2FP4B

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gtp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 131
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fp4B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fp4B02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fp4B03
3TQTA 2W6MA 2R6FA 5EZYF 5J2TF 1EZ1A 4O7WA 4YB8A 1KC7A 3GIDA 2DZDA 3KREA 5LOVF 2CNUA 3JRWA 4MV9A 4HR7A 2Z04A 3LP8A 2I8CA 1JKJA 4HQ6A 4Y8VA 3SE7A 1CQJA 4IIJF 4ZI7F 2YZLA 3AW8A 3PFFA 1OI7A 5CAEB 3WO0A 2XCLA 3RUPA 2V58A 1EUCA 3ORQA 1I7NA 4XYLB 3KAKA 2NU8B 2I80A 1B6SA 1OBDA 4O7LA 5BPHA 3V4ZA 5DMXA 4XX0A 3ETHA 3VOTA 3VPBA 4XZ3A 2I87A 2Z02A 1UC8A 3U55A 3OUZA 4MV1A 1M0TA 2YWVA 4EGQA 5JVDF 3RFCA 2NU9A 4I50F 4C5CA 1EUCB 1I7LA 3DF7A 3VMMA 4C5BA 3MWDA 5LA6F 2FPGB 2C00A 4FFLA 4MA0A 3N6RA 3E5NA 3U54A 1EHIA 5H80A 1VBHA 3R23A 4HNTA 5K2MA 1JLLA 1M0WA 3V4SA 5BPFA 3U9TA 1SCUB 2J9GA 4TV9F 5GONF 2FB9A 2WYOA 4ME6A 3JZIA 1IOVA 2YS6A 5JH7F 4NYEA 2YRWA 1C3OA 3GLKA 2FPGA 1PX2A 5I47A 4FU0A 4O7YA 3G8CA 1KJ9A 1UC9A 2FPPB 1IOWA 1E4EA 5D8DA 1Z2OX 1JDBB 4FFNA 1OBGA 5KKNB 1JLLB 4MV7A 5CA0F 2GQRA 1SCUA 2YL2A 1AUXA 2VQDA 4ZOLF 1A9XA 2P0AA 3TINA 1BNCA 2HGSA 3MWEB 3I12A 3Q1KA 4O4HF 3HB9A 2FPIB 2CQYA 2R82A 3TW6A 2R85A 3DMYA 2YV1A 2ZDHA 1KJJA 2NU8A 2FP4B 5C1PA 4O7VA 1KJQA 5IYZF 3UFXA 3KAJA 5FNVF 2NU9B 4FFRA 4YBZA 4ZQIA 1DIKA 4XZ3B 1EUDA 2FPIA 2NUAA 2GQSA 4O7SA 4IWXA 1GSHA 3TIIA 4YJ3F 3JRXA 2YRXA 5BMVF 4MV4A 3UFXB 3AX6A 5LXTF 3ORRA 3HO8A 4IWYA 1GGOA 5JVLA 4YAJA 3KALA 2R7KA 2HJWA 1CE8A 4O7ZA 4E4TA 3NUAA 1CQIB 3Q2OA 2NUAB 1KUTA 2DWCA 2DLNA 3OUUA 2R7NA 4FFMA 3WO1A 3N8DA 3LWBA 4YAKB 5LYJF 1Z2NX 2YS7A 1E4EB 5JQGF 4EG0A 1KJIA 4XYMB 4O82A 3VPDA 1M6VA 1GSAA 5JQWA 2CNQA 1AUVA 1CQIA 2QK4A 4FE2A 2GPSA 2YZNA 4TUYF 5HV6A 4DIMA 4MV3A 1GSOA 4O84A 4YJ2F 5HBRA 2R86A 4YAKA 4QSHA 2FP4A 4O86A 4O7RA 2PN1A 4XYMA 5CAEA 5CB4F 4YBZB 4RZQA 2NU7B 2W6OA 4O2AF 3U9SA 5C8YF 1WR2A 1EUDB 1KBLA 3TIGA 3WNZA 2YZGA 2X0SA 4FGRA 3R5HA 2ZDGA 3R5FA 2SCUA 1JDEA 4O81A 2IP4A 1GLVA 4I4TF 4IZOA 2CNVA 3HBLA 1DV1A 2QF7A 4TV8F 5C1OA 2YZMA 3MJFA 2YV2A 1DV2A 4YAJB 3K5IA 2V5AA 3MWEA 2V59A 4I55F 4O4JF 2NU6B 4FFPA 4WD3A 2W6PA 4MV6A 5J2UF 4WBNF 4O4LF 2R87A 1C30A 1T36A 4YB8B 4HNUA 2R7MA 4O4IF 1VBGA 4O83A 4IHJF 2W6QA 4MAMA 2VPQA 1JKJB 2R84A 4HNVA 3K5HA 2OLSA 2PVPA 1KJ8A 4L1KA 3ETJA 4ZHQF 1ULZA 2NU6A 2GPWA 3BG5A 3G8DA 1Z2PX 1KEEA 3QFFA 5HBRB 2YYAA 4XYLA 2W6ZA 2FPPA 4O7NA 5LP6F 3RV3A 4M9UA 2CZGA 4FFOA 2VR1A 4EGJA 5KX5F 2R7LA 4XX0B 2ZDQA 1CS0A 1W96A 4MA5A 3VPCA 2W71A 2DIKA 5CA1F 3MWDB 2W70A 4O2BF 4C5AA 2XD4A 1EYZA 4MV8A 1BXRA 2NU7A 3RV4A 3R5XA 2PBZA 3K3PA 4O7TA 1W93A 1A48A 1B6RA 3VA7A 1PK8A 1VKZA 4Y8VB 1CQJB 2GLTA 4DLKA 2YW2A 3JZFA 2SCUB 2CSUA 2W6NA 3R9RA
chains in the Genus database with same CATH superfamily
1SD5A 4MAFA 521PA 1APBA 3W1GA 4I46A 2W6MA 1WOMA 3P9SA 4O2BA 2NUTA 5AUPB 2VP9A 2XDWA 1RYZA 3EFOA 3VV2A 4E4YA 2B78A 1U7PA 2XTMA 3KEFA 2NZYA 4QLOA 4WZAE 4E6PA 3UPTA 5L1KA 5HDBB 4FXOA 4GX5A 1PL0A 2P4UA 3EA0A 3UXYA 1SVMA 1GG8A 2EZ8A 3LQYA 5BURA 4NH4A 4H08A 5IBCA 2Q6TA 1LDMA 3QPWA 1CK4A 1TF2A 1FMCA 3K32A 2X0KA 2UUOA 2P78A 4IH1A 3TOCA 3FNFA 2ZSJA 3PZPA 4HC4A 4HQ6A 3BHIA 3DJYA 4OM8A 1P62B 1TW2A 1P4AA 2DBYA 4Q4HA 5ED4A 2G36A 2QM7A 3H5VA 1IUPA 2JDID 4M8SA 1E64A 1AV7A 2NVUB 2VYFA 4D45A 2WWFA 3M9OB 4N48A 4I6JA 2ZI4A 4K2HA 3CSWA 1BVUA 3CR7A 3KB6A 5IUNC 2JD2A 2VAXA 4ZOLA 3R0ZA 3TRJA 5IYBG 4B40A 2FETA 4OBWA 3L7OA 3E22B 1L4BA 1H2ZA 2QUIA 5EJAA 3ZN2A 4RGQA 2N42A 4ENQA 2VDWA 5BSVA 5ES3A 4IDFA 2BR5A 4F7WA 5CITA 4CIBA 5JWRA 1A8UA 2X77A 3BXFA 3ESYA 4XYBA 5C8VA 3IELA 2XIQA 3RUPA 1FF9A 5EE5B 4U7GA 1NXXA 1QZUA 1XZPA 1E2DA 3T1OA 4N5HX 3K6SB 1H66A 3JU3A 3OU7A 1SCIA 5CJJA 4ACAA 1BDIA 3SJUA 3RAQA 1M8GA 2PZBA 5FPYA 2FNAA 2H31A 2FGJA 2GK4A 4FHFA 1I3LA 1TTPB 2LCIA 2YJZA 3G0BA 4O08A 4HEA6 3VUEA 2XUKA 3TQOA 4DA9A 4KJZA 5H8WA 5DBEX 4IFEA 1T24A 4KAXA 3Q8LA 3LWZA 4EB6A 1F5SA 1QG0A 1LPBB 4HVAA 1GAEO 5TPZA 3RRJA 4B2IA 3UHFA 1C9KA 4QT0A 3GA5A 2J30A 4Y6SA 1L9KA 3U49A 1I36A 2PCLA 4M7RA 5JZ9A 3U55A 4LYEA 2IA5A 2GBLA 1FLDA 1NJGA 2YXNA 4YY3H 3BGDA 3MB8A 3MGAA 4FYPA 3IKVA 4UVIA 5H68A 4XWTA 1QNFA 3ST7A 4CM4B 4ZYLA 1KR2A 1DX6A 4P33A 4O4LA 5J5VA 5BV8A 4FMPA 1E79A 4V0KA 2B1IA 2QRZA 3QE3A 3Q7IA 4LY6A 4BLUA 5DP2A 4ZZ3A 3E0XA 3OPNA 4WZBE 2HH9A 4RTMA 2N9UA 2BGWA 2UXBB 4GFDA 3C3PA 4GL2A 4JXUA 1GFIA 1KH1A 3AYZB 4X45A 4ZTBA 3K9LA 3KXIA 1ONPA 1U2GC 3TSOA 2PU7A 3DLBA 1UOQA 4CKZA 1UH5A 1C5KA 3IILA 5KT5A 1G2OA 4BNXA 4OP1A 1JR3A 1QO9A 5LZ7A 4DNFA 5KFSA 4EY7A 3RUAA 3IAFA 4HH4A 2EP5A 1T8PA 4B4VA 3EPLA 2D8AA 4Z99A 3Q1LA 2FWIA 3ETDA 1UNNC 3CVZA 3WK6A 4A36A 1R0ZA 4LZPA 2P9TA 1ARZA 4JBNA 5KZMB 3W1WA 3HDVA 2OVFA 3KR1A 1Y1VA 2QDKA 3THOA 3PNBA 4IV8A 3UQYS 2XEDA 1RXCA 1CF9A 1FFSA 3HCBA 1SKMA 1EEXB 1PQUA 2K7FA 4WESA 5EXDA 4CLRA 1L4KA 1PYDA 2J3IA 1RXYA 2ZRPA 3IBSA 1Z68A 2JHCA 1LQ2A 3A9TA 4EYQA 4ZDKA 3RVNA 1E0DA 2YS6A 3EIQA 3JQ8B 4COKA 4ZMBA 2BKEA 1AKVA 1NBEA 5LQKA 4EWLA 3RGXA 4LRYA 4Z4IA 3LRPA 1PP4A 2WIBA 4I3GA 4QULA 3GGGA 4NOKA 3GFFA 3DEYX 3WNQA 1KVRA 3PUXA 2PUDA 2F9LA 4DCNA 2XHEA 1FJ2A 3EEYA 3OQPA 3W0LB 2FPPB 5ALGA 4QIHA 3JQBC 1IOWA 1MTZA 3EDMA 1E9BA 3FHLA 1AA9A 1JDBB 5EAIA 3QWAA 5LU8A 5HJ2A 4EY4A 2GK3A 4CLEA 2KJQA 2VRBA 3H65A 4RTNA 3QGMA 2QBYA 5JZVA 1XJ0A 3KBOA 1EHCA 3WRYC 3PB3A 4RB0A 2BFDB 4L50A 4ZXFA 3RS8A 4EATA 3HSSA 3HHEA 4ECXA 4N3NA 2FI1A 3H1GA 2IGBA 2NYUA 4KXFB 2B1QA 4DAEA 1CF2O 3DS8A 2GN0A 5EXTA 4OQLA 2E4XA 2E89A 3OI7A 2BSXA 5CH3A 2AW3A 3IPRA 2QRJA 2Q4BA 4RMGA 4RA9A 3DYIA 4MW5A 3CLRC 1T6NA 3PX3A 5AK6A 4BVKA 3NBYC 1FSZA 4Q7LA 2DLCX 1SG0A 4QVIA 1U8YA 3KTAB 5CNIA 2HIMA 1Y1WA 2CXSA 2ID4A 5CCBA 1GEEA 2RK3A 3IUPA 1W4AA 1GNVA 4PHGA 5DNUA 1AHIA 4JIMA 1U0LA 4M0MA 4ZEXA 3VVLA 2RI0A 2WFMA 3KEOA 4KFTA 3PK0A 1RACA 1JUDA 3BDAA 4GBED 4N0EA 3W2FA 3QG5A 3PNPA 3NASA 3JQAB 2ZTUA 3MOGA 5JISA 1M6WA 1NSTA 3QHPA 5DH9A 1Z2EA 5AKHA 4MP8A 2WWYA 3FYDA 3N44B 3LAWA 3FBWA 3P2JA 1Z28A 4RS4A 3V3KA 3AM1A 1JKIA 4ZQIA 2H63A 1FRZA 3GLHA 5AM4A 2EFHB 4QYIA 2BI7A 4FLFA 1U31A 3E7XA 3C5CA 1Y1WG 2BKXA 4DR7H 1IY1A 4RUCA 1BXGB 1I6MA 2GD6A 1NHGA 3R9WA 4BX9A 3C24A 3C14C 2Z4SA 2ZLBA 5CTAA 2DLDA 3P4XA 3LO8A 3V42A 1DAMA 3EZGA 4BE7B 4CKEA 2KX7A 3BRQA 4OOEA 5BSRA 1ADCA 5K51A 4P3OA 1M8JA 3EXFA 2ZI5A 4TLLB 1UIMA 4LFCH 1D7OA 1VLQA 3DOHA 3IH5A 5ERXA 4FGLA 4RUAA 1RXUA 2Z6VA 3EUFA 1O4VA 4A7PA 1UPFA 4DF3A 4ZMRA 3KHSA 2VK8A 4P08A 5LL6P 4OJKA 1R4ZA 1QPBA 5B3JC 4PBSA 1G64A 1NVMB 3T7JA 5KQRA 4Q1VA 1P5RA 2ZCJA 2Q9CA 5CFNA 4ZVKA 2VG8A 4CQMB 2C9ZA 3MTEA 4MV4A 1XZNA 3AB7A 2OBNA 4AROA 3UFXB 1V96A 2LDBA 4WA8A 1NT4A 2P9GA 1BVHA 3F6SA 3TXAA 1P1JA 4GE3A 2P77A 2E4WA 3GC6A 4ND5A 2X6RA 5EWJB 4BTEA 4N76A 1RP1A 2WVAA 3O0TA 3FDSA 1E8MA 2RGXA 1DOHA 2LBPA 3NRJA 2G7MC 4I2NA 1WCXA 4GMDA 4OI1A 2M6LA 1Q19A 4QFDA 1IEVA 1YA8A 2QN3A 1XTRA 3R6WA 4KN5A 5DSZA 4DRFA 3WAGA 5ALJA 1P5JA 1ADYA 1S2OA 2ST1A 4RJ2A 3GB8B 1RHKA 2GCOA 2PZJA 2JA6G 1BX3A 3DFZA 5AKXA 1OX6A 1FP7A 3NHLA 4EZIA 1TO6A 2KSQA 3RS0A 3EJWA 3SS9X 1US8B 4ARIA 2D2IA 5ESRA 3H2BA 4UAVA 3OO0A 3MTBA 1Q1AA 3WP1B 1P2BA 4E7PA 1LVUA 4AJ9A 7GPBA 5ADVA 5J1SB 1Z6AA 3F90A 2NXWA 4YLEA 3ZOKA 1Y48E 1NMXA 1KNQA 1PRYA 1TO1E 2VT7A 2YY6A 2VF8A 5LDGA 4D6PA 1FS5A 1VHQA 3SY8A 1FYVA 4QICA 1E4EB 2AR7A 1TWHA 3NNSA 3ENWA 4ZC1A 1FS4A 4AO8A 1AKEA 1U65A 2I1WA 3V8EA 4G0QA 3UJAA 1R6UA 3RW9A 3G1UA 4X61A 2AXEA 4HDCA 3GHHA 4FCTA 4TQSA 5G4KB 4WLVA 5T4FA 1OLXB 4CG0A 4G0UA 1WVGA 4WKGA 4OHWA 1T0JB 2QN2A 5SY6A 2ZE8A 2DU8A 3LT0A 4JODA 1WMSA 4NG5A 1DVRA 3VH4A 4AJKA 4QDUA 1H9BA 5AI8A 4ZI7B 3PRHA 2CCJA 2GZHA 2PWPA 5JJKA 1Q0RA 3OWXA 2FJ0A 5E0KB 4J49A 2HRZA 1CQWA 2JCBA 1XZKA 3CWQA 3D2BA 3LVRE 4MNTA 5EQTA 2BFAA 2GEUA 4TUYF 3IEVA 4WOCA 2QPLA 2VTEA 3LLVA 4U2GA 3GNLA 1Y7PA 3HEAA 5FBWB 4OHOA 1YI8A 3CVOA 1DCKA 1ANKA 5JBIA 1VE1A 3QPDA 4EEXA 4K87A 2JHGA 1UWLA 4EJ6A 5CLQA 4M2LA 2ZRMA 2WMDA 2JIZD 5CA0A 1TLTA 2CKZB 3BJIC 3HU5A 2XZDA 4QSHA 1DO8A 3K0KA 5TQ0B 3VR0A 1NATA 3G5LA 3M81A 3NCHA 4BVAA 3BXPA 1RXWA 3SBOA 1NY5A 3VR6A 1XD2A 4Z2AA 4MWBA 4EB3A 2XVMA 3D0QA 4P4TA 3OZBA 4EQ6B 3U44B 3Q7RA 3O1LA 4ZYZA 5JADA 1WD5A 4J0EA 2YZ2A 4AUNA 5DM2A 4EI8A 3HN7A 2JI8A 2OFWA 3TQQA 1BQ3A 2QTHA 4PIMA 1W1WA 1GTZA 2ODWA 5BN3A 1SUFA 1KSFX 4DPKA 4MK4A 2ISQA 2JBAB 5G1PA 4HWGA 4F9FA 3EGIA 3FNIA 3E5RA 4DY6A 5ALKA 3N0VA 5AJYA 2MOKA 1GGFA 1HL3A 2NZ2A 5LMUH 4PZ0A 4FQ5A 3MK31 5CXQA 5B1IA 1T25A 3HJHA 2YHAA 4N4AA 3F4KA 1BQEA 1LPOA 1T5DX 4XB1A 3HGTA 1EGHA 1OUMA 4XIGS 4F12A 4GSKA 3R8XA 2OHXA 3I09A 4HDNB 3GP3A 5F7ZA 3UT5A 2NPIA 3LRXA 2BEUA 5ITZB 3BILA 2IYTA 3TK1A 4RZRA 1U8AA 4RB3C 2EX0A 3ZU2A 1K98A 3SPXA 1COWD 2J3QA 1U02A 4XTRA 1Y81A 3P9RA 3BXXA 4IG9A 4J9NA 3JAMA 2CUKA 2RHBA 2GAAA 2RK6A 2OKGA 1UKBA 2VH5R 4QQ8A 4DMLA 3CPEA 1BW9A 2P9FA 4GLWA 4XRRA 4HAUA 4MV5A 4AJ2A 1MRZA 5A2QA 2OUKA 3RVLA 2NU6B 1C0KA 2NZ8A 4B33A 1V6AA 4QJFA 2C5GA 4MQUA 4EW3A 4QUAA 5DNAA 3UPUA 3G6XA 5E9QA 3R7AA 2CLCX 4H1UA 2J9XB 1ZD3A 2O2YA 2BCEA 2XOKA 2XVXA 5AM5A 3EQ9A 5K01A 1N1EA 5M3BA 1I01A 5T57A 1T3TA 4C6TA 4KH1A 1DBWA 2WEKA 4Q15A 4QOSA 4TUYA 2XX3A 4BGVA 3TGLA 4XB6B 2EU8A 3UKJA 3D6JA 1XNJA 3VNQA 2EKQA 2P79A 1C7ZA 4ZCLA 2A9PA 3ZUPA 4O83A 1A7JA 1G5TA 2JH9A 2W6QA 2Q5EA 4LRQA 4CV3A 4E1AA 1EJ2A 1RRMA 2ZSDA 4XWGA 3JYQA 4J9MA 5JSUA 2VZLA 3PNVA 1QVWA 3N2LA 1H3FA 1P80A 3K5HA 2VLIA 1KJNA 3ONDA 3MWYW 3PSHA 1CP2A 1B73A 1N3YA 3B1XA 3E27A 4DQUA 1X13A 4TS4A 1WD7A 5FNZA 4N0QA 4QO7A 5D84A 3ZV7A 1OAOC 3BN3A 5K3EA 1ML3A 1MB0A 4QBFA 4RAYA 1E9VA 1HLGA 1RLIA 4JB8A 4BNTA 1UAYA 1IN4A 4GI7A 2PGJA 3CURA 4ALKA 4KYIB 4N8DA 2GPWA 1QKJA 4RF4A 4FBUA 5E38A 1RAAA 2F6RA 2ZJOA 5HFNA 4KRFA 2EJWA 4GP9A 3AM4A 3SSMA 4MR7B 4I4NA 3A36A 3I62A 3OF3A 2D06A 4BAGA 3O7WA 2JGJA 3ZDYB 3SX2A 1N33H 2WB1A 2VAMA 2XRMA 4NCNA 3I04M 4FEGA 3QXXA 1Z0KA 3L7LA 3TWOA 3GT4A 1ET0A 2PCJA 3ADDA 3SS7X 1EFUA 3W8DA 4JC4A 2IEYA 5DN9A 3NNDA 4BBPA 2HV8A 3BFKA 4KIUA 1W7AA 4OHFA 3FYTA 1J8YF 1I9GA 1P2SA 3L79A 5KG6A 2J6SA 4JJ7A 1YV9A 4ZVUA 4EA6A 2RGDA 3IPCA 2KMLA 1CS0A 3CF4A 4G36A 4YDRA 1YFJA 3FPLA 1U5AA 3ZDBA 3M4ZA 5GP1A 4REQA 2HBYA 3CQZA 1BG6A 4YR0A 1GPDG 1OC2A 4QNNA 5JNRA 2HADA 3CONA 4D25A 3ZVKA 4JLOA 1JQJC 3EVZA 4BEBA 4NU6A 5DVZA 1RJPA 2HAEA 2F9MA 3KLOA 1F51E 2C28A 