WA 3R9RA 1JLLB 4FFMA 1CQJB 4MV8A 2FPGB 5BMVF 1EUCB 1I7NA 1PK8A 1CQIA 4O7RA 3MWDA 4O4IF 2FP4A 5HBRA 5JQGF 4DIMA 2NUAB 2YZLA 2DIKA 4MV3A 1VKZA 4WD3A 3JZFA 5CB4F 2I80A 3ORQA 3QFFA 2FPPA 3JZIA 4ZOLF 2QF7A 4FFPA 2NU8B 4FFNA 3V4SA 1Z2OX 4YAKB 2DLNA 2GLTA
chains in the Genus database with same CATH superfamily
2WINI 2JFUA 2QG4A 3GFQA 3LS2A 3HOYG 3NANA 4X90A 3W2GA 1OBFO 1FQWA 2R7MA 2ZZNA 3NHZA 5AVZA 1CNMA 1U28A 3HL4A 2WVHA 2JLYA 2DETA 2IYUA 5C51B 2XJ4A 3LT4A 3O74A 3WL8A 3NR2A 4FBMA 3RYFB 5CX1B 2GPTA 4CLRA 1RPJA 1EEXB 2V96A 1X70A 1A8UA 2OKGA 3DEYX 2PMCA 1P45A 3JXEA 4F6LA 1X7WA 2WJ4A 3B1ZA 3RVLA 1CZRA 4TWJA 3T3EA 3PGLA 3LQ4A 5KFIA 121PA 1GN9A 5JU6A 4EPTA 4FZJA 1K4YA 2IYVA 3CMMA 3EG9B 1EGHA 4ZAXA 3ESAA 5E6SB 2PUDA 2JF0A 4EQ6A 4U9UA 3EQ6A 1K4KA 3BMCA 3GOQA 3BRQA 1YZLA 1TLTA 4BPBA 3TBHA 3ELUA 5F7JA 1T26A 4OHKA 3R7FA 4YP1A 4J07A 1UDRA 1Q6YA 1HYEA 4Q34A 4Q0YA 1L5SA 2BE7A 1O94D 1N2SA 1QLHA 4G25A 3TN7A 1N1GA 4GPAA 1OHHA 3LDUA 1CJCA 4ZOLA 5EZ6B 1U0FA 5AHWA 1BJTA 3PW2A 3C14C 6YASA 5L6MB 3NAZA 3LLMA 1NNLA 2AK3A 3PLRA 4L07A 1Z8DA 1MVOA 3FYHA 1OIVA 3I92A 3ZV4A 5F4BA 3D4OA 2J9GA 3AK4A 1W0KA 3C8DA 4COOA 2HMUA 5DEIA 4HOYA 4KK4A 4O4JB 1G5RA 2R3SA 4U2BA 3M9XA 3MLEA 3EOZA 6NULA 1VHQA 4AJ9A 2IP2A 3NIFB 2O0JA 1M2VB 3N7TA 2AI2A 5KT2A 3GARA 4D02A 1ZUD1 3ZW8A 4E1VA 2I67A 4G9EA 1C1DA 2YJTD 2YYZA 3B2EA 1U31A 1JEAA 4LAFA 4IDAA 1IB6A 4OBXA 1N2HA 2MSWA 3AUTA 2YL2A 3I34X 1ZRHA 5K3EA 1JEDA 3MUFA 4I6GA 1X9NA 4B6QA 4NJEB 1DI0A 2PH7A 1G16A 4AY6A 2GZ2A 1IPFA 4TWRA 1JDZA 1YL7A 3VHXB 2HIAA 1JHXA 1NWCA 1V7PC 1ZUNB 3R0ZA 3FNGA 4G97A 3NB0A 2OTCA 1HDZA 5LNK6 4J2OA 1VL0A 4DV6B 1E63A 2JLVA 5MDHA 2C5AA 4OP2A 3DT8A 2VEDA 3EXFA 1W4AA 2QSJA 3EEOA 2OFOA 1SCAA 1PGPA 2I7CA 3EA5A 4TZTA 3AYZB 3MMXA 3ZCVA 2FOIA 1IBLB 1IVYA 3HPRA 4DA8A 1CUWA 5AW4A 1G64A 5LMUB 4MQ5A 1HSOA 3DVLA 3WTCA 1W19A 4ER7A 1MB3A 1Y9JA 1XVUA 4UCQA 1J24A 4D9NA 4UNPA 3KUXA 2I8LA 3IQZA 1TAEA 3GTGA 3KEGA 3S2UA 3NS7A 1Z5GA 1UBEA 3P9KA 2VT7A 3ND9A 3IBFA 5EWMA 1U8FO 2P0EA 3GUYA 3RJ5A 5DNUA 2XGMA 2I3AA 3HBJA 4KX3A 1Y7PA 2YWCA 4QYWA 4TLDA 3RBEA 1RQ7A 2EX0A 3BDAA 4NLLA 3X2EA 1ECGA 2PJDA 3ONWA 2DHQA 4Y1FA 4AYXA 3FKQA 4M9ZA 5BWVA 4GRIA 3ZJTA 2FK1A 2C1ZA 3RKRA 1L7XA 4Z2AA 1HT2E 1TC1A 4A82A 1K1EA 3KT3A 3CUKA 3THXB 4P5PA 3H5RA 2CWDA 3H04A 1A7KA 1GNSA 2OAEA 3FX2A 1COWA 1ISJA 3O95A 3LDHA 1BFUA 5JMTA 2PX2A 4A8HA 3U61B 1FMTA 3MILA 3QKSA 4WBNA 4I7EA 1JLSA 2NXJA 1XPOA 1GNTA 4YRNA 3PHBE 2VWPA 4WGGA 2PEZA 1OLUA 3FZYA 3L0PA 3UOAB 2FR0A 2QAGA 3VPGA 3PF9A 2VA9A 5FLMG 1QTQA 3OA0A 5ESRA 2OBMA 3RV3A 1G7RA 5A4JA 1ML4A 1JFSA 1RK6A 3S6JA 1SFOA 2XCPA 1HK7A 4NABA 4O4IB 4GUAA 4IBOA 4BFSA 2Z2IA 1YS2X 5K9ZA 2JNWA 3PI7A 5I6DA 4WX2B 3UANA 1G8FA 4OUDB 6CHYA 4LX8A 1QH0A 2E5WA 3ELYA 1NNI1 1TW2A 1S4MA 2VDJA 4DSUA 3KQTA 3GGCA 3RTEA 3NHAA 3KPUA 1KI7A 3F67A 1PBNA 1B6SA 3QV1A 5CEEA 3QZUA 5CAEA 4R8UB 2HN9A 3MCZA 3SKXA 2HIHA 3R8XA 2GESA 1DLJA 4S1WA 2IXTA 4KGDA 3NJ4A 1C9JA 2ZIUB 1KKUA 3HXOA 2ZYGA 4A26A 1N2CA 2FFAA 4OQXA 3M3HA 2YHBA 2FR8C 1PBTA 3GNTA 4IJQA 2ZUUA 3GJSA 1C8BA 3IOYA 5H4GA 1KJQA 4KOAA 4MVWA 4YCNA 3LCRA 1XXHE 2BFFB 1FLAA 3ITNA 1CC1S 3EY9A 1T2AA 3BE5A 4IMIB 3LY8A 1KBLA 2YVQA 1KSGA 4J4TA 1OI7A 2GGSA 4CDMA 1VS0A 5GAJA 3T61A 3KKPA 4CIDA 1YFLA 2G0AA 3WGUA 1CY7A 1GCGA 1CX9B 2VJMA 5DF1A 1EZ4A 3H9GA 4LRXA 1KZ6A 2J31A 3HBAA 5C3UA 1L4GA 2B5VA 4JFAA 2E82A 5IVIA 2BFMA 4HYTA 4Y2JA 3H0KA 1FU4A 2EYUA 1H05A 5AR1A 3FKIA 1NKVA 5JC1A 5IVKA 1N6NA 2WYOA 2R85A 2C94A 4IWXA 2AEEA 2HCJB 2QUKA 2YQ4A 5JMPA 4ZEOA 1NM5A 4Y2GA 2Q8PA 1XQXA 4DSNA 1J0CA 5EPOA 4GLFA 2AFIB 1SKUA 1W94A 3L5OA 4E07A 2FVXA 4HDOB 5CNMA 1W49A 2Q0QA 1WWKA 3OLWA 5KFXA 3W8DA 5IP7G 3W2IA 3IHLA 5A4KA 1DUVG 1RM5A 1QYDA 4BUJA 2ASJA 1NR1A 3ODPA 4N6NA 2ZUBA 3ZJUA 5CRIA 1VE7A 2A4MA 2G07A 3EA0A 1GU0A 3W1GA 4BZXA 2X40A 2VLBA 4WXEA 1V1RA 1KQNA 2G08A 4W1RA 4EVQA 5HDBB 4S3MA 2QW1A 4KMSA 5A0TA 5ESXA 2ENUA 3KZCA 4YLYA 2PFKA 3DHVA 3U54A 2D5LA 4BYGA 1SUCA 3NFYA 2J5KA 3I12A 2FH5B 1TJYA 2FPRA 2DUUA 1K06A 3HBLA 1ULBA 3K6RA 2V7GA 5HS4A 3KOZA 3U4QB 4J9VA 3AUUA 4MQUA 2R2AA 5KNBH 3RAGA 3VO1A 4P6VF 5DHFA 5D5HA 1QKJA 3KHUA 2AZTA 3I9MA 3RH0A 2VJDA 2FX5A 1RIFA 2EAUA 1L4NA 4RHXA 1L1FA 4EA6A 4RFSB 4DIEA 2YVKA 4AZSA 1KEKA 4MVCA 2WMYA 2O23A 4MOWA 3AF6A 2I6SA 2HJVA 4FOPA 1LC3A 3VJRA 1O94A 5CXSA 1MUUA 4HAWA 2GLXA 4IFIA 5G40A 1N2JA 4YRZA 4N18A 4ZTZB 4FB4A 3EFBA 2C3OA 1H0KA 2QNRA 3JQBC 2CBXA 2YFHA 4HS4A 3BSSA 1RPNA 1PNRA 5BMVF 3L0DA 4YEDA 5KKCA 4ZI3A 4PO9A 1KJNA 4JR1A 1Z74A 1QX3A 2J9YB 3ZC3A 5DLYA 1Z0KA 1M7GA 1UK8A 1GL6A 1N0VC 4FCVA 4BGUA 2ID7A 4O3MA 2XKKA 3LFHA 1U5CA 2BFDA 4HVCA 1ZGHA 2JD0A 2PRYA 2AYZA 4O0LA 2NLOA 4HWGA 3NHYA 4OHVA 4JELA 3SJ7A 3Q8KA 2RK3A 3BA6A 4RF2A 5E9WA 4EFNA 5HF5A 3TLAA 5ALDA 3BH7A 2R00C 1Z7GA 5F98A 1S0OA 