2FPBA

Structure of strictosidine synthase, the biosynthetic entry to the monoterpenoid indole alkaloid family
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
305
structure length
305
Chain Sequence
PILKEILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVMKYEGPNSGFVDFAYASPYWNKAFCENSTDAEKRPLCGRTYDISYNLQNNQMYIVDCYYHLSVVGSEGGHATQLATSVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTGRLMKYDPSTKETTLLMKELHVPGGAEVSADSSFVLVAEFLSHQIVKYWLEGPKKGTAEVLVKIPNPGNIKRNADGHFWVSSSEELDGNMHGRVDPKGIKFDEFGNILEVIPLPPPFAGEHFEQIQEHDGLLYIGTLFHGSVGILVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Rauvolfia serpentina strictosidine synthase is a novel six-bladed beta-propeller fold in plant proteins
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Lyase
molecule keywords Strictosidine Synthase
total genus 70
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 4.3.3.2: Strictosidine synthase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03088 Str_synth Strictosidine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 2fpbA00
3LI4A 2W8BA 3WW9A 1C9UA 5D9DA 2W8BB 1V04A 3SREA 5GX5A 3V64C 3S2KA 2ISMA 1CRUA 4IYGA 1C5KA 1RWLA 2P4OA 3Q6TA 4ZLRA 2GVXA 4GN8A 3FW0A 4O5TA 2IAUA 2IARA 1QBIA 2GHSA 2IATA 4JMLA 3S94A 2IAOA 3HRPA 1N7DA 4Q1UA 2IAWA 3DR2A 1RWIA 2V91A 4A0PA 3KGGA 1CQ1A 2IAQA 3O4PA 1PJXA 3S8VA 1E1AA 2IVZA 1QLGA 2DG0A 2IAXA 3E5ZA 2GVUA 5GX2A 4HHOA 5GX1A 2FPCA 3BYCA 4GNAA 3P5BL 2DSOA 3SOQA 4IMBA 3HLHA 3A9GA 3KYAA 3SOVA 3SRGA 2FP9A 2POOA 5D9BA 3Q6KA 1NPEA 3S8ZA 2G8SA 1Q7FA 5GX4A 3DASA 4R40A 4HHQA 1IJQA 4O5SA 1CRZA 3G4HA 2IAPA 5GTQA 5EX7A 2IAVA 4GNBA 3AMSA 2OJHA 4DG6A 2FP8A 2FPBA 3G4EA 3LI3A 4HW6A 3V65B 1POOA 2QE8A 3WWAA 3SOBB 3I1CA 2GVWA 2HQSA 5FWWA 3A9HA 1CVMA 3HLIA 3IAXA 2IASA 4GN9A 4PWZA 3AMRA 3TC9A 4GNCA 2DG1A 3LI5A 2VAQA 3Q6PA 5GX3A 4GN7A 3FVZA 3U0SA 1H6LA 5D9CA 3V1SA 2GVVA
chains in the Genus database with same CATH superfamily
