2FP9A

Crystal structure of native strictosidine synthase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
305
structure length
305
Chain Sequence
PILKEILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYASPYWNKAFCENSTDAEKRPLCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLATSVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTGRLIKYDPSTKETTLLLKELHVPGGAEVSADSSFVLVAEFLSHQIVKYWLEGPKKGTAEVLVKIPNPGNIKRNADGHFWVSSSEELDGNMHGRVDPKGIKFDEFGNILEVIPLPPPFAGEHFEQIQEHDGLLYIGTLFHGSVGILVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Rauvolfia serpentina strictosidine synthase is a novel six-bladed beta-propeller fold in plant proteins
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Lyase
molecule keywords Strictosidine synthase
total genus 72
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 4.3.3.2: Strictosidine synthase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03088 Str_synth Strictosidine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2fp9A00
3SRGA 4O5TA 5D9CA 3Q6KA 3FVZA 1V04A 1H6LA 3LI5A 1CRUA 5GX1A 2IASA 1POOA 5GX5A 5GX4A 3LI4A 2QE8A 3S8VA 3G4HA 3Q6PA 2POOA 2IAVA 5D9DA 4GNAA 1RWIA 2V91A 3HRPA 5EX7A 4GN7A 2GVVA 2GVXA 4JMLA 3SOQA 4GN9A 1RWLA 1C5KA 2GVUA 5FWWA 3TC9A 5GX3A 4HHQA 3V1SA 3V64C 3HLIA 4IMBA 3A9HA 4HHOA 2GVWA 3O4PA 5GTQA 4IYGA 3SOVA 2VAQA 4DG6A 4PWZA 2G8SA 3U0SA 3G4EA 3LI3A 3P5BL 3I1CA 2DG1A 3SREA 1QLGA 2IVZA 2IARA 2FPCA 4Q1UA 3SOBB 3IAXA 2ISMA 2IAWA 3Q6TA 2IAOA 3E5ZA 3HLHA 1CRZA 1IJQA 2GHSA 1PJXA 2IAXA 3BYCA 1E1AA 4ZLRA 3WW9A 3AMRA 2DG0A 2W8BA 3FW0A 1NPEA 4GNCA 3A9GA 3S94A 2IATA 3KGGA 3AMSA 3DASA 2P4OA 2IAQA 1QBIA 2IAUA 2OJHA 4GNBA 1N7DA 1Q7FA 2W8BB 4GN8A 1C9UA 5D9BA 2FPBA 1CQ1A 2FP9A 4O5SA 4HW6A 2IAPA 2HQSA 4A0PA 5GX2A 4R40A 3DR2A 3V65B 2DSOA 1CVMA 3S2KA 3KYAA 3S8ZA 2FP8A 3WWAA
chains in the Genus database with same CATH superfamily