1Y5MA 1YBFA 4B87A 2DZDA 1YA4A 3AM3A 1APBA 3HKDA 4URFA 4R51A 3A2KA 2YFQA 4XPIB 3AKCA 3WMRA 4TV9B 2XAUA 4JUAA 1R27A 2VUSA 4ISBA 4YBRA 1H4QA 3AUYA 4ZCSA 3H1GA 5JUWA 4WN9A 3N2YA 4QYMA 4JV1A 1Y1VA 1P73A 2E5LB 1TJ3A 2BGMA 3ZCRA 3O1JC 2X41A 2GZMA 2YWGA 3X0DA 4N9WA 4HNQA 1SUFA 3KKLA 5TQ0B 5DMHA 3DQZA 4EG8A 1UXJA 1GCOA 5TQVA 2LDXA 4HDQB 4FFBA 4WK0B 2EXXA 2YIJA 3EYAA 4CMIA 1T3LA 3AGQA 3H5IA 5D8DA 3WLOA 1RW4A 4E5NA 2ZPAA 3GIWA 5EJ4A 5E1MA 4FU0A 2O8BB 3ZKAA 4JJZA 3ONVA 1UPAA 3OPYB 5KG0A 4LTNA 2XV1A 2UUBH 4YK7A 3SJZA 1F6WA 4O7WA 1VL5A 4A0GA 4AX8A 3HWWA 2XWSA 5DOZA 2QXUA 2NM0A 5KU7A 3A9WA 3IT2A 2P5YA 5FQNA 3ZY4A 1KJZA 1I0ZA 4GMKA 2CMFA 1A0IA 3WK9A 1HG0A 1LBSA 2A9JA 3WE7A 5K5EA 2R47A 1TEVA 1RQRA 1C30A 1X80A 3NLLA 3EVBA 1ZZEA 5GJCA 1PQWA 1N9ZA 3G1UA 3WHLA 4QVKA 1TX4B 2J67A 4P7GA 2E1RA 2P7HA 4BX0A 3UMGA 5LB4A 5JH7B 4U2KA 3KYJB 4L50A 2BZSA 1YHNA 5LB2A 4BB6A 4Q9AA 5KX5B 4MGHA 3LO8A 3RF2A 1LTHR 5T4HA 2D2XA 5CMLA 3IQXA 4LGMA 4N39A 2AHOA 1R5NA 4TV8F 1DELA 3B85A 2FZWA 4JZKA 5IZ4A 3RU3A 1SUDA 4PO8A 5T7BA 5DLFA 5I3ZA 1R9NA 4XX0B 4GQIA 1DEOA 3BVPA 2ZP1A 3AM5A 3FBGA 1B93A 4LSMA 1D1PA 2GRJA 1WB9A 2A5DA 2QN2A 1AUQA 4OYYA 3LHFA 3CZPA 1U2GC 2FE3A 1FEZA 3UAWA 1SCNE 4D4MA 4E51A 3B48A 3QI2A 4LF8B 1DFGA 4TUYF 1VJCA 1Z25A 2ZUTA 1G2IA 3BS4A 1PJ3A 4E2ZA 3C15C 3GMSA 5F52A 2DWCA 3QWIA 5I8ZA 4D4LA 4XYEA 2I99A 3T38A 2J3KA 5J2TA 2BJVA 2R87A 4DR7H 2QJFA 3DMNA 4BQSA 1I2KA 2W2QA 2BLNA 1NN0A 1JZSA 2NXEA 5L3VA 3WOHA 3JSAA 1JTVA 2ODBA 4OB8A 2HDOA 4HN2A 2AJBA 4RXTA 2YBDA 4FOLA 2ZI6A 4IFBA 4CW7A 3WBBA 2GZRA 4WZAB 5FO0A 4PVCA 5IX8A 2A78A 3IP9A 3LUAA 1PFVA 1RYYA 4QDZA 3U16A 1MXFA 3P94A 1PSZA 3NP9A 3UJPA 4I7HA 1XTTA 1R0SA 4IM7A 1ODLA 3V7YA 3ZWWA 4RK6A 3VMFA 4TTJA 2Y0BA 3TDKA 5LQUA 2EGUA 2BFOA 3PDWA 5BNFA 5A9RA 2ZSEA 2D2VA 5AM4A 3WWYA 3UTDA 4I8IA 2PLWA 3CRRA 4O7SA 3CHYA 5EIAA 1PV1A 2B8EA 2I3ZA 5KJCA 2GKGA 1DZIA 3DZKA 1J8VA 2PQMA 4ON9A 1ORRA 1AQNA 1RXWA 3OCZA 4R1LA 1UFQA 2FQXA 2OAQ1 2EJTA 1Q84A 1U63A 1YIAA 1X7HA 4E1AA 2NZUG 1Z2DA 2V5UA 1F4LA 1MZBA 3FCCA 4H6XA 3ADOA 2R79A 3TS1A 1IXZA 3PDHA 3L4EA 4YMLA 3F8NA 4QFMA 2XY4A 3DAHA 4YCSA 4YDSA 3UQYS 1FJXA 4TKMA 1M1XB 1FNBA 1TQHA 4V0RA 1T5DX 5LDHA 4S1VA 5TS2A 2Q62A 2XD9A 5BW5A 1TUIA 4HQ6A 1IG3A 1S1CA 2MINA 2XOKD 3DTVB 2I4TA 5TXGA 2W6ZA 2IXGA 3W5SA 1H1TA 3FOWA 5CEFA 2D1SA 2EX1A 4MGZR 1RC1A 2PHZA 1D5CA 1SCKA 1Y98A 3A4VA 1ZVJA 5D84A 1T2EA 1H1DA 3K70B 1M0SA 1QIDA 4JXXA 1KBQA 3IMEA 5JISA 2O8NA 4LF5H 2L69A 5H68A 5HTKA 5CDFE 2ZRNA 5KEIA 4BO9A 3MAJA 1LC0A 2HFKA 2QTCA 4I46A 1NVGA 1D1TA 4OQNA 4EBFA 4O5AA 5ALVA 3AUJB 4B2PA 1JECA 1G19A 3M9LA 4DSAA 1KAEA 4HMQA 3W7VA 2XCTB 5HA5A 3GIMA 2PUHA 1QE5A 1E1MA 1EZZA 4K86A 2XLBA 1IHOA 2VAVA 5G41A 2IL1A 3C6MA 3OJFA 3R1IA 3BDVA 1I3OA 3EQZA 3N6RA 4M7PA 1E0DA 1JB1A 3GQBA 3C43A 4LXQA 4XIJA 2C88A 4WZBA 1FOEB 1QIKA 5EYPA 2EJ3A 1NULA 4B35A 1FTSA 4WE3A 2YUTA 1SD5A 1M6NA 3W04A 5J2UA 3UXYA 5JCOA 4HYKA 3G0CA 5AW8A 1CF4A 1B23P 4NNJA 3S2GA 1K6JA 1KY3A 3FWPA 3COWA 1XLTA 4DDVA 3GJ6A 2D59A 2CHQA 4BNKA 4JLDA 5IYZB 2OK7A 2AGQA 4C2AA 3JZDA 2RHBA 4MUMA 4EHBA 5DH9A 2OPHA 2AL7A 4GICA 4I08A 2WAOA 1KEZA 1V5GA 2EZ4A 1E6EA 4GBJA 4RKFA 1J49A 1SU7A 2QVGA 2B61A 2PGIA 1U4NA 5D87A 2WYUA 1TWFA 1XG5A 1PJCA 2A5LA 3O8BA 3KQKA 5KSOA 2HCRA 3PNLA 1GGOA 2WT4A 2I8AA 4A2PA 1SD1A 1BX0A 1BH2A 2HLNA 3R5HA 2H51A 3RTGA 4K9PA 4EW3A 3E48A 2XIJA 3WB2A 5DNDA 2W42A 2F6RA 4M0KA 2FVYA 4KDEA 3O31A 1J1ZA 2GN0A 2H52A 5DGAA 1CE8A 2PGXA 2MDTA 3FTQA 4DQUA 2HBYA 4C4ZA 4MXDA 4LCJA 5JSZB 4R8SA 3U3MA 3FPCA 3ZDZB 2YCHA 1DC8A 2ZKIA 1BDHA 1D2CA 4L8VA 1XYYA 1G21A 4OU4A 5AKLA 2JGAA 5EUCA 2ORVA 3SI8A 5GONA 1XTVA 4Q9IA 1NOKA 2D0IA 3CGWA 1DT3A 1J0DA 3KSBC 1KAQA 1E18A 2ZYHA 3IA2A 1I7NA 1RBZA 2FV8A 4K9SA 4X64H 5K0SA 2XBMA 5G0VA 2X22A 4F8JA 3ZCXA 5KFDA 5H4HA 3C39A 2WF5A 4M1EA 4PO3X 3JD2A 4NMMA 1CVIA 5GV7A 4Q1EA 2ZYIA 2P11A 1ZNYA 3WNDA 2Z6AA 2BI8A 1Y3AA 4DC0A 4XEUA 3UT5B 2BBWA 2H5JA 3VSDA 3TW0A 5JXIA 2VNIA 1LF5A 3UZBA 5TJHA 3OOJA 3NORA 2BM9A 1IXKA 2XCLA 3JQ7A 3HVIA 2PBLA 3FDZB 5A3JA 1FDWA 1HNXH 2HJHA 2X76A 2W7PA 3NASA 3Q3HA 2ODPA 4FE3A 4BWSC 1JKJB 1A72A 2GCGA 4F5EA 4G8JA 3ILYA 1NVAA 3WWDA 4A3DG 4F5YA 2BBSA 3K6JA 1NI5A 1I50A 2PMFA 4F11A 3KOWA 4QVGA 1AF7A 1XDNA 1ZUIA 1U81A 3DF7A 8ADHA 1ESNA 2RGEA 5DBIA 4JROA 4CF4A 2PZAA 3N1UA 3N8NA 4Z0PA 1NYQA 1RHQA 2YZGA 5CH8A 2DPLA 2Y0SE 1TC2A 5IARA 2YKGA 2P4EA 3VR6H 4UUNA 4KR7A 4LE2A 3ZZTA 2UZ4A 3NCTA 4G5SA 1XZJA 4JNCA 4H3VA 1SBHA 4X63A 5DGBA 5IT9A 1G6Q1 2OCDA 2L42A 2BKVA 3LBYA 4YTEA 1ODIA 2WICA 1ZH8A 4TKVA 5CH3A 3NEJA 5TNXA 3GT7A 1B26A 1Y3IA 2PZFA 1XP8A 5IYBG 3J81k 2W0SA 1Z13A 1W9HA 3R9WA 3IVAA 4W7HA 1YBHA 5LQKA 2V7PA 3WMEA 2HWKA 4Z7NB 4HLDA 4R7ZA 4KPEC 4BFWA 2YBEA 4Q4AB 4AQDA 3UAGA 2WD9A 1RWVA 4ZVUA 2C7GA 3NBYC 4CHTA 4ED3A 3AESA 4YB8B 3ZH2A 4DLXA 3RROA 5BSFA 5U4QA 4B17A 3FJYA 2VXCA 4TMYA 5BN1A 1YJ5A 1CS4C 3L0OA 4DXAA 4MVJF 2FFRA 2A1TS 3IPAA 3QKWA 4U7TB 4DCOA 2GVNA 4BV2A 1I24A 2P90A 3PFWO 3DT6A 4IMJB 3HZZA 3OZDA 4KU4A 2WOJA 3J81A 1V37A 2X4GA 1EKVA 3FWYA 1C4XA 3KQWA 3Q1LA 3EIOA 1Z3CA 1XA0A 3C1AA 3KJGA 3EDOA 5HKKD 1GAQA 5ICCA 2ZBFA 4JP1A 2XI4A 1Y14B 4KP7A 4RPIA 1PZXA 3K15A 5JV5A 5IABA 4O84A 1ZH2A 3AF2A 4M8KA 4ZMBA 4G0UA 1RAEA 1RM4A 1KFJB 2B36A 4MMXB 4FTWA 3UQZA 1V41E 4XYMB 2R97A 2JBHA 1CRPA 3C70A 4ND4A 2XCRB 3NOXA 1M8JA 3UW3A 2GZDA 4FSDA 3T4EA 4XD7D 4LYHA 1CQXA 1P61B 4TT3D 3MFYA 1K9VF 4K6GA 3R7BA 2J6CA 4IDNA 5FOTA 4TWBA 1H6DA 3BD9A 3VDXA 1UT8A 3BXGA 1JQDA 4OSEA 3W2TA 5JNUA 1EVZA 1RKVA 1GADO 4PZLA 4LVCA 1BH6A 4X9XA 4E5DA 2O5EA 1IZ9A 4BY9E 1IY1A 4YY3B 1RSZA 4TWIA 5D1PA 4MMZB 1T5IA 2XOKA 2BTQA 4DWOA 1G2OA 2C9DA 1ABFA 2PWYA 3DZFA 5K6AA 1AGYA 2I62A 4C7JA 3IBGA 2VJCA 3EDMA 3SY8A 4Y8VB 4ZVNA 1KFKB 4OXYA 4LV8B 1GNRA 4MYRA 1C80A 1D2AA 2C07A 1I0IA 4X54A 4KIWA 3IPCA 4ZN6A 1KA9H 1UBFA 4MCAA 1LB1B 1DC7A 4LQDA 4NCKA 3PQ8A 3ID6C 1R10A 3E0QA 1NIJA 3HB4X 6REQB 3TQQA 3K32A 3WLSA 1DQNA 2FN7A 2Q1XA 5DT2A 3QWFA 4RXUA 4IJKA 5IKXA 1JRLA 3OO1A 3ZHSA 3V9AA 2G0NA 2ZTVA 3WGTA 2WJVA 2HBRA 2R1VB 5DTJA 3VR4D 1NW8A 5E7QA 1M73E 1O6FA 5EIHA 1PT5A 2ZIWB 1N6KA 1HNWH 2MMCA 3PA8A 3B1WA 5A0VA 2A8YA 2JLAA 3M3PA 1AGNA 3UKDA 5L9XA 3L9WA 3CV3A 1JQAA 4XD2A 2PZ8A 1ABBA 3JD1A 3BERA 4G0YA 1GKIA 4GRDA 5DCLA 5KTSA 4AM8A 2ATEA 3K73O 2IEIA 5NLLA 3L1KA 1R0YA 4M1YA 2QY6A 4CTNA 3H5OA 4LGCA 4DLZA 1X7YB 1DFHA 2J46A 3D1JA 3LCCA 3R4VA 1GVHA 2ZITA 5F3WB 4NXMH 3ZNQA 4BMXA 5AVVA 3M6AA 1HLGA 2KPOA 1H2XA 3UGTA 1BZYA 4C3VA 2FQYA 4XCXA 1SCBA 3V6KA 3T8YA 1AB5A 5KOYA 2IMWP 3H4TA 1E59A 4Y0AA 4E4YA 2VYVD 3OZBA 1VJRA 3N0TA 1P6UA 1BXRA 1L5QA 2PT5A 5KWSA 2N46A 2YOGA 3WLFA 4EAAA 3PJEA 3P9IA 3I28A 2QM0A 5HK9A 3GLGE 2RF4A 1VJ5A 4B4WA 3QH4A 5ESWA 2VQ3A 1P75A 3V9PA 5EE5B 4KGVA 3EULA 1ODFA 4UEKA 2ST1A 2NZJA 2FB9A 1WPRA 3GG9A 1IDN1 4GO1A 1TQ4A 2RHRA 1SZDA 4CHGA 2VCYA 3M4NA 1EB9A 1E3EA 2WNHA 2JI8A 3GLFB 5AK0A 2X2OA 2CQYA 5F2KA 2AOUA 3N0WA 4Q24A 3WNBA 2DAAA 4RDCA 1O95C 2HKIA 5KDDA 2PYDA 3R20A 4GOJA 3FUWA 1DIBA 2J32A 4ENWA 1Z0FA 1RJRA 3IUQA 1JEJA 4EW1A 1OHHD 1Y8AA 5CFQA 4P2BA 4QT0A 4QBKA 3GEBA 5L4NA 4CM8B 1G9XA 4LJ7A 2KMLA 3ZK8A 3BOSA 3CUYA 5J5AA 4GOLD 4GM1A 4DA7A 1G6KA 1P4RA 5HJEA 4GPTA 1BGXT 2OE2A 3GFTA 3DE5X 1XZNA 1KFBB 5HUJA 3DEKA 4Q93A 1HKHA 1ZISA 1AIPA 1J0XO 1SBYA 2VQEH 5EQTA 4P34A 1SXIA 4EG0A 4JVSB 2GASA 2H4HA 3BMQB 2R7AA 4NI5A 3ZE0B 1PKXA 2ROQA 4NU6A 4FUTA 4CM4B 5KFZA 3HYLA 1L1EA 1Z4QA 2PSJA 5B12A 3H11B 4UHJA 1OFGA 2X77A 3PFHA 3FD8A 3E3LA 3I9OA 1KYZA 3UUGA 3THWA 1D6NA 4UCXA 5DI9A 4QDUA 1FDVA 2RSLA 1NQXA 5CPFA 2R60A 3RIXA 4K6HA 4IRDA 3BWMA 4IH1A 3G68A 3H17A 5ALEA 2WWTA 2CUKA 4QFBA 5LQMA 1WU7A 5BR7A 3MS4A 4WSOA 1Q1EA 1Y63A 3DVQX 3TY5A 3CONA 3K0CA 3L7NA 1B8UA 4YHBA 3EXHB 4EY6A 5SICE 5BV1A 4NF2A 3KPWA 3QYFA 4EJSA 3D54D 4LJRA 2HFJA 2F1HA 2WT8A 1J2JA 2QLNA 4K9KA 3DZGA 4MTLA 4QDTA 3O82A 4C4SA 3EYYA 3FW1A 3BILA 3V8RA 3BSFA 4JR0A 2JGDA 3P9YA 1VGQA 3KKMA 2J85A 3UB3A 5T4EA 4PG8A 4GZ5A 3DBIA 4A2QA 1MAUA 1FRVA 1CQJB 3FNQA 2PX8A 2JIRA 3BFVA 5T57A 1T3GA 3NBMA 3HP7A 1XZKA 5KTYA 2I6QA 4RCVA 5C8VA 3QKTA 4KQEA 2UUCB 2O2XA 2JIQA 3KX2A 4XJVA 2OBLA 4H17A 4D4JA 4XWWA 3W0LB 1Z83A 4I14A 3I1IA 5EG5A 3F73A 3WLKX 4R2HA 5T8KA 3D3EA 5KG5A 1Z08A 5BV2P 2LCFA 3WWHA 5EE9A 2WYWA 1XL1A 4YRMA 1Q95A 5EP4A 4M2LA 4RB3C 1C4OA 2WZBA 1IN4A 2XKAA 5EESA 3O4JA 4HFJA 4H2DA 4ECRA 3AHJA 4YMSA 4RD3A 3Q9NA 2OXFA 4KV7A 1TWHA 5KG6A 4HNUA 3D6UA 3NBKA 4IHAA 4PGGA 1P0CA 2H8KA 1TQ6A 1IWPB 2PRJA 1JSLA 3M2PA 3DE1X 3D6MA 3F4KA 5HKKA 1ZVQA 4YPOA 3D7RA 1WHTA 1KJ9A 4KI0A 2XUPA 5M7EA 4F9GA 1ZN8A 3GY0A 4QQFA 3GK3A 1MTOA 4RWEA 2R1TB 2O3SA 4QEDA 2OCKA 4BFXA 2FX3A 3BACA 4HQOA 3NTLA 2BGNA 2AG6A 1KSJA 1SUBA 2OZLB 3ILXA 2ZDGA 3D2AA 5SY9A 4XD7A 4PCVA 1T10A 3M6MD 2FOLA 1YAJA 4TT3A 3B12A 4ZVRA 1W581 5KG7A 4ND2A 3V46A 1B0PA 1ICIA 5KFJA 4TKLA 2XCOA 3WL3A 4KRYA 3U60B 2W11A 4IZOA 3FPFA 1GL9B 4PLPA 1E60A 4UCOA 5LQAA 4NZMA 4MW9A 2Z0MA 1I4DD 5JANA 4ARIA 5JTTA 1KEVA 1ACMA 2ZATA 5CX4A 1NHGA 3GTPA 4F8EA 5EMLA 4JI2H 5TGTA 3OM1A 4QYSA 4M0MA 4JI1B 1L4EA 1LK5A 2HSJA 1FFHA 1DQZA 1K1SA 3N05A 4NP6A 2IPLA 3T5AA 2FJZA 5ADVA 1M2HA 3OT4A 3IIIA 2VP6A 4HGRA 4Q1CA 1PL7A 4X00A 2HNAA 3SMVA 4HV4A 5EA2A 5AKKA 2XVAA 1R18A 2X3YA 5FUWA 3RAXA 3GJQA 2EBUA 1S9DA 1OTXA 4CG2A 3FB1A 4PQFA 3SZ3A 2LXNA 4PBRA 3LKVA 4V1CB 3WB1A 1NN3A 4YBZB 1E1KA 4DR1H 3RM3A 2JA5G 2IY7A 1T6XA 1DTSA 2B7CA 1HNZB 3N43B 3OT1A 4AQYH 3IAXA 3BFJA 3JWPA 4CKWA 3FF4A 2VTVA 1NVDA 3VR4A 1M1NB 4BNUA 3DZHA 2VNAA 4YP3A 4FYWA 2R92A 5AI5A 1VP3A 4Z3DA 1SU4A 1YDGA 4DZZA 1JFTA 4FD3A 4HCJA 4FZVA 4G5GA 3CZ9A 2NPFA 3VM6A 5JE8A 4L5BA 5IAAA 2C4WA 3O1LA 