3LI4A 1ZI0A 4K1HA 5D9DA 5FZNA 2C4LA 3SREA 2DYHA 4MZEA 3A71A 4IQKA 3VNHA 4KS3A 5HUMA 3BEQA 1W8OA 4XE9A 4Q6KA 2VW0A 4XJUA 2HTVA 5FZJA 5FNRA 4IFJA 1NSDA 2YDPA 4D8SA 1B9SA 4D52C 5FNSA 2GVXA 3TI3A 4XMBA 2VSKA 3FW0A 4FPOB 4GN8A 2XN4A 1K32A 3JU4A 4O5TA 4C1YA 1QBIA 4X47A 4C1YB 2GHSA 4CH9A 2VK5A 3S94A 2YDTA 4B7MA 2F10A 2WOZA 1IVGA 1IVCA 2IAQA 6NN9A 1NSBA 2BF6A 2HU4A 1WCQA 4GDJA 2HTYA 5FNQA 2QWFA 3WDZA 1MS8A 1N6FA 2GVUA 4HHOA 4CPNA 4G3NA 2SILA 3T1EA 1NCBN 1L7HA 4YW1A 4WA5A 3P5BL 2DSOA 2QWJA 3HLHA 3ADEA 3SALA 2W38A 4MWRA 4GZSA 2Z32A 1INGA 2YA4A 2YA5A 4XJ9A 4M4UA 1NCAN 2W20A 1NCDN 3O9JA 4HHQA 4WEGA 1XOEA 1N1TA 3G4HA 3L6VA 1V2IA 2F13A 1S0JA 4B7RA 2FP8A 1X2RA 1VCUA 5FNUA 4AH4A 4J9TA 1SUUA 2QWDA 4CPYA 3WWAA 3I1CA 2QWCA 1MS9A 1A14N 2F29A 2IASA 4GN9A 5M1ZA 4PWZA 1INHA 4FPHA 5NN9A 1MWEA 4QN3A 2HT8A 1E8VA 2FLUX 2VAQA 3Q6PA 4GZXA 3U0SA 4WEFA 4MJVA 1INXA 4MWUA 1IVEA 1C9UA 3CYEA 4XOGA 4HZVA 4FOYA 3S2KA 4XYXA 4FP2A 2VW2A 4FPEA 4YY8A 3NSSA 3TIAA 4FOVA 1MR5A 4KS4A 3TI8A 4XHBA 2YA6A 1RWLA 4FJ6A 4YW4A 2QWEA 5H47A 2H2NA 4FQ4A 3SILA 4FVKA 2IATA 1N1VA 1SLIA 4Q1UA 2IAWA 2V91A 1NMAN 4MWJA 1F8CA 1V3BA 3H73A 5F72C 1A4QA 4FPCA 4MZAA 3S8VA 1E1AA 1NSCA 1Z4ZA 1QLGA 2VPJA 4X49A 3K36A 1USXA 3TI4A 5GX1A 2ZZKA 1IVFA 4YW3A 4FPYA 1W21A 3BYCA 2QWAA 1IVDA 4FOQA 4GNAA 4XJZA 4GDIA 4CPLA 2YA8A 4B7JA 4MX0A 3O9KA 2BZDA 3SOVA 2FP9A 4D4UA 4XIOA 1S1DA 5D9BA 1NPEA 1INWA 3NN9A 1W0PA 3GVKA 4FZHA 1Z4YA 2HTUA 1Q7FA 3TI5A 2ZB5A 2HTRA 3UC1A 4ZY3A 2A75A 4K3YA 5EO8A 4GJTA 1ZGKA 2F0ZA 4R40A 4MC7A 4KS5A 4GZWA 4CHBA 1CRZA 3B69A 5HUGA 2W5OA 5EX7A 2ZWAA 1W20A 2FHRA 3OPZA 4YZ1A 3AMSA 4FPGA 2FPBA 2HU0A 4GB1A 4UF7A 3LI3A 4HW6A 5HUKA 4WA3A 3SOBB 4YW2A 2VVZA 2HQSA 1NN2A 1MZ5A 5FWWA 4AHAA 1CVMA 4HZWA 4FPKA 2QWKA 3HLIA 3IAXA 3K39A 2BERA 3TC9A 2QWGA 4GNCA 3SLIA 4K1KA 4ASCA 3B7EA 2H2UA 1VCJA 1MS5A 2F12A 3LI5A 5GX3A 5F9TA 2XZIA 2HT5A 4GN7A 5HX0A 2GVVA 3WW9A 1N1YA 3CL0A 4L7DA 2C4AA 5GX5A 4L7CA 3H71A 3K38A 1KITA 3D11A 1MZ6A 2HTWA 1N6DA 4MWYA 1Z4XA 2SIMA 1C5KA 2P4OA 4I00A 5HUNA 4ZLRA 4HZXA 2IAUA 4IFNX 2IARA 4AGIA 4JF7A 2IAOA 5EO7A 1N1SA 4A0PA 1CQ1A 2F25A 2ZW9A 