3SRGA 3VNGA 1A4QA 1B9SA 1W0OA 4NCSA 1W21A 2YDTA 4AGTA 1POOA 4QNPA 4FPHA 4MZEA 5GX4A 4MWUA 3LI4A 3S8VA 1IUCA 3G4HA 4ZGCA 2ZB6A 3TI8A 1DILA 5D9DA 1L7HA 4GNAA 4XHXA 2AGSA 4K1IA 3HRPA 1NCDN 3H72A 4GZQA 3K38A 2FLUX 3SOQA 1X2RA 4GN9A 4FPGA 1RWLA 2WOZA 3O9KA 2GVUA 4YZ4A 4HHQA 3V1SA 4IMBA 4B7JA 1N1VA 2Z32A 3NO0A 3BEQA 4IYGA 5HUMA 3K3AA 2VK6A 4XJWA 4FPEA 1W1XA 5B2CA 2G8SA 3P5BL 4KS5A 2AEQA 3II7A 3TI4A 2QWKA 4YW1A 4QN5A 2F29A 2F10A 3INBA 4FZHA 3B7EA 4KS4A 2IAWA 1V3EA 1NCAN 2F0ZA 1CRZA 1K32A 1S18A 2HU4A 1N6DA 4FPKA 2IAXA 3L6VA 4L7BA 3ADEA 1Z4XA 1F8EA 1X2JA 2F25A 2VW2A 4FPOB 4NC5A 4M4VA 4ZLRA 4FOQA 4GNCA 4SLIA 3CL2A 3KGGA 2SLIA 3DASA 2P4OA 3NN9A 4MX0A 1N1TA 1INVA 1N6EA 5F72C 2SIMA 4CHBA 5FNQA 4H53A 4CSDA 2BERA 1Q7FA 2W8BB 1XOEA 1Z4WA 1XOGA 1CQ1A 4MWRA 4O5SA 1W8OA 3W09A 4FOYA 1BJIA 4K1HA 4GEZA 4K1JA 1IUBA 3TIAA 4D4UA 2HTUA 4MWLA 3DR2A 1V0ZA 2HTVA 4XJ8A 2FP8A 3S8ZA 3JU4A 4WA5A 3H71A 4O5TA 4X6KA 1NMCA 2YA5A 3Q6KA 6NN9A 4B7QA 4CPLA 4H52A 1CRUA 5GX1A 2IASA 2F12A 4ASCA 3NSSA 1MR5A 4XILA 2AH2A 1E8TA 1NNAA 1MS3A 3Q6PA 2POOA 3WN7A 2VW1A 2IAVA 2QWJA 5NN9A 4FVKA 4ZY3A 1IVBA 5FNUA 2XZIA 4GN7A 4IFNX 4UOUA 4MZAA 2QWHA 1NNCA 4MWVA 2HT8A 1U6DX 4XMAA 3TC9A 3TI6A 5GX3A 4GZWA 4GZPA 3SANA 4IFJA 3A9HA 4HZVA 1USXA 3SOVA 2F27A 4G3NA 1V3BA 3SLIA 2VAQA 1NCCN 4KS1A 4PWZA 1INWA 4QN3A 3LI3A 2A75A 4YW2A 1Z4YA 3SREA 1INGA 2QWEA 3A71A 1MS5A 2XCYA 4D8SA 4IQKA 3SOBB 3K39A 2ZW9A 4CPYA 4XJUA 1V3CA 2IAOA 4CPZA 2H2NA 2HTWA 1INFA 4GZOA 1A14N 2AEPA 3GVKA 4L7DA 1N1SA 4QN7A 4XJZA 2XZJA 1WCSA 4YZ3A 1W0PA 3SALA 2F28A 2BATA 3A9GA 1V0EA 1MS1A 4YW5A 2IATA 3ALWA 5M1ZA 4GZSA 3GVLA 2IAQA 4J9TA 1IVFA 1V0FA 3H6JA 4HZZA 2VPJA 4CH9A 4XJQA 1NNBA 1INHA 4NN9A 5HX0A 2FP9A 4XMIA 3TIBA 4K3YA 4KS3A 1Z4VA 2DSOA 1CVMA 4CPMA 3S2KA 5FZJA 4I00A 3WWAA 2HTQA 2W5OA 1A4GA 5CGJA 5D9CA 2ZWAA 3FVZA 4HZYA 3ALXA 4FPFA 4QN6A 2F11A 3LI5A 4M4UA 4FJ6A 3CKZA 1DIMA 2QE8A 1IVDA 1E8VA 1L7GA 2QWAA 5JYYA 1VCJA 2H2UA 3H73A 3UC1A 3SILA 4WA3A 2FHRA 2V91A 2XZKA 3TI5A 2ZB5A 4XJRA 2GVVA 1V3DA 4M3MA 1B9VA 4AH4A 2BF6A 5FWWA 7NN9A 2YDPA 2HT7A 2HTRA 2ZZKA 4HHOA 2C4LA 1N1YA 3A72A 4MWXA 4XJ9A 3O4PA 5GTQA 1MS8A 1S1DA 1EUTA 4WEFA 2YA7A 4D52B 4M4NA 5FNRA 4B7MA 5B2DA 2B8HA 4YZ2A 2VW0A 3G4EA 3K37A 3I1CA 4DGRA 1Z50A 4D52A 2W20A 1QLGA 1VCUA 5EO8A 2IARA 3IAXA 2ISMA 3T1EA 4X47A 3PJQA 1NSBA 1V2IA 4XOGA 1B9TA 2QWGA 1E8UA 2QWCA 2YA8A 1S0IA 2QWDA 1E1AA 5F9TA 4FOVA 2VK5A 4UF7A 3D11A 4FOWA 2F24A 3ZGCA 1USRA 1ZGKA 3AMSA 4XE9A 4WEGA 4CPNA 1INYA 2IAUA 4XHBA 4B7RA 2HU0A 1SUUA 1N7DA 4XYXA 1EURA 3WDZA 5D9BA 4HIZA 4HZWA 2F13A 1WCQA 2IAPA 4HW6A 5GX2A 2VSKA 1F8CA 1WP5A 1SO7A 3O9JA 4JF7A 5FNTA 3V65B 1F8BA 4YY8A 4N1BA 3KYAA 2RKCA 4FP2A 3ZGDA 2BZDA 4FPJA 4KS2A 1V04A 3GVJA 4FP3A 1INXA 1H6LA 2JKBA 1NMAN 3VNHA 5GX5A 3B69A 4FPYA 4C1YA 2F26A 1KITA 4YW4A 4AHAA 1RWIA 3D12A 4Q6KA 4HZXA 5EX7A 1MZ5A 4B7NA 1NN2A 2VK7A 2GVXA 4JMLA 4XIOA 4MWJA 4WA4A 2HT5A 1MS9A 1C5KA 3TI3A 4C1YB 3TICA 3OPZA 1F8DA 2SILA 4XIKA 5HUGA 2W38A 4MJUA 3V64C 3HLIA 5FNSA 2QWIA 1SNTA 4IFLX 1SLLA 4GZXA 4MWQA 4X49A 2GVWA 2YA4A 2CMLA 4CPOA 1IVCA 2VWDA 1MS4A 4YZ1A 4GDJA 4MWYA 1L7FA 4DG6A 4YW3A 3K36A 3U0SA 2DG1A 4MWWA 2C4AA 1Z4ZA 2IVZA 1EUSA 1MWEA 2FPCA 4XJAA 4Q1UA 2X9MA 4D52C 2QWBA 1MS0A 3Q6TA 3E5ZA 1MZ6A 3CL0A 1IJQA 1W8NA 3HLHA 2GHSA 4BBWA 1PJXA 1NSCA 4K1KA 4GB1A 3BYCA 4GZTA 1NMBN 2YA6A 3WW9A 1IVGA 2DYHA 3AMRA 2DG0A 5EO7A 2W8BA 3FW0A 1NPEA 1W20A 1SLIA 4IN4A 3S94A 2HTYA 1IVEA 1NCBN 2QWFA 4L7CA 4X4AA 5H47A 4YZ5A 1NSDA 1QBIA 2OJHA 1OFZA 4FPLA 3CYEA 4MJVA 4GNBA 1N6FA 5HUNA 4GN8A 1C9UA 4AGIA 4MC7A 5FZNA 2FPBA 4FQ4A 4GDIA 2W5NA 4FPCA 4QN4A 2HQSA 4A0PA 4R40A 4XMBA 4GJTA 1S0JA 2XN4A 2VSMA 5HUKA 1ZI0A 1EUUA 2VVZA
chains in the Genus database with same CATH topology
3SRGA 4O5TA 5D9CA 3Q6KA 3FVZA 1V04A 1H6LA 3LI5A 1CRUA 5GX1A 2IASA 1POOA 5GX5A 5GX4A 3LI4A 2QE8A 3S8VA 3G4HA 3Q6PA 2POOA 2IAVA 5D9DA 4GNAA 1RWIA 2V91A 3HRPA 5EX7A 4GN7A 2GVVA 2GVXA 4JMLA 3SOQA 4GN9A 1RWLA 1C5KA 2GVUA 5FWWA 3TC9A 5GX3A 4HHQA 3V1SA 3V64C 3HLIA 4IMBA 3A9HA 4HHOA 2GVWA 3O4PA 5GTQA 4IYGA 3SOVA 2VAQA 4DG6A 4PWZA 2G8SA 3U0SA 3G4EA 3LI3A 3P5BL 3I1CA 2DG1A 3SREA 1QLGA 2IVZA 2IARA 2FPCA 4Q1UA 3SOBB 3IAXA 2ISMA 2IAWA 3Q6TA 2IAOA 3E5ZA 3HLHA 1CRZA 1IJQA 2GHSA 1PJXA 2IAXA 3BYCA 1E1AA 4ZLRA 3WW9A 3AMRA 2DG0A 2W8BA 3FW0A 1NPEA 4GNCA 3A9GA 3S94A 2IATA 3KGGA 3AMSA 3DASA 2P4OA 2IAQA 1QBIA 2IAUA 2OJHA 4GNBA 1N7DA 1Q7FA 2W8BB 4GN8A 1C9UA 5D9BA 2FPBA 1CQ1A 2FP9A 4O5SA 4HW6A 2IAPA 2HQSA 4A0PA 5GX2A 4R40A 3DR2A 3V65B 2DSOA 1CVMA 3S2KA 3KYAA 3S8ZA 2FP8A 3WWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SRG A;  4O5T A;  5D9C A;  3Q6K A;  3FVZ A;  1V04 A;  1H6L A;  3LI5 A;  1CRU A;  5GX1 A;  2IAS A;  1POO A;  5GX5 A;  5GX4 A;  3LI4 A;  2QE8 A;  3S8V A;  3G4H A;  3Q6P A;  2POO A;  2IAV A;  5D9D A;  4GNA A;  1RWI A;  2V91 A;  3HRP A;  5EX7 A;  4GN7 A;  2GVV A;  2GVX A;  4JML A;  3SOQ A;  4GN9 A;  1RWL A;  1C5K A;  2GVU A;  5FWW A;  3TC9 A;  5GX3 A;  4HHQ A;  3V1S A;  3V64 C;  3HLI A;  4IMB A;  3A9H A;  4HHO A;  2GVW A;  3O4P A;  5GTQ A;  4IYG A;  3SOV A;  2VAQ A;  4DG6 A;  4PWZ A;  2G8S A;  3U0S A;  3G4E A;  3LI3 A;  3P5B L;  3I1C A;  2DG1 A;  3SRE A;  1QLG A;  2IVZ A;  2IAR A;  2FPC A;  4Q1U A;  3SOB B;  3IAX A;  2ISM A;  2IAW A;  3Q6T A;  2IAO A;  3E5Z A;  3HLH A;  1CRZ A;  1IJQ A;  2GHS A;  1PJX A;  2IAX A;  3BYC A;  1E1A A;  4ZLR A;  3WW9 A;  3AMR A;  2DG0 A;  2W8B A;  3FW0 A;  1NPE A;  4GNC A;  3A9G A;  3S94 A;  2IAT A;  3KGG A;  3AMS A;  3DAS A;  2P4O A;  2IAQ A;  1QBI A;  2IAU A;  2OJH A;  4GNB A;  1N7D A;  1Q7F A;  2W8B B;  4GN8 A;  1C9U A;  5D9B A;  2FPB A;  1CQ1 A;  2FP9 A;  4O5S A;  4HW6 A;  2IAP A;  2HQS A;  4A0P A;  5GX2 A;  4R40 A;  3DR2 A;  3V65 B;  2DSO A;  1CVM A;  3S2K A;  3KYA A;  3S8Z A;  2FP8 A;  3WWA A; 
#chains in the Genus database with same CATH topology
 3SRG A;  3VNG A;  1A4Q A;  1B9S A;  1W0O A;  4NCS A;  1W21 A;  2YDT A;  4AGT A;  1POO A;  4QNP A;  4FPH A;  4MZE A;  5GX4 A;  4MWU A;  3LI4 A;  3S8V A;  1IUC A;  3G4H A;  4ZGC A;  2ZB6 A;  3TI8 A;  1DIL A;  5D9D A;  1L7H A;  4GNA A;  4XHX A;  2AGS A;  4K1I A;  3HRP A;  1NCD N;  3H72 A;  4GZQ A;  3K38 A;  2FLU X;  3SOQ A;  1X2R A;  4GN9 A;  4FPG A;  1RWL A;  2WOZ A;  3O9K A;  2GVU A;  4YZ4 A;  4HHQ A;  3V1S A;  4IMB A;  4B7J A;  1N1V A;  2Z32 A;  3NO0 A;  3BEQ A;  4IYG A;  5HUM A;  3K3A A;  2VK6 A;  4XJW A;  4FPE A;  1W1X A;  5B2C A;  2G8S A;  3P5B L;  4KS5 A;  2AEQ A;  3II7 A;  3TI4 A;  2QWK A;  4YW1 A;  4QN5 A;  2F29 A;  2F10 A;  3INB A;  4FZH A;  3B7E A;  4KS4 A;  2IAW A;  1V3E A;  1NCA N;  2F0Z A;  1CRZ A;  1K32 A;  1S18 A;  2HU4 A;  1N6D A;  4FPK A;  2IAX A;  3L6V A;  4L7B A;  3ADE A;  1Z4X A;  1F8E A;  1X2J A;  2F25 A;  2VW2 A;  4FPO B;  4NC5 A;  4M4V A;  4ZLR A;  4FOQ A;  4GNC A;  4SLI A;  3CL2 A;  3KGG A;  2SLI A;  3DAS A;  2P4O A;  3NN9 A;  4MX0 A;  1N1T A;  1INV A;  1N6E A;  5F72 C;  2SIM A;  4CHB A;  5FNQ A;  4H53 A;  4CSD A;  2BER A;  1Q7F A;  2W8B B;  1XOE A;  1Z4W A;  1XOG A;  1CQ1 A;  4MWR A;  4O5S A;  1W8O A;  3W09 A;  4FOY A;  1BJI A;  4K1H A;  4GEZ A;  4K1J A;  1IUB A;  3TIA A;  4D4U A;  2HTU A;  4MWL A;  3DR2 A;  1V0Z A;  2HTV A;  4XJ8 A;  2FP8 A;  3S8Z A;  3JU4 A;  4WA5 A;  3H71 A;  4O5T A;  4X6K A;  1NMC A;  2YA5 A;  3Q6K A;  6NN9 A;  4B7Q A;  4CPL A;  4H52 A;  1CRU A;  5GX1 A;  2IAS A;  2F12 A;  4ASC A;  3NSS A;  1MR5 A;  4XIL A;  2AH2 A;  1E8T A;  1NNA A;  1MS3 A;  3Q6P A;  2POO A;  3WN7 A;  2VW1 A;  2IAV A;  2QWJ A;  5NN9 A;  4FVK A;  4ZY3 A;  1IVB A;  5FNU A;  2XZI A;  4GN7 A;  4IFN X;  4UOU A;  4MZA A;  2QWH A;  1NNC A;  4MWV A;  2HT8 A;  1U6D X;  4XMA A;  3TC9 A;  3TI6 A;  5GX3 A;  4GZW A;  4GZP A;  3SAN A;  4IFJ A;  3A9H A;  4HZV A;  1USX A;  3SOV A;  2F27 A;  4G3N A;  1V3B A;  3SLI A;  2VAQ A;  1NCC N;  4KS1 A;  4PWZ A;  1INW A;  4QN3 A;  3LI3 A;  2A75 A;  4YW2 A;  1Z4Y A;  3SRE A;  1ING A;  2QWE A;  3A71 A;  1MS5 A;  2XCY A;  4D8S A;  4IQK A;  3SOB B;  3K39 A;  2ZW9 A;  4CPY A;  4XJU A;  1V3C A;  2IAO A;  4CPZ A;  2H2N A;  2HTW A;  1INF A;  4GZO A;  1A14 N;  2AEP A;  3GVK A;  4L7D A;  1N1S A;  4QN7 A;  4XJZ A;  2XZJ A;  1WCS A;  4YZ3 A;  1W0P A;  3SAL A;  2F28 A;  2BAT A;  3A9G A;  1V0E A;  1MS1 A;  4YW5 A;  2IAT A;  3ALW A;  5M1Z A;  4GZS A;  3GVL A;  2IAQ A;  4J9T A;  1IVF A;  1V0F A;  3H6J A;  4HZZ A;  2VPJ A;  4CH9 A;  4XJQ A;  1NNB A;  1INH A;  4NN9 A;  5HX0 A;  2FP9 A;  4XMI A;  3TIB A;  4K3Y A;  4KS3 A;  1Z4V A;  2DSO A;  1CVM A;  4CPM A;  3S2K A;  5FZJ A;  4I00 A;  3WWA A;  2HTQ A;  2W5O A;  1A4G A;  5CGJ A;  5D9C A;  2ZWA A;  3FVZ A;  4HZY A;  3ALX A;  4FPF A;  4QN6 A;  2F11 A;  3LI5 A;  4M4U A;  4FJ6 A;  3CKZ A;  1DIM A;  2QE8 A;  1IVD A;  1E8V A;  1L7G A;  2QWA A;  5JYY A;  1VCJ A;  2H2U A;  3H73 A;  3UC1 A;  3SIL A;  4WA3 A;  2FHR A;  2V91 A;  2XZK A;  3TI5 A;  2ZB5 A;  4XJR A;  2GVV A;  1V3D A;  4M3M A;  1B9V A;  4AH4 A;  2BF6 A;  5FWW A;  7NN9 A;  2YDP A;  2HT7 A;  2HTR A;  2ZZK A;  4HHO A;  2C4L A;  1N1Y A;  3A72 A;  4MWX A;  4XJ9 A;  3O4P A;  5GTQ A;  1MS8 A;  1S1D A;  1EUT A;  4WEF A;  2YA7 A;  4D52 B;  4M4N A;  5FNR A;  4B7M A;  5B2D A;  2B8H A;  4YZ2 A;  2VW0 A;  3G4E A;  3K37 A;  3I1C A;  4DGR A;  1Z50 A;  4D52 A;  2W20 A;  1QLG A;  1VCU A;  5EO8 A;  2IAR A;  3IAX A;  2ISM A;  3T1E A;  4X47 A;  3PJQ A;  1NSB A;  1V2I A;  4XOG A;  1B9T A;  2QWG A;  1E8U A;  2QWC A;  2YA8 A;  1S0I A;  2QWD A;  1E1A A;  5F9T A;  4FOV A;  2VK5 A;  4UF7 A;  3D11 A;  4FOW A;  2F24 A;  3ZGC A;  1USR A;  1ZGK A;  3AMS A;  4XE9 A;  4WEG A;  4CPN A;  1INY A;  2IAU A;  4XHB A;  4B7R A;  2HU0 A;  1SUU A;  1N7D A;  4XYX A;  1EUR A;  3WDZ A;  5D9B A;  4HIZ A;  4HZW A;  2F13 A;  1WCQ A;  2IAP A;  4HW6 A;  5GX2 A;  2VSK A;  1F8C A;  1WP5 A;  1SO7 A;  3O9J A;  4JF7 A;  5FNT A;  3V65 B;  1F8B A;  4YY8 A;  4N1B A;  3KYA A;  2RKC A;  4FP2 A;  3ZGD A;  2BZD A;  4FPJ A;  4KS2 A;  1V04 A;  3GVJ A;  4FP3 A;  1INX A;  1H6L A;  2JKB A;  1NMA N;  3VNH A;  5GX5 A;  3B69 A;  4FPY A;  4C1Y A;  2F26 A;  1KIT A;  4YW4 A;  4AHA A;  1RWI A;  3D12 A;  4Q6K A;  4HZX A;  5EX7 A;  1MZ5 A;  4B7N A;  1NN2 A;  2VK7 A;  2GVX A;  4JML A;  4XIO A;  4MWJ A;  4WA4 A;  2HT5 A;  1MS9 A;  1C5K A;  3TI3 A;  4C1Y B;  3TIC A;  3OPZ A;  1F8D A;  2SIL A;  4XIK A;  5HUG A;  2W38 A;  4MJU A;  3V64 C;  3HLI A;  5FNS A;  2QWI A;  1SNT A;  4IFL X;  1SLL A;  4GZX A;  4MWQ A;  4X49 A;  2GVW A;  2YA4 A;  2CML A;  4CPO A;  1IVC A;  2VWD A;  1MS4 A;  4YZ1 A;  4GDJ A;  4MWY A;  1L7F A;  4DG6 A;  4YW3 A;  3K36 A;  3U0S A;  2DG1 A;  4MWW A;  2C4A A;  1Z4Z A;  