3CZ5A 4BS9A 4C30A 4IUBS 1AXGA 1CKNA 4UE2A 5U4XA 2ZSBA 1M7JA 2LCIA 2XYVA 2ZQZA 5EQDA 3QZ8A 3TG8A 1KZ4A 4MS1A 5AFSA 4BRWA 3ST7A 3AVUA 4RENA 1OX5A 1K7XB 4N7JA 1AA9A 3FTCA 3MWKA 4TT8A 1I1NA 3VTAA 5ER6A 4M7WA 3P0IA 4GD3Q 4B1FA 4KYVA 4H0CA 3RS2A 3O3NB 2XDQA 1GHTA 2BL4A 3C2QA 2AE2A 3SQNA 1QO9A 2GBLC 1XZLA 1SCUA 2EWMA 2VYVA 4LIPD 1TT5A 3BYZA 1ENZA 3LGSA 5H83A 4E14A 2I1WA 2FSIA 2NT3A 2YNMD 4AN1A 2ZR0A 1JR3E 1FJGB 4I3GA 1X87A 5KHAA 4LC0A 3JQ8B 1LQUA 2ACKA 4F93B 2F3TA 4RPJA 3H87A 2EL7A 2PXAA 2C1EA 1EGQA 4TROA 1USUA 5KT3A 3M5CA 5LQJA 1JVSA 4EYSA 4H6PA 3QV2A 4U4AA 3KM0A 1HPLA 3TLJA 3X1JA 1VKZA 3HABA 3BRCA 1CY4A 4LSZA 4R2JA 2R65A 3QYAA 4FW9A 2JEYA 3DE0X 1H1LA 2O5VA 5ALZA 2VDWA 3TR6A 3DVRX 1U8XX 2D8AA 1PLJA 4ARZA 4QUIA 4UBIA 1Z7EA 3UK7A 4F9TA 5IBPA 2E21A 1MFPA 4CCWA 1LU9A 3BJMA 1N5JA 2B0JA 3N41B 1ULHA 2VP4A 3B9QA 4O02B 1NQ5A 2FRXA 5F9NA 5IWCA 2ADOA 1JEEA 4A3CG 4LBZA 3JVUA 2I66A 4GL4A 3GTOA 3EEBA 3UENA 1TPYA 1PR9A 3GILA 3K9CA 3QYJA 4FCWA 3B51X 4X84A 1MQ9A 2AEJA 2CFRA 1NVWQ 4A93G 4FJ2A 4LKOA 3H3JA 3E0XA 3L8CA 3ECAA 5EEHA 3M6WA 2FMUA 1XMQH 2W43A 1TM7E 5AWFC 1UQUA 3D1VA 1LJUA 4JXZA 2B8NA 3ZBTA 2ZUWA 2Q6TA 2P9YA 2IW3A 3L1HA 2ZBEA 3QY9A 4LFCB 4G5HA 3GIKA 3CO5A 2P67A 3F5DA 4D0RA 1N3YA 3T94A 1XQ1A 3EG5A 3DKVA 1DEXA 3OPMA 3M82A 4FCTA 3F9IA 4L8FA 3FFWA 2DEUA 5H7XA 3VMMA 2DFNA 3B6ZA 3STTA 3DP9A 3A4IA 1H85A 3USCS 2ODNA 1Z35A 1CRLA 2RGXA 1A4RA 4XQEA 1QF7A 4JJAA 3A6PC 4CV3A 4B3MB 3E23A 1TLLA 4NU0A 3G7NA 4H1VA 1ET0A 1AJEA 4Q3KA 1C3LA 3DKPA 4R98A 4LXTA 3BK7A 3TAXA 1KIFA 4OXNA 2QL5A 3C0KA 3C74A 1E3TA 3FYTA 2X19A 3L7JA 1F7UA 1JU4A 4F5WA 2OESA 4OBBA 3NHJA 6PFKA 1XDDA 2QRVB 4CUJA 4A91A 2HHFA 2FMAA 4OIMA 3R5FA 2IEDA 1G20B 3R2JA 3L0IB 1Q0ZA 1GUZA 2XDAA 5BMVA 1L2ZA 5TV2A 3U80A 2AF4C 1G42A 1XVAA 2QUAA 5KFFA 4Z9AA 3JSNA 4FNMA 1U4SA 2PFGA 3GJ7A 4IINA 5CFPA 4RIIA 4JLVA 1LZLA 2RHDA 2G1AA 1RKQA 1GAWA 1Y5LA 2PCLA 1JLKA 3H9CA 2OAP1 2B4YA 4MWTA 5L3SB 1WE2A 3FYUC 4QL3A 4JJIA 2P75A 1R4NB 4CNQA 2QX4A 5TR9A 4ZALA 4U39A 3GRZA 1KDTA 1T4BA 1NOIA 1T35A 1IVNA 5IMSA 2NU9A 2JGMA 1K86A 4D0GA 2WJIA 4BDTA 2OV4A 4M46A 3ZQUA 4CF6A 5IKMA 1YKGA 4CL2A 5E38A 1KC7A 2R5NA 3EIEA 3LL7A 3MAGA 5IWAB 5IM4F 2I6TA 5JYEA 1QZTA 4YFVA 1MDFA 4RTNA 4L4ZA 3DDUA 2HGXA 2EHJA 1U9YA 4RIGA 1NJ2A 2XB8A 4REQA 3LHIA 2ZM5A 3VSCA 2WI8A 3UK1A 4ESEA 1S97A 1AMUA 2HX1A 3TEMA 1U0EA 1G3UA 4Z4QA 2DTXA 3OTHA 4HAOA 3KYDB 2CKMA 3GR6A 2IXEA 4OMCA 1PSWA 3O8OA 3V4OA 3B1JA 2YWXA 3NX4A 4RU9A 2FEMA 3RSFA 3IAHA 4PZZA 4K8RB 3STWA 3A0RB 4RTJA 4B7UA 3ONFA 2H9IA 4U6NA 1PK8A 3JR3A 2EJBA 2G9ZA 1M2WA 4N6OA 4DGSA 1FLDA 5KJ6A 2IOHA 3SX2A 5FOSA 2ZULA 4RYDA 2ZI7A 1DO8A 3TRJA 4LA4A 4HAXA 5AXBA 1BQ3A 1J2TA 4WINA 4EECA 2JI7A 3AY0A 1MDBA 3VC2A 1J0BA 3MTGA 5CTJA 5F5NA 4G01B 4M1TA 5CDYA 3BCSA 1R00A 1B3BA 5K0NA 3KK0A 4A3MG 4P31A 3CCFA 3GVCA 1E8DA 2F3RA 5FBHA 1U7PA 3LBIA 4P84A 3BGDA 3KHKA 1OBOA 3WWEA 1N3LA 4JYAH 3DLAA 3K0AB 4ZKDA 2FRDA 4HDCA 4IJUA 1XKLA 5SZKB 1SKAA 1E1NA 1X6VA 2BEVA 1KEEA 3T4PA 3JAMW 1WUJS 1U7WA 1NW3A 4FEGA 1O0CA 1NKTA 4Y9SA 3RS5A 1T43A 4D8YA 3WJAA 1K7SN 1W76A 3X1XA 4JI7H 3CLTD 2UUOA 4Y2TA 4L75A 3ML1A 4QYIA 3PDJA 3EC2A 3V42A 1XRMA 2R6GA 1GRCA 4IVNA 1YC2A 4CFZA 4WLVA 1QZ3A 2W6NA 4CGZA 4J94A 4P98A 4BNVA 4MUFA 5JFGA 3UJAA 5KYGA 3RS3A 5CCXA 2XBLA 3O4GA 5LOVF 5K8UA 3DAYA 5BSMA 1U7UA 4NU5A 1NVBA 5EZ5A 5J1TB 4JMPA 3PXAA 4IV5A 1OBDA 2LP4Y 2CK3A 2BZ1A 5COAA 2H2WA 1WBJB 1N5LA 3SNOA 2JKZA 1V8PA 1NSTA 5DCUA 4OMUA 1UBUS 4WLEA 4LDNA 4Q1DA 1KMIY 2I0FA 3RGXA 2AMVA 2P7IA 5DX8A 1M0EA 2BRUA 1ZOLA 2A9KA 3AHDA 1XAJA 3JQAD 1WZNA 2YNMA 1ESMA 3P9NA 2WTEA 2ZRKA 1KOJA 4IH4A 4ZHQB 4YCDA 3PEUA 3IDAA 1G8GA 3U4IA 1E0SA 3ONDA 4QGFA 1GKUB 5SY6A 3ORSA 3NYWA 1ZNXA 3VNAA 2V7XA 2FZLA 5KVAA 5LWHA 4B31A 2Q9AA 3DOCA 1J8YF 4NICA 1F5SA 3OM0A 3DHEA 1A2QA 1YZNA 4QFCA 2BGGA 1N0IA 4DMGA 3TO5A 2B20A 4UTXA 2AN9A 1SKBA 3JYNA 2C9BA 3RQSA 1RHJA 1Y48E 4X1YA 3HVUA 3WB0A 3N0XA 4I8DA 1QE3A 4OJTA 4WFJA 1Z6GA 1G9SA 5AHRA 3RYIA 3PR3A 3GB9A 4ZRMA 4I4TB 5JEEA 3AB3A 4AFNA 3LC1O 3VZSA 4UM9D 3EVAA 4YRRA 2JFHA 4HGOA 1DQYA 5GVSA 3U4CA 2PUAA 1NY5A 5C8YF 1BKDR 2EDAA 3O9ZA 5AK6A 2BM0A 4MKGA 2OT3B 4HAZA 4FYVA 2IYLD 4RVNA 4QG7A 3QTTA 4DIDA 5EWJB 2BSAA 1WSDA 4JC8A 4PIPA 4UNIA 1ZMXA 3SYNA 3K3PA 4BNIA 1GQFA 4G1MB 1II8A 4C4RA 2WWRA 4UXIA 2XMQA 5B53A 3SOPA 4CLHA 3KKOA 4H7DA 1KDYA 2ILTA 2F8LA 4RXMA 4ZT7A 1WEHA 1U9JA 4DBZA 5KDLA 2FSHA 4QYTA 4IG9A 2BTOA 5CB4B 1OSNA 2PZEA 1BMFD 1KGDA 2NZXA 3VYSB 3BE8A 1FUYB 2IHZA 3RYHA 4HC4A 1TD1A 4C0AC 3IR5A 4R3UC 2DUWA 3CH5A 5IM5A 5FEUA 1X1QA 2QROA 1IVSA 4NBWA 1XPJA 3CWQA 4F21A 1MG5A 4J0HA 4IDHA 5DCWA 3MJ4A 3BIWA 1F8XA 2VHUA 3KT6A 5JCPA 1MD9A 4DJEC 5SYMA 2EJ0A 4XOIA 2ZJ3A 2DCUA 4DW8A 1ZCBA 4LNAA 3VNQA 3M81A 2ADFA 2TECE 3VUFA 2A5GA 4DV4H 2G06A 4DEYA 5T14A 2W9XA 4PLWA 1JPJA 4MV0A 2FLKA 2HWWA 4DDMA 1OUMA 5F7XA 5BVGB 2Y66A 5FPHA 2WEKA 1BHSA 5FFFA 2QZ4A 1I94B 3FOBA 4L0QA 3GIPA 1HYHA 4QO7A 1UIMA 4CDGA 3OHBA 4WERA 4QAJA 2RHCA 5CLGA 1AGPA 1BHQ1 2OXRA 3HXTA 1A82A 3OSZA 4NRDA 4AT1A 1A69A 4FYJA 1BU5A 3O38A 4QNMA 1M5TA 2WVGA 2Z3ZA 1UBSB 4DLTA 2F1KA 1T25A 5LJLA 2B94A 1JHQA 4DBLE 3CZ4A 1TK9A 4A3BG 4U2FA 2XOXA 2V7EA 4NBSA 2BE9A 3HDJA 5ALGA 3DF9A 4K2HA 1X8LA 1WNFA 1XKTA 3SWWA 1DIKA 3OZWA 2H1IA 4C0WA 1ULAA 1XF9A 3QUBA 2II6A 1FDSA 1MJNA 1JF8A 4L2IB 3GDOA 2XGGA 3E1GA 2JK1A 1L5MA 1WCMA 2JH9A 1QQ7A 4NG5A 4HTAA 4S04A 2QVBA 2BR4A 4LJ9A 4G67A 4EG7A 2W9CB 3LP8A 2XUJA 2J7KA 2JLSA 4KSBA 3QQ5A 3ZJ5A 3L8MA 3AETB 2F3PA 3A0UA 4AMYA 2WWXA 4EB0A 4RCYA 4CMFA 3W5CA 3R77A 4LF9H 3W1BA 5BWBA 1GSIA 4ZO7A 3DZJA 4MIYA 3VTZA 3A3NA 2GXUA 3DZCA 3ZX4A 1C9YA 3JWIA 4C6RA 1A71A 5IKEA 4KR9A 1P5HA 4UUBA 5AW6A 2NYAA 1V25A 1GGEA 2RONA 4IAJA 3KP1A 2CZCA 4FFLA 1UWCA 4LX0A 2HPHA 4LNUB 1KVQA 1XDSA 1Z12A 2Q6KA 4FT4A 1DFIA 2I2DA 1JX6A 2EFGA 4HQ0A 2O8VA 1WUKS 4IY1A 2I5PO 5KU1A 1GEGA 5C4GB 1WSBA 4UCVA 2D7JA 4PWQA 2MTBA 4AJLA 3FVQA 1XQWA 3VXKA 1I0LA 2ZJOA 7ABPA 2N0SA 4CC6A 2C4NA 2Q3JA 5IK2D 4OQFA 1U6JA 4OP3A 2ZE6A 3KEQA 4C4OA 2DY1A 2X2PA 4DBLC 3FBWA 1H6AA 3AXTA 1E98A 1GQRA 3NTRA 1JDNA 1RM3A 4LGYA 1HR0B 4HB2A 1F51E 1Z0JA 1ZK1A 1ESDA 4LOHA 5GIOE 2I2XB 4TZ0A 4MQFA 3DR3A 1U94A 1MHTA 1A9XB 4B3HA 2OQRA 1F17A 2JA7G 2R4UA 4KVFA 4G24A 1WUHS 4F3RA 1ESCA 3RLFA 1LS1A 2OBFA 2NGRA 4BTVA 5JS8A 3GUZA 3GCGA 4RIHA 4YJ2A 1RCTE 1E2NA 4UULA 3PKIA 1FY2A 1W85A 1KVSA 4IJ5A 2EFEB 4L08A 3C3JA 4D6YA 2NUPB 1BIFA 1B8VA 4O2AF 3FF1A 3KAJA 4JLWA 4DB2A 2GI4A 4IQGA 3PUJA 4NHOA 2IX3A 1KZHA 5E8JA 2O8FA 2A4KA 3JQAA 1QVRA 2G3YA 2JEJA 1W75A 1HFWA 5EQJB 2V8BA 4MARA 4NR0A 4WXHA 5J63A 3ANTA 2WDZA 3FZGA 5CD9A 3VVLA 4FEYA 3PIIA 4J9NA 1YSCA 1Z2OX 3BD8A 1BMTA 4GR4A 1N6HA 4HLNA 1M8PA 2MWMA 1SC6A 5HNKA 2ECFA 1PJLA 1BS9A 4J49A 3E5MA 3PQ5A 2YV5A 4O1HA 4DUZB 1OZ0A 3I04M 1SQSA 3LPNA 4RZXA 4RK0A 4MVJA 3F6PA 1CDOA 1QRRA 3ZVMA 1EFHA 4MI3A 5HPYB 4LWPA 3IPYA 1QUFA 3D7KA 2C2MA 4WCDA 3TRIA 1S68A 2BLLA 3LUJA 4CMAA 3B20A 1U3GA 1QFSA 1CNEA 3E1KA 3AF1A 4XASA 2NO5A 4UMEA 1LSSA 1ZW6A 4OI4A 1UDCA 1P1IA 1NF2A 3CA8A 1YV9A 4EZIA 3ON5A 4XGKA 4U7WA 1PN3A 3K4QA 2GK4A 2J48A 2Z8ZA 3BMOA 4C0HA 4KXNA 2C8JA 5GVRA 3ZW7A 2HF9A 4QDJA 1DX6A 3WGVA 5JROA 2J87A 4IWYA 3TBFA 1THZA 2EGHA 4R9RA 4JQOA 1G291 3KFVA 2C22A 4H3SA 1TQDA 5ALXA 3HXKA 5AKZA 2DX7A 5ALHA 2VJLA 2FEOA 3QRWA 3M4IA 3NBFA 2IEGA 4QHSA 1BMFA 5LU9A 1N5RA 3U56A 3MAAC 2ERCA 2VZEA 3RWMB 1G38A 3GTKA 1XDWA 3GFOA 3PUXA 4LFBH 1U0BB 3TM4A 3L7YA 3UHAA 4NDAA 1AV6A 1YFJA 2J9FA 1Q91A 5BNWA 4HPWA 2KLBA 3VU3A 1I2ZA 1T4CA 3AY3A 5GMOA 4HQNA 3IJ5A 3PYLA 3V6LA 1L5LA 2Z2JA 4MRVA 2QUIA 1GLNA 3ZXYA 1PDWA 4Q3BA 1BKYA 2D7CA 1XYVA 4EYHB 1T8TA 4EKYA 4OX9B 1NI4A 5JRJA 4R0MA 3IQEA 2ZBPA 2QR5A 2O07A 3JAKB 4D41A 5A7FA 2JZCA 2RDJA 2EFCB 4RK5A 1Z68A 4AXBA 1GD1O 2HGZA 3ZGXA 3T4UA 4L4XA 3P7MA 4NK4A 1ZU4A 2QPLA 3PNKA 1Y1RA 4ESOA 3GZTB 1T13A 5K7SA 3QHAA 1RLIA 2MSCB 1R6TA 4YT8A 3OTQA 2ASLA 2YDYA 3DPUA 2E6KA 2XUZA 3QUTA 5GM2A 1OX6A 5G1NA 1H6CA 3EWAA 3IE0A 5KFMA 3P2IA 3VKHA 2QQEA 4LDZA 2XGQA 1OXVA 3HI6A 4L4RA 1HY3A 1DGQA 4IUDS 2PK3A 2QTBA 5I5EA 2PUFA 2Z56A 1U0NA 1PQPA 3A36A 3IQHX 4Y1RB 4ZHSA 4B3TH 4Y1GA 5CNKA 1EYZA 3AJDA 3O9VA 4AP5A 4Q02A 3BAFA 1UC8A 4JLAA 4B6JA 3PIDA 3R76A 1IJFA 1XFAA 1WCXA 3TQRA 4WECA 421PA 4CIXA 4N7RA 3LQ1A 3HP4A 5DASA 2CYCA 3CW2A 2Q07A 2PS1A 4FW8A 3HUUA 3WQHA 4N1AA 5JASA 5HKAA 4KDCA 2XQGA 4DTCA 2R86A 4DANA 4MYSA 3GQCA 2BUAA 5H3HA 5JBNA 2R0QC 1RXSA 4F4UA 3G5AA 3D8RA 1K7YA 1OLXB 4O7RA 3AR5A 2H1HA 4H6VA 3WFZA 3K5PA 4LSWA 5EN4A 4AJKA 1Q20A 3WP1B 2NUAB 3FY4A 3HR4A 5DSZA 4ZAYA 2V4UA 3U7QB 4C4XA 1N34B 1FXUA 3KZXA 2IOFK 3ZDFA 3AIIA 5FLKA 2FWJA 2QZ9A 3NDPA 4RQBA 4FBTA 2HU8A 4Y9DA 3DMRA 1QHNA 5C35A 1KXZA 3UWSA 3ISJA 5FT9A 2HQOA 2CXRA 1QIMA 3IXQA 1EM8A 4FQ5A 1NMXA 5C5JA 4PF1A 2D6FA 4H77A 4GLXA 4R1SA 4PXSA 4AZWA 2ZYVX 4AF7A 1R8QA 1Y5IA 1SMKA 4MEAA 2XLCA 2VDQB 2Z5LA 1WKCA 1IRXA 2C2BA 3S2YA 3IEUA 3EDYA 2UZ1B 3FNHA 3JQPA 3C5WP 2XB4A 3V1KA 5D51S 3SC2B 2CXXA 3A2LA 4U7PB 2Q3FA 5AUQA 3R0IA 1IN6A 1GNLA 1TFUA 3PU6A 3D3WB 5IK2A 1T91A 2IWRA 4GLOA 1NE2A 3CRQA 3A70A 4W5TA 4GRAA 4ZYLA 4GKBA 1O8CA 3BSWA 2ZTMA 1C3XA 1L8AA 2AQIA 4PXYA 2ZYWX 2HD4A 1L7RA 1UM8A 2C2HA 2NIPA 1G6OA 2DHDA 3NONA 2P69A 1ZOSA 2B37A 2Y9PB 2QE7D 4J9LA 1Y6ZA 2X5JO 5D6OA 4AKHA 1L3CA 1IWBB 1KQOA 4XOUA 3BULA 4Y2UA 1N6LA 1ZJ6A 1I4EB 1RYZA 3I42A 1MH1A 4N0QA 1XT6A 2D5BA 3HS3A 4WJZA 4OXKA 4BYMA 1FZQA 3QM1A 3KL2A 1E9FA 2Y8EA 5I5YA 1I5EA 2DH6A 3ZHZA 4JY7A 3Q8LA 1ZJ4A 5AKEA 5C32A 1F3LA 1UK7A 2OV8A 5MF6A 2ZBQA 2PTGA 3FSEA 4HZGA 1PV4A 1IY8A 2WM9B 5FI1B 1G5IA 4E31A 3H1PA 3P26A 3CFYA 5EZSA 2FHSA 3JASA 2PX5A 4E13A 1PF7E 1CUVA 1P1KA 5FEMA 4XAQA 5JLJA 4HQKA 2UXBB 5IN4A 1A9OA 3U37A 4RU1A 3I8OA 2HSGA 2A5YB 4BTEA 3EZ2A 4JYCA 1S9HA 4BKPA 3K2IA 1NJSA 4NK5A 3BAAA 1N36B 3BA1A 5B1IA 3OJLA 4BIMA 4PGMA 1C8KA 1TCBA 4MYTA 4QEZA 5BYKA 1GXSA 3OCCA 4FDUA 4L4UA 1T0BA 2ZIVB 4JLNA 2RIRA 1RDFA 1V3VA 1YOBA 3K7EA 2IS1A 4L5AA 2Z8YA 1NX6A 5J5CA 1GA4A 3B3GA 4HD8A 1FK8A 4RTMA 3I05A 2FSFA 1ZIDA 2QI9C 1L4UA 2EW1A 4DR6B 1TYEB 2V3VA 4KYIB 3SZMA 1D0VA 5TQ2A 4WKCA 3AEQA 3FFTA 3K8OE 2P2SA 1SJ9A 3DWIA 1A8QA 5B2FA 2HAEA 1YT5A 1JE0A 2W93A 5KAMA 4PZ7A 2QN1A 2RGAA 4TM7A 5FNZA 5F1OA 1NRIA 1CR2A 3C3MA 1AZLA 3QVOA 1AY0A 3C3DA 4Q18A 2AG5A 4BV8A 1AZSC 4N49A 3KWJA 3HRHA 3WA7A 5BWWA 2D1FA 3S99A 4YAUA 2ZRAA 3I5XA 3R6WA 3AOEC 3FMAA 4LSXA 3LKBA 4ZVTA 1VHLA 4WK4B 2XCIA 3N53A 5EHIA 3ZGLA 1BCRA 3RU9A 5EWFA 2O7RA 4FMCB 1QHHB 1TW3A 3N87A 4HZUA 5T4FA 3GJ5A 4WGFA 4YRLA 1YB5A 5L1KA 4EG5A 5KT5A 3LUHA 1OU0A 4F4FA 4L57A 5BORA 2V7TA 4EUHA 3FCSB 3PQFA 1AF4A 4GP7A 1DGSA 3TLKA 1ZN9A 4CQJA 2YZKA 5DBHX 4HQFA 1QGYA 2XHEA 5DNVA 1VI2A 4GPD1 2X13A 3HV0A 3B52X 3K94A 3B1KA 4PC3A 1V4NA 5AESA 5KREA 3R7LA 1CTQA 3RYCB 4FB5A 1UOQA 3H9UA 3JYPA 4CI9A 4X1KB 2ZIXA 2FR8A 2WFZA 4A0QA 1PX2A 2IKSA 3VC1A 4NYJQ 2C00A 1Z39A 4BEJA 1OC2A 2Z3WA 1TMYA 4LXIA 4ARCA 2OHJA 2JFOA 4LZWA 2EL9A 4EF5A 4N3NA 1SQGA 5JMOA 2GCPA 2F1IA 4EQZA 2VSQA 1KARA 2JVIA 2R5WA 3NGMA 3RI3A 2JGKA 4CC5A 1ZH6A 4G0VA 3RBXA 3NI2A 4PW0A 3BH6A 3TRHA 3WZMA 1O2DA 4M36A 2QVCA 4YP5A 2VKQA 2UXCB 1WMSA 1OXSC 3UA4A 4LHVA 4C0QC 2MMGA 4G9BA 3T5GA 1BVRA 2Q2NA 2D3TA 4UEOA 1YL6A 2BISA 4DMKA 2AC2A 4PG5A 3W9SA 1RK5A 4KR3A 3ETJA 3ESYA 2QE6A 2CLEB 1T8WA 4MUBA 1VPTA 3BORA 5AVRA 4C14A 2HJ9A 4MVJI 1RYBA 5LDDC 2E37A 4U2GA 1XWFA 2H85A 3HB7A 4MPPA 2LKDA 4L6CA 4KVAA 1UC5B 4ENRA 4EABA 4DR4H 3QKRA 1C3VA 3ZIUA 5JPIA 4QJ3A 4GEGA 1U8YA 3IQGX 3B8HA 1QAOA 1WOMA 5B4TA 3KV1A 4IQ8A 1ONBA 3L4BC 3L9XA 4BNDB 5JOQA 4B47A 2RE8A 2VTBB 3SLKA 3DO8A 3IOEA 1ONOA 3F7NA 4B3SH 1P5RA 4MQBA 5DE3A 2DPHA 4YA6A 4YALA 2HQRA 3T5HA 1KKLA 2KX7A 5K4HA 4CCAA 4KXXA 3T1NA 3KQOA 5EPEA 4ZQEA 3BPSA 1XRLA 3PTLA 3LT0A 4LXYA 2Q3HA 2ORIA 5JS2A 3A4LA 3BD7A 4BNGA 3HB5X 1HLDA 1XXHA 3OEHD 3IHKA 1P7CA 3CVUA 1XMJA 4V3BA 2CNDA 2NX2A 5FR9A 1XMIA 1XI2A 4US1R 1E7YA 3VHRA 3A04A 4BO8A 2NV6A 4TSKA 4YYEA 5IDXA 4O08A 3D8HA 3SQOA 1XMPA 3TJMA 2PMWB 3JQBA 4W8HA 3D0RA 1K97A 3EGEA 2B6HA 3KCQA 3UFXB 2H4JA 2ZB8A 2VJYA 3H8WA 3E22A 1TAGA 2WWHA 2PPVA 5L40A 2JKVA 1QR2A 3V33A 5JYBA 1OYYA 4C7OB 1RWNA 1Y1LA 2IHJA 3B78A 4YDRA 4XKJA 2DE0X 2FMTA 1B3RA 4MCIA 2WIKA 3HGMA 2C28A 1FFGA 2VP5A 1VBMA 3A1EA 2P9GA 2QB5A 3H4DA 1U1DA 2TMDA 4K9QA 3SFVA 3MQ4A 4IL5A 2GBIA 1BMDA 1N77A 5KTMA 1O4WA 1VBGA 4B46A 3NH9A 1NVMB 1V96A 3G13A 5A7GA 2QE7A 2R00A 1GOTA 2IE8A 3T12A 3T3NA 3WMGA 1OTHA 4V02A 1HX7A 2GNPA 3B7PA 4DDKA 1FFCA 5EFOA 4O81A 4NEHB 4GC7A 4LZNA 4UKDA 2DG2A 5JSFA 4G26A 2JH3A 1VBNA 4KFTA 5E95A 1P4AA 4DT1A 1CQIA 1NN1A 1MG0A 1NFQA 4DHEA 3I30X 3RW9A 5ED4A 3NM6B 1ADCA 4UQPA 4D8UA 4MV3A 2CHGA 2QHXA 1RT9A 2VT6A 3QUCA 4MPRA 4KQJA 5BWTA 5LLTA 3NVKI 2QG9A 1WMDA 2DBQA 5CP8A 5A4FS 4W9MC 4KQ6A 2C7OA 4L3VA 3R5KA 2BFWA 5JI2E 2B4QA 3WHIA 2XE8A 1AUOA 4Y30A 1ECBA 3KJEA 2FETA 2WTMA 5IC6A 1E4EA 3CLRC 3QP9A 3UA3A 3DOEA 3QGMA 1AUXA 2BI7A 1WPXA 2IIPA 5FNVF 3VVMA 5CUQA 2QD4A 2F8SA 5LYJF 2WZDA 3NNNA 3KQYA 2EJWA 4Q21A 1Z0DA 1VQ1A 4YUWA 1Q7GA 1EWKA 5TX7A 5JAMA 5CVEA 2GEJA 3PCXA 2ZTHA 1D2MA 3DYIA 2XW6A 1SUEA 3IPXA 4BP8A 1TFRA 3HPQA 3Q3CA 4DCUA 5KZMB 3VZRA 1GSAA 3PNOA 5G4LA 1J9GA 3WGQA 4R69A 2F3QA 3VR4H 1JIXA 5CIYA 1OWNA 1Q77A 1SHKA 4HLQB 2R4TA 2M32A 2VN8A 4TRMA 7REQB 2R6AA 5KUTA 3CXUA 4NPAA 3C16C 3MLBA 2XF2A 3SX0A 4RL4A 3BBLA 1J39A 1OVGA 3KVYA 4S05A 4RLHA 2P1RA 1O0BA 1TM5E 1N57A 5C3MA 4RJLA 3QMWA 2ZUSA 3KB8A 3HGQA 3BC1A 4CKYA 1WD7A 3H40A 1ZK4A 3I52A 2CK3D 3GUCA 1FVIA 2BKLA 4MIEA 2NMVA 3AV0B 4AG5A 2BC9A 3VO9A 4BEVA 3EPRA 4WL0A 2PBZA 1AG9A 2FRVA 2DC1A 3H1EA 1CIJA 4WV3A 3QW2A 1U2GA 1UT6A 2REQB 2PYIA 3C7DB 5P8WA 3IEVA 1WS6A 3EGXA 2CFOA 3J7AC 2GPWA 2I87A 1ZICA 3D43A 4Z8XA 5ENDA 1R8XA 1ZD2P 2PL9A 1A5TA 2ECOA 2VUMA 4NH0A 3UCEA 4GNKA 1BA3A 4WY2A 2FLPA 1BDBA 3BB1A 3Q7RA 2H08A 1S7CA 4M0EA 2C5GA 1VHDA 2Y4OA 4B7AA 2B1GA 1J9EA 1X2BA 2FHPA 5JJBA 2QD3A 1CB0A 1T1IA 3ASVA 1UEJA 4XARA 4I3FA 3E84A 5JAQA 2CHFA 3PXXA 3ZD9A 2OORC 1NONA 3KQUA 1P77A 4JSTA 1YU9A 4HX5A 1XAHA 1Y1KE 2QSYA 4JI0H 4UU0A 2IPOA 4OX9Y 2AXEA 5E2BA 2WHRA 3A27A 2XD4A 3KZOA 1H2ZA 1RXIA 4H31A 5ALWA 5B36A 4AIIA 3RGGA 3DOHA 4DLSA 3DV0B 3DBRB 3BXFA 5IYCG 1E9VA 4MWDA 1KPHA 2O19A 1NW9B 5JZOA 4JEIA 1UT5A 4MZDA 1YRYE 4XEHA 5D1OA 1V43A 2H4YA 3GD7A 3BWCA 4M1WA 1X94A 2VO1A 3GLIB 1IATA 2R6R1 4RUAA 4BGIA 5E3IA 3SXUA 2AR9A 2XYQA 3THYB 4BQFA 4PV7A 3RB6A 4DRFA 3E7PA 1ECPA 4NAVA 4MV1A 2VOJA 1M3SA 1S0NA 2MSNA 1FP7A 3CKLA 2ZUEA 3EGCA 3MWDA 2IW1A 2A9PA 3IBTA 3FETA 3OF3A 4FN5A 3ZWXA 5JWRA 1PD1A 4MIOA 3EEYA 1XRPA 4RMHA 3PD7A 3TW8B 3NKLA 4BPRA 3RTXA 4IYJA 3T1YB 1L4LA 1TZMA 4WADA 2OXIA 4PC6A 1EB8A 4E5SA 2AK2A 2X0EA 1O87A 4P7BA 1B76A 5CFOA 2AG0A 3K0FA 2QDXA 4ROSA 3WQRA 4QU8A 1WCV1 3I76A 1FB5A 3QEMA 4MICA 1MX3A 3DP7A 1JG4A 4LRTB 2JHGA 4HSGA 3OQBA 4Z4IA 2QTLA 4BXOA 5TSDA 2O6LA 1WVGA 2XSZD 1Y80A 1V7CA 1DPFA 5KT7A 3GFGA 3DMHA 3OEHA 4RIEA 3C7CB 3DE4X 1UXGA 4PVDA 2JRLA 1A7UA 3PO2G 3KQMA 4YAGA 2G7MC 3TLCA 5AVTA 2DRIA 2BHSA 3QK7A 3U7IA 4X66B 1T8SA 3JZMA 4EO7A 4P32A 3K6SB 1OREA 1UMBB 5KFCA 1FQJA 4B3JA 4RVHA 3F6BX 3KKZA 2D0OB 4MW6A 4XPZA 3GLHE 4MULA 2C5BA 5H3LA 2QLMA 1EUDB 5E9AA 5DP2A 1V3TA 2P62A 4JD5A 2IZ6A 2XA9A 3UMSA 5F12A 4XGNA 2FXIA 5H1YA 3TG2A 1DO2A 4G84A 1VI5A 4KACA 1KR2A 5DGXA 5FUBA 1DEAA 3KQLA 4B3BA 3COJA 1QIJA 2OLKA 5DTIA 4ND6A 2ZANA 2AJDA 2FJUA 3Q3JB 4RSHA 4J2HA 1MW9X 1YFKA 4RE6A 3T5CA 4UOEA 2FK3A 1WZCA 2BKAA 1HH4A 1VBHA 5CB8A 1GEEA 5JSUA 5ALRA 3CT6A 1BE6A 2ZM6B 2W6PA 4ERXA 2DSNA 3RTDA 3VTKA 2VEOA 2QMQA 3E03A 3GWGA 5KOHB 5D3MA 1H0HA 1RLJA 1Y42X 5CCEA 4F72A 3DE6X 2UYHA 4PYLA 4MJ3A 3CZAA 2DP4E 1TUBB 3HVKA 1DC5A 2HEGA 4LDPA 4BO2A 1P72A 1Y6FA 3LBHA 3LTEA 2NVUB 2J0QA 5ADWA 1C7FA 3OM9A 4DXHA 4W7SA 4N6GA 2A1HA 4G1BA 3QUAA 5K0LA 2NSHA 2PE5A 2PZBA 4JP5A 4ZTUB 1JDBC 1N7HA 2FGJA 1P44A 3GXBA 2D0PB 2ZREA 3R3ZA 1LWOA 4YMWA 2HSEA 1MX1A 2E4AA 3IIEA 1NC1A 1FVXA 4DCNA 5CDFA 3OHPA 2PWAA 1Z5ZA 1YZGA 2W6OA 1P6XA 2XWQA 3OFSA 1V39A 5HZMA 2VK4A 1TVKB 2COIA 4ES6A 3I6QA 1O95D 2DHEA 4DPKA 5DYYA 5C1PA 4RFLA 4RS3A 1DINA 4JC4A 1F2DA 1ZRNA 1U1FA 3CLHA 4PYNA 3CRMA 1JJFA 1XALA 1F6BA 3A1UA 3D2BA 3WXMA 1Q5PA 4G86A 5F1PA 5K8CA 4RKEA 2HIVA 3BABA 2G9NA 1Y89A 1KPIA 3KR9A 3K1TA 5AKXA 2I7XA 4HDMA 1MIOB 3TIXB 4ZO6A 4Q9HA 4TLEA 2PMDA 4XYLB 4KQKA 4N40A 4MDEA 1YR9A 3PR2B 4ZVVA 3R41A 4C88A 1LA2A 4BX3A 4NMXB 4MEJA 2AVDA 2UVRA 1GPLA 4DLLA 4Q7JB 4YUYA 1DUIA 1SOUA 4HH4A 3N59A 1RRMA 3E9CA 1KTAA 2A1UB 1ZOPA 3GZNA 5BRNA 2QP3A 4GX1A 5KFLA 3B1YA 5C1BA 3DD1A 1BOOA 2QVXX 2ZS9A 4JODA 1F2UB 5ANRB 2VF8A 1JIIA 5DTRA 2XUDA 3ABOB 3TGPA 4MO2A 3QPVA 3HBFA 2DBZA 1JFFA 1KI6B 1E2KA 2PRZA 4ETSA 3A9TA 3QXJA 1C1XA 1HE3A 3W8EA 1ZD9A 2CW8A 5JFTA 4TV8A 2YUIA 5K3BA 5CB6A 4A23A 2FF5A 3R7NA 1ZGZA 3WYFA 2ZE7A 3ICPA 4HP8A 2UU9H 1G5TA 4YJHB 5LMCA 5DGIA 1IEXA 2UAGA 3IPRA 4GKKB 3NM4A 4ZQHA 1Z4IA 4YASA 1O7JA 5I9IA 1UANA 3QWAA 1VLHA 3V7FA 1P7PA 1T2CA 3EVNA 4AP9A 3UQ8A 3R5SA 4FHDA 1NDUA 3AH8A 3GRRA 5G0WA 3ESRA 5LN1A 4DN6A 4BB5A 4DA0A 1FDRA 3EY4A 1O9HA 4OHPA 4KQXA 4YJDA 4TUYA 3MQFA 5JNSA 3WQQA 1I3KA 3VZQA 3KHGA 2WM3A 1RWWA 2V9WA 1PJZA 3ONEA 1P7ZA 4DABA 5BWRA 4BJ3A 1T0UA 4LHSA 1OB2A 1I2BA 3D6JA 1XN1A 4YC7A 4BBZA 2JCSA 1H9AA 1KU6A 1MO6A 4MVJD 5EJ9A 5EHZA 1SN7A 2DWOA 5BWXA 1GCIA 1Y81A 3SKVA 3X1WA 1NQVA 3KKQA 1LNZA 4RPLA 4N5MA 1UPXA 5K3FB 3OE1A 1U7TA 1K63A 3SEFA 3UAYA 4UUGA 3CF0A 2HA2A 3HUFA 2HQSA 3QBDA 1VL1A 4JYZA 3TLXA 1XVVA 1SHZA 4PZCA 1QAQA 4DV5B 2BBTA 4TMVA 2ID9A 1JL3A 1GVNB 2V65A 4HPJB 4LXUA 2JBWA 2QORA 2DJ5A 1PJ4A 2VQFB 1DBPA 4JC0A 1YH3A 2C4HA 2I4RA 3G2JA 3RADC 3EMVA 4UM8B 3FTFA 4UTRA 1US8A 4BNNA 3NBQA 1R0XA 1I6LA 3UPTA 3O8NA 2Y0SA 2QU7A 4QOSA 1PWXA 4AJ1A 4ITUA 3RIMA 1N0HA 3CTPA 2RHOA 2GTHA 1WSCA 4I1OA 2VUUA 3GEPA 4RA6B 2WK1A 5ALPA 5AM1A 5K3CA 4E2YA 1PRYA 2VTDA 4BKUA 3BZWA 4EJ2A 1NXQA 1F4PA 4RELA 2CD9A 1A8PA 3KQVA 1JSXA 2I7TA 4FKMA 2JCBA 3LFUA 4R8VA 3OCVA 2DXIA 2QJOA 5BWNA 2XTMA 4NV0A 4JI4B 4O2BB 4H7FA 1X7ZB 2YOFA 2JCYA 3LQKA 3MELA 5AKHA 2O7SA 3PO3G 1A8SA 4LMYA 4PFSA 1CKMA 10MHA 4B3DA 1QSGA 2GN2A 3PUYA 2WFLB 1W59A 2XSZA 1R3DA 5FL3A 2E48A 4YCJA 5IAOA 4WHXA 4WNIA 4C7BA 4AZ3A 4Y18A 1RPZA 1TA8A 3GYGA 2KB0A 5E6RA 4GH5A 3HB0A 3OC0A 4C1NA 4F2PA 3ZVKA 3BE4A 1VE3A 2B25A 1PGQA 1KS2A 1P4HA 3GLRA 3K1YA 1AHHA 1EWVA 2J33A 3DC2A 2QUZA 1UJBA 3NHMA 5KDOA 3FIJA 2C2KA 1KOFA 4XYBA 4ZYUA 4JKOA 1DHRA 4OHZA 2AZ4A 4TS9A 1JQLB 4BOYA 4AKGA 4B85A 4FKZA 1JIVA 5AW0A 1V9SA 4Y6QA 1HQDA 2ADMA 4X65B 2AMYA 1A7AA 3G0DA 3G2IA 4YWJA 2A88A 1SVKA 4OI1A 3W4IA 1EK5A 4QOEA 2FKAA 1GTMA 1RQNA 2TRSB 5K8TA 3QELB 5A9SB 5MN5A 3T7SA 1KMMA 3C3KA 2FP4A 1NUSA 3QE0A 4Q4JB 4O4HB 4ZCRA 4UVIA 5FTWA 3CX6A 5LUBA 4W8OA 5FI5A 1ZMOA 1XQ9A 1IOLA 5BNTA 2ASEA 3ICEA 4MKFA 2BAGA 5K4GA 2VAMA 3MA0A 4DQDA 3JW8A 4O3PA 4ZI7F 2IUEA 3PC4A 3G0HA 2ZRIA 4PHFA 5KG1A 5TPWA 3P27A 3ZXUB 2DPMA 4NY1A 3RYTC 4RWZA 4JV0A 2FEXA 4XWTA 5D5PA 2QTZA 2FPGA 3ZX5A 1A9SA 4YI3A 4L5CA 3H5WA 3BJIC 5LXTF 5KVCA 2CZQA 4E33A 2WWVD 3EOAI 3PCRB 2HI0A 3EVTA 1XZPA 3AEUA 5CR5A 3PFCA 4EKDA 3NIGB 4CIBA 2LUOA 1FW8A 3BMNA 3HC7A 1CWUA 1O95A 3NC0B 5HILA 4K0RA 3R7SA 5HJ5A 2FG7C 1I6KA 3AUXA 2GN8A 2P6RA 3REQA 5JRZA 1KRHA 4ZIRA 2LWIA 4J7UA 2ASDA 1CUXA 4E30A 4QNRA 3HJGA 3FJOA 4MB2A 2WHEA 4J9QA 4BKQA 2H65A 3FCAA 4HJRA 5F5LA 3NDBB 2B82A 4O3QA 1G8PA 3CYFA 1E2HA 2AUMA 1EFTA 3N2KB 2OA0A 4IPTA 3TYXA 2R7LA 4XI9A 2G9VA 1HOTA 2C7QA 1ULSA 3C5EA 1ZW1A 1SXGA 3IP8A 4DM4A 3PKJA 2WF8A 4PZ8A 1GQ2A 4L95C 4OH7A 1G5PA 1WDTA 2BTEA 4JI8H 1XU7A 3WAGA 1E3QA 4QWAA 3T3GA 1WAMA 5JNRA 3A1FA 1XROA 2VJQA 1ID1A 2EEPA 3TOCA 1I1LA 3LWDA 5HRAA 2VSOA 2QRPA 2IX9A 5PGMA 3NIBA 4U7DA 4B83A 5AW9A 4K26A 4QFDA 1QHSA 2FCRA 5TQJA 3GLGA 4KLNA 3OOWA 1JR3D 3DKIA 2YRFA 4KN8A 4DV7B 4CQLA 3PG5A 3TOVA 2FTKE 2Z02A 3H3XA 1EFUA 3RASA 4JV5B 3KQPA 3GA7A 3H8VA 2EKDA 5EKUA 3QVWA 4TTQA 3KTAB 1YCHA 2Z83A 3C1TA 2AA3A 3C97A 4FVTA 2BPOA 2DSTA 1OGJA 3JALB 3W2FA 4ZVLA 1SZPA 4ECZA 2PX3A 3BGOS 3OAAD 3MIZA 4A0FA 1E9CA 4ZQCB 1IN7A 4CKCB 3FGPA 2PL1A 4I4LA 1F1BA 5IJ9A 5DHAA 3AY7A 4RACA 3M89A 3GGPA 4C0XA 2CJWA 2F1OA 1KYWA 1T5OA 4GLBA 2NTNA 4LMPA 4F7WA 2JVKA 1XZDA 3O83A 3H2KA 2ZSDA 3OZRA 1E66A 2W8BA 3L4JA 1KI3A 3OFND 1VIAA 3KOYA 4D57A 1HDGO 3FDXA 2E4VA 4UNQA 2R7KA 1K8QA 1ISHA 4MVJH 3ER6A 2W4QA 2ZBVA 1ULZA 2QI9F 2QN8A 2CHUA 3V55A 3BL5A 3WK5A 5DRYA 2IV7A 4F96A 2IH4A 2G8NA 2GJ4A 4ZT6A 3KXLA 1G8YA 4QSMA 1VJDA 2ERXA 1E8NA 2Z5FA 3OEYA 5K0JA 4DLBA 3R6LA 3PPIA 1WRVA 3GQVA 1S5PA 4KXUA 3MJTA 1EFKA 2CXPA 3NTVA 1ZRSA 4QM6A 1JFRA 1NMEA 4OATA 4LF4H 2ZI4A 1FFWA 4QTYA 1U9IC 2FU5C 2CF6A 1OZHA 2G5GX 4AJIA 2BFBB 5EGNA 1T8UA 3SF8B 2HJSA 5CM8B 2QMUA 5ILOA 2P4SA 2IE0A 3C1UA 1AXRA 4Q8EA 3G6KA 1NUPA 1T9GR 5KFYA 3OLQA 1W1IA 4EMUA 2ZBGA 1KAGA 4EIWA 1HURA 4WESB 3EBLA 4WCFB 2BJHA 1EWRA 3SQWA 3LPCA 1ZCZA 4S2EA 1PFWA 4EY3A 4QGSA 1QMGA 4AY3A 1PGOA 3MMPA 2QU8A 1MVLA 1RVV1 5HFNA 4EQ5A 1SVSA 1JZQA 4CQMD 1KDOA 2JJYA 1P39A 2VSYA 3D4LA 1YVPA 1ZC4A 3RWBA 1YU6A 4F2GA 3LQRA 5BUCA 4O2LA 2Q3DA 2BGJA 4QXMA 3P4XA 3PJDA 3G59A 2PZGA 1ATIA 3TLMA 3HI4A 3PE3A 4D3FA 1RLTA 2NACA 5C46F 2VG8A 4ZCTA 5ABPA 4ZCPA 3PD1A 3ACDA 2XJ9A 3M1LA 3D3JA 4F3CA 3II6X 4DYHA 4J1NA 2R8RA 3OZTA 2E2HA 2B2CA 4PNPA 3B3JA 4HQLA 4Y6LA 1FS6A 2MIIA 4JA0A 4QXPA 2JJ2D 2H07A 3A9CA 3IURA 2YW2A 1CW2B 4TPKA 3QBVA 3A3PA 3KALA 1ZUWA 4LWOA 4LJLA 3UMMA 3KB6A 1JKMA 1HQKA 2O8EB 1CZNA 2CDCA 3K4HA 4AYWA 5B30A 3OCJA 1W6UA 1FUEA 1RWMA 1YKFA 3FN4A 5BR1A 3DJFA 4Y7CA 4J90A 4OM7A 4N3CA 4RD1A 2HRRA 1R4MB 5I7WA 3LUFA 1ISSA 2EV9A 2PH5A 5KSYA 3OMLA 2V98A 4YH1A 3AUKA 2ZSHA 3X1KA 4ZT2A 5FBLB 2O1WA 3IESA 4WOCA 4I55F 1JQJC 1EG2A 3H5NA 3EZYA 4BNXA 4YUZA 1H3EA 5I5UA 4YRBA 2QTGA 1JBKA 3KZNA 3RVKA 4MV7A 3B2NA 4FQ8A 4Z7OB 1VCIA 2G70A 5HX7A 4O4LB 3GP8A 1R8YA 1NG9A 1N6OA 1N2ZA 2GBLA 4MZXA 5HFAA 3AVYA 4BLRA 2R8BA 3ZU3A 4KXVA 3UHJA 2Z1NA 3BTUA 4XDZA 5FWDA 1YJQA 1L5ZA 2A30A 3L40A 3Q3EA 5BWMA 3N40P 1TU4A 3B70A 1Q3HA 1AB6A 1GKLA 3LE8A 2CEAA 3O4VA 2WP8J 3AINA 4HB0A 4IILA 3CF4A 4JLJA 3LY9A 3JQFC 1SZCA 3AVPA 2EP7A 2OCLA 1NRXA 4LJSA 2BN4A 2Y0EA 4NWIA 3KPVA 5HE8A 2CFMA 2ONKA 1EAYA 1TKCA 1LWNA 3M4XA 4DRYA 5DNYB 4QDOA 5B1HA 1W52X 5GOZA 3FMGA 4F92B 4LY6A 2O2CA 1THMA 1N56A 4O33A 1U2SA 2WQ7A 4F0JA 4TLCA 3KETA 2CNQA 4YAOA 4MKIA 3BIOA 2CC2A 4X1IA 4TLLB 5C4XG 2V58A 5T64A 5JW6A 1U0GA 2QZJA 4MIKA 4JQSA 1PL0A 4I4IA 5BPHA 1FDTA 1L6RA 1X42A 4CFSA 4LBVA 2F7SA 2J0UB 3WS7A 4F85A 4R1PA 5CNIA 3QXGA 1N3BA 1QYXA 1JSZA 4DZTA 4OFBA 4UCFA 1YQUA 1AHPA 2WIBA 3QF4B 1LDGA 1NW4A 2BT4A 4YJ3B 1AQLA 1THGA 4QKQA 3L07A 1R8JA 2R8IA 1JXQA 3KTMA 3KTDA 5DM60 2X86A 4C03A 2G36A 3SBDA 2GLTA 5HKLA 4MVXA 1Y4SA 5BR4A 2QG6A 4YDHB 1LPNA 4TKUB 3NAGA 5HIIA 3JPYA 1D04A 3SZLA 3VH2A 3TQSA 2FUG1 1HV8A 3AEKA 3AV3A 5LYYA 2RIPA 1JR3A 3TZBA 4PX5A 3PR4A 4H27A 1FX0A 2G5CA 4XFJA 3RC1A 1DT5A 4NJMA 1JG6A 1JVNA 1SPBS 2GBPA 1RJDA 2O2IA 5L7YA 3BG5A 3NHSA 3DHNA 3A11A 3QKUA 1E0AA 3C98A 1I51A 4II7A 4MRMA 3P4UA 5HDQA 1GG9A 3AW9A 1D4ZA 3BXEA 3ACBA 1BJKA 1A88A 2CNKA 3RHTA 3GT0A 1LTKA 3EUFA 5CDTA 3J80W 1KL7A 3HYCA 3OAAA 2OYRA 5CXQA 2A7XA 4HAUA 4ADSG 5AW2A 1CJBA 5FWXA 1E7MA 1Q50A 4MYHA 4ZICA 4P7KA 2RB5A 4JC5A 2HK6A 2JDID 3BH0A 5GPBA 3NCHA 4CV2A 4CKBB 2ZOSA 4UXJA 3LX6A 2HF2A 3IO5A 3LA8A 4BL5A 1ODKA 5G0TA 3PDIA 1AV7A 2PBFA 3HWRA 2QVZX 3OWXA 5I9NA 1GPNA 3OVMA 4G1EB 4LF7B 3OFNA 4BO6A 1LI7A 4NFHA 1FQOA 1E69A 4OGWA 4ZO9A 1JIHA 1XIVA 4HMOA 2DH5A 4IMRA 4GGOA 4KAJA 3K09C 1KMCA 5REQA 1IBMB 4NYIR 4KFRA 5JARA 1PU2A 3PGXA 5CVJA 3FYUA 1EFRD 3QEKA 4FXOA 3PXBA 5JVDB 4AJ2A 1WABA 2B1IA 1VAJA 5ECGC 5AVSA 2PXXA 4RZ2A 3I5YA 4QDXA 4KHPH 4H7KA 4NXNB 5AH0A 1QWOA 1L9XA 5FYDA 2JJ1D 1GLVA 4O5OA 2RARA 2DTEA 1H2EA 2YWEA 4F46A 2R4QA 1H0RA 3VNSA 2Q27A 4UEWA 4BAGA 2RGDA 1ADFA 2ZAYA 4RMGA 5JWHA 1B7GO 4K6CA 1QIGA 3M9WA 2R93A 5B3JC 3MCWA 3WRYC 2NU7B 3OQ6A 1IXRC 1GQOA 3LHDA 4DA9A 3B6KA 3SOZA 2QTTA 1QYCA 1Y4AE 4JENA 5I7OA 5EIOA 3LKDA 3ICQB 3T5JA 5FDFA 2YWDA 3OX3A 1KERA 1PNVA 4CQMA 2V8OA 4PN7A 2EG9A 3GDEA 2PJRA 1E89A 1KSHA 5JIBA 3TTUA 3RFFA 4MUHA 2K6GA 2WIDA 4QOFA 2X9GA 4BASA 4CTOA 3IHWA 3D7LA 1I6UA 3SU8A 3MJRA 4LC9A 1QG6A 4UAVA 1AQYA 3GXOA 2OBYA 3IFSA