4GZOA 3GVJA 2AGSA 1PJXA 4FPLA 4KS1A 5B2DA 3PJQA 1EUSA 4XJQA 2IVZA 1NCCN 2DG0A 2IAXA 4NN9A 1Z4VA 4MWLA 5GX2A 3K37A 1XOGA 1U6DX 3TIBA 2F11A 2YA7A 3D12A 4FP3A 2F24A 5B2CA 2VK6A 3SOQA 2AEPA 1X2JA 2AEQA 1INFA 4IMBA 4YZ2A 4YZ3A 4K1IA 3SRGA 3ALXA 2CMLA 2VSMA 3H72A 3TI6A 1MS4A 4XJWA 4DGRA 1DILA 4X4AA 4IN4A 2G8SA 1F8BA 3ALWA 1L7GA 4CSDA 4MWXA 5GX4A 4B7NA 4M4VA 4NCSA 2XCYA 1E8TA 1NNCA 2F26A 2IAVA 3II7A 1INVA 2OJHA 1N6EA 3WN7A 3INBA 3G4EA 4MWVA 4X6KA 3V65B 2VW1A 4FOWA 1INYA 2QWBA 2GVWA 1BJIA 4XJAA 3A9HA 1F8EA 4UOUA 4ZGCA 4XILA 1IVBA 4H53A 4WA4A 3ZGCA 3W09A 2F27A 1USRA 2DG1A 2XZJA 5JYYA 1EUTA 4QN4A 2SLIA 3A72A 1W0OA 4M3MA 4XJRA 4H52A 2W8BA 1MS3A 1MS1A 4XMIA 2W8BB 1WCSA 1V0EA 1V04A 1L7FA 3V64C 1DIMA 4KS2A 1SO7A 4K1JA 2VK7A 4XJ8A 2BATA 1W1XA 1NNBA 2ISMA 4GEZA 1V0ZA 1CRUA 4CPMA 1WP5A 4QN5A 4IYGA 4GZQA 4QN7A 1IUCA 1EUUA 3Q6TA 5FNTA 1IUBA 3NO0A 4FPFA 1NNAA 4D52A 4XHXA 1F8DA 4D52B 4JMLA 1W8NA 3HRPA 1N7DA 4GZTA 4IFLX 3DR2A 1RWIA 2X9MA 1MS0A 4QNPA 3KGGA 1V0FA 3SANA 2HT7A 3O4PA 4MWWA 4L7BA 4MJUA 1V3CA 4XMAA 4B7QA 4YW5A 3E5ZA 2F28A 4QN6A 2FPCA 4AGTA 1SNTA 4SLIA 4CPZA 1S18A 4FPJA 3GVLA 1OFZA 1S0IA 2W5NA 4HZYA 3A9GA 3KYAA 2XZKA 2POOA 3Q6KA 4YZ4A 4YZ5A 3S8ZA 7NN9A 1Z50A 4CPOA 4M4NA 3VNGA 1A4GA 1E8UA 3DASA 1NMBN 1IJQA 1B9VA 4O5SA 1SLLA 4MWQA 2IAPA 5GTQA 1EURA 4XIKA 4GNBA 2ZB6A 1NMCA 4DG6A 2HTQA 2RKCA 1V3EA 4N1BA 1POOA 2QE8A 3ZGDA 4HIZA 3TICA 2QWHA 2B8HA 2VWDA 4GZPA 5CGJA 3CL2A 4HZZA 1B9TA 3H6JA 4NC5A 3AMRA 1V3DA 2AH2A 3K3AA 3CKZA 4BBWA 1Z4WA 2QWIA 3FVZA 1H6LA 5D9CA 2JKBA 3V1SA
chains in the Genus database with same CATH topology
3LI4A 2W8BA 3WW9A 1C9UA 5D9DA 2W8BB 1V04A 3SREA 5GX5A 3V64C 3S2KA 2ISMA 1CRUA 4IYGA 1C5KA 1RWLA 2P4OA 3Q6TA 4ZLRA 2GVXA 4GN8A 3FW0A 4O5TA 2IAUA 2IARA 1QBIA 2GHSA 2IATA 4JMLA 3S94A 2IAOA 3HRPA 1N7DA 4Q1UA 2IAWA 3DR2A 1RWIA 2V91A 4A0PA 3KGGA 1CQ1A 2IAQA 3O4PA 1PJXA 3S8VA 1E1AA 2IVZA 1QLGA 2DG0A 2IAXA 3E5ZA 2GVUA 5GX2A 4HHOA 5GX1A 2FPCA 3BYCA 4GNAA 3P5BL 2DSOA 3SOQA 4IMBA 3HLHA 3A9GA 3KYAA 3SOVA 3SRGA 2FP9A 2POOA 