2FP4B

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gtp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 131
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fp4B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fp4B02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fp4B03
3RV3A 3U9SA 3TINA 1C3OA 1DIKA 3KREA 2YYAA 2CNQA 5I47A 1JDBB 2NUAB 2QF7A 3UFXA 4L1KA 3VPBA 5KKNB 5LYJF 1C30A 4YBZA 3JZFA 3I12A 1GSHA 4O81A 1KJ8A 5KX5F 2DIKA 4YB8A 2W70A 5HBRB 2YWVA 3JZIA 1JKJB 5DMXA 4FE2A 1UC9A 2I80A 1AUXA 2NU7A 1CQJB 2R84A 5IYZF 1GLVA 2NU9B 4O2BF 2J9GA 2PBZA 2VR1A 5JQWA 1A9XA 4Y8VB 2W6OA 1EUCB 2FPIA 4XX0B 5LOVF 4O82A 4XYLB 5BPHA 4NYEA 4MA5A 3TQTA 2SCUB 4O86A 3TIIA 3MWDB 2ZDHA 3MWDA 4E4TA 2GQRA 2R82A 1EUDA 3N6RA 1KC7A 3U9TA 4YBZB 4O7YA 1GSOA 2I87A 3LWBA 4YAKB 2NU8B 5J2TF 2XD4A 3ETHA 5FNVF 4DIMA 3QFFA 4O7VA 4O4LF 4XX0A 1CS0A 3V4ZA 5C1OA 3GIDA 2NU7B 2Z04A 5C1PA 4ZQIA 3K5IA 4EG0A 2W6ZA 2W6NA 3KAKA 3R5FA 1B6SA 2YRWA 1E4EB 3K3PA 1OBDA 4MV9A 4ZOLF 4Y8VA 4O7LA 2FP4A 3BG5A 2WYOA 1PK8A 1ULZA 5C8YF 4O7ZA 3WNZA 2FB9A 3G8CA 2R7KA 4YJ2F 4FFRA 2CSUA 3G8DA 2W6PA 4HNTA 1OBGA 2X0SA 4MV4A 1VBHA 2V5AA 3AW8A 1Z2OX 5LP6F 4O83A 2C00A 4HNUA 4FFMA 4FU0A 2FPPB 5BMVF 4EGJA 4O7WA 4I50F 2YZNA 4IZOA 4XYMA 3DF7A 3UFXB 1M0TA 3NUAA 4HNVA 2CZGA 1EHIA 2W71A 5GONF 1SCUA 1W96A 2YRXA 5CAEB 5CAEA 2NU9A 2I8CA 4MV3A 3KAJA 2QK4A 4YAJA 2DZDA 5BPFA 1EZ1A 2FPPA 3MWEA 2YZGA 4TV9F 2R87A 4ME6A 4YB8B 4O4IF 5EZYF 2SCUA 5LXTF 1M6VA 1JLLA 3SE7A 4O4HF 1Z2NX 5JH7F 1VBGA 3WO1A 2NU6B 4IWXA 5CA1F 4MV6A 4I55F 3OUUA 3Q1KA 4O7RA 1OI7A 3R5XA 1T36A 2VQDA 2FPIB 1EUCA 4YAKA 2GLTA 2V58A 3R23A 1GSAA 5CB4F 1GGOA 3OUZA 5JVDF 3R9RA 2Z02A 3VA7A 1JLLB 2R86A 3ORRA 2HJWA 1KJQA 1W93A 2NU6A 3HBLA 1DV1A 1AUVA 3U55A 5HV6A 4QSHA 2YV2A 4XZ3B 3JRWA 5CA0F 2R7MA 2YV1A 1BXRA 1CQIA 1Z2PX 2ZDGA 2CQYA 3N8DA 4I4TF 5K2MA 2YS7A 3U54A 4FFNA 4C5CA 2DLNA 2YZMA 4HR7A 4XYLA 5D8DA 2YW2A 4XYMB 4FFOA 4FFPA 3VPDA 3MJFA 4FFLA 1EUDB 3VOTA 1KEEA 3TIGA 4M9UA 3R5HA 3RV4A 4XZ3A 3Q2OA 4IIJF 3MWEB 1VKZA 2DWCA 4O7TA 3WO0A 4WBNF 4MAMA 4DLKA 2R6FA 4YAJB 2W6QA 1KJIA 2PN1A 4MV1A 3HB9A 1UC8A 1KJJA 4IHJF 3K5HA 5HBRA 3RUPA 1CE8A 3TW6A 2NUAA 2R7LA 1KJ9A 2FPGA 3HO8A 2GPWA 3E5NA 2FPGB 3KALA 1CQJA 4WD3A 2HGSA 2GPSA 4MV7A 4C5BA 5LA6F 3VMMA 1M0WA 3ORQA 1JDEA 2YS6A 4FGRA 4MV8A 2R7NA 3LP8A 1DV2A 2P0AA 1A48A 2YL2A 3ETJA 2XCLA 2IP4A 4O7SA 2PVPA 1SCUB 2NU8A 2GQSA 2FP4B 1EYZA 2W6MA 4IWYA 1I7NA 4ZHQF 5JQGF 1PX2A 1JKJA 4C5AA 1B6RA 2CNVA 1IOVA 3V4SA 2ZDQA 3AX6A 3GLKA 2V59A 2VPQA 5J2UF 4HQ6A 3JRXA 2CNUA 1I7LA 4O4JF 4O84A 4EGQA 4ZI7F 4TUYF 3PFFA 4YJ3F 3RFCA 5JVLA 4MA0A 2OLSA 1WR2A 4RZQA 1KUTA 5H80A 4TV8F 1CQIB 1KBLA 4O2AF 1E4EA 3VPCA 2R85A 2YZLA 1IOWA 1BNCA 3DMYA 4O7NA
chains in the Genus database with same CATH superfamily
3T1HH 3V7FA 3RV3A 3M2TA 4GOLD 3OBBA 3AEYA 5EJMA 4R1TA 3RBAA 4N3AA 3I09A 1QANA 4Q9KA 1DADA 2QG6A 5D3ZA 5I47A 2FSGA 1ML3A 2ZAMA 4PBRA 2XB9A 1Y8RB 2QTZA 2OLJA 3AHJA 1T3GA 4OL0A 5AVWA 5HRCA 4F1WA 2BFEB 1S0UA 2PLAA 4KX3A 1R9JA 5D51S 4XJTA 3IP9A 5CFPA 1UJMA 3D8HA 4II3A 3IE0A 2QRVA 4RAOA 4ENRA 4WK0B 5EIWA 2GESA 3VPBA 1PBTA 1ZUWA 5IPFA 3H20A 2PKQP 2IS2A 3NBYB 5I5GA 3GPCA 4EM6A 3AXSA 1C30A 1VMKA 3MTDA 4BE7B 2NM0A 1DKUA 4TMFA 4QWCA 3DV0A 4D8UA 1L4FA 5A02A 1JQ5A 2WB2A 3WBJA 4OUDA 3KPVA 3H18A 3VO2A 3UA3A 3CX8A 2BZGA 4GKBA 1LC3A 5IC4A 2BGRA 4E51A 4B2PA 3VR6H 1M34A 2J07A 4NYIQ 3KSBC 4OIFA 1E0JA 5IMSA 5J4YA 3KTMA 1XE3A 3OHPA 2VATA 2OZLB 3VHLB 3GTMA 3OKFA 4JV2A 1UC4B 1YL7A 3RC1A 4K6HA 4L6AA 4QOGA 1FFEA 5GTDA 4MWTA 2BZ0A 1EXDA 2BDTA 5EWJA 1F8GA 2DFKB 1P1JA 4HO1X 2IA6A 2FJ0A 1XZPA 3JS5A 1G8JA 4GDMA 1NF2A 1YULA 4LHYA 4KP7A 1NQUA 3S2ZA 1J5EH 1JYEA 5J9FA 1A97A 2VTVA 2R84A 1R4NB 1XQVA 4B3XA 1B42A 2RI6A 4YHHH 3W5VA 1GLVA 3KHLA 2Q8QA 3DDOA 2Q50A 4IDBA 4G0WA 5K3DA 2NU9B 3PO3G 3AF0A 4HYKA 3B8EA 3IBCA 4KQCA 2H9IA 4ACAA 1K66A 4Q3OA 1FX0A 1VCOA 2AX3A 1EKVA 2OBBA 3E3LA 5LBTA 4AICA 5AJZA 1MB3A 3BTVA 4H7IA 5LOVF 1QHNA 2FN4A 4QQRA 1YRAA 3E3MA 1PL8A 4WESA 2B4YA 5IJWA 3KYCB 3BQ0A 4QIWA 1YVUA 1PT5A 4CL8A 5HUHA 4P22A 3IR5A 1ZK4A 3DDWA 1FFBA 2H3EA 2DBYA 4S12A 2HPVA 1NVWQ 3BA1A 4WINA 4LXTA 6AT1A 3NBQA 3QLVC 5BR8B 2PQMA 2HI0A 1GZ3A 3E53A 2VDQB 3FBGA 2O0JA 3EEOA 3WAGA 1BO6A 3NYWA 2ERYA 4RAQA 2BSXA 1IIBA 9MHTA 1NBEA 2C5EA 3KSRA 2V9CA 2ZR7A 4YTEA 5FLKA 4F97A 5A5DA 5BN5A 5DPMA 1AQJA 3HOVG 2GEDA 2R5FA 4OX9Y 1ZKMA 3PDCA 4AK9A 2XODA 1P2TA 2C94A 1N2CA 2P9ZA 2CFTA 2WV9A 3G9UA 1BFDA 1GFIA 1Q7TA 1EEXB 4KIGA 3NTLA 2WF9A 2B25A 4TT3D 5FPPA 2VSNA 3RVDA 4DV1H 5BN1A 4ILKA 3QYAA 5KFCA 2BW0A 2W2VA 2Y0CA 3G0IA 3QBEA 2AQ8A 3O8BA 3AUXA 4DDVA 3CWZA 4ZVMA 2RD2A 4ND4A 3D8BA 4LGMA 2R6HA 2JAUA 3PBKA 1R4MB 2BEKA 3DEFA 3FPJA 2C2XA 2D2VA 2PUVA 1T8RA 3K0AB 3PPVA 4G2TA 1ECGA 4A73A 3RADC 1KRHA 3GJZA 1PTKA 1QHYA 1B43A 3JQPA 5KYTA 2PU7A 5KUTA 4FOTA 4Q7KA 4MHTA 1HOXA 3GIDA 1JJAA 4INAA 1I2DA 2D2IA 4K9LA 4WJZA 4JCCA 5FPSA 3UK7A 1WETA 1N48A 4HH0A 4RVNA 3TSYA 4F7DA 1BROA 3FOCA 3WQQA 1M8JA 5L9XA 1C9NA 4R1LA 3EIEA 1IRXA 2J9YB 5FBLB 4BPBA 4UCTA 5KFGA 1CNEA 1Y9ZA 3C4QA 4PXYA 5EMHA 2I91A 3QYJA 5DYIA 4IV8A 5E9QA 4ECWA 2FHPA 4WZBE 4KXWA 4ZZ2A 1ZOPA 1JFVA 1Z0JA 1G8FA 2I76A 4INJA 5ALRA 3EDQA 3L41A 5HE9A 2NPOA 5JYEA 1P72A 2FCRA 4RF4A 3F97A 1GPMA 3WI7A 5D6OA 5KSYA 1DCFA 5FLMG 5TF4A 2G5GX 3RUIA 2JD0A 1L8XA 3DTTA 4NQZA 4G41A 1I2MA 5JSZB 3DMFA 2YYZA 2FPUA 1JG1A 2DUNA 3OM0A 1FVOA 4RD1A 1UEXC 4BECA 5DWQA 2X1VA 4G3IA 4MCHA 2XCRB 2GJ8A 1COWD 5F78A 5BRNA 1ECJA 4Q82A 3G9QA 4G5RA 1D1PA 2R7KA 1OI2A 3SYRA 1DCKA 3WYGA 3HBAA 2WUEA 3RKRA 1XSEA 3ROQA 4E33A 1B04A 4TLMB 4MVJH 1R0YA 2P2CA 2HSWA 1G20B 2NAPA 3CSDA 1DO8A 4PNPA 1JKMA 1MFZA 5DCYA 3RSCA 1XMVA 5E9JA 5CBPA 2B1GA 3GDGA 1X86B 2VSQA 2O8DB 2NXWA 3HLKA 2HR1A 3A4IA 4KQJA 4JB2A 3O31A 1EJ6A 2TMYA 4I8DA 3GRCA 5BQFA 3HOXG 1T6BY 3NORA 4UZSA 2C7GA 1DSSG 1A5TA 1X8KA 2CLSA 2IU6A 3GX1A 1WVIA 3IAM1 2PU5A 3NJ8A 3PGMA 4J9NA 4RKEA 4UDYX 4WACA 1GNVA 2HWUA 3DHNA 5HKLA 3DEAA 3PR3A 4OJQA 3ZGXA 5U4QA 5AW6A 2ID4A 1KMQA 3CF4G 4QLOA 3FPGA 4DL2A 3E48A 1U7PA 3OJCA 1XXHE 1EB8A 3IT2A 5I5EA 4TROA 4NSNA 2DC1A 2VJBA 4X95A 1GGMA 3RVNA 4R0MA 1U8CB 1VHJA 4KPYA 221PA 2IW3A 4CTMA 1VTKA 3UFXB 2H00A 2KSQA 3PUJA 1P0MA 5E9AA 2MMGA 3MMSA 5ER9A 3W34A 4QU9A 4GPAA 1EHIA 4E6EA 4G0MA 2VRBA 3EVCA 3L18A 4O63O 1BXGA 1CTQA 1PSDA 1AB5A 1N2ZA 4LFCB 3TECE 2O3TA 5JWRA 1B76A 4REOA 4OHRA 5DTMA 5K0JA 2YXLA 1O95A 1XX6A 3DC2A 3RYHB 1JDUA 1UQRA 1WEHA 5C32A 4G84A 1IZZA 2MINA 2P78A 1K5DA 1TJ3A 2AMJA 2EDCA 1IZ8A 1TUEA 5KB3A 5IKPA 3FPEA 3ONWA 1D6NA 2QK4A 1XRQA 1F2TB 1V1JA 3HJAA 2CBZA 3U4GA 1XJWA 5ER6A 5JXGA 3WDMA 4H18A 5BWNA 1RHQA 2OO5A 1OKKD 2C95A 1CDOA 3KUXA 4WQMA 5C4IA 2BP7A 2ONZA 1KP3A 3RFTA 3L46A 1J09A 1V5GA 4KEAA 4CYMA 2WW8A 1CIJA 4J76A 1SBYA 3AR5A 1HDCA 4TQRA 1W4RA 4KQHA 1O8BA 1UQUA 1PNQA 2GSDA 1WXEA 2GNPA 4WTOA 4X92A 3RRJA 3HV2A 4CR6A 1JDZA 2J6SA 2FEWB 2VDJA 3DVAA 1LLFA 2IXEA 3K4PA 1RWOA 5KFXA 4IO1A 4KQIA 4P5EA 1LSSA 4D0RA 1PJAA 5C35A 4DV1B 1GZHB 3EA0A 3BF8A 3IUMA 5AVUA 3MGKA 3DFUA 1JJVA 5FI0B 2BJHA 3AESA 1JSRA 4R98A 3GV8B 1XJCA 1G7RA 1W88B 5KYKA 1DX9A 1D5CA 4ZYTA 2AFRA 3Q1KA 2Q2TA 2WHPB 3K2QA 3LC2O 5LKRA 3OTOH 1JECA 4B6PA 4XSGA 4FYIA 4QTTB 3GCXA 1Y3CE 3OFKA 4UTNA 3FSGA 2ZB2A 2I22A 4MW1A 2X0KA 5CB4F 1IBRA 3H40A 1NJGA 2P65A 4BL5A 3W4JA 4KTTE 5LNK6 3WX0A 1HK7A 1UK6A 3DJFA 4ZI5A 3KS9A 3VA7A 4H4DA 3R7BA 3O21A 3FPHA 3G2LA 1GILA 4IJMA 3WGQA 3B1KA 3FWNA 4ENQA 2ZUEA 2HJWA 4DR5B 3SZRA 1TT5B 2C2EA 1FLDA 3DNMA 4K0KH 5DN6D 1LX6A 4XDGA 2VQ3A 3AEKA 5K8JB 4TKUB 1C1DA 3VDRA 2C29D 3CUUA 3GAZA 3KOMA 3L6RA 1U9JA 2O8CA 1ODTC 3UMVA 3GXOA 3B7GA 4HADA 1GJRA 2QR2A 4P80A 4PVCA 4ZQHA 5F98A 4N4AA 3V4FA 1AO3A 4ESHA 2XBUA 1LTKA 1TKCA 2FMXA 2IYRA 5DBOA 3T4UA 3RIEA 3JYLA 2F1IA 5IS2A 3KZCA 5KG4A 5KYYA 3AU8A 3RS5A 2JJ1A 4DBLC 5KFDA 1ONSA 2AZDA 1G5FA 4IW3B 1I5RA 1Q0LA 1M34B 4IUDS 1Z8DA 1UMDB 1UK9A 3BH7A 3OZGA 5A5GA 2EG5A 3MS7A 2H0RA 1OLXB 4HP8A 4FFNA 3V4OA 3L8CA 4OXXA 1RKXA 2YZMA 2W22A 4HFNA 3PVSA 1HQDA 1PZEA 3PIDA 1PRYA 2NYUA 3TX2A 1Y1KE 1OU0A 3AUAA 5IMBA 3TZCA 3L8ZA 1UM9B 2P5YA 1ZGGA 2NN3C 2QRVB 3I4LA 1R74A 1ZD9A 2WA2A 3LYLA 3PICA 4R7ZA 3RAGA 3ZI0A 2OM2A 4MJ3A 2BFEA 2H92A 3H9CA 5CJ2A 2HVSA 4BCDA 3VR1A 4D96A 4QREA 2VZEA 1RRMA 2HWXA 3E05A 2GLXA 2RSLA 4PGMA 1NBOA 2HJGA 4YYEA 2NZYA 2X3FA 2H18A 4XFKA 4LVUA 1PEDA 3WWOA 1JDJA 1SD1A 3AR9A 1A3GA 1N6KA 3O91A 4BFSA 4B3SH 1XCBA 2BHRA 3JVIA 2DHCA 5IU6A 3BABA 4IBOA 3K5HA 4S24A 1Y3IA 2CUTA 3G1WA 1V16B 2L82A 4PGHA 4KVFA 1KYTA 3AH8A 3NHAA 4TMKA 4YALA 1B14A 4KMOA 3TRJA 2XHEA 3L7NA 5DOVA 4RPIA 3TBKA 1P31A 2BUAA 4DM4A 2XZOA 4OQZA 3R8XA 1CEXA 3U13A 1Z0FA 4GUDA 4M22A 4YPFA 3TNJA 3GJ6A 1FXSA 4LOLA 1SU6A 1CFZA 3QVUA 5G40A 5H0IA 2FPGA 3GLVA 2H48A 4KL8S 4E2FA 4YUAA 5H4GA 1U3WA 1AS0A 2WHXA 1DCMA 2CN1A 1T4CA 4DADA 3EBOA 2I2AA 1IUNA 2G0AA 3EAGA 1PFYA 4ZK2A 3MCTA 2Y1GA 1ESMA 4RU9A 4GKKH 2DAPA 2W2TA 5B1SA 2WLSA 4D5EA 4HTFB 3QWUA 1UXKA 1JVNA 4QYMA 2L42A 5JC1A 5L1KA 1M5UA 2Z2XA 2G9ZA 4RNDB 1R5NA 2RHGB 4YN3A 2YVQA 3PEVA 4QG7A 3HJNA 2E5WA 4IOMA 4EEXA 1KAEA 1GITA 4IIVA 3ZD7A 4A36A 3LRTA 4X94A 4UUMA 4OHFA 3PUKA 3L4SO 4DMFA 1WB5A 3C3WA 1PJBA 1T4MA 3VR4H 4G5HA 3GN1A 3PU6A 1OAKA 1YK0A 4GD3Q 4OBBA 1MNQA 3KYCA 4J0CA 4NHEA 4EHIA 4OHMA 3CVZA 4DCJA 3LMKA 3C7AA 4TWBA 3RTDA 3LP8A 3ABSB 4AKHA 1NA5A 1C7FA 2PH7A 3IRUA 4E4YA 1WXDA 3L7BA 4QNMA 4TXJA 4WKPA 5JVDB 2XGSA 3E3NA 3QKSB 2JFUA 3KE9A 4OLJA 3ZGVA 3WKAA 2FW0A 3A4YA 4DA6A 1QIJA 3IVRA 4R2HA 4E31A 5E95A 5CVDA 1MXHA 3EQ2A 3N58A 1YHZA 3WYFA 3I45A 4B3SB 1FX0B 4EW2A 1FTQA 5BYAA 1QG2A 4KO2S 3RFVA 3DWFA 3NGMA 1WB4A 2A6PA 3CURA 4CODB 2XTZA 5JEDA 2ATEA 4PPNA 4TYPA 1TA4A 4LMRA 3T7IA 3QJYA 4S05A 3IDQA 1O5TA 3ZLBA 5K6TA 3VZRA 2PUCA 4X7MA 2C2GA 3RYCB 1K86A 5AVRA 1CY4A 4UCFA 1LI7A 4IIDA 4UCWA 1YA8A 4XWTA 1KAHA 3P0HA 5A6VA 3WSVA 1B6RA 2C8JA 2D8MA 4KO4S 7ABPA 4CG0A 1ISSA 3BKXA 3WYDA 3F7NA 1MABB 2ZS7A 3PGA1 1QXSA 2EZ4A 2W37A 4QDJA 4F5YA 4W5TA 3GK3A 3NKVA 2FPXA 2HJ9A 2VCHA 3ZWBA 4TVKA 2QVBA 3MJ4A 4BP9A 8MHTA 4ZTBA 2ZBDA 1YC2A 3PXXA 2A7XA 3T1VA 1DEKA 1SXJD 5L1IA 1I7DA 1R10A 1HEIA 1RRCA 5B3JC 3D3WB 1PS8A 3DLIA 4EB6B 2EDAA 3COJA 3DYIA 3EVEA 3L4EA 3RJ0A 3ILSA 3VUEA 4PSKA 4D8VA 3S4YA 1RXIA 1PUXA 1Z6PA 3B6IA 3C3XA 2I99A 2FETA 4J9UE 3RW9A 3W2EA 1WRVA 2CXHA 2A5LA 2PS1A 3BD9A 2IOFK 1E2KA 3MWYW 4I2VA 1KEPA 5IAJA 1E1QA 3AIMA 4KR0A 4MUBA 3ZQJA 1LF0A 1YRYE 5LVAA 2IU4A 5EXEA 4NIMA 3JZAA 4M38A 4DEXA 1WR2A 3RC8A 1RTKA 2B4QA 5ED0A 4A0SA 4BNZA 3PD0A 1HLDA 2O2DA 3E4CA 5K4HA 2E3JA 3CPEA 2YDXA 4HH1A 3I34X 4IIJB 8ADHA 3TPZA 5J4LA 3OEYA 4DV3B 4GPD1 1KBLA 3HKDB 5I51A 2W9XA 1JPJA 1ZJ5A 3D5QA 2ZU0C 2O2GA 4F50A 3L0ZA 3FPSA 1IXRC 1US8A 3LUHA 2A88A 3OEWA 4GEGA 4QARA 1V6SA 2WUWE 4HB2A 1LQUA 4OHPA 3BSYA 3C43A 1CUJA 1RM3A 2PL5A 4WN9B 2R85A 1SXIA 2OORA 3BWBA 2GFHA 4KAXA 4JZKA 4F38A 2SKEA 3QWFA 5JXHA 2RGDA 4Q9IA 2QHXA 3QHAA 3WZ2A 1VE9A 3AI7A 4YMTA 1GTJ1 3AY3A 1Z73A 2Z95A 4U7TB 4F3KA 5B1HA 2SECE 4DB4A 3WTCA 1UBJS 2J3QA 2GJ9A 1R37A 2VJLA 2G5CA 3D8TA 4GC5A 2Q1XA 1IQ0A 2XB8A 1RYHA 1VKNA 3TAUA 3NWEA 5JC8A 3ENZA 1ULUA 3VDQA 5IDXA 1G5TA 1V0JA 3GARA 3KYBA 4WL0A 3KVRA 1LPPA 1JDBB 4ND8B 3LYHA 3HWX1 4JEHA 2WMNB 1EE2A 3GMIA 1ZVMA 1N2EA 1W88A 1W29A 4MWEA 3WSTA 1K8ZB 3RK4A 3BYZA 2AJDA 1ABBA 1QHHB 3LC0A 3EVAA 1I0LA 1OWPA 3PXAA 1NP7A 4TUYB 2WSMA 4KZPA 2QM0A 4JK3A 2JJ8A 5HIIA 4EO7A 3QE4A 5ITZA 5COQA 1TMOA 1JGTA 3NFYA 4QOJA 3KB1A 5IM4F 2FK2A 1P9LA 3N8NA 2C2OA 3BIJA 1T9AA 1TGYA 2IEZA 5B37A 1NI5A 1J70A 4YB8A 4YVFA 1W85A 3UCEA 3GLGA 2BSAA 1MLDA 2HY7A 2P91A 3EHDA 3FUCA 4RM2A 4J07A 5J2TB 1L2TA 3OU6A 1PGNA 4WZBB 1YZKA 1ZA2A 3R41A 2GWHA 4DCPA 2J5RA 4DMHA 4RF2A 5DSTA 4GI7A 2OM6A 4CTJA 4RGVA 4EHKA 4Y1RB 4KHPH 1DXQA 5HGJA 5AJTA 5DK4A 3CZQA 3UC5A 4AT1A 3A9TA 5KYGA 3MAGA 2CBGA 1L8QA 2ZJ4A 3IV9A 1D2RA 4ZT6A 3AHGA 1CERA 1LFDB 2Q5HA 4D8WA 3H5LA 1MT3A 2AQHA 2E2WA 3PYLA 4TMYA 4DTCA 2IIPA 4V0LA 3PQDA 2P9EA 4EF5A 4EGSA 3ZE1B 1FJXA 4M21A 3HEMA 1XROA 2DX7A 3DBRA 1MAWA 1A5ZA 2WF8A 2GTHA 3EW7A 1VL6A 3IODA 3TMKA 1MRZA 3GJYA 3IPRA 5T57A 1X92A 4YUYA 3TQTA 1M7GA 1KO1A 4HUQA 1K83A 2FOXA 2C3OA 2XE8A 2ZS8A 1PYDA 3R7DA 3SNHA 1KWKA 5FHRA 1CUCA 1L5MA 4R5HA 1E58A 5TS2A 1ATZA 5KYNA 3U7EB 1KK0A 2WWXA 3CZRA 3FWPA 1V3QE 4LFBB 2IHTA 1A50B 1HDRA 3FOBA 4Q1EA 1ZY2A 2ZSBA 1DDIA 4ETNA 2EGGA 1Y5LA 4JCOA 2AC2A 1Q7GA 4CFYA 3KAQA 2OFPA 2UKDA 3JAMA 3DOHA 3JWGA 3RIMA 1HYBA 3V8NA 4O7YA 4LF4H 1IXYA 4LOIA 1A77A 1YR8A 4IV5A 4NATA 4C7OB 3GGCA 4BQOA 3TOVA 3SLKA 4UU7A 2PUFA 3V00A 3CN7A 1MA0A 5FNVF 3QFFA 4O7VA 1M3SA 5KFFA 2IHZA 3E9DA 4U7PB 4UTOA 4XIJA 4V0QA 4EY3A 2A9FA 3AF2A 2J9RA 2HRZA 3RSSA 4AY5A 1QP0A 1WUKS 1N9GA 2HDNB 2XCPA 4MV0A 2XGGA 2PMWB 2C57A 3TH5A 3OHMA 3RREA 2JIQA 5FI3A 4JVMA 1OASA 2Z04A 1UBCA 4DC9A 4LZLA 4EI8A 1YHNA 3ROGA 3ETDA 3W5HA 1LPAB 1NV8A 4PC2A 4X64H 1EBFA 1JEEA 4WA7A 1TF7A 3SX2A 3TQCA 1LD3A 4LIPD 1TLTA 2AWOA 5KNCD 3GZ4A 3VKVA 4Z2AA 3I6ZA 4KR7A 5EMNA 4G1EB 4NJMB 3QZ7A 1OIXA 2CXRA 4A3CG 1BDIA 1A2QA 3CRMA 3O03A 1G8YA 4QJ5A 1F8FA 4OQYA 4GXNA 2QX9A 5KJ6A 2VIIA 4ZO4A 4DFDA 2OENG 4A0HA 1APBA 1JEJA 2NVOA 1ENZA 4HGQA 4L16A 1S2MA 4QUDA 4YBRA 3UO8B 1OHHD 1WZUA 1YRWA 2H0AA 1PZMA 1KU6A 3KUUA 2PV7A 2HPHA 4ZT5A 4H7FA 3MLEA 3BG5A 1T6NA 1LK7A 1W0CA 2AMFA 5B5SA 3A2KA 4ZTUB 1IZ7A 2PUAA 3I4NG 1TCVA 3VHXA 3VZQA 5EOVA 5BMOA 2EWMA 1U6JA 1DUIA 1VRWA 3I42A 3D1LA 1DB3A 1QO0A 2P9QA 3EODA 3LBYA 4CQLB 4P4UA 5EWGA 4OJMX 4DRXB 4F4CA 5IG2A 1DELA 5FNZA 4UCOA 2ODWA 3PFGA 3F67A 1JDVA 3M3PA 2AFIE 4D43A 2XCTB 1OYVA 1RRGA 2AZ4A 2PQ2A 5KOYA 3X1WA 1B1AA 4WNYA 3TCKA 4EBBA 4U1RA 4NOKA 4D44A 4D4JA 2ZKIA 4DDWA 1P1IA 1YQGA 4P7KA 4YY3H 3WIBA 3QUTA 2NLOA 1SUSA 1MOZA 4ZAVA 3TG8A 1FRNA 3ESDA 2X40A 4TVBA 3H1FA 821PA 5ALNA 2RGYA 2F1KA 1L5WA 3PEUA 3F1LA 3CVWA 4U7DA 2M1ZA 5LP6C 3QU7A 4CNQA 2Q1YA 5K3SA 5FUBA 2ZI6A 3M5CA 1KKUA 2Q9CA 4K81B 3STYA 1C4XA 3H9QA 1KE2A 3HB4X 4Q05A 4BVAA 3F8NA 4AG6A 3AKCA 3CRNA 2PX5A 3E81A 1K9VF 4X00A 2ADFA 3V8PA 4H1TA 4LMPA 4Q66C 1RNLA 3LYAA 2P3LA 4DLPA 5FUQA 3T3GA 3K0CA 3W5IA 1Q57A 4DR6H 1WCV1 2ZSKA 5JRDS 4Y0AA 2FEAA 4DQUA 4R1OA 3PNMA 2CJWA 3QVGB 1OBFO 3O1JC 1X6VA 4REQA 1OLOA 2GOYA 2O5EA 3OO1A 3TIXB 3F78A 4KIUA 1O96B 5ALHA 1E9BA 4LZZA 2CXPA 2DLCX 3WKEA 2MSCB 3L7MA 3OU7A 2IOFA 2ACKA 2NO4A 1N5OX 3TRDA 3PDJA 2XNDA 3NHMA 4YREA 2RB4A 2BHNA 1CZNA 4LDAA 1AN0A 4BNKA 5L8VA 3I83A 2YZGA 2JLXA 1TFUA 3H1EA 3JQAD 4XD7A 1XYYA 2YFYA 3PENA 5AOBA 2F3RA 4FC7A 4B81A 1EB9A 1NFRA 3H6KA 2C07A 3L1KA 3TSZA 4YH1A 1Z6QA 1JUDA 1M7HA 1ENYA 1D6JA 4X60A 3D3KA 3V1MA 1DWOA 4LXUA 2O4UX 2ZRCA 4HPXB 1JLLA 3QNUA 4WAUA 3WICA 4BX2A 2CJFA 1N7JA 3U3JA 2GERA 3X1DA 4R1UA 4ZA2A 1AHNA 2G06A 3N87A 2GF2A 1KT8A 2UZAA 2H17A 1P45A 1S8OA 2EKPA 1TO1E 1HR0H 4MV6A 5BUSA 1MJGM 1TJPB 3O1HB 4HX2A 4FYKA 4PQRA 3BOSA 1NUPA 5BT9A 3CH7A 5HK8A 2HEIA 2VQDA 1H5QA 5EWLB 2OCKA 3EGVA 3E9QA 3JXEA 5KEIA 2H65A 2Z3VA 3GZJA 3E8XA 4YA6A 1PFQA 3AR7A 4MVYA 1PVOA 3KHTA 4JL6A 1GL9B 2EZ9A 4ZVRA 2HMVA 3HSKA 3T0IA 4ARVA 2CJXA 1S97A 1Y5IA 1U98A 3KBOA 1YJAA 3UMBA 4BKPA 2P79A 2QG9A 3ELUA 4LY6A 4MGIR 1QX3A 2B5WA 1QGAA 4BMDA 3ZU2A 3CLRC 2GK7A 1BX1A 1KJQA 4M99A 1T3NA 2PV0A 1R3DA 2QVXX 2XTJA 4NVRA 4RZ2A 2NU6A 4YRQA 5D1OA 4XUEA 1DV1A 3Q7IA 5KFTA 4N7JA 3PZPA 4R2KA 3VNBA 1E5QA 1KY2A 2PLRA 3JRWA 4OK5A 2I9KA 4LXIA 3F73A 3A1UA 3FVWA 2NVWA 3C5VA 4OMFG 4Q12A 3WLMA 5ADWA 3JWEA 3R3WA 2JEZA 4NABA 3AIOA 2QKYA 3HRKA 3NDRA 4Q19A 1I1LA 5CXUA 4MTEA 3AYHB 1O58A 3HKDA 4FE4A 4RW0A 3OEED 2PT9A 3REQB 3DEYX 5TGDA 4AXBA 2ZRGA 1XTKA 3FOWA 4XB2A 1X3SA 5K2MA 2ZI7A 3O2JA 4NEQA 2C3PA 3VVBA 1Z8FA 2AIRA 4KQWA 5T3YA 2W11A 3SF8B 4BX8A 5KDDA 5GIOE 2WC1A 4QYSA 3NBUA 5JMWA 1QJCA 4Z8YA 2J67A 5DXFA 3V9AA 2J08A 5EWMB 1OMOA 1PN3A 3VHRA 1YVPA 1O97D 4FFOA 3BHMA 3N76A 1HTTA 1P8LA 3FN4A 3PC7A 4OU4A 4WGGA 5KCMA 4CHTA 1P1HA 2OBMA 3MRTA 2W9AA 6YASA 4F4HA 2QRJA 2K2QB 2XY4A 3NM5A 1G2WA 4BQPA 4NZOA 1GGNA 1NX6A 2YBEA 3GIWA 4KKVA 3A2LA 1PQPA 3VPFA 5HHTA 4ILEA 3D2LA 2PFGA 1FLVA 4QRDA 1KEEA 3HOYG 3WMRA 1E4FT 3A4VA 2PT6A 3R3HA 4EFEA 1IN8A 1N57A 1L4KA 4QXAA 1TI7A 4DLKA 1TJ4A 3OA0A 5C5EA 2FK1A 4BEJA 1JF8A 2W6QA 2Y6UA 2PN1A 4X7RA 5JECA 3BERA 3OX1A 1NQWA 4RQUA 3FNEA 2GPTA 3USZA 3RB3A 4M0KA 5HBRA 2WPNA 1ZM4A 3QMMA 3HCWA 5DBIA 4YMVA 1MO5A 2RONA 3W78A 4YPVA 1BQEA 4H0NA 4K28A 4DTIA 5BVHA 1FFSA 1QYVA 1Z8HA 3EQ9A 3QA9A 2QAIA 4JSYA 1DOZA 2GYWA 4IIEA 4KO8A 4ERXA 2CXXA 5F2NA 4P08A 5LP6A 3OQNA 2VTBB 3ZXUB 3S1SA 2BN4A 5JHGB 2O8FB 3G0OA 4JLUA 1BJTA 4LA4A 2IEYA 2ONYA 3ROPA 2IYYA 3PNKA 3ZVRA 3WY9A 1TLLA 4Q1CA 4LOAA 3R9XA 3WNBA 5ICFA 3AK4A 5SYMA 1MVNA 1RU3A 3Q9LA 3VNRA 2Q3MA 4RETA 1ONNA 1TWGA 1WKBA 2OHJA 2W2XA 3B8HA 2BFBB 4LVOA 3ZD9A 1O94D 4G9EA 2VOJA 4QGAA 2C04A 4A0GA 1BX3A 2X9VA 3INRA 4BNJA 3PVCA 4L3OA 1HFJA 3ZHSA 2XQIA 1I9CA 1MTZA 3DKRA 3D6HA 4LKOA 3JTMA 4BBPA 3GCZA 5HR5A 5IVIA 5AHRA 1GPAA 1G8KA 5HK9A 1DHTA 4GKKB 3GJSA 3GLGB 2RGEA 1FF9A 3GP3A 3CXRA 3UW1A 2PSHA 3HGMA 4HFRA 4QVGA 3K0FB 4AURA 1B93A 5LIPA 1JR4A 2FLVA 4M1TA 4WXMA 3CCFA 4WUVA 3TZKA 1M0WA 2D5IA 4KDRA 4EZIA 1U8EA 2FSFA 3C41J 3NT4A 1BE8A 1A8UA 1W0KA 4BGUA 2OVFA 4FS2A 2H4ZA 2BY4A 3W9BA 1XEFA 3NRJA 1L4MA 4UCUA 3RGWS 1EIWA 1HT3A 5IT9A 1VBFA 4YLEA 4EEKA 1NGSA 4LC9A 3OQIB 2O4CA 3EY9A 2QQ0A 4A3GG 1QVRA 4D45A 4CC6A 3LX4A 3OIGA 1P2BA 5LR6A 2PA0A 2NU8A 1RLMA 2H51A 2I7XA 3G59A 4BBSG 5DM70 1GCGA 3RC3A 4MLPA 1XYGA 2G9RA 4O4HB 3NWPA 4UEKA 1B3BA 4QIWE 2WDTA 1MFPA 2LP4Y 3CNOA 3HUEA 3I4FA 2HDKA 4KACA 4MTLA 4NPAA 2GZSA 4ZVLA 4PFKA 4LX8A 2QJWA 3SBXA 1G17A 3T15A 4LYYA 2E5LH 1UZLA 3W8DA 2R0QC 1PG5A 3CMCO 4AMGA 3DD5A 3ZHTA 1K89A 4DLYA 5FAKA 4MVJI 5DX0A 1O5IA 3MXTA 4U3JA 3T8YA 1GL3A 1C7QA 4ZRMA 4L5JA 3N05A 3OQBA 4IIUA 4HDCA 1O77A 3BGWA 5EE3A 4C4ZA 4ZZ0A 3TUZC 2FEMA 3SIWA 3RG8A 3TKLA 2HWYA 3VH1A 3AVYA 5FTWA 3MJDA 3R0IA 3BAAA 1SCQA 3Q8LA 1JIJA 2V7UA 2X0DA 1Y1PA 5BYJA 4UFOA 4X91A 4TYYA 2Z9CA 2AGQA 3NTOA 3QPVA 4OXKA 4QHTA 3N07A 3AT1A 1SR8A 4JV5B 4ZAFA 3PWSA 3CGWA 2WTEA 4TT8A 1DJMA 2VUGA 2R8IA 1FRFS 3OJOA 4J0JA 4U5XA 1W9HA 5EMLA 3I9JA 3NLLA 1L5RA 5IP5A 4QWDA 2O9JA 4HRXA 4F91B 1J2RA 4UVHA 1LNZA 3ZOZA 1FP2A 3FETA 1GUYA 3IULA 4JYZA 3ETEA 5DM0A 4ATNA 4BMVA 4EHAA 1EWQA 1RPTA 4BNVA 5J58A 3H2SA 3B3AA 3DE3X 3GO4A 3FPFA 5IZCC 1SZPA 3H42B 5BNIA 4PANA 4EO9A 2D1TA 3ZKWB 1NPTO 1CY0A 1YJBA 5AK4A 3S1AB 1UXHA 4ER5A 1P7WA 5AKKA 5E6SB 2IUSA 3A3KA 3OLYA 4RPLA 4HATA 3G2MA 1I80A 3IELA 1TKBA 1UXGA 4TV8F 3H11A 2WHEA 3KZVA 4IVNA 1MQAA 3B7WA 4KDEA 4B73A 2XUZA 4D0NA 2OCIA 1E1RD 2GZ3A 5C8YA 1BEEA 3T3HA 3VVCA 1EJ0A 3I4CA 2EFHB 2VTDA 4UQLA 2OL4A 4UHJA 3KJIA 4XJSA 2VJMA 3HDQA 5AOCA 3TR0A 3DMYA 4O7NA 4JH0A 5AJHA 4J1SA 4DLLA 1I3MA 3TLXA 4F4DA 1RJWA 2D0DA 2QU8A 3GJ4A 2P2ZA 2X3YA 2OBYA 4L6IA 4TSRA 5CVJA 3ZH2A 3V5NA 4B3IA 1VSBA 4AP5A 4QYXA 3D4OA 3TTSA 4AMBA 4ZDIA 1KZ7B 4ETSA 2GXSA 2PA3A 2JI8A 3P2KA 4YP3A 3O4HA 2I1QA 4GKAA 2AJTA 3R8CA 3WL5A 1LXCA 3DAYA 2GXAA 3JZDA 4CM1A 1UBHS 1UAYA 4CC5A 1ZSNA 2B8JA 5LLTA 3HKZE 3WLHA 2KW5A 5A04A 4Y67A 4Q9JA 1IJEA 2C82A 2QTRA 2QUAA 4N39A 4EY5A 4L1KA 4B8WA 3TQSA 3HB7A 4FBTA 1P61B 1SC9A 3RSFA 1O8CA 3KEFA 3M6XA 1E3TA 1RMTA 5L3QA 4MMZB 1RLJA 4KX5A 4JBYA 5T4EA 4RHUA 2IYTA 2WT4A 2YYSA 3G85A 1JXAA 3KOOA 4KBYA 5JDIA 1OZAA 1Y1VA 2YIVX 1HDIA 2O1XA 2ZT7A 4KUGA 4G5SA 1IY8A 3KQNA 5E4JA 3D0OA 5FUXA 1IXZA 3HN2A 2XAAA 1C2YA 2C1XA 3M6UA 1PV4A 3IDFA 4N5MA 2WJWA 4HV4A 2IYNA 3JZIA 2DEUA 1M1YE 3G1UA 2PYDA 3Q8PB 2D1QA 2GBGA 3I6YA 1XZMA 2PMDA 1WBJB 1Q2UA 4QBTA 2ALZA 2HREA 3L7AA 3OF5A 3U4HA 3D4PA 1B0PA 3S2IA 2W8KA 3MMNA 4ZJYA 5TY0A 4RUAA 3C3YA 4JI2B 1OYYA 3ESAA 4UASA 5EC8A 2O8DA 4W8OA 2CYCA 1CKNB 2F43B 2QNIA 2YV5A 2WTBA 4NU6A 5LDDC 2QRQA 2JIMA 2O57A 1I7QB 1FS6A 4RM3A 2I2BA 2ZJ5A 3B6JA 2VDLB 3P4UA 1G291 5JANA 2X8AA 3L3BA 4R83A 4HB4A 4RA9B 1Q2XA 5JSZA 5IT9W 1NVTA 2OEPA 2D3WA 4XX0B 2I6FA 2YIJA 1E6WA 2NACA 1V96A 4C43A 2ZTVA 1EFTA 3PJFA 1NW5A 4MRNA 3SZOA 4RPCA 4D02A 5KMGB 4GH5A 2AKEA 1Y89A 2CLFB 5B6PA 5BP7A 2Z3ZA 3BN3A 1ZITA 4DUZH 2YNMD 1DCTA 4GL2A 1G8GA 1M1UA 3MTEA 4JUFA 1RWNA 4J6FA 2C3YA 4GMXA 3LKZA 3QVWA 4DJFC 2X5XA 3P8ZA 1K8XB 2ZDHA 3DOUA 1GCUA 2BH9A 3TOXA 4ECQA 3KUKA 5DN6A 4YDQA 4B3GA 2OUIA 5CURA 3HUFA 3PQEA 2JZNA 3VGPA 1UKAA 3UICA 1GPLA 3GFOA 3WYEA 1W36B 2JFZA 1QMGA 3LA8A 3O26A 5HM8A 4A10A 3CZ5A 1T1IA 1PJCA 1JB9A 1J06A 3PW2A 3GVCA 3CNQS 4FDLA 4E13A 3QPCA 2ZM6B 3W9SA 2IH5A 2D1YA 1AQLA 2BFCA 2WJ4A 3PK0A 3QX3A 2CK3D 1NBMA 4MQEA 3SCZA 4DMKA 5J2TF 3UGQA 2I9PA 3PUHA 3IALA 5H1YA 4E08A 3JTEA 4KW7A 3KYHC 5KNBA 3H2BA 4QASA 4CKWB 3R5KA 1CS0A 1COWA 1W0JD 4OXYA 5G1NA 2QYTA 1OREA 2BKAA 4DCGA 3SD7A 4YRDA 2V3VA 4JMPA 4LZWA 5E1OA 1CJMA 2A3RA 3WKDA 1EVYA 1X7XB 4ZVUA 3ZY6A 4ZQIA 2H1HA 3S7ZA 1JIXA 2H06A 3RFFA 1QS0B 2XT6A 5HQ3A 3RYCA 5AVXA 1I5OA 4H17A 4O4LB 3EF1A 2SKDA 4M76B 4N6GA 3B78A 1V41E 4O4JA 2E2HA 4Y0VA 4E1BA 2O8CB 4HH4A 1SVNA 4M1MA 1WDLA 1IAVA 5CYOA 5HFNA 3SQOA 2OFWA 3D6JA 2VFAA 5SZHB 5ALZA 5JARA 2F59A 2J6IA 1T35A 1TVEA 4H59A 3MIIA 4UUOA 3RVRA 4E5VA 4EHJA 3X1JA 1BYIA 1LBHA 4BAGA 4KBGA 1ZMOA 3G0DA 3GFQA 3PEFA 1Y1TA 3VGJA 2QI9C 2F4VB 1YE5A 3M33A 2DPHA 3RJZA 1KARA 3RNOA 1GQQA 2AE1A 4LJ9A 1GGVA 1HLGA 1A88A 1MIOB 2ENUA 2YOGA 4ABYA 1OA1A 1Y82A 5D7BA 1Q50A 4FDUA 3N28A 4QDKA 5LMNB 4E5KA 5H83A 1YBAA 3BRSA 1E79A 4KU4A 3WE7A 1M2GA 4DGQA 1E6EA 3RAJA 4A3DG 3CLTC 1W34A 2GYVA 3THSA 4OP1A 3N44B 2B8NA 5ALEA 2RHCA 3I53A 3OQ6A 3JAMW 4EPWA 1HLFA 2IHUA 4O5AA 3WBFA 2UUBH 2E18A 5AW3A 3ZJ5A 4KFSA 1AT1A 3U6KA 2ZSHA 4QAQA 3NWJA 2CWWA 3TTVA 1T34A 2PJRA 3RBDA 1BMFD 2E89A 2HN9A 2C98A 1ZU4A 2JFYA 3D7MA 2ZCVA 3OAAD 3T7RA 5KDLA 1Y5NA 2JATA 3BBPA 3NHBA 1QLHA 4FFMA 4NXMB 2QZPA 3H1AA 4N03A 3S7TA 4AKSA 2RHMA 2Z8XA 1BEZA 4BGIA 1E3WB 4A5SA 1U1DA 3HY3A 1VMDA 2W8BB 4JKIA 5LYJB 3ED1A 2IYXA 5CB0A 3ZIAA 4B45A 2SBTA 4EGJA 2O54A 2ISQA 1A9ZA 2BP7B 2QL9A 1G1MA 3KB2A 1NBHA 4M1KA 4A6PA 1RCTE 4XYMA 2IIQA 4JWKA 5IKXA 5CM8B 1OC4A 1GWNA 1RI4A 1P29A 3JD2A 5B1DA 2CE7A 2NP7A 1J2UA 2HFKA 4DDMA 3QBTA 2X23A 3QSGA 4ESEA 3IAS1 4GVXA 1K27A 3QUAA 3VSBA 1GRQA 2R6R1 3BQ9A 5IKMA 3JASA 1KMCA 1WF6A 1ZINA 2I3ZA 4OVKA 2B35A 2YN2A 4JP3A 1YDEA 1WOYA 1YQWA 2HDHA 1C8VB 3H04A 2GAAA 1H9BA 1YRQA 1P62B 4KNWA 4Z9YA 5HCNA 1EVQA 2GJSA 4UARA 4LOJA 4DDTA 1UXJA 4YV0A 2CXUA 3MAJA 2R79A 1AN7A 1Z4OA 4RVUA 4GE3A 4G8BA 4QDTA 5B2ZA 4OJYA 2H2HA 4N7BA 1KOJA 3L43A 1LJLA 4BJ5A 4C04A 1VL1A 3WB1A 2GBPA 1L7RA 3MFQA 5EJ2A 3R0ZA 1ZQ9A 4MJLA 4ES6A 2W5UA 4YI3A 3QLVA 2Z2JA 4J3JA 3VSDA 3GB9A 3GGDA 2IHNA 2EZ8A 3HKBA 2VZLA 3TX6A 1CZUA 3O8NA 4JUZA 4D42A 1K1EA 3IT0A 2GBLC 1E3DA 1XA0A 2ZETA 3EDMA 1B7GO 2XUOA 1GEGA 3C0FB 3T9CA 4FIZA 4TVOA 1T36A 2BGIA 4C2BA 3SP1A 2B4KA 2WU3A 2GHRA 5AM5A 2AFIB 5REQA 1X1QA 1OXMA 2GZRA 1UFRA 2OFFA 3FE2A 2V9WA 3OT4A 2HA6A 3KKPA 2XWQA 2BF4A 3CLKA 1QYIA 3CU5A 4HNAA 3K31A 2EARA 2J7KA 4DAOA 4JBGA 3WMWA 2GZ1A 3GMDA 4Y2VA 3T7CA 1ZJ6A 2CLHB 4KN5A 5JJBA 1LV7A 4RA6A 3ORRA 4TLAA 3L6OO 4MRSA 3BXHA 2ZT6A 3CFYA 1RJ9A 5TPWA 4COKA 1QK3A 2AWNA 3IJEB 3ITDA 4HEHA 3MJVA 1M6VB 1X7ZB 2CLLB 4FT4A 4HOYA 2MT9A 2J32A 1SG9A 1VHWA 1AXRA 1TADA 3JYPA 3LUPA 3OIWA 2E4UA 2G70A 3W7VA 3ROKA 5BWRA 1IAQA 4L28A 1WSBA 5A9SA 1IM2A 2VA9A 4LGVA 4BLOA 2VUTA 4U8HA 3KQHA 4MYSA 1LDNA 1QH8A 2WE6A 3N5KA 2HKIA 1HLPA 4KQGA 4G1VA 4TMZA 4MRMA 4RCNA 3NAMA 5FBWB 1ZMBA 4Z4HA 4D0SA 1H9CA 1VIVA 1VLJA 2ZSUA 3UAYA 5EFZA 1SPXA 2J7PA 1JQBA 5EMMA 3H86A 3TPCA 5BSGA 2ZGIA 1KETA 1VM6A 4EFMA 2RBGA 4BAZA 1XCOA 2D2EA 2W93A 1V5IA 3VH3A 1CKEA 3WIOA 4B6QA 2KYRA 3O95A 4M9SA 3BMNB 4U02A 1Q6YA 4ZU3A 3SSOA 2VDVE 2NVUA 3RWMB 1KI7A 2IBKA 4FFPA 3VPDA 1RYZA 1V9LA 2GCEA 3DL2A 1LB1B 4DJAA 2ZZMA 1ZOLA 3VPGA 1ZNXA 1FVXA 3MJFA 1GKYA 2PBFA 5CDFA 5C5JA 2HQRA 5DJ5A 3ZJYA 4Z7OB 3C7KA 3CZAA 4FT2A 1Z4LA 4BNDA 1GPBA 5CX1B 1OBHA 5JJLA 3ZDRA 5E7JA 1WIWA 4ANFA 1P1RA 2W6ID 4L07A 3UGTA 2P6MA 2RGNC 4WZ6A 2IS4A 3ZVNA 3G8BA 2ODPA 1C7RA 5KG6A 4BVHA 5LNK1 3TDKA 4W5WA 3UQZA 3K2IA 1P0FA 5EINA 1QH1B 3LO8A 1EX7A 3UMJA 5L4SA 2I4LA 1UC8A 4GMFA 2ZT5A 5GJBA 2I6XA 5C4XG 4W5JA 2DRIA 4CMCA 5EJ8A 3E22A 1UPTA 3TL2A 1QVZA 4BQEA 4CU5A 5J47A 1E9FA 2X42A 1A4XA 3TCXB 1FW6A 4XSHA 4BKMA 3TK1A 2FJPA 3H4DA 1PDOA 2OV3A 2XMSA 4ECXA 4LRUA 2PJUA 3TZEA 1FDRA 3W9UA 1SIBE 3R6LA 4RCZA 4U2EA 1NURA 1V8DA 3HC7A 4W8GA 3RU9A 2Z5GA 1IOLA 1T3SA 1O3YA 3VNVA 2BMJA 5HIMA 2G67A 3FMFA 1PJRA 3AF5A 3HQ4O 2G4VA 3KOUA 5G2OA 3UY4A 4DF3A 4DXAA 4PFQA 4KFUA 3WV4A 1IB0A 3GV0A 1MG0A 1YI1A 3KVOA 5L7WA 4JGIA 3OZTA 3WVNA 3KSAC 3WTBA 1GNRA 2BM8A 2LDBA 5EP1A 3ZTYA 2HA3A 3KR0A 4JC8A 2C1EA 4HY3A 1JQDA 3H2JA 4GOXA 4BCBA 1A5SB 2ONJA 1WXFA 4B3FX 3K9BA 4X66H 1BA3A 2H29A 4L27A 1P9NA 3T35A 1UJ2A 2X41A 4QD3A 2ALJA 4YJFA 3MW8A 2Q41A 1TF2A 3T5JA 4I1RA 3ZE0B 4JI4H 1UK7A 3VYWA 3EWAA 2Q0SA 1WKCA 1Z7BA 1I4OA 2HMSA 3S70A 2VYVD 4H6WA 3BFVA 1OU4A 4MO2A 2W2LA 3LW8A 2QX7A 3SLRA 3AF1A 3BJYA 1W5EA 3DTVB 4RZSA 5AKXA 5FPTA 3VU9A 4UMEA 4J16C 4JJIA 4ZOEA 4ALJA 3R4CA 3HOWG 3CLVA 3OCXA 2WTUA 3OQ1A 3B2QA 4F11A 1U99A 4AZ3A 1M9NA 2AR9A 2JH9A 1N3YA 3ELBA 1TWHA 3M9MB 4J9LA 2PBLA 4MMYB 3A10A 1PR6A 1ZH4A 4HDSA 1YJ5A 1SQGA 5LDHA 5J43A 4E2XA 2HOQA 3K5PA 4TSFD 3RT7A 1XYVA 2A59A 4FWBA 2WIAA 4ER6A 1F3OA 1N1EA 1WV1A 2WAXA 1NTOA 3N7UA 5DHAA 5NULA 2IZ5A 6REQB 3QU5A 4GOMD 2C35B 4PZ6A 2IODA 5IYDG 2JLCA 1BXKA 3VHQA 4KXQA 4PPYA 3C3AA 4M1OA 2R00C 3O73A 2UUCH 1JKJA 1IH8A 2FUG1 1P7VA 3R0VA 3CNHA 4BZZA 2ZIVB 1HYHA 4J0FA 1SHKA 1Y1RA 2ODQA 2CVHA 5PNTA 4JI3B 4L3WA 4F71A 3UPTA 4AG5A 3EF3A 2ORYA 1U9IA 1XMOH 3O0TA 3F5SA 5J2TA 3ZBPA 1ST2A 1JH9A 4PZ8A 3KKEA 3TE7A 5JJIA 1C9MA 1M72A 3DE4X 3BZBA 5JBNA 2GM4A 2AC7A 1I94H 3KYJB 3LUJA 2XWBF 3AFOA 5IK2D 1KJZA 3AERA 4DDHA 1W36C 4IRMA 3EEBA 5KYXA 1WUHS 1VMAA 4HUTA 3BSFA 3VTFA 1E3WA 3O90A 3AGQA 3BFKA 1XNHA 4D98A 2UUPA 1N5LA 4WDQA 5LJIA 1DUVG 4FSDA 4LPKA 1R0LA 2DPJA 3N6VA 3ZE6A 4Y2HA 2APJA 4FZVA 3L7CA 4NG4A 1WZIA 3MJCA 4TV8B 2EIXA 4LRQA 4Q8EA 1JJIA 1U8XX 3I2YX 2NUTB 1JR3A 1V5EA 2GM3A 2JGIA 1KMHA 2G7MC 4PHCA 2H5IA 3K9LA 1ESNA 3H5IA 3ADKA 1L1EA 2I4IA 1YDWA 4CE5A 3A3OA 1UZNA 3IIIA 4BMZA 4C2TA 1LBTA 2XXJA 5C5DA 2C2YA 3KX2A 4RXMA 2XYHA 5BV7A 5JOQA 5EL0A 4ZVNA 3T0GA 2DABA 1HL3A 1A5BB 2EQBA 1ZCJA 5CR9A 3LIIA 2I55A 2M1XA 1FUYB 3NW9A 1ZRNA 2ZTLA 4RQTA 4AQ7A 2ZSIA 4N8SA 4FFWA 4L72A 3FZQA 3GU3A 1QKIA 5KJ1A 3M4JA 3UCXA 2V7BA 5HKAA 4QUBA 2PIDA 4GO1A 1G2OA 3KZNA 3EGEA 3ESYA 2WVHA 1NXXA 5AJUA 4WMLA 1JIQA 4ZYYA 2A33A 2A3NA 4OUDB 1U2RA 1VJRA 4LE0A 2VHJA 3CCCA 4BMPB 5HTOA 4KUEA 3RB0A 3MJSA 3W6UA 1Q0UA 2BKUA 3BXOA 1WCYA 3CINA 3K71B 3IKTA 1LBEA 3OFJA 2D0PB 1XOIA 4KXVA 1A98A 2DWOA 3MOIA 4MUHA 5LQJA 1F7UA 1BSVA 3UMYA 5EGNA 2CD7A 5GM1A 2Z4SA 2JCBA 4IZ6A 2FFRA 2HQSA 3HKBB 4GL4A 4KB5A 4MQLA 2PEYA 4MYUA 4NJEB 2DPXA 5HTKA 3FSRA 2E6KA 3UBTA 2X5OA 3L1UA 3DTVD 3AM4A 5CPBA 4UUNA 2YHSA 2XIGA 2NMVA 2R8PA 2JLAA 3RUAA 1JZSA 2A5FA 4NARA 5K51A 3BXGA 4YDRA 4DNQA 1E99A 5IDYA 4RA6B 3L49A 3DT9A 2G08A 1NE7A 4D57A 4AO8A 1KEZA 1RJ9B 3T54A 4OOFA 2QPAA 1ZIYA 1TNDA 5TEVA 3BULA 1XKQA 2I34A 3QV1A 4AL4A 1R6BX 2QL6A 4MIEA 1IBMH 3IEKA 2ZUSA 3L7DA 2M9MA 5D7NA 2Q21A 4QFDA 1W2WB 3T12A 3ZZUA 2A78A 1GZ6A 1CPYA 2TMGA 3ZBTA 2Q5QA 3I2HA 4J1NA 3RIXA 3IEMA 5IAKA 4ZTZB 2ATVA 4HDRB 1N3BA 5DNWA 4ZO7A 1N2GA 4BLTA 1QP4A 1H4SA 2ZAYA 2JA6A 4AJNA 1U2DC 3G7SA 1B8OA 3GRAA 5BV8A 4RNOA 1KFBB 3BGOS 3CONA 4C0AC 4C3VA 4BQRA 1P19A 1SB8A 1O96A 4J0DA 3LDHA 5MGNA 4BKUA 1DBRA 3F6SA 4JI5B 5DHRA 3VMFA 1RW4A 3H2IA 1BN7A 2F2TA 2N42A 1E9RA 1T0JB 4J0MA 5AICA 4N41A 3RBXA 4MVJF 4KRGA 1DAAA 2WSIA 1JBEA 3W3AH 4XGIA 2NYRA 2BFWA 4CIVA 3IPXA 2ZWMA 6CHYA 4W63A 4AQYB 5TMPA 1XRRA 1SXHA 5HFJA 2XUGA 3A11A 2JPDA 3COSA 5JSFA 1VI2A 2XCUA 3NCHA 2P9YA 4UUAA 2MJLA 4RDCA 2IUEA 5I01A 3SNOA 4A92A 2J7PD 1QYXA 5DP2A 2C9OA 4JNCA 4F8YA 1MQ8B 3OF2A 4M8KA 1NVUQ 2EF1A 4UUGA 1JXQA 3FG9A 1F7VA 5IEBA 1MJFA 4MQUA 3S29A 3MEQA 6ABPA 3EEFA 3PZRA 3FCCA 1KYWA 4RL4A 5ICCA 1I33A 3IQFA 4QPZA 2VZ8A 1WL8A 1AY0A 2WJYA 5CRIA 3DB1A 2QLLA 5D84A 1Z29A 2YFHA 4OGLA 1E5DA 2OHFA 4YCDA 3A6DA 3MTBA 5EE9A 1TDJA 3UAVA 5AK5A 3U3XA 3VXKA 3VAAA 4B83A 4YAKB 5BXYA 4R1SA 1XHEA 3OY7A 4AB1A 4E11A 2C7RA 2H9AA 2ZR0A 3E5HA 2FKLA 2P9GA 2Q27A 5HX7A 3PCTA 3Q98A 3SLGA 1L3CA 3L8MA 2GNOA 4J9OA 5E9WA 1DKNA 3HB1A 1W47A 2A9RA 2DAAA 1E2BA 3BMQA 4R54A 3UAGA 5KT2A 4EA8A 3K0AA 1YB2A 1KS2A 4J90A 3KHRA 2FPSA 2FX3A 5DM60 3Q6IA 2XRFA 2C28A 1VKHA 1EFKA 2GYUA 1MCZA 5BN3B 2ZIAA 2O7QA 2BEUA 4KVZA 1UPFA 3T7SA 2K7ZA 3EH1A 1FU7A 5I7VA 1IYDA 2CHEA 2ZANA 4ZALA 5GOTA 4LBVA 1HBJA 4JL5A 5BN5B 3WISA 2JIZD 4YJ3A 1WAMA 5FA5A 3QLUC 4HMPA 3RS0A 1F51E 3MD9A 5MN5A 4TVSA 3N8GA 4QUEA 2ZR9A 1P5RA 2EJ0A 4MV9A 1KC3A 1YOVB 4BTVA 3VM6A 4M0JA 1HNZB 1WCIA 2B0CA 3H9BA 2Q5IA 4RMJA 1KMIY 3IDSA 2HVQA 4I81A 4DT1A 4F12A 5IVHA 2R2AA 3GH3A 4PRKA 2P69A 2WBLC 1P17A 5KOHB 1A1SA 2Q0HA 3V1LA 4ETWA 1NAIA 1FFXA 3WNZA 4JJ4A 1J8DA 3ANXA 1KOLA 4EDFA 5KSPA 4B46A 2ZYAA 2Z83A 1FSGA 1MD9A 5HG0A 1BVRA 3H5AA 3U62A 2VP4A 1E77A 3AR6A 3PZBA 4MCAA 2W6PA 3BRCA 3FCUB 4YP9A 2CDBA 4B3TB 1GV0A 2AKAB 4JVSB 4JLBA 1JNYA 1G20A 5F9MA 1RQ7A 2V8BA 2J3IA 2BUCA 3L8DA 2H2IA 3PRJA 2ES4A 3FGZA 2IGTA 4N0QA 1QB7A 4QBKA 3BFPA 4FNAA 5C4MA 1N5JA 2Z57A 1YZFA 1L3BA 5LZ9A 4BVKA 3ZWWA 2RDIA 3CR7A 2IUTA 2PH3A 4A2CA 1NXQA 1O9BA 5SZIA 1JSZA 3CVVA 3WB0A 2JBWA 2WZDA 1RI5A 3CNBA 3A3NA 3LGAA 4H4CA 4RYDA 5EXPA 3QUCA 4XEHA 4YECA 3PKZA 1Z2CA 1A1VA 3NHWA 2QTFA 2W58A 1NBME 2ASEA 2WKSA 2OHIA 1D8TA 3H0KA 4FYYA 5ESXA 3ZWCA 4CUZA 4KN9S 3G1TA 4BE4A 3NVMB 4K9QA 4A26A 4FZJA 4WY5A 2FE1A 2I4MA 3QYFA 4NYMQ 1U3GA 4MVJD 2PKEA 4JT8A 3RYFA 1B2RA 1W48A 1DFIA 1BKSB 2WQ6A 2ZVDA 1M2OA 4M7OA 1LC0A 1VL5A 3GEHA 4N5LA 1W96A 1Z0DA 2R1TA 4BNWA 5KBYA 3PQ4A 3UHOA 1YZYA 3F8SA 1WO8A 4IHQA 3T5LA 1ZU5A 1YHYA 1ZNQO 2WJIA 3D0RA 5D6NA 2B8WA 1KE1A 1YV9A 3UYKA 2HU8A 1KP2A 3DAHA 4R4JA 5LLSA 4Q7EA 3G2PA 2YV3A 4YGYA 3DL7A 3OIFA 3PRKE 1EZ1A 3LD9A 4R3UC 4J4HA 3ZNNA 2FPPA 3FDZA 3KPYA 5CG2A 1RXYA 4GRDA 1WU8A 5DG8A 2OHOA 4TSKA 1HWYA 4E3WA 4TV9F 3T41A 2E87A 3I1YA 3NH9A 4C14A 2A14A 1U94A 1SBHA 2CHVA 2VSYA 4HEQA 4BDTA 1XD2B 1WB6A 1Z9BA 1E63A 2FQQA 1U0FA 5AVJA 5TB5A 2B20A 1DRUA 3JPYA 3W1WA 1RFLA 4BLSA 1IN6A 1CK4A 1O6FA 3FKQA 2AF3C 3L0CA 3VVMA 4QJ4A 4K3UA 1V3UA 4F9TA 4W6QA 4O4HF 1NVFA 2C84A 2VDOB 4OSPA 1OJLA 1UINA 1XZ8A 2WJAA 3GT3A 2D8AA 4LYHA 2VDPB 3WLQA 3FFWA 3M6MD 4HX5A 5DGCA 3S24A 3VR2D 1FJGH 3HL4A 3VYRB 2AXPA 4C05A 5J59A 5CA1F 5T5QA 3R9KA 1VLLA 1TT5A 4JJEA 2IV2X 1PJ3A 5JUMA 2C2KA 4I55F 1D1SA 4MR9B 1L5SA 1I3CA 1XRJA 1AQNA 2WKPA 3NC0C 4QWAA 1K7YA 1CJCA 2BMVA 4EFDA 3SFVA 1Q5PA 4IY1A 4A3LG 1EUCA 1N5MA 2QPOA 2PFSA 3OIVA 4PIVA 2GLTA 1QH9A 3DH0A 2FJUA 3LUAA 2F9FA 4IH9A 4F4XA 3PR5B 2OK8A 1QWSA 4PWZA 3DP9A 1MZPA 2OCDA 4GR4A 4INZA 3OUZA 5AW2A 3F6EX 3W04A 2QDXA 1I1NA 3C85A 1CKMA 2WJ3A 3PSHA 4X71A 3PKIA 1Y81A 3LPDA 4M0LA 3UJDA 3PA6A 1PV2A 2ODBA 4J6EA 4X90A 4QU8A 1K5GA 2J59A 4QWEA 2IPXA 2NTNA 3HZHA 4MXDA 3ISVA 1S9HA 1CP3A 4MW9A 3MC1A 3VJMA 4TS3A 1Z4PX 3AHDA 1G2IA 5EXDA 1WULS 1LLUA 4WSOA 1DVRA 1DTSA 3E3OA 3NH6A 3BA9A 4NDZA 3QELA 2C7PA 3MS2A 2MSKA 4XZ3B 5CA0F 2XA1A 3BILA 3X1ZA 2RK4A 4KGZA 4A1FA 4B7AA 4C4XA 2C9DA 1GYRA 3OH8A 1XFAA 5BWXA 1CNFA 2Y0PA 3QU9A 1L5ZA 5LMUB 1RAGA 3R5TA 4L8GA 5A2QA 1WHSA 1V71A 4XLLA 2HF2A 4Y7DA 4OJTA 2CNLA 4MGHA 5A4DA 3UW3A 3P2YA 5T4HA 1CLEA 2HLDD 2AJLI 4C7BA 2PD3A 2W2KB 4U0KA 3MBOA 2HMUA 5AK3A 4MAFA 1ABEA 1W44A 5FYQA 1GPDG 1QC5B 4P31A 2V4UA 3RK0A 5DULA 4AN4A 1E1YA 4DMGA 1CVLA 2CT8A 2W57A 2RJ3A 3L04A 1T9CA 3GRUA 1G2PA 3R0QA 5AJXA 4AG3A 3AY6A 4RORA 4CIYA 1TZJA 2EKLA 3T06B 1LEHA 1RXVA 3FUTA 1DJOA 2GEJA 3C3KA 1YS4A 1QCZA 3Q8RB 3BQMB 1Y9AA 4B3JA 1JI0A 2GK4A 5HQTA 2OBNA 1NXOA 3E15A 3OE1A 2ZYSA 4FOOA 2VHXA 1NU6A 4MZXA 3UUGA 3W3ZB 5KI6A 3LS2A 1YZVA 2ZUUA 2ECPA 4UULA 4Z4FA 3BE6A 4M9UA 2XDQB 5DLEA 4WXRA 4DCCA 3ENQA 5CW1A 4AC9A 4E2WA 1ZZGA 2KMLA 3Q3JB 4BVFA 4O7TA 1S1MA 2ZP1A 3ANSA 3KJNA 4QFMA 4CLOA 3EG9A 1DWPA 3N7TA 3ON5A 3OG9A 4YAJB 2PBRA 1HDGO 2EHJA 1SXGA 4GRAA 4OD0A 3Q3IA 3MWJA 1KJJA 2X5RA 3MA0A 1NJ1A 2MYPA 2IYOA 4BVBA 3MMZA 2A0UA 3HKZA 3I9MA 4WKOA 4QJFA 2WPDD 4BZQA 4Q9NA 4IEIA 1KU0A 2R68A 1GTG1 3NUZA 2CSXA 3VAZA 4NRDA 2RE8A 1MZBA 3ZY4A 1WW2A 2YHIA 1V9CA 3TLGA 2JEJA 2EP7A 1OXUA 3M6IA 3C7TA 4FPXA 4U3JB 3WFZA 2ERCA 1N2OA 1GG5A 1SCNE 2RKWA 1R6XA 2WM2A 3MILA 3HZOA 4YR9A 4TV9B 3A4TA 1VGQA 1ZCZA 4QPJC 3QVVA 1NXPA 4PZ9A 3RUFA 5DNAA 3SC2B 5KX5A 3HO8A 1XA4A 4HDRA 4L4ZA 1FPQA 4DSNA 1F9EA 1E1CB 2RHDA 3BXXA 3MTIA 7MHTA 1XFDA 2CXTA 2WM8A 4ZU1X 2PR2A 3DF9A 1RLTA 2DH6A 2PMZE 1NSYA 2ZRMA 4IX1A 3CX4A 2VLIA 1FEZA 1MB0A 1XLTC 3EK2A 2BD0A 2X8JB 3EXIA 1BE0A 1JNXX 2I6UA 3EZNA 3MCAA 3QK7A 4RGYA 4YP0A 5ULLA 3RO7A 4C5BA 2JB9A 3BTUA 4BNLA 2XUJA 3LHIA 4UTXA 4ISBA 3THXA 2C9ZA 4JLSA 4MW4A 5K4AA 1XZHA 1EHCA 4XVRA 3VMMA 4EY8A 3QVTA 3BB3A 4BNUA 5BUQA 1XZLA 3FNRA 1CB7A 5JAMA 2XRMA 2B1RA 2ZE8A 3KQWA 1OWNA 4O1IA 3SGIA 4DV2H 1YQDA 4BFCA 4G0QA 1EVLA 3NTXA 3EDOA 3M6VA 4XM2A 3WMEA 1M2EA 2BT4A 2R7NA 2MCFA 1DV2A 1M8PA 3H99A 4YJ3B 4BJHB 5IEJA 2B4TO 3KVYA 4IDFA 1WJGA 4KQEA 1FTSA 2WA1A 2ZSEA 1YI8A 4GM0A 2VHYA 3DXZA 1E7QA 1MB9A 3H2GA 1P2UA 2B69A 4Z3DA 5DRYA 1XBTA 1EK2A 3WBKA 4NXMH 3EW9A 4R2LA 4D6PA 4DRYA 1P5JA 4LDRA 2WDZA 1OFUX 4L4UA 4IWYA 5EI5A 1YL6A 1Y34E 1QIGA 2FR1A 1RI3A 3FVTA 4H7JA 4LWPA 2WE7A 4Q4JA 4YCJA 4DQVA 5IH7A 4MDYA 1OWLA 4JQSA 3KWFA 1VE1A 3EEIA 4OTZA 3DPUA 5EIHA 3DUFA 4YAOA 1R66A 4B5LA 5KFAA 1U28C 3DZHA 4CQJA 4I66A 2PUBA 1ZGAA 1PSZA 2VYQA 2MHCA 2GPBA 4YASA 4C1NA 2OD2A 2OZEA 4X62H 5C44G 2UXBH 1E2HA 3QBJA 1LX7A 3BORA 3R20A 1XDBA 1RXEA 1EK5A 1FE8A 4IR9A 1HKHA 1QHSA 1QF7A 4ZP1A 5G41A 4PG8A 4MYCA 3IAAA 3ONEA 2KB0A 2A0WA 2C9CA 1BVHA 1G42A 1QKJA 4C4YA 4G4IA 3EYAA 1XKLA 1Q6ZA 1RCFA 3TQ1A 1TC2A 3LBIA 3HJBA 2P11A 1NUTA 1L8OA 1R4AA 2X7XA 4WGFA 2LCQA 3TLYA 1QBKC 4O3SA 3DZIA 4H9GA 4CKYA 5JVDA 5L3QB 1SEVA 2FAXA 3GRVA 1P74A 3EBLA 4LNHA 2H85A 4UCVA 1N2XA 1VRCA 1HNZH 4A8TA 1ENPA 2Y27A 1FP4A 3N2LA 2PRIA 3PGLA 4KQ2A 3U4MA 3V9PA 4C6TB 3OWXA 2Y0SE 1RLOA 3VU1A 2XBLA 3MB5A 3O82A 3FMOB 1X15A 2HNAA 4H6VA 3H8WA 3KL4A 4QT4A 4O4JF 4YUXA 4D3DA 5KZMB 1HRDA 5AXAA 4O84A 4EAAA 1CUIA 5CFQA 5IAAA 4G1MB 1SCIA 1ZMXA 2H7CA 1JI3A 2H2DA 3LZ6A 3CZMA 3UB2A 4Z54A 1DQRA 3BHNA 1IHXA 2VK8A 2GN6A 1U7UA 1TO2E 4GVLA 1ESZA 4CMDA 3VNUA 3BS4A 3KRTA 1HNWB 3DB2A 1X9HA 2PUHA 1D4AA 3QEMA 5A71A 5TGTA 3PE4A 4LF6B 1EESA 4NMWA 3E9ZA 3RASA 1YQUA 3FCXA 2VPXA 1N8KA 4B3TH 1P5FA 2BEVB 1JE0A 2FXVA 4KR9A 3EZ2A 2GKGA 1QG4A 2VRCD 3HU3A 1S4QA 3KQOA 4CKZA 4RUCA 4JI5H 2B4AA 3AP2A 2JJYA 2I29A 4Q47A 2ZBQA 4GM1A 2LE0A 2O6LA 2HSEA 4M54A 4HN2A 3K0BA 3C3CA 2GBCA 1ELOA 1WMFA 2DH5A 4DMUB 4F2GA 5FPRA 2RG7A 5FUWA 3EFOB 1LWNA 1WSWA 3PF8A 3HEBA 3KAPA 5KMGA 2GB4A 3AUUA 3CRQA 2A9OA 1C0IA 5IP9G 1P2VA 3RSQA 1V26A 2NW6A 3HMQA 3R7LA 1VPLA 2DUMA 3U7IA 5ARCA 2HLDA 3W6NA 1XR3A 4DILA 4GPIB 3QKUA 4NCJA 3FM9A 4QBFA 4DZZA 4OP3A 3DO8A 3PP8A 3JQEA 4DCVA 5ICGA 1KH2A 1XZCA 4G65A 1Y6JA 1C2TA 2X9QA 4HQNA 4LQDA 4MMXB 5FLEX 1GSIA 3BK1A 3EWSA 3OCYA 2XT9A 1ISGA 4CM8B 1EXMA 2CZQA 4PPFA 4S1VA 5CP8A 1LW6E 1YZQA 2EG9A 1NVKA 1GA1A 3PX3A 4PQEA 1UMBA 1DC6A 3INNA 4J75A 3BEOA 1C3LA 4OBEA 5AMXA 3R7NA 4DZTA 5FO1A 3IQGX 2EFJA 2HRRA 4ETMA 1CHDA 2EATA 3IIKA 3ZZ0A 2XYVA 4MITA 3PC4A 4A0FA 4CDGA 3LQ1A 1AKRA 1CUAA 1BMDA 3HYCA 1RSZA 4XLTA 5DAAA 3T9AA 5B12A 5DLDA 1E4YA 1XP5A 3ASUA 5TT0A 5KJFA 1U3DA 1O5OA 1VBMA 4R7GA 1P4JA 3OE7A 1SN7A 3QELB 2VBCA 3Q12A 4JJ8A 4LGCA 1QVAA 4OLFA 1VPWA 1FQOA 1S68A 1NP3A 1N33H 1ORRA 2VUHB 4P0QB 3KK0A 1JXOA 2G40A 3VO8A 2H52A 3DNPA 1PFVA 4MLCA 3WLLA 8ATCA 4HUQB 4C3UA 5CIYA 4O08A 4GWGA 4X6UA 1YR1A 2X14A 5AVZA 1OGJA 3B3GA 3I9NA 4IIYA 5IYZF 4XQ0A 4P84A 5KAPA 4K6KA 1V43A 5ELLA 2ZWVA 5E7MA 2W2KA 3H17A 1KAQA 4O2BF 1JWBB 3LYUA 4TGLA 3S2GA 5JQWA 1K9SA 2CWDA 3PNPA 4Y2QA 1FBTA 2J0UB 3D8UA 3V6JA 4DR2B 1EUCB 3NKFA 2P5SA 4UCSA 3OFND 3PGKA 3O0DA 4QOSA 3ROTA 2BFFB 2FV8A 4YJGA 5AHXA 5BVGA 5I3CA 1CQPA 1PR5A 1QDEA 1G3UA 4G6ZA 5D1HA 3ZU4A 2AYZA 2H11A 2YJZA 3EGDA 4Q7QA 2IYLD 4NYEA 4RH3A 3ZTTA 1GQFA 5JNWA 4JXUA 3MAAC 5BYBA 4O3QA 1XEWY 1Z06A 3IUPA 2AU0A 1XXHA 2WF6A 1NJ2A 2W8BA 4LYDA 4DQXA 3E9MA 2CUKA 2XKAA 2PHZA 2NSJA 2F3PA 4LDZA 3RODA 5EJ6A 3MRVA 3KUCA 5CLIA 3VR2A 3Q41A 1UKCA 4HDAA 3UOAB 4ED6A 4PBCA 3BJIC 3IVMA 5JASA 2G72A 3QVJA 1FX1A 1V8PA 1Q0TA 1T5OA 3GRYA 4I4TB 4ZCTA 4FS8A 3DTNA 1V2GA 3UA4A 2OD9A 4GPEA 3GILA 1RC8A 2AG8A 4L73A 5EAIA 1RKUA 3GMTA 3BZUA 1GSOA 4LG1A 2A1TR 3RWBA 1PT9A 1EHYA 2YJ3A 3ZY3A 3AVVA 2VCYA 3QPDA 4JKOA 3HCDA 4S3MA 1ZH2A 5B6JA 4R16A 4G23A 3PE6A 1D6SA 1H8EA 1QGUA 1JR3D 1T8TA 3AF4A 1KC1A 4BQNA 4IKOA 3HA3A 3UVEA 1W6RA 4DYVA 4UVEA 1OH8A 1K92A 4LHXA 1KK3A 3AR4A 4O8CA 2IH2A 2FZVA 4NICA 2LVBA 4NAUA 3GFPA 4J2OA 5JNVA 1E1KA 2IHVA 5AW0A 3G02A 1M6HA 4IXNA 2PEZA 3DVLA 1JEYA 4OU5A 4DV0B 2W6ZA 2XB2A 1R27A 3K1ZA 2VF2A 3RDPA 4D9HA 2P9BA 3LUGA 2PH1A 2QGZA 2FF5A 1IQRA 4BV9A 2HHFA 2EJUA 2XUHA 3KXLA 3ME5A 4C2MA 1ZD4A 2MR6A 3B9BA 3PPYA 1ZNWA 1OUMA 2C0CA 4K46A 2RAFA 3GBPA 4I1VA 2ZPUA 3KXDA 2AZXA 1ZVQA 2H2FA 2L0XA 2Y4OA 3EUEA 1L5OA 3N3AC 2Q5FA 2FP4A 2QLMA 2DSTA 4FNMA 2X1MA 4HNAB 1C4KA 3DXXA 4RJIA 3ZLJA 1A71A 1BCRA 1M73E 3EXAA 1DC8A 2C1ZA 4PWYA 2OPHA 2HYIC 1PKXA 4O7ZA 2BGGA 1ZD2P 3KHKA 5C0OE 2FB9A 2XNDD 3G8CA 1IUPA 4YRTA 2O3RA 4LXQA 4R2XA 1FSSA 1JVSA 4PR3A 4UCQA 1L7QA 1Y6FA 2I8AA 2P67A 2GM9A 3K92A 1OBGA 3TW8B 1V1RB 1XQYA 2PZJA 3VKWA 1SA0B 1WXQA 4G1CA 5JATA 4UHCA 1K7CA 4E5SA 2ORWA 4JLDA 4WXHA 3EZLA 1BHQ1 5KPJA 3TW8A 4UUQA 5B3JA 3SVLA 4KYVA 4F5ZA 2QE7A 4AJ4A 5JNRA 3EG9B 4DR4H 1VBHA 1V7CA 1Z2OX 1T9ZA 4LZJA 3LQKA 1NYLA 4RKYA 3C0KA 4K2AA 3B52X 3FIJA 4LE1A 4IEFB 1QH1A 1DNPA 4J0KA 3QZ8A 1OXTA 2WNIA 4N3CA 2HLPA 4X3CA 2NTVA 5JS8A 3RROA 1SOVA 5CCEA 2QTCA 4R9RA 2QMHA 2Q2OA 2NV0A 4FWTA 2GWRA 1ZIOA 5BMVF 2WIKA 3UZOA 2Y1OA 2B99A 2FPKA 2YZNA 4CDNA 3ZS9A 3OZRA 4NYJQ 1ZW6A 1EP3B 3AJEA 3OO0A 4M1ZA 1XWFA 1U90A 2ROQA 3ACDA 2XOEA 3ORYA 4CM9A 3SZMA 2C5LA 4BNXA 1XZIA 2RCNA 3AFMA 3C74A 3SKXA 4RJKA 1ACJA 4B7XA 2IZ6A 2GAIA 4GF5A 2E82A 3IT1A 4PX9A 4C0SA 2CJWB 1SCUA 5C3EG 3E9RA 4QDOA 1BX0A 4X8OA 3SMQA 3JQ7B 1H9AA 4MYRA 2ZWIA 3CH5A 4NMMA 4OJKA 4F4WA 1Q1NA 3W4KA 4DV0H 4EB0A 3GLFB 3JR3A 2FA9A 3WOVA 1E9EA 4RHCA 3QVGA 5CNMA 4BGVA 3PEWA 1ZXLA 3GDWA 1TAUA 3ZD6A 4RK1A 2C42A 4QGGA 5DLYA 1U1CA 3HDTA 5AVVA 4JB8A 4Z53A 3T5DA 3RRBA 4DV4B 3K6KA 4YXWD 4D4MA 4Q03A 3TQFA 1OXKB 4AQYH 4UVIA 5KQLA 3E2IA 1HV8A 5JSHA 4UE3S 4MUEA 4KWEA 3V2GA 2EJTA 1ZS9A 4J3FA 2QZ9A 1DBWA 5E2BA 3TOSA 1XZEA 1AMOA 3WLJA 1UIMA 2F17A 1TWAA 2CEAA 1HNXH 3W2FA 2H16A 2X76A 2YMLA 4LQLA 1YZUA 2ZSJA 4ZCMA 1Y4DE 1T5BA 2Y1DA 1A96A 4HQFA 4IUYA 4C6HA 3U4AA 1ID1A 5FCDA 4ZREA 3DQZA 1X38A 3U37A 4DLWA 1HR0B 4X65B 4IWXA 5DCWA 1O95D 4KV7A 2VK2A 4ED8A 3U1TA 5BQOA 3T7EA 4IUBS 3IBGA 1YR2A 3AVWA 3AONB 2P2SA 1SQSA 3HUTA 3M1YA 4KPGA 4MRAA 5ES4B 1T0PA 2O59A 3PJGA 4NY1A 2NZ2A 4MARA 2RK3A 1NF3A 3PEEA 3S40A 3KNZA 1QZUA 4R6WA 1FYFA 3U48A 4ODIA 4TQAA 2O3QA 4QU5A 3FH0A 3W6ZA 2QMOA 4ZZIA 2VJNA 2XDAA 4RFLA 4BQSA 1ADYA 4WOBA 1L7PA 2I1WA 3E9NA 3U7FB 4G5YA 4BAUA 1W581 5BXQC 2ZRBA 1I4TD 2OCAA 4AZTA 2JFGA 5LQRA 3M81A 5B1EA 2H59A 2RH5A 1VPDA 5FADA 3CLHA 3BJMA 4G3XA 4GC9A 2FLNA 3NB0A 4WE3A 1W7AA 4EYEA 2IZOA 2OWEA 3I9LA 3OSUA 3OTQA 3NRCA 4QO7A 1M2NA 2IXTA 4BOYA 2MSEB 3P0EA 2MYUA 4BMCA 3OE5A 4RTPA 1RAEA 5ICMA 3ETNA 1XVIA 1JMKC 4FMDF 3CG0A 4MVXA 4GC7A 2HK6A 2PJZA 1T26A 1QORA 2BI4A 2YV1A 3VNAA 4KHPB 5JS1A 5FFNA 4D9BA 4EG5A 4ZI3A 3REQA 4BDSA 2JEGA 3E5MA 3G88A 2XWSA 5I9LA 1ONOA 3IE1A 3IEPA 1EVKA 2GDZA 3MJEA 2RHTA 2UYQA 3M9OB 4XJVA 3SHTA 3M4NA 3UV6A 4ZCIA 3L05A 5HFAA 4ENTA 2XE7A 1K8RA 3ER6A 2CXNA 1SBQA 5HZKA 2BOVA 1U04A 3VYSB 2IP2A 4JENA 1RT9A 1ISHA 3AI3A 3LNTA 1Y8RA 1AK1A 4A8HA 1SBNE 1FBNA 4QOFA 2Y99A 5D8DA 1MGPA 2FX5A 2C3MA 2YC4C 4ZV7A 5G4KB 1KDYA 3H8VA 3TR6A 3IAS6 3S81A 3QENA 1HNXB 1OV6A 1QU3A 2XZLA 3I3SR 3IUQA 3VYVA 5LB4A 4DY6A 3T9FA 4G8JA 2IYSA 1PEYA 4Z99A 3LT2A 2VT2A 1QYDA 1UAGA 3AY7A 4GGPA 1D8AA 3N2GA 5AK6A 3DWIA 3UK0A 4J9RA 1YUBA 2VHQA 1TEVA 2HRDA 3PC3A 2IFTA 3D8RA 1EPUA 3RARA 4MPRA 5DHTA 4L15A 2OPBA 5ALKA 1QG0A 2AOUB 2P5UA 3R7WB 2EKBA 4AJKA 1PJTA 1Z28A 2WWWA 4BYGA 4P6VF 4C87A 4YRMA 2NG1A 4L4YA 4FQ5A 5EJFA 2C2DA 4EKNB 4LHSA 4WK6A 4LFAB 3F4LA 1UMKA 1ZXXA 3LLVA 2A2ZA 2ORIA 5E1DA 3TI7A 1ODKA 3B70A 3QFSA 2GZHA 3TDMA 3HDYA 4F6RA 3EGOA 3OC6A 5BQ3A 4BMSA 1ZM7A 1NQTA 1EK6A 1EP9A 1XMIA 3UC9A 2R8OA 5KJEA 5FWXB 3ELDA 5G0TA 1QDLB 4YR2A 1C7ZA 1NXWA 1ZO8A 2C31A 4A23A 5AI4A 1UBOS 4PF1A 4K6NA 4EJSB 3OCUA 2JH3A 5IK2A 3E7FA 5C1DA 3OKCA 1EUZA 3A2NA 4IV0A 5BORA 4FJ2A 1R4ZA 1L4EA 2QDKA 1DIAA 2QPLA 4WCFC 3IE2A 3FKJA 1UWKA 4L5IA 4NYMR 5AUOB 3A1FA 3H0CA 2NSHA 4V0OA 3NX4A 3PLRA 2ZJ8A 3E5NA 4LF6H 4QPNA 2DT8A 2IE8A 2QTNA 3NHYA 4NBUA 3R9XB 4ZMBA 3NBKA 1QGUB 2AN4A 3DE7X 1HEUA 3M6LA 3LPLA 4UZEA 5J5VA 5CDHA 3QX9A 1YCGA 3T94A 3TBFA 4K86A 1X7WA 1KI8A 4LY0A 4FEEA 5G0VA 3S55A 4C06A 2HF8A 5P21A 5KREA 3OCZA 3HFGA 3IQEA 3ZEIA 3HXOA 4J03A 1V4NA 4B6FA 1RWKA 2FSPA 1Z4IA 1ZMRA 4CL3A 4KSYA 1HSZA 3HBJA 4NBKA 5GMOA 4MCJA 4OB8A 3ZHXA 1USKA 2Q9UA 3OJWA 4A93G 5E4FA 4F0JA 2G88A 1CSEE 1TTQB 3JQ9C 3N0RA 3Q2IA 4WFIA 4MQMA 5JFTA 1WW3A 3ZBUA 3HJCA