2IVZ A;  1EUS A;  1MWE A;  2FPC A;  4XJA A;  4Q1U A;  2X9M A;  4D52 C;  2QWB A;  1MS0 A;  3Q6T A;  3E5Z A;  1MZ6 A;  3CL0 A;  1IJQ A;  1W8N A;  3HLH A;  2GHS A;  4BBW A;  1PJX A;  1NSC A;  4K1K A;  4GB1 A;  3BYC A;  4GZT A;  1NMB N;  2YA6 A;  3WW9 A;  1IVG A;  2DYH A;  3AMR A;  2DG0 A;  5EO7 A;  2W8B A;  3FW0 A;  1NPE A;  1W20 A;  1SLI A;  4IN4 A;  3S94 A;  2HTY A;  1IVE A;  1NCB N;  2QWF A;  4L7C A;  4X4A A;  5H47 A;  4YZ5 A;  1NSD A;  1QBI A;  2OJH A;  1OFZ A;  4FPL A;  3CYE A;  4MJV A;  4GNB A;  1N6F A;  5HUN A;  4GN8 A;  1C9U A;  4AGI A;  4MC7 A;  5FZN A;  2FPB A;  4FQ4 A;  4GDI A;  2W5N A;  4FPC A;  4QN4 A;  2HQS A;  4A0P A;  4R40 A;  4XMB A;  4GJT A;  1S0J A;  2XN4 A;  2VSM A;  5HUK A;  1ZI0 A;  1EUU A;  2VVZ A; 
#chains in the Genus database with same CATH homology
 3SRG A;  4O5T A;  5D9C A;  3Q6K A;  3FVZ A;  1V04 A;  1H6L A;  3LI5 A;  1CRU A;  5GX1 A;  2IAS A;  1POO A;  5GX5 A;  5GX4 A;  3LI4 A;  2QE8 A;  3S8V A;  3G4H A;  3Q6P A;  2POO A;  2IAV A;  5D9D A;  4GNA A;  1RWI A;  2V91 A;  3HRP A;  5EX7 A;  4GN7 A;  2GVV A;  2GVX A;  4JML A;  3SOQ A;  4GN9 A;  1RWL A;  1C5K A;  2GVU A;  5FWW A;  3TC9 A;  5GX3 A;  4HHQ A;  3V1S A;  3V64 C;  3HLI A;  4IMB A;  3A9H A;  4HHO A;  2GVW A;  3O4P A;  5GTQ A;  4IYG A;  3SOV A;  2VAQ A;  4DG6 A;  4PWZ A;  2G8S A;  3U0S A;  3G4E A;  3LI3 A;  3P5B L;  3I1C A;  2DG1 A;  3SRE A;  1QLG A;  2IVZ A;  2IAR A;  2FPC A;  4Q1U A;  3SOB B;  3IAX A;  2ISM A;  2IAW A;  3Q6T A;  2IAO A;  3E5Z A;  3HLH A;  1CRZ A;  1IJQ A;  2GHS A;  1PJX A;  2IAX A;  3BYC A;  1E1A A;  4ZLR A;  3WW9 A;  3AMR A;  2DG0 A;  2W8B A;  3FW0 A;  1NPE A;  4GNC A;  3A9G A;  3S94 A;  2IAT A;  3KGG A;  3AMS A;  3DAS A;  2P4O A;  2IAQ A;  1QBI A;  2IAU A;  2OJH A;  4GNB A;  1N7D A;  1Q7F A;  2W8B B;  4GN8 A;  1C9U A;  5D9B A;  2FPB A;  1CQ1 A;  2FP9 A;  4O5S A;  4HW6 A;  2IAP A;  2HQS A;  4A0P A;  5GX2 A;  4R40 A;  3DR2 A;  3V65 B;  2DSO A;  1CVM A;  3S2K A;  3KYA A;  3S8Z A;  2FP8 A;  3WWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...