5D9BA 3Q6KA 1NPEA 3S8ZA 2G8SA 1Q7FA 5GX4A 3DASA 4R40A 4HHQA 1IJQA 4O5SA 1CRZA 3G4HA 2IAPA 5GTQA 5EX7A 2IAVA 4GNBA 3AMSA 2OJHA 4DG6A 2FP8A 2FPBA 3G4EA 3LI3A 4HW6A 3V65B 1POOA 2QE8A 3WWAA 3SOBB 3I1CA 2GVWA 2HQSA 5FWWA 3A9HA 1CVMA 3HLIA 3IAXA 2IASA 4GN9A 4PWZA 3AMRA 3TC9A 4GNCA 2DG1A 3LI5A 2VAQA 3Q6PA 5GX3A 4GN7A 3FVZA 3U0SA 1H6LA 5D9CA 3V1SA 2GVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LI4 A;  2W8B A;  3WW9 A;  1C9U A;  5D9D A;  2W8B B;  1V04 A;  3SRE A;  5GX5 A;  3V64 C;  3S2K A;  2ISM A;  1CRU A;  4IYG A;  1C5K A;  1RWL A;  2P4O A;  3Q6T A;  4ZLR A;  2GVX A;  4GN8 A;  3FW0 A;  4O5T A;  2IAU A;  2IAR A;  1QBI A;  2GHS A;  2IAT A;  4JML A;  3S94 A;  2IAO A;  3HRP A;  1N7D A;  4Q1U A;  2IAW A;  3DR2 A;  1RWI A;  2V91 A;  4A0P A;  3KGG A;  1CQ1 A;  2IAQ A;  3O4P A;  1PJX A;  3S8V A;  1E1A A;  2IVZ A;  1QLG A;  2DG0 A;  2IAX A;  3E5Z A;  2GVU A;  5GX2 A;  4HHO A;  5GX1 A;  2FPC A;  3BYC A;  4GNA A;  3P5B L;  2DSO A;  3SOQ A;  4IMB A;  3HLH A;  3A9G A;  3KYA A;  3SOV A;  3SRG A;  2FP9 A;  2POO A;  5D9B A;  3Q6K A;  1NPE A;  3S8Z A;  2G8S A;  1Q7F A;  5GX4 A;  3DAS A;  4R40 A;  4HHQ A;  1IJQ A;  4O5S A;  1CRZ A;  3G4H A;  2IAP A;  5GTQ A;  5EX7 A;  2IAV A;  4GNB A;  3AMS A;  2OJH A;  4DG6 A;  2FP8 A;  2FPB A;  3G4E A;  3LI3 A;  4HW6 A;  3V65 B;  1POO A;  2QE8 A;  3WWA A;  3SOB B;  3I1C A;  2GVW A;  2HQS A;  5FWW A;  3A9H A;  1CVM A;  3HLI A;  3IAX A;  2IAS A;  4GN9 A;  4PWZ A;  3AMR A;  3TC9 A;  4GNC A;  2DG1 A;  3LI5 A;  2VAQ A;  3Q6P A;  5GX3 A;  4GN7 A;  3FVZ A;  3U0S A;  1H6L A;  5D9C A;  3V1S A;  2GVV A; 
#chains in the Genus database with same CATH topology
 3LI4 A;  1ZI0 A;  4K1H A;  5D9D A;  5FZN A;  2C4L A;  3SRE A;  2DYH A;  4MZE A;  3A71 A;  4IQK A;  3VNH A;  4KS3 A;  5HUM A;  3BEQ A;  1W8O A;  4XE9 A;  4Q6K A;  2VW0 A;  4XJU A;  2HTV A;  5FZJ A;  5FNR A;  4IFJ A;  1NSD A;  2YDP A;  4D8S A;  1B9S A;  4D52 C;  5FNS A;  2GVX A;  3TI3 A;  4XMB A;  2VSK A;  3FW0 A;  4FPO B;  4GN8 A;  2XN4 A;  1K32 