1N75A 2P4QA 5ILGA 1FJXA 1SJ9A 3KJEA 5E8JA 1T9AA 1N5LA 3H8SA 3LT4A 4E21A 3UGJA 4KFRA 4LH6A 3C6ZA 3WFJA 4AYTA 2PBZA 3B2NA 5JH7B 3MTGA 1OQAA 3GRRA 3ILXA 4FDUA 3TTTA 4BLWA 5L51A 4ED2A 2RE8A 3AEKA 1S2MA 1VHTA 4OUDA 4AYXA 3GBPA 1SO8A 4EY5A 3HCPA 1PEDA 1TJYA 4EG6A 2ECOA 1VRCA 4RZSA 2D0IA 1X14A 1LPNA 4IIFA 5HILA 1XAGA 9ATCA 1SCJA 4Z9AA 2QHXA 3KUXA 2SCUB 3MOSA 5FL7D 2ZJ5A 1L5YA 3M5PA 2ZRCA 1U3WA 3CLTD 4MKGA 1DT5A 4QGBA 4DXDA 1MVLA 5HM6A 3EGDB 3JWPA 3GUZA 4C87A 1P2VA 9MHTA 2NACA 3P9ZA 3P9KA 3E22A 4CEHB 1QV9A 3F5DA 1IHOA 1E58A 2BUAA 2NTVA 1HG1A 1XC7A 1TJ4A 3B5IA 2VDWB 3BB4A 3CLHA 1RQ2A 3G8BA 4INZA 4M6WB 4Q1AA 3U7QB 3OD1A 1WTCA 5B58T 5C4GB 4C4TA 5JRJA 3GV8B 5TIIA 1JJ7A 1MEJA 1UK9A 4LOHA 4O7WA 1Q74A 2EKPA 5C7IO 5HTKA 3GDHA 3QFHA 3WK8A 4BV3A 3KOWA 5CA1A 4KJXA 4IDAA 4MEBA 4LDPA 4YTEA 1N56A 1ZGHA 2ALZA 3C39A 5KFUA 2C54A 2F00A 1XZEA 2VJAA 1XZDA 1QTNA 2CNUA 2EFYA 3DYVA 3H5OA 3JWJA 3W3AH 4OHRA 1NRXA 4K9OA 3QPCA 5BNTA 1PLLA 5IHPA 2YXBA 2BTOA 2B63A 4RVSA 4G0NA 5EZ6B 1TUBA 4QYSA 1VJ5A 2IUYA 1B41A 2D74A 3MW8A 3W7AA 3GQCA 1XMQB 4J3JA 2ZTSA 5D87A 1DNPA 1Q1BA 1N2ZA 4XIIA 1RWWA 4NFYA 5E3JA 5G3YA 4TXHA 3UWOA 2V6MA 2A57A 2WJ6A 4IIHA 4KFSA 2IV7A 3WP0A 2O5EA 1U90A 2WJ4A 2WF5A 4ARBA 4H27A 5ENZA 3BXGA 3LL4A 3QFCA 3PF8A 4RKQA 3AVXA 3BOSA 1OWPA 2B7CA 2CJWB 2QZPA 5GPBA 3PNOA 3T7KA 1KAEA 1VSUA 2P2CA 5LZ4A 4XVHA 4KL8S 4HGNA 3HRKA 4ER3A 1TVKA 5JCJD 4DL5A 3HPRA 3RC7A 3ILSA 5A71A 4ENWA 3PFCA 2A9FA 3GR6A 3HSYA 1SELA 2V55B 6GPBA 4D26A 3D3NA 1FYEA 2ZIVB 1R0LA 3A0UA 4MEAA 4ZOAA 3L46A 3KJXA 3Q8QB 3K4QA 4M22A 3L0OA 1DG1G 4HOYA 1G2WA 1PV2A 4DBLE 3CUKA 4DVGA 5C5JA 2O8EA 4LIPD 2VJDA 1C8LA 3FDIA 4X00A 3DVRX 4O7LA 2R0QC 3MQ2A 2CW7A 4L9SA 3I73A 1COZA 4EKIA 5CD9A 1RYNA 2I2DA 4RQBA 4CT4B 1FMJA 4D0LB 4JYBA 2D13A 3BXHA 5DV9A 1FFCA 5A7HA 5KYKA 1C3LA 1Q83A 2W37A 2ATLA 3U3JA 1QGED 4C6HA 4IJ6A 4EGQA 4KQIA 5KMGA 2AGQA 3CO5A 4P92A 1FEZA 1W4RA 5AW0A 3J80A 2Q3FA 4KHPH 2CN1A 1NASA 3RTDA 3IDSA 1N8NA 5SYNA 3HV0A 1JFSA 5CH8A 1ECPA 4BE4A 3L7DA 3MXOA 3EXG2 2HMYB 3KEMA 1C50A 2FQXA 4J9RA 2R25B 3HA2A 3N3AC 3FXAA 3PEFA 4FILA 1DBPA 4JOQA 4PAMA 3WGIA 1RLTA 4JP5A 3LM8A 5C51B 5GV8A 3IP7A 4O5AA 2AJTA 3DM9B 4D81A 2W2MA 3KFLA 2P6RA 3HBAA 3BB1A 3WNDA 5B7QA 4DSTA 1FL9A 2MCFA 5BMOA 2NO7A 3X44A 4YMVA 1HV8A 4TN5A 3MBIA 2QG4A 4R69A 4XYEA 3T38A 2RH5A 5AJUA 1XVTA 2HQOA 4Y1RA 4B3RB 2P7IA 1ATIA 1QIMA 3AF3A 3JYLA 4DLAA 3LIIA 5DAAA 2QBYB 1Z6XA 2V0GA 4D3DA 2JGFA 1C4XA 4PHFA 1GPH1 2FB9A 1GZUA 5P8WA 4Z3OA 2FMUA 5IM4F 1JH8A 2NSDA 4AXBA 1YH3A 3TQRA 3S8YA 2EKDA 3PYMA 2A1UA 2LUOA 3U26A 1TAQA 3GRAA 4BIMA 4QQNA 1KSHA 4NXMH 2FDXA 1XAJA 4H6XA 5D2CA 4O2AA 5F9MA 3J7AC 2P9CA 1OGYA 3R4VA 5MN6A 1LDNA 3EF0A 3T7SA 1U9IA 4C14A 3ER8A 3S55A 4DPLA 1P0CA 1EHYA 2GTHA 4JBLA 5FFNA 1GYQA 4AYBA 2CE7A 3LQ1A 4FU0A 5AHOA 4XI9A 2Y1LA 2D0OB 3JQRA 2L82A 3LXRA 4J0CA 1O7JA 1ZK1A 4MR8A 4QUDA 5D6OA 1LFDB 3OESA 4IHKA 3V2UA 1EM8B 4JI6H 4GI3A 5I5SA 1TA4A 3W5VA 3EIEA 4R0NA 3WIBA 3UATA 1V51A 1CIJA 4EHNA 2Y4RA 5ILQA 1X87A 3UICA 2MINA 1NBAA 5EIXA 1XNRB 5DHTA 1EMDA 2CB9A 3ZJVA 3FKJA 3SDZA 5KG4A 1GZ4A 3QYAA 1ZU4A 2ZVJA 2PUAA 1KEWA 2F17A 4ZOLF 4MTDA 4OQXA 3UMVA 3CINA 2HNKA 4JSRA 2H4HA 1H65A 4LQ4A 4PLFA 3V4LA 1L7NA 3OOSA 4JXXA 1HDRA 2F1RA 4IR7A 3B6MA 3TINA 1MVOA 1T5HX 3U7EB 4Z3KA 1U6KA 2X5KO 1O03A 4ED8A 2AR0A 2F43A 2E2WA 3B78A 3G2QA 3NHKA 3NUZA 3GJ6A 4LVUA 4OJNA 1A1SA 3ECSA 5BV2P 2QGFA 1E5LA 4AG6A 1ZW6A 1FSFA 2R6GA 2EIHA 3QVLA 4IUYA 3ZY5A 2CLSA 1T9DA 3TW6A 4JJGA 3FTPA 1JEAA 3T9EA 2BE9A 3REFA 2BFPA 5KYYB 3H3VH 4LHSA 1SA0B 3IE2A 1HR0H 3VAZA 2CNWA 3WL3A 2X58A 3MR2A 3TR6A 5KVVA 2CF5A 2PL1A 3H99A 121PA 4ASUD 2PYIA 4OGFA 4URXR 5T4BA 3S7TA 2QA5A 4MVXA 4PGAA 1YR1A 4IJUA 4QPZA 1SC9A 3ORFA 3S8MA 4LXYA 3W9UA 1WBJB 2J31A 5L3QA 4Q3DA 5JALA 2F3TA 1QVVA 4EEYA 3WGQA 3EFBA 5A5FA 1UBEA 2QLTA 4J1TA 1V8FA 3D31A 2WFLA 4NHOA 3DDZX 4FBMA 2JLWA 5GM2A 1DIOB 3MUEA 3UUWA 3KK0A 3ZU5A 2NO6A 3OQMA 3E2MA 4KAAA 2OXIA 4D99A 5BWCA 1UBOS 3A25A 1G8PA 2V98A 3KTDA 2XECA 5K20A 1VAJA 1W8IA 4ETIA 2V03A 1JQEA 2GQSA 4HEHA 3IG0A 3SF8B 4DJ5X 4RTOA 2XMGA 3HOYG 1OD6A 2G0NA 2C7VA 2QZ9A 1VA5A 2ZSFA 3I5MA 3IQEA 4JDUA 3RBVA 4A6DA 2C0QA 2PS0A 3VR5H 1IBKB 2AWNA 5TF4A 1HE4A 3K0AB 3M4JA 5EZYB 2JLVA 3O2SB 4NCJA 4QTZA 3A3NA 5JBNA 1U7DA 4HUQA 2SNIE 3F1KA 4RTKA 3NOXA 4FFSA 2AC4A 1ITZA 1K6XA 2BHNA 3C7AA 3L6UA 5DF1A 2B6NA 3N86A 5SY9A 3TUJC 2W6CX 4LJKA 3HCCA 4CFYA 1PL8A 4DQXA 5B7GA 3SAJA 1N8SA 2NZWA 3NOOA 3QLEA 3QPBA 4YLGA 4D9CA 5AXCA 5AKKA 4BC1A 4JI4B 1IXKA 1N6IA 5ARDA 1A7UA 3KSDO 2Q50A 3RDPA 1PG0A 4EUEA 5ITWA 5JSQA 2JLXA 3WLJA 2AVNA 2FMFA 3T7IA 3ZBTA 4DM3A 2JK1A 2ZWVA 3RU7A 2D1FA 3ACBA 3FVRA 4PQRA 4Y6LA 2W6IA 3NTOA 4BKQA 1V9PA 1Q7TA 5FI3A 4MRRA 3CCFA 5TS3A 3LY5A 3AR8A 1Y6JA 2Y99A 3RHTA 3R9XA 3O26A 4CDRA 3JVVA 2BF4A 1BU5A 3D43A 4IVNA 1A2BA 1NN5A 5IKXA 2R48A 1PZXA 3WO1A 2FHSA 4GQIA 2WF6A 1IN5A 2ZZKA 1DHTA 2AA3A 3Q0TA 3ZIDA 4E08A 3THXB 1VL1A 1JHZA 4HNQA 4CEJB 3WK9A 2H7XA 2AZ4A 2Z43A 5L4LA 4DYDA 3QX3A 1N77A 2Q5JA 4W5OA 2G77B 1XXHB 3DFFA 4P7FA 1VECA 3HKZA 4L7VA 3I1IA 4Z0HO 5DHPA 5TB5A 1KJIA 4WSOA 3KV1A 4M36A 2P3LA 3KL2A 2ZROA 5FLYA 2AT1A 1DADA 3M82A 1NW4A 5K0NA 2NV6A 4ZQCB 4LMYA 4BBSG 4BMCA 5FUMA 5J4LA 4MYCA 1UJBA 1T0IA 2H3EA 3LP5A 1PEAA 5DK6A 1CJKC 3WMWA 2LGJA 3N58A 4OIMA 2IV3A 3AFOA 3STYA 4JOSA 3TLBA 3ZC3A 1GN8A 4WGGA 2OSBA 3N07A 3DTGA 1UWKA 3EYWA 4TYQA 2GSWA 4WGFA 1XWFA 1ZN2A 1FDUA 1T5IA 3UY4A 3W8RA 1OWLA 2ZUDA 3P2EA 1S2LA 1V41E 5KU1A 4WLUA 4FMCF 1ZX1A 1B1CA 3TJZA 4WBNA 2AN5A 16PKA 1EJBA 3N2NA 4WEOA 4ZALA 1ID8A 3KXYT 1JDUA 1JB1A 2FMIA 1WHTB 1T13A 6ADHA 1RPAA 3OCWA 1SCDA 3WHPA 1WSBA 3OHSX 4YPOA 4J9KA 3BQ0A 1M6YA 1U0TA 1WVIA 2YV3A 4YJHB 2Y67A 4IGKA 5IKPA 1Y1SA 3AYXB 5ELLA 1U63A 3ES9A 3AR7A 4ETSA 3GG9A 5KHOC 2R97A 4C06A 4EEQA 2H5EA 2VBCA 3B3JA 1E6EA 2GAFA 2QU7A 3CZ4A 3DMNA 1TAUA 7MHTA 1PV4A 3WWDA 3W6OA 5BWTA 2CLEB 4WA7A 3SLRA 5L7WA 1OZFA 2R8PA 1EK0A 2PGNA 2ADMA 2JFZA 4LV8B 4OJTA 2CJYA 2X5NA 1GKIA 3VO8A 4BC0A 4IGIA 1MC1A 4IOMA 1Z8HA 1SXJD 1II8A 4BN5A 1V16A 1MW9X 3F0TA 2HRBA 2VEDA 3FJ1A 2OD2A 3E4DA 4C4XA 1JYSA 4HNRA 1CUFA 4TUYB 5B3KA 1DOAA 3RHSA 4MVJP 3BKWA 4HTAA 4OHZA 2PV0A 2Q5CA 2GZAA 1VL8A 2OV6A 4R1SA 1UZLA 4R9VA 4YPFA 1W0JD 4C4YA 3VNUA 4C2AA 2MR6A 3CRW1 4E88A 3L92A 3O47A 2CXOA 3OCCA 3OPMA 5C35A 4LVOA 4F5WA 1NJ8A 3KR9A 1P18A 4IZOA 1G6HA 1GYRA 1LI5A 1ODFA 2YH2A 4LSAA 1P7YA 2BHTA 3FFAA 2HT6A 3HI4A 4IGAA 4CFZA 1I0IA 3G89A 3FWHA 2XNJA 4UUBA 1YVUA 4C9BA 3U3MA 4MW2A 3JATB 1GXSA 2ZATA 3CZ9A 3E15A 4RULA 2WQ7A 4G0WA 3RS3A 2WWVD 4NICA 1Q21A 3DR5A 3OTGA 5E6RA 2A94A 1G6Q1 3ZJTA 3PN1A 3DWIA 1UZMA 3LX8A 4PG7A 1FX1A 1G2IA 2O2DA 3Q8SB 3G8YA 4DWWA 1IY8A 3AU9A 4G81A 1PTJA 4NV0A 5CLLA 4EGCB 2R44A 4D57A 3CVYA 2HU5A 1Z4JA 1E7YA 3CNEA 1KZGB 3LECA 2WMOB 1H1DA 2XNCA 3SHQA 2DJ5A 2FDRA 4KXLA 2QVZX 2ZIXB 3CH6A 2ECKA 4R9RA 2FZLA 1JV2B 4EA7A 5KO2A 1Q92A 1FMLA 5CNKA 4FI3F 3I4MG 4RADA 2DULA 2KLBA 3HABA 1DXHA 1Y5IA 3L8CA 3R2JA 4MUFA 5CH5A 4B4KA 2V6FA 4F21A 2AOXA 3DKIA 4KV7A 1XNHA 2A1IA 2EG5A 3KKLA 5F5NA 4PW0A 2LCQA 3RC3A 1BGXT 3RROA 2JS7A 2VLBA 1PI3A 3MUOA 5FOSA 1GO3E 3WIUA 4BMOB 4BXOA 3ZHXA 4MJLA 4ICIA 5KFCA 1JBQA 1V8BA 2JIPA 3LTEA 4L1KA 4IHJB 3P9YA 4M99A 4DDHA 4CIYA 1AS0A 5AXBA 3FE2A 2NVBA 5IBQA 4GMFA 4ZHQF 4REQB 5TLSA 3Q8RB 4ILEA 1BD4A 2R2AA 5DTEA 4LK2A 4A3JG 1P4HA 3C1OA 2ECQA 2QJWA 3DDWA 4GPD1 5DI9A 3UUEA 1QRRA 2ZE6A 2ORYA 2AUTA 5IAGA 4DRYA 2ZJTA 4E33A 3V6HA 3FKSD 1DAAA 4B9EA 3F2VA 1CJVC 2XR1A 3IQHX 4J3FA 1L1FA 3V4OA 3SKXA 2FLLA 4WOKA 4YQZA 4ZP1A 3W6NA 4K0KB 1U0HC 2AI3A 4POAA 3PX2A 5BSGA 5WRFA 4DR6B 1L3CA 1JSZA 1SB8A 1N5DA 1T2NA 3AFIA 2E82A 3QWBA 2HPVA 1F6BA 5C32A 5A9SB 4P5EA 3VDMA 2O07A 1L0BA 3AFMA 2RGCA 2X8AA 1QFSA 2PT5A 2W2PA 1OKKD 3PQ3A 1Y3AA 3OJEA 4B7UA 3HCDA 4OHMA 2XA2A 1GD1O 4IPTA 2XWPA 2NVOA 4QOHA 1VE3A 4RQAA 5DKFA 3A1NA 1E1DA 1Y8RB 3UO8B 4X60A 4EQ6A 1JVSA 3A9CA 3QHAA 2X4DA 1P6XA 1J09A 2R5FA 4TV9B 2CK3D 3HWX1 1T2CA 4CR7A 1TYAE 1V11B 3L7NA 4US2R 3THWA 2O05A 1JNYA 2FMAA 5EJ9A 1IDOA 1D5CA 2AD5A 2E4YA 5JO0A 2TYSB 3D3WA 3LT5A 4ZCIA 3B8EA 5TC4A 2CWDA 3ZH9B 1UBFA 4MXDA 1D4ZA 1X15A 4WINA 4D3XA 3I9FA 4JEHA 3VKHA 1KXZA 1HL7A 2X8JB 3CLTC 3OA2A 1GL9B 5AXDA 4C4OA 5LLDA 3U19A 4RAZA 4X54A 3RBZA 3VDQA 4CQMD 4A3DG 2NOAA 4EFBA 1WMFA 2PV7A 4IIJB 3RT7A 2D5AA 4JUAA 3R7WA 4BNZA 4QPJC 2QW1A 1VE5A 3KC2A 1WMEA 3CJRA 3KPUA 4JQOA 4FC6A 4U2EA 1J6UA 1RABA 2A9VA 2BJWA 2DR3A 2D3TA 1LKZA 2REQA 3KFXA 3QYJA 4HDNA 5KEIA 4MGYR 3LZCA 4PNHA 1J23A 4TT3D 5D5QA 2DFTA 1GGVA 2ZW9A 1UBLS 3FHCB 2TMGA 3UGKA 3GJZA 5GIPE 1SCQA 2ZE5A 3M3HA 3L7KA 3DL2A 5K0JA 1LGYA 2Q1SA 5LQNA 5TEVA 4RPIA 1N33B 1SVNA 2VOJA 3KV3O 2Q9BA 2DTXA 5EZSA 1NLMA 3RS4A 4Z51A 4N6NA 1M2HA 5A7GA 3TW8A 4MPRA 2X5OA 5IW8A 1S4MA 2JW5A 3Q2IA 5L6LB 1GTL1 2VF4X 1DIBA 1UPBA 2HBZA 4INAA 2GBIA 5TXGA 2R93G 1U5BA 4RIGA 2K7ZA 5FA5A 2J0EA 2QAGB 2YXDA 3ZXXA 5E6SB 5J58A 5HFAA 5KYGA 1E9SA 2OPHA 4ZARA 4BLVA 4BNKA 1T5LA 2H48A 4NC9A 2B2NA 3AH8A 3B1VA 3OU2A 1RKBA 1T36B 1VIDA 2P5TB 1WXHA 4JZYA 3U3DA 1HFEL 5B2EA 1CQJA 3ZVMA 4ARSA 2NZXA 4JP3A 2EP8A 1V4VA 1QKKA 4V0ME 4EF4A 3NBZC 5KQSA 2C7OA 2PH3A 3ZWAA 3CNNA 2GARA 1RR6A 2GEVA 3K5PA 1FFBA 3NGLA 2I8AA 5KYTA 1W34A 1SUPA 2ZJ4A 2LIPA 5A05A 1CE8B 3FUVA 4G1MB 3F71A 4J16A 4EJSC 3PFFA 5AICA 3OMWA 1OOEA 2ZOSA 4NEGA 4O3QA 1X7YB 3UQZA 1YS4A 2OCXA 1KYQA 1GZDA 3WO0A 3AIOA 3FUTA 3OPXA 2A1HA 2PUGA 5EOYA 1JAXA 1X3SA 3A70A 3H3JA 4TL9A 4Y9DA 1C80A 3BAZA 3DWFA 3WL5A 4ZI2A 3FSGA 3Q5GA 1XTQA 1GPNA 4UBKA 2O3JA 2WHPB 4G4IA 1L7EA 3MS7A 4FGWA 2RDMA 2HMSA 3G2JA 3KWMA 1CVIA 1ULSA 2BGMA 3QKSA 4U7WA 2IU0A 4I7HA 2DQSA 5FBLB 2RIPA 3SLKA 2XD9A 2QRUA 4XWOA 2UYHA 2AI1A 4EMSA 1K08A 3IEIA 1KZ7B 2O2HA 3DXZA 4NABA 1KAQA 1M34E 5DMXA 2L17A 3AUKA 2GFQA 3DBRA 3O31A 4Q3CA 2GDZA 5C7OO 2IYNA 3VOTA 3DE4X 3K2QA 1N48A 5J4HA 4BMPB 4BU1A 2BGUA 3PQCA 3A2KA 2J85A 3RIZA 1GUFA 2C4TA 2J1LA 2JCGA 2RIRA 2VATA 3E2IA 3IMFA 3LA8A 1N6HA 2ACEA 3OIUA 1JKFA 4GXRA 1LQTA 2GAJA 1JHRA 1W85A 2P5YA 4F11A 1U2DC 3OTWA 1IK4A 2YW9A 1SVLA 4BBJA 4DIOA 1HMPA 1QGDA 4OXRA 3P0RA 1YE3A 2IWRA 5FDFA 1QSGA 1Z4MA 1U3TA 1WF6A 2WE8A 2Y1DA 3M89A 4OL9A 2ZIWB 4UTOA 2ZUTA 1SBHA 3ITEA 1SBIA 2PX2A 1TU0A 1Y4DE 4WFKA 3R09A 3B8HA 3EAGA 1MNQA 1VGRA 5EIOA 4U8HA 4CCYB 5LA6F 4EPTA 5JROA 3CG4A 2C00A 5REQB 3O3CA 3MLAA 5DLPA 3BCHA 1PU2A 3AQIA 3OT4A 1HE2A 3FA2A 2I6TA 1MH9A 4R3NA 2RHRA 5HQ3A 1QB7A 2PO7A 4IIXA 3N8NA 3TE7A 3VVBA 1KQOA 3RB4A 1MQ9A 3FLEA 1XZHA 3TQ1A 3PCTA 2AHRA 4UD6A 3AR3A 3H17A 3BBLA 3E8XA 4MLDA 4PQEA 4E2WA 1JFRA 2IYLD 5GONF 5HXAA 2JGNA 3GY0A 2H2GA 4JLUA 3E7WA 4TLEA 4FP9A 4AS3A 4OVKA 4IY1A 4B3DA 2GJ9A 5C31A 2D1QA 3QWHA 4E0BA 1A3CA 1BKDR 4ZVQA 1KHTA 1K0UA 2E4VA 2I8LA 2UXCB 5FLMG 4PEVA 1G3MA 4B3MH 1M2NA 7REQB 5I5UA 4YRFA 4KSCA 3DUFB 5LD2B 2DR2A 1DJOA 2WLSA 1UFQA 4JT4A 2UAGA 2C1EA 3N0WA 5CUQA 4G37A 4MUBA 2FTKE 3HU2A 1DEXA 3DKPA 2R4QA 4DRXA 1ZMBA 5LBUA 1GIAA 1KC3A 4XWAA 4S3MA 5B58C 3E61A 2D2VA 2DT8A 3CEHA 4AXXA 1RYMA 1OXVA 1E4EA 1S3GA 3VR2A 4LJ5A 4ECSA 5F21A 3GA7A 3PNYA 5BVHB 2JAHA 2NO9A 1IXYA 2H9AA 4PC1A 1U7UA 3HPQA 3SQOA 1VPWA 5GZ3A 4Q48A 1TJ3A 2H4WA 5CR9A 1GU0A 2VHQA 3HJNA 1MTOA 4F3RA 3E5MA 1SWVA 1KBOA 3EDQA 4LKOA 1KZ4A 3AP2A 4L8VA 2YL2A 2ATVA 1ISIA 4LHXA 4TVOA 3KU1A 4G09A 4V1CI 3C0KA 3NBMA 4IDEA 4HB3A 1ZSVA 5IPFA 5KCZA 2ZS8A 4ZI7A 3F5MA 2PMWB 4YUXA 4LXGA 1CXZA 1G21E 1Z8FA 3CF0A 4F4FA 5I9LA 4ENTA 4A8HA 1HETA 1KEZA 1KSJA 1H2WA 4QLBA 3U61B 2PYZA 1LNQA 4C0HA 1D4FA 1QTQA 1M6EX 4FYMA 4LBWA 4WFIA 4DL2A 1D03A 1EVQA 4FIDA 3ZWVA 2GKSA 4DVJA 4NSNA 1MJGA 5CCEA 4B4OA 4Z1MA 1G5HA 3AINA 4HDMA 1NJ1A 4GG1A 1IBCA 1AQIA 1NVWQ 3P19A 5KTRA 1AB5A 2QRVA 1BDJA 3CR8A 2JCYA 2CSXA 3PPIA 2BH9A 5AXAA 3M1LA 5KNBH 1NUSA 1EVKA 1WIWA 4JK3A 4TV8B 5EZYA 3HR8A 4WKBA 2LVBA 2KM1A 1TQDA 4GOLD 4WY5A 3MINB 1VXRA 1JZQA 2Z3VA 4O7VA 1TKAA 1HLPA 1P1FA 2FK8A 1KIAA 3L04A 1W85B 3NB0A 4JQYA 4XFDA 4CHTA 4E31A 2J9YB 2QE6A 3TIXB 5EJ7A 1JECA 1ZC3A 3IO5A 3IJEB 2LDXA 2VDRB 4RX1A 4GD3Q 4AS1A 2EJCA 3GFPA 3PITA 4B5KA 3HCAA 1E1RA 1EWRA 2B2CA 1EP2B 2IYOA 3QVSA 4HADA 1QCCA 2OFPA 3PZBA 4ZPJA 3BXZA 5KU7A 1I33A 3RBXA 1EG7A 1XMXA 3HXKA 1BOFA 1JIJA 2YV5A 1ZRMA 5AJZA 1M2OB 5JHHB 4DR5B 2V7QA 5JASA 3AJ8A 1IONA 1OF1A 2GLUA 4CGZA 3RRXA 2V4QA 2CVQA 5JDCA 1F2TB 5K3CA 1BOOA 1GADO 2WJAA 1KMNA 3UHOA 5JOQA 5KFHA 3FX2A 3WGMA 1HFKA 1Y1QA 3RTBA 2BEUB 3K8OE 2PR7A 3CZCA 1R4NA 3WV4A 1U3FA 3T9FA 4WH0A 4HBGA 2PQMA 3N75A 1EUZA 2EBUA 1VA4A 2GDJA 2R8IA 2HYIC 1F17A 1K8RA 1MJFA 4TMTA 2QB5A 3MFQA 2XOKD 3GGPA 3WAKA 2EATA 5B53A 3ZXYA 2GA9A 2NVUA 4W8GA 5CB6A 4MUXA 4RH0A 1HFJA 1T9HA 1T6XA 1HDCA 2X4IA 2ZUCA 3LG2A 4UBMA 1QP7A 5KTTA 1GGOA 4YJ3A 1B6TA 1OXSC 1VCOA 3M4NA 3I64A 3ZHVA 1R88A 1U2GA 3H5AA 3HP1A 4FLEA 5HPYB 1VKOA 2Z5FA 1UK8A 2HJWA 3DUFA 4K03A 1KMIY 1T5SA 3DLAA 1WB6A 4PG4A 2B99A 4E4TA 1FQOA 2ZIZA 3GJTA 1S8NA 1DXQA 3EBPA 1XLUA 3GT3A 2HF8A 3S2IA 1XALA 3P4YA 3AB3A 3C5EA 1U9CA 3EIHA 1KUTA 3KZVA 1AQ6A 2O0HA 4FMDB 4PO3X 3SJZA 4X1KA 3T7AA 2Z1MA 5K0EA 2OGUA 1USIA 3FYHA 4DKXA 3Q15C 1BJKA 1L6RA 3QX8A 1Y3HA 2QR5A 1XYGA 5F3RA 3OFSA 4CKCB 4RDCA 3E5HA 1QOZA 2JJ1D 4BY7G 1U0FA 2L19A 4LOLA 4R2KA 4Q1DA 1XLTC 2CL7X 4W9NC 5EP1A 1I1LA 4MGIR 3G7UA 3O82A 5LYJF 2H4ZA 4HYQA 4ZZIA 5KYWB 3M9LA 5JYDA 1ZH6A 2ZR9A 3CSDA 4EVSA 1T0HB 3WBJA 2W9CA 4PRZA 4QTTB 4Q82A 4CL2A 3QE2A 2D4HA 2VHCA 4IL5A 4XFKA 1PZHA 4YROA 4BNYA 3DBHB 5BWNA 5CEEA 5IUJC 4NMMA 3MGGA 3W3AA 4LGVA 3L07A 4EMBA 2AG5A 1J0XO 1RTTA 3S1SA 4IIVA 2CNQA 4YNBA 3LA6A 4U02A 1NXSA 3M3DA 3CB4A 1IYEA 1GPLA 2V7XA 4HDMB 1U8EA 4RAQA 1H3EA 2AOTA 4IBOA 3S1AB 1I3QA 4TQAA 5IULC 4KWEA 1POXA 3ID6C 1DAPA 3R4CA 4OYHA 1KDTA 1MW8X 4H1VA 1W52X 2Y0SE 3RO7A 2P9EA 1HDGO 3PQ4A 4F9GA 1GSOA 1II8B 3DGEC 1KYVA 3L77A 4HX2A 2B9VA 3F7OA 3G2IA 4YRQA 1ZVMA 3J81k 1CR6A 1XDBA 4L9WA 3OEWA 3OHMA 2NTEA 4L74A 4HMPA 3K8YA 2X6TA 2GEBA 4BS9A 1UK6A 3ONEA 3QQMA 3JQAA 1IIRA 4LJ4A 4KSBA 1UJ4A 4DQKA 2Q6VA 4Q0YA 1PFKA 2CVZA 3HKBB 1RPZA 4JJ6A 2HTEA 3T4PA 3O4IA 3WB1A 4B6PA 1SXJC 1Z6TA 4DA7A 4D98A 3HJFA 3H9QA 5IYZB 1J21A 2PD6A 3CT6A 5IXSA 2FZVA 2RMKA 4Y9SA 3JCZA 4F4CA 2R11A 3ZE0B 2VDJA 3GRFA 4OGWA 4UU8A 3T1HB 1GPAA 1PFGA 4GC9A 2OFFA 3RM3A 3PWKA 2HMWA 1KBLA 5I4CA 3WRXA 5JH7A 1YZKA 5KVCA 3IUBA 1DTEA 4YY3B 3IPAA 1PG5A 2IYEA 4P1ZA 3H4TA 1JDTA 2FUG1 4A82A 3IAUA 5KKCA 1NQUA 4QUKA 1K63A 1NKSA 1SBTA 3EYYA 4LNUA 3KSMA 4YAEA 2VJMB 3OHPA 6PFKA 4CM7A 1SXGA 3WMGA 5IVHA 4TTJA 1GZHB 3HKCA 1TADA 4L78A 1OI4A 2AQKA 4JX9A 5TQ2B 5EE9A 4GGPA 1ZD4A 3QMVA 4YCAA 1HXHA 3C5VA 4AK9A 2P3QA 3H18A 3CH5A 4RVFA 4UPDA 3OZCA 3ETCA 1K4KA 1WULS 2O4CA 1UEIA 2GZSA 2XE6A 3KHLA 5LQSA 4YRCA 4KO2S 1MR3F 3ANXA 3KQYA 5A06A 2HWKA 4DPMA 1TO2E 2ZRBA 5A9TA 3VNRA 3BAAA 5DLYA 4FNMA 4ZCRA 4M21A 1JSCA 3P27A 4NCXA 5GGYA 5FO0A 4XIFA 1WOYA 3W8FA 2A7XA 2ZUFA 3EA5A 1BFUA 1WCIA 1A72A 1T8RA 2Q5FA 3JQPA 4GLFA 4O2BB 2J3HA 4Y67A 4BFLA 4E5PA 1TTTA 2WIJA 2DHRA 2DUNA 2QMOA 3V34A 3KTMA 4MQEB 4EHKA 5LOVB 5E1MA 4EG4A 1D2AA 2WQZA 2I3AA 1VG9B 3TKAA 5EJ6A 4FR5A 2O06A 1JYFA 4NOMA 1YXMA 2HU8A 1EFDN 1PWYE 3P9PA 4I66A 1US8A 3T3IA 4FFDA 5BSHA 4KQ9A 3EPPA 2J7PD 3SXUA 5CM0A 3MAGA 4L73A 5K4AA 3O8QA 3KB8A 2GNAA 1QYDA 4MI9A 3EA4A 1J07A 3EK2A 1QIKA 3L4BC 4HD8A 4ZODA 3NDIA 4DR1B 1GYFA 1UJNA 1JE1A 2P0EA 1TJNA 1VTKA 1ZL2A 5CTJA 1NLFA 4RLQA 2PX4A 3V8BA 1KJ8A 3GEEA 4IYRA 2GRJA 3GFBA 1J2JA 3VR4D 1TZCA 1Z38A 2IOQA 4KYVA 4CFSA 4Z7NB 1Z2DA 3IMGA 4MMXB 5JHGB 3CE6A 4X3PA 2HZ7A 3BWBA 2QVCA 4H3HB 3OZSA 4CTOA 1TXGA 4DR2H 2F3PA 2IHVA 3I2YX 3MERA 3G8DA 1KEEA 2WU1A 3DAAA 3R0IA 4CNQA 5C5IA 5LDDC 3UANA 4IMIB 5C3MA 2VBIA 3ZXSA 2H08A 4Z54A 2RG7A 2PZMA 1SD1A 2ZAIA 3ICEA 1OKKA 1SBCA 4P9NA 1KRWA 1XZJA 3JQFA 4Q24A 4XGKA 1R3UA 4L6AA 1QX3A 2QYOA 3LL7A 1LLUA 4AWAA 4F6LA 1XP8A 1M8PA 4TWZA 3PKZA 4YV2A 4IIJA 4Q02A 1SH7A 4L0DA 3TS1A 3GVIA 1J7KA 3SKVA 2WVJA 1NN3A 4QVKA 5KX5F 2M9MA 1YIDA 4ENUA 3IBFA 1ZHSA 1SB9A 3MWJA 4LV6A 1O6CA 4J0KA 1O96A 4TMYA 1JEEA 4IR9A 4Q9LA 5AJHA 5DNVA 1M34A 2C5LA 4DBLC 1K4MA 4HSGA 5IXJA 5I7RA 2HCTA 4JHLA 1WUHS 1XZMA 1YONA 2EFCB 3CRZA 4Q4LA 2YBEA 3PIDA 3FHJA 1XKXA 1DX4A 3NANA 1NUUA 3H0GA 1D1PA 1DIRA 2FOIA 5C8XA 1K6MA 3KE9A 3Q3EA 5TQJA 5KSZA 1CC1S 1C9EA 1E3JA 1UOPA 1MB4A 1GGJA 2G08A 2PSFA 1MQSA 3P71T 1YI1A 4NAHA 5T8KC 3DDHA 4LOIA 5HZHA 3ELBA 4G8CA 1AIPA 1E1YA 2HO5A 3P9NA 2Q8PA 1ISFA 2FSIA 1IN7A 4X6YA 3DWGA 3IOEA 3EVBA 3UTCA 5FBKA 2FQ1A 3NIFB 4PC7A 3T5GA 3O0DA 1CQJB 3VO9A 3ZZNA 4DADA 2VQFB 3OZTA 4PNEA 2C9YA 2OLJA 4XJTA 1L1QA 4RM2A 3KR0A 2IGTA 3RRZA 4YO8A 4F45A 4AJHA 2QX8A 1U7WA 2I9KA 5ITZA 4NDNE 4QWMA 3KCNA 2YXPX 1RKVA 2DHDA 3R9RA 1QQ5A 2HLHA 3A58B 3O74A 2QS9A 1Y34E 3RJ0A 5FEUA 1M2FA 4BVLA 5JD4A 2IPOA 1PGOA 3F6BX 5H3HA 5FWYB 3NUGA 5IFLA 4M7PA 3F78A 3H13A 5B30A 5MF6A 1RRVA 3DAYA 4E94A 2I4LA 4F7DA 1N34B 1IN1A 5J2TF 1LLDA 2IHKA 4EUKA 3H0CA 4R2IA 3UJ7A 3EZNA 2C9OA 4MS3A 4YEDA 4C6SA 4EPXA 1DWUA 3FUXA 1SOWA 1FNSA 3PUKA 5JCJA 1BE6A 3SXUB 4KVGA 1W48A 2BZGA 2IIBA 2QX7A 3LQQA 3CLVA 2JANA 1W88B 3K6JA 3NT2A 1VCIA 1PYOA 2DFVA 1XJCA 4CKBB 3UMFA 4JV1A 2VNKA 2WFAA 5IVPA 1DPFA 4FT4A 1BGVA 2FRVA 1NURA 5ELMA 4ASUA 4ZYVA 3M9XA 2B36A 3I4CA 2I2AA 4C01A 3WLQA 3D8UA 4P2GA 1T6YA 1T10A 4UFZA 1II9A 1XO1A 3C8MA 3K70D 3ZDCA 2J3JA 2ZTMA 2QD3A 2WD7B 3GNQA 3PZRA 3R0XA 8ATCA 4GKAA 3RVSA 2HBRA 3ITNA 4LF5B 1PW7A 1RD4A 5MN5A 3JQ7B 4BX8A 4B3TH 3AEYA 5EYPB 5BNFA 4DMHA 1BH6A 5CAEB 3BX1A 2HGZA 2YNMD 3P97A 5ICFA 2HLDD 1TM3E 1UANA 2QD1A 5SICE 3UB3A 3R0JA 1HK7A 3OLQA 3V1YA 2OL4A 5E4FA 5BN3B 2G72A 4GT1A 2JBAA 4NTZA 1T4MA 1PQYA 2ZIEA 3LV8A 5DJ5A 3U3RA 1FYFA 4O63O 1IBMH 1RADA 3AI7A 4TT3A 5HMLA 3GD5A 1YZFA 1ZMXA 2IF2A 1H2AS 4B2LA 3SZLA 4DIBA 3AFHA 1OBDA 3PFNA 4NR0A 5L45A 3ISVA 2VL7A 1DBRA 2BHSA 3DHEA 1ZHHA 5TPWA 4IIEA 1MO3A 3UN1A 1X92A 4DOMA 1RFLA 2HQSA 3E23A 2OHHA 4PVCA 3BIWA 2ZB7A 3A6JA 4B8WA 3VSDA 3UT5B 2V3VA 3NJRA 5J1TB 2V7WA 3FG9A 1Z7WA 1L4UA 3T5JA 3NEPX 4GEGA 1UC8A 3ROEA 1WXEA 2HPHA 3UJHA 5JU6A 4CV0A 2RAVA 3BFVA 1E2EA 3D7KA 3KB1A 4A4DA 2G9RA 4EYEA 2FE3A 2CMGA 3K5WA 4Y30A 1SCKA 1WS6A 2ID9A 3SQWA 1DCMA 1UBUS 3MR6A 5DWDA 1FNDA 3AVYA 1NIPA 1SOAA 3SBEA 1O9GA 4HN2A 2BEJA 4A2CA 1HSZA 4EMTA 3L0IB 2O52A 1X7GA 3IP9A 3MIIA 4J0JA 5H82A 3W7BA 1WCV1 1XRQA 2J4DA 4GZLA 3LO5A 4CR8A 1BA2A 3WDMA 4NMWA 3T54A 3MGCA 3K0AA 2O1WA 2XDQA 1SKUA 4MKIA 3VX4A 2DPGA 3FLBA 4MS4A 1S9HA 4C6TB 4GWGA 2JFNA 1WXXA 4QAJA 5CW2A 2JJ8A 3TOSA 3LU1A 1HEYA 3LCCA 2GMWA 4LZLA 3DMHA 3STTA 2VSXA 2AFHB 4E2XA 2WSIA 3I83A 1EXMA 1J5XA 4MUYA 4X1YA 4RTPA 4K05A 2VP6A 2VT2A 5FKJA 1CFJA 1V39A 2G63A 5JNWA 1RIIA 5AO9A 3OSUA 4G26A 3V4SA 3FAZA 5BPFA 3AXSA 5A0FA 2MYUA 3K2EA 4TV9F 1O95C 3AWIA 3NZEA 4I08A 3R75A 4DAAA 1RE1A 2W58A 3ZIUA 4BECA 3ED1A 1ADFA 4MDYA 3G9TA 3H5RA 2B20A 3DEFA 2XHZA 4RDIA 5C8YA 4BY1G 4HYEA 4JP8A 4OYRA 2Q6LA 3BA9A 1TMGE 1ZFNA 3D8NA 2Y4NA 4MW9A 3SQDA 1XZFA 4MR9A 4RKEA 3VZDA 2AG8A 4YPVA 4X71A 1G41A 1CULC 4YR3A 2RAUA 3DHVA 1C4WA 4RK6A 4BGEA 4QTYA 3S2SA 1CUHA 3AJDA 1B04A 1QFJA 3ZZTA 2JD1A 3A4TA 2ZYRA 2UZ0A 2FFHA 3HA7A 1Q7BA 2HV9A 4XQGA 5JC1A 1D09A 1YDFA 2Z1NA 2EHDA 2Z4RA 1XRLA 3PXEA 5JYEA 4ESHA 4NEHB 2HK9A 2AC7A 5GJBA 4DXHA 1I13A 3DAOA 4IEEA 2C9CA 1AO0A 2DETA 5KKNB 4Q9DA 1JLLB 2MSKA 2QN1A 5ISMA 4XPIB 4ZGBA 3EGWA 3L0ZA 4LJ7A 2NO1A 3X2SA 2Q2QA 4LI3X 2IP1A 1OV4A 1J33A 1UKYA 4N8SA 3BJRA 1G7CA 4A0HA 3K8ZA 3C1AA 2BZ1A 2ETXA 5DQGA 3UCEA 1ND5A 1QBKC 3RFVA 4KI7A 4JNKA 4BQSA 1XT6A 4ZPXA 1TGYA 3K0FA 4EENA 2LKCA 3E2PA 3G9ZA 4U1RA 2G6TA 1SBQA 4N82A 2OZEA 4QEZA 1LBHA 1QIFA 3N8KA 1KYTA 4QU9A 5A4AA 5JNSA 1DINA 4D92A 4MB0A 3U31A 5KFXA 1Z83A 4D8VA 2IPMA 1OA1A 2HQRA 3EXHB 3V7FA 2VBGA 3T9AA 1XWIA 3GV7B 1CLUA 3WR5A 3UAVA 4PINA 4IOLA 1XRNA 5LOVA 2GZMA 4A6PA 4DMUB 1XTTA 1ZC4A 2FX2A 3L9XA 1JPJA 1Q95A 4ED1A 2RK4A 2BISA 2NU8A 4EF6A 2W42A 2TECE 5JV5A 2A4KA 2R00C 4UXHA 4X92A 4PPYA 1XL1A 4KKXB 1Z0DA 2HHFA 5L3ZA 3FLAA 2V9WA 5BT8A 3FPEA 2JGDA 1Z25A 3QEJA 2R6AA 3GO4A 3STXA 1H2EA 2FVYA 4FFRA 2LXNA 3BKXA 2V0CA 2XYQA 4IQGA 1G19A 3EQ7A 2ZT7A 2QLLA 5JCOC 4RFVA 4YBZA 5IC6A 4E3ZA 5BWRA 3L18A 2F4NA 3K9CA 4FFBA 4OQ4A 5HE9A 1NSYA 3GI1A 1DTSA 2VHEA 1OHHD 2DBVO 2PT7A 4X24A 1RVV1 4TN1A 1DWQA 5JY1A 1N2JA 3DF9A 1SGWA 3I32A 4P34A 3G0IA 4BNDA 1AK2A 1BCRB 3L8DA 3G3EA 2NUAA 1IAVA 3MJ4A 3HDJA 4H9GA 1PTKA 4LF8B 4C7MA 5B4TA 2J09A 5K0SA 4UQPA 4IWXA 3L06A 3HQ4O 4ROTA 2EQBA 3L01A 4N3GA 1H1TA 2HLNA 2YKGA 3BWVA 3KIPA 2W8LA 1E4VA 2G28A 1BWQA 1M1YE 3MM4A 2C9BA 3CYFA 1CY0A 2Y3IA 4HAOA 5ENVA 3WWYA 2WJZB 4BWSC 3QJ5A 4JD5A 1UAAA 5BMVA 3HJAA 4H7FA 2DTDA 3TLGA 3DAGA 1CY2A 3OU6A 2WIFA 4RESA 5KT6A 4Y1RB 5IJ0B 2OGTA 2JJ2A 2WUVA 3NCTA 4NG4A 2B0JA 3KPWA 1Q7RA 5KYUA 3A4IA 4P22A 1GU1A 4ALNA 1GAXA 1ZSYA 5C0OE 2YBDA 4LXUA 3DW1X 4NDAA 3CPHA 1LSSA 1BAPA 1MJNA 1NUPA 2IE8A 3NP7A 5FXMA 4MYTA 1RM5A 2OBXA 3LPNA 3OO1A 2I9PA 2Y0SA 1BXRB 2ZRHA 4KN6A 1RI2A 3AR6A 1KI3A 1VBNA 2JJYA 2ZIFA 2ZWPA 3IP8A 5LVAA 1UPXA 1G4HA 2J6CA 3I2KA 4YCDA 5CNJA 5E4YA 4DLYA 4EB0A 4GMHA 2QE7A 2FX5A 4P53A 1SD2A 3LWBA 4YP3A 1DU4A 2FN3A 3CM0A 3MJHA 2FZWA 2W9XA 5KAPA 1LBIA 4EFDA 1U0RA 4D5GA 5KC9A 4NIMA 3TTWA 1CUAA 1NPDA 1JHOA 2YS7A 1O6FA 2AKEA 3PPXA 1QLWA 4BVJA 3I39X 3BMOA 3GTGA 1KI9A 1MB2A 3DOJA 5CXXA 4BO5A 4HQKA 1NDQA 1FRQA 5HGJA 2Q3DA 3ZY4A 2XWSA 3HKBA 4ZV4A 2N47A 3GVXA 5DHUA 3HEMA 4YR9A 1YZNA 5FAKA 1XMIA 1TYZA 1CQIA 2HD4A 1RAGA 5DI3B 5JLAA 1XMQH 4KO3S 1E6MA 2QT0A 4CV1A 5ICSA 1HRDA 1DKOA 4WOPA 2IPXA 3C5WP 3OSNA 4NZNA 4ALMA 2PR2A 4OHKA 1Y98A 1N8KA 1VL6A 1HSOA 1JFTA 1JILA 5AKGA 3RU9A 1MC8A 4RFSA 2BFBB 1H2FA 3N2KB 4K1XA 1XNGA 1L5GB 4PO9A 1CUIA 4HVLA 1DQNA 1ZITA 1UCFA 3O91A 2WJWA 5JD5A 1CY7A 5K6TA 3UBTA 1LX6A 1VKJA 1RAEA 1DHRA 2O20A 2VUMA 3EGXB 3LGSA 4TWRA 4L22A 5IVIA 4BU0A 3NKVA 2I91A 4BVGA 1HYBA 2OWEA 2C2ZA 4I4CA 4TV8A 3CVVA 4MEJA 5ER9A 4MPJA 2WWHA 3PDUA 3RVKA 2PN1A 1BRMA 1QGUB 4B32A 5JPDA 2JJ1A 3IUEA 4L76A 2O1XA 1J1ZA 2JVJA 4P3PA 4YP1A 1IPEA 4C4ZA 1J2YA 1NN0A 4BX0A 1ZBDA 4KRGA 5F2NA 1PDVA 2RH4A 3JASA 2P4HX 2HXSA 3L7IA 4EHFA 5LSAA 1YHNA 4RZQA 4FCVA 5AIAA 4I9NA 1MT0A 3TNJA 2OYSA 3WI7A 3WZ2A 3BS4A 3GTLA 1Y8ZA 1QV7A 1MAHA 1EUDB 1YZTA 2Q0QA 2VF2A 3L02A 2VNJA 4PG6A 4U7CA 1VPDA 5K0FA 2AW5A 3EVAA 4FBGA 1TAHA 3ZNQA 5EKTA 2QGNA 4RIFA 1R8YA 4GR9A 4OF4A 1S3SA 1ZQ9A 4HTFA 1R4AA 1R5BA 3D7MA 3KDPA 1VLZA 4HH0A 1GV1A 2PGXA 2PGLA 4H77A 4KXUA 1G8SA 1R0SA 2WHYA 4ECUA 4NBRA 3TLAA 3BH6A 3TLGB 1ZUNB 1AT1A 2GB4A 3K0CC 1JSXA 1NA5A 1ZNWA 3AETA 2QSJA 3HJGA 3IBTA 4UU1A 1DLIA 2QVBA 2RI6A 2ABJA 2R6JA 1W0KA 3BIXA 4EKNB 5K3WA 5ILOA 3IEMA 2HHHB 3I53A 2V1XA 2WV7A 4B3BA 3WKCA 1IVSA 1J56A 5CDUA 3GBVA 5KSOA 4QFMA 4W5NA 5HIMA 1Z5OA 3Q8WA 3U09A 1AH2A 2P9BA 3E48A 2QF7A 3CSSA 3JD1A 5FL7A 4HDKA 4OEHA 5BP7A 1EVLA 3FOBA 4CF6A 1DUVG 4N7BA 1NC3A 1HF3A 4WZ6A 4KQEA 5LYJB 1FTNA 2IDMA 2YMMA 1CD5A 4ZOEA 3AZQA 5EUMA 1KEEB 2RBGA 3VC3A 4R81A 3ZXUB 2XXBA 4CF5A 3EYAA 3T95A 2JA6A 4XR4A 1U98A 1C30A 5AJVB 5DU2A 4V3BA 4UD2A 4C7OA 3NOQA 1T36A 1M83A 3T5HA 3OCJA 5EHQA 2XCRB 4YVFA 4X1KB 5KT7A 2ZTVA 4D44A 1NUAA 4NMLA 2PQ6A 1X2EA 3U7HB 2BELA 1YL7A 5KYVA 4WNYA 1U11A 5L9XA 2ZWAA 5FORA 3I4LA 1RC1A 4O29A 3NLLA 1JHPA 3VNSA 1PWXA 1M9NA 4JUFA 5TMDA 1MX1A 2DYKA 1TUBB 1X1TA 3F8WA 4XQEA 4ETNA 2Y6VA 4Q4HB 4CTMA 2AWOA 1V7PC 1YIAA 1VHWA 2C8JA 5FPOA 2GGSA 1OGJA 4FQ7A 4JT8A 1W36D 3FCOA 1VSQA 2Z4TA 2CNDA 2WFLB 4RJLA 3DBHA 2PSEA 3KR2A 3QNUA 4C3VA 3D1LA 1RBQA 5F5LA 3FKIA 4WMLA 4Y6QA 1P9NA 2B83A 1C4KA 1GG2A 2OOSA 1FNMA 2J6TA 1NBHA 2Q49A 3HYNA 3KQWA 3LK6A 3ND8A 3OEYA 3PXDA 5CHEA 3UA4A 2Y6UA 3CFYA 3NHPA 4BUCA 2D8MA 1U9ZA 4K3VA 3CEBA 4R1PA 1T9BA 5J9FA 3UYLA 1W87A 5LKRA 2LW7A 3C70A 5MGNA 4J1SA 1LTQA 4WW0A 3UHPA 4B8ZA 1AKUA 4QOFA 4O7NA 1ZM4A 2GCNA 1NL3A 3HBNA 3JD2A 4BLOA 3EUAA 4PN7A 4L8YA 3QI7A 2CNOA 4W1SA 3DBLB 3DZ8A 2AZDA 4JJ4A 5JSZB 1YZUA 3H2IA 3U13A 2WG0A 5COQA 3TPZA 5KOJA 2JAWA 1WZEA 5AW4A 1S68A 2C2BA 3A6FA 3PTAA 3WK5A 1RZRD 3LUKA 4KWCA 1EB8A 2GT1A 1YQTA 2XNKA 2YJTD 3D6HA 3QQPA 2BGRA 3GJSA 5DBFA 2W8KA 1AXEA 3NNNA 1E1CB 3T06B 5K45A 2WWRA 3ISTA 4WKPA 2LCFA 1MIHA 3UK6A 4YV0A 3L05A 4KPFC 3JPWA 4YCMA 4IXDA 4FN5A 2JAOA 4MV8A 1NWCA 1QOPB 3A06A 3ROQA 4NBLA 1N7HA 3I28A 1GQQA 4RF3A 3X1WA 1KO1A 1NM5C 2JI7A 3A27A 4C6RA 3SU8A 2HEIA 4QC2A 3HDHA 5D5HA 3SNHA 1U8FO 3A6KA 4BMSA 1QPZA 1RJWA 4BCCA 3IR7A 4F5YA 1Z33A 5D1HA 3UMGA 3V3TA 2QN9A 4IHAA 2EEPA 3FVWA 4QEDA 4EPWA 4S12A 1M1UA 1SC6A 2OCLA 2WKQA 5IJXA 5EWGA 2QTZA 1TJPB 3USCS 1FDOA 2AF3C 3TLEA 4HL6A 3UIEA 4F60A 5JAIA 1YT5A 4M0CA 5IAAA 3JAMW 1RBYA 5GZ6A 1ONSA 1J39A 4M0EA 4X0EA 3VM6A 1IATA 1SUWA 3OX4A 3V2HA 3H6HA 1MZPA 4FFBB 3T3OA 1QYIA 4JLAA 3IHLA 4KH0A 4JI0H 1VPTA 5GOZA 1B0ZA 3H75A 2P3SA 2Y05A 5IKEA 4QPNA 4HYKA 1J42A 1C30B 2B61A 4UAGA 2OBLA 1V45E 5TDHA 3UG7A 1FVHA 5JANA 3O8CA 1LLFA 2QL9A 1SVOA 4I9UA 3IE1A 2DWQA 5EE0A 3OZEA 5DYNA 4AJLA 1X80B 3DL4A 1X7ZB 2R68A 1KAOA 3A1FA 1F6WA 2C94A 2I4OA 2R6R1 2ZJ3A 1X7DA 2X15A 3DP9A 3GJ4A 3GTMA 1GTRA 1JLMA 3TEKA 4WNAA 1GHTA 2OYRA 3C3WA 2VDMB 3HACA 4RK4A 3UH0A 4CM1A 4AY6A 4OBBA 1RJQA 3Q4GA 1S2IA 4P7KA 1O2DA 1AMOA 3FM9A 1F1BA 1UKCA 4KMMA 3UW1A 3ZDZB 4A1OA 4W7IA 4UHDA 2AJ8A 2PSDA 3DFMA 1I1NA 2E3JA 1NVFA 3T61A 2PMEA 1ZAKA 4FHEA 5CEFA 1V0JA 3AW8A 3C3DA 4G24A 1QRAA 1G60A 1XEWY 1ENPA 3QVTA 2IPLA 5FLXW 3JSLA 4AIIA 1LJUA 1Y3IA 3F8SA 4EOGA 2XIJA 2ONZA 3P0EA 4DSOA 1W4CA 3WHLA 3U3XA 1G5QA 3L1JA 2GLXA 2OCYC 3O4VA 3KAKA 1K5HA 1N3LA 1OY1A 2RB5A 1GGKA 3SXPA 1NYLA 3V2IA 4AY4A 8AT1A 3BJYA 2B98A 1YRYE 2C59A 2YWDA 5F9FA 1JZTA 4DLZA 4QWEA 1KYWA 1ECLA 3I9OA 1P6UA 2FR0A 2FKNA 2P9ZA 1FUIA 3PCXA 3IVMA 4JH0A 5DW0A 4EVRA 5JXGA 1XTIA 1V9SA 3NEJA 2ZI9A 3A9RA 3QNMA 4A16A 2AJDA 3V4ZA 1OW3B 2GX6A 1MPXA 3KFVA 4JWKA 2HCRA 4JLSA 4FGKA 4CQJA 2FFBA 2VN8A 2BBSA 2B35A 3IDOA 5BORA 4PC3A 2Q8NA 3QTTA 4XOUA 2BZ0A 3A1VA 1U2RA 1STOA 5EGSA 4FWIB 1KA9H 3OUZA 3JZ6A 2YWVA 1F14A 3BRCA 1MOSA 1YS9A 3RFCA 3K0CA 4LJYA 3VBCA 4E5UA 3ZCRA 1V5GA 4BMDA 2XQJA 3RB0A 3GK3A 1H9CA 3JD3A 5GJWC 5E6RB 4LSZA 3SYRA 4QPPA 3M83A 4DUPA 1FZTA 4KHPB 1FCJA 4BL5A 4CCSA 2FEKA 2ZAOA 3IUQA 4OQQA 1A95A 2RSLA 3N2GB 3RR2A 3KKMA 4URYR 2X3YA 4TSKA 3ESCA 2AK3A 1XNQH 5JTUA 2ZWIA 1RI3A 1FFXB 4CWAA 2LKDA 5FI5A 4IO0A 4J9QA 4DT1A 4UQLA 1QO7A 1A8PA 1NDHA 1TMOA 2ERCA 2BI8A 5DWQA 4P6VF 5LIPA 1MGPA 4CHGA 1M0EA 1EHIA 4JI7B 3QLUA 4O3PA 4E2ZA 4BO9A 4X7BA 3V48A 3K2IA 2FEPA 4NH0A 4IQFA 3W34A 1GLNA 2X8JA 2ZUBA 4YJ3B 2XZPA 1F8UA 4ZCQA 1U3DA 4Y2YA 5DHSA 2EJ0A 3L1UA 5L7TA 5EHIA 4BATA 2CFTA 3L7MA 1CDDA 3A3KA 1C1YA 1XELA 3PJGA 1IUKA 1G7RA 2P69A 2PMBA 2BCGY 5KFRA 1HDIA 2PT9A 3S68A 3KP1A 4PPQA 1R00A 3NORA 1M1NB 1XMPA 2ZFUA 1AA6A 1OBOA 3LFUA 3LGAA 3ELYA 4BO4A 4CW7A 2YRWA 2XUDA 4M98A 2DWUA 4DQ0A 4ZV7A 2QTVA 3GVCA 4IXTA 4ZTUB 1BHO1 1JBKA 5DTQA 3GLGB 2E5WA 5A0VA 1PV1A 1EA5A 1NQXA 1PJ2A 2AJBA 2OAGA 2XE4A 1X6VA 4KRXA 5U9CA 1XQ1A 2O8BB 3BMNB 1FLVA 2VF7A 3I2JA 5BO5A 3FCEA 2ODAA 4EARA 1J5EB 2VSFA 1IB0A 3PHGA 3EZ2A 1M10A 1CZOA 4MS3B 4PX3A 3K0HA 1ZUNA 4R01A 4FIZA 4WNIA 1E1MA 1JU4A 1CUDA 3KPVA 2YHIB 4MV7A 3KT3A 1V2GA 2D3WA 1OZGA 2RGNA 2BCJQ 2JGDB 3MMNA 5AOBA 3IQDB 4YJ2A 2CNLA 1OH5A 1XU9A 1XRPA 5HCUA 3WBKA 2HSEA 1YL6A 4EZEA 3IJPA 4P58A 4KHZA 4F92B 4YMSA 1C7QA 3UKDA 1KRXA 1SVWA 2AOTB 1FP1D 2RKOA 1H5NA 1P0PA 3FMIA 3GDOA 3AM3A 2ISSD 4V0OA 5DM0A 1ZUHA 2GEDA 3S7ZA 3MWGA 4RCNA 5JARA 5J40A 2A0YA 2HRDA 3LPDA 4AT1A 1EX9A 1NF3A 4LBYA 2CQYA 2HA7A 4AWBA 1T5OA 5IT9A 1F8GA 4JJIA 2YCBA 2ZB4A 2RCYA 4RVDA 4HAXA 4PYIA 2PU5A 3VXKA 2DGDA 1K92A 2B3TA 4B5LA 1PJRA 4D0SA 4G67A 2O7QA 1YFKA 1CQPA 1DWPA 1ZGGA 3K94A 5T14A 4TZ6A 1HNWB 1W76A 2P68A 1OLSA 1TIKA 2ZVDA 4WWHA 5A9RA 3FOZA 2QAGC 1G1MA 1MZBA 1ETUA 3NHMA 3QU7A 4QU5A 1J0AA 4O1HA 3IRVA 5JLJA 4PC2A 2J7PA 3ICCA 3BQ2A 4RORA 4EW1A 5IYZA 2H57A 2HNBA 2REQB 3U6BA 5KFZA 3F2IA 3WISA 3OZUA 3AUTA 1L4GA 4Z3DA 4AJNA 4BGIA 5JRZA 2BYTA 3IX7A 4J07A 3WGTA 2PG3A 3OMLA 4JP1A 5FBVB 3AZOA 4J90A 1Z0IA 4L8GA 2AG0A 3PW0A 2CWWA 2GN9A 3F3SA 4QBIA 3RNOA 3R9KA 3LBYA 3GXBA 3U1TA 3GQVA 4BCDA 3OE7D 1UC5B 2H18A 3GOQA 1DJLA 1F6DA 3QV1A 3ZLBA 3UAOA 1UKZA 2WF8A 2XSZA 4B1FA 4C88A 4DR3B 3SWWA 1VPVA 4DABA 10MHA 5JS1A 1LVGA 4Y2SA 2MSDB 4WUTA 1UXGA 3GEMA 1ZGAA 5LMUB 4ETMA 1N5OX 2ZE7A 3T1HH 3PPYA 4GMGA 4DNPA 4BO7A 1WMAA 3AX6A 3EWNA 3N74A 3QPAA 3RUDA 5I5GA 2GPBA 3QUBA 2ZGVA 2O6HA 4WY8A 1LF0A 4IXWA 1FVOA 2CCGA 3MYRA 3SM9A 3B70A 1N92A 4LFBH 1CY8A 3QOYA 1A5BB 5LP6B 2NP7A 2H9YA 4BZWA 5JVLA 2V9CA 3VDNB 4GR4A 4DLTA 2G4CA 1QHYA 3OFVA 1P2UA 3P2MA 5M34A 4UCQA 3TTXA 4FOPA 4DWOA 1P1HA 3DONA 3G9QA 2G5PA 3IALA 4R9NA 4LHZA 2H1HA 1H2YA 4BNUA 3L0BA 2O8BA 1CQIB 1RHRA 2VHTA 3JATA 1AKNA 4Y2XA 5A2GA 2G9UA 1V4YA 2GK7A 4OB7A 3STHA 1U4SA 1GGEA 4BKPA 1OFGA 3DMGA 4W9RA 4MUJA 1D3AA 1DMRA 2ID8A 5C4MA 4WDRA 4NECA 4HVTA 1E77A 4K40A 4RKFA 1KH3A 3R7SA 1ODLA 3VYRB 1X7HA 4RFSB 4FFMA 3T0IA 1UAGA 3B82A 3Q41A 2PZLA 5FNVA 4J0FA 4GM1A 2VOEA 4P7JA 1B74A 2REOA 1Z2NX 1EU1A 3N8HA 2WHEA 3UJNA 5EDWA 2AYYA 4CGYA 2GBCA 1IQPA 3HY6A 1IXSB 4GLLA 4DSAA 4E51A 4EG0A 1CT9A 3DUWA 2H1SA 3UOWA 2J59A 4IVRA 2OZKA 3I9NA 4EJSA 3DEKA 1WHSA 2Z2KA 3SYMA 4AG5A 3K3VA 1PO7A 4FNGA 4UHKA 2FZGA 4QBTA 3E3NA 4YJKA 2JZOA 3CC8A 4O8ZA 4WN9A 2FFAA 2WD8A 3UF0A 3LKVA 4GGMX 1SXQA 5FTJA 1SU8A 1AUVA 5DLGA 1ZI9A 2X86A 1LW6E 5FV7A 4OMDA 4IHJA 8GPBA 4PYNA 2C3UA 4G3IA 4YO7A 1A0IA 3Q0EA 1OT5A 2Q3MA 3R77A 2OHVA 1RBZA 2HZBA 2JLUA 1EDOA 4S2EA 1R6BX 2CL0X 3K0FB 4G1FA 2PUEA 1T0PA 1GTJ1 1Q7EA 3ENNA 3QA3E 4I1SA 4LRXA 3ZDXB 3ZU4A 3ZX5A 1N5JA 2VPXA 3ZZUA 4UUPA 1GPBA 5E6UA 1ZIYA 3COZA 4BASA 5TPZD 4UNNA 4ZJUA 4KXWA 2J6HA 5IU6A 3L8HA 1J0BA 3IUJA 2IWHA 1A50B 4KUGA 2OYCA 2N46A 7MDHA 4C22A 1FXSA 2QTTA 1P0QA 2A1TS 3DTVA 4FYKA 4IVPA 1R1DA 1GU7A 4OXNA 4QG7A 1D1TA 4GMKA 1WETA 2X1VA 3SZGA 2YASA 4DNOA 1YU6A 2GETA 5LPNA 4CRWB 3B3FA 2BF7A 2ATIA 3F9IA 2WPDD 3U7JA 5A02A 4JIGA 1UJ6A 2Q8QA 3UQ8A 3C3AA 3ETEA 3U4DA 4RK5A 1E7QA 4OPMA 5KSPA 3NHBA 5BW5A 3VZBA 1UFRA 1KQFA 5EWMB 4HDRB 1QFMA 4KACA 1CRPA 3GLUA 2QAJA 1QRUA 2JFYA 3N76A 2XY4A 5KT4A 4MUMA 2AR9A 2Y4OA 5T41A 5C5DA 5BWMA 4ZQGA 3RC1A 4HQRA 2VQSA 4FGZA 2A35A 2WTAA 3CKKA 4ABTA 3EOZA 4ZC8A 5KTKA 4NE9A 5IDWA 3E8SA 4KQJA 1PK7A 4LX0A 4TM5A 1U2QA 2PY6A 4RKWA 1RWMA 2PMZE 3WFIA 1ZR4A 2UYOA 3NOVA 2GD2A 2ERXA 4GOKA 4ZAWA 3RYIA 3VR3D 4NYMR 2LZ0A 1RXEA 2V7QD 3FHOA 4P2BA 2HB6A 3DGFC 1QP8A 4OMFG 4O81A 4D4JA 2CB0A 2QX4A 3S24A 3EZ6A 1WDWB 2HHAA 1ZONA 2W93A 1RI1A 4R2MA 3TIFA 4BZXA 5AQ1A 5BWBA 2XWBF 3B2QA 3EEQA 1CBUA 1ACMA 1MX9A 2PEYA 4OP3A 1EINA 5ALSA 1E94E 1KMCA 2CNVA 1JMVA 1M3SA 1UWCA 1JNXX 3MA0A 4M88A 5AKZA 1DBQA 3L7CA 3GFQA 3WB9A 3K96A 3K70B 3VBEA 5FIUA 2VPWA 2CNBA 3PVXA 2DH6A 2I66A 2RGNC 3B13B 4Q05A 2WHQA 4FYHA 4CM3A 3NR2A 4J2OA 1KJZA 4B0PA 1KIMA 2B5WA 3IGFA 3TEFA 4DR7B 4WD3A 1KI6A 4BX3A 5DTRA 1JDSA 5IZCA 3GJXC 3WMEA 4F4XA 1UT5A 1Z35A 1CJMA 4PSAA 4AUEA 4KR6A 3EEBA 5D3MB 1PEYA 1Z4LA 3BL8A 3PQ8A 2B1RA 3GJRA 3GRZA 1SHZA