A;  3JU4 A;  4O5T A;  4C1Y A;  1QBI A;  4X47 A;  4C1Y B;  2GHS A;  4CH9 A;  2VK5 A;  3S94 A;  2YDT A;  4B7M A;  2F10 A;  2WOZ A;  1IVG A;  1IVC A;  2IAQ A;  6NN9 A;  1NSB A;  2BF6 A;  2HU4 A;  1WCQ A;  4GDJ A;  2HTY A;  5FNQ A;  2QWF A;  3WDZ A;  1MS8 A;  1N6F A;  2GVU A;  4HHO A;  4CPN A;  4G3N A;  2SIL A;  3T1E A;  1NCB N;  1L7H A;  4YW1 A;  4WA5 A;  3P5B L;  2DSO A;  2QWJ A;  3HLH A;  3ADE A;  3SAL A;  2W38 A;  4MWR A;  4GZS A;  2Z32 A;  1ING A;  2YA4 A;  2YA5 A;  4XJ9 A;  4M4U A;  1NCA N;  2W20 A;  1NCD N;  3O9J A;  4HHQ A;  4WEG A;  1XOE A;  1N1T A;  3G4H A;  3L6V A;  1V2I A;  2F13 A;  1S0J A;  4B7R A;  2FP8 A;  1X2R A;  1VCU A;  5FNU A;  4AH4 A;  4J9T A;  1SUU A;  2QWD A;  4CPY A;  3WWA A;  3I1C A;  2QWC A;  1MS9 A;  1A14 N;  2F29 A;  2IAS A;  4GN9 A;  5M1Z A;  4PWZ A;  1INH A;  4FPH A;  5NN9 A;  1MWE A;  4QN3 A;  2HT8 A;  1E8V A;  2FLU X;  2VAQ A;  3Q6P A;  4GZX A;  3U0S A;  4WEF A;  4MJV A;  1INX A;  4MWU A;  1IVE A;  1C9U A;  3CYE A;  4XOG A;  4HZV A;  4FOY A;  3S2K A;  4XYX A;  4FP2 A;  2VW2 A;  4FPE A;  4YY8 A;  3NSS A;  3TIA A;  4FOV A;  1MR5 A;  4KS4 A;  3TI8 A;  4XHB A;  2YA6 A;  1RWL A;  4FJ6 A;  4YW4 A;  2QWE A;  5H47 A;  2H2N A;  4FQ4 A;  3SIL A;  4FVK A;  2IAT A;  1N1V A;  1SLI A;  4Q1U A;  2IAW A;  2V91 A;  1NMA N;  4MWJ A;  1F8C A;  1V3B A;  3H73 A;  5F72 C;  1A4Q A;  4FPC A;  4MZA A;  3S8V A;  1E1A A;  1NSC A;  1Z4Z A;  1QLG A;  2VPJ A;  4X49 A;  3K36 A;  1USX A;  3TI4 A;  5GX1 A;  2ZZK A;  1IVF A;  4YW3 A;  4FPY A;  1W21 A;  3BYC A;  2QWA A;  1IVD A;  4FOQ A;  4GNA A;  4XJZ A;  4GDI A;  4CPL A;  2YA8 A;  4B7J A;  4MX0 A;  3O9K A;  2BZD A;  3SOV A;  2FP9 A;  4D4U A;  4XIO A;  1S1D A;  5D9B A;  1NPE A;  1INW A;  3NN9 A;  1W0P A;  3GVK A;  4FZH A;  1Z4Y A;  2HTU A;  1Q7F A;  3TI5 A;  2ZB5 A;  2HTR A;  3UC1 A;  4ZY3 A;  2A75 A;  4K3Y A;  5EO8 A;  4GJT A;  1ZGK A;  2F0Z A;  4R40 A;  4MC7 A;  4KS5 A;  4GZW A;  4CHB A;  1CRZ A;  3B69 A;  5HUG A;  2W5O A;  5EX7 A;  2ZWA A;  1W20 A;  2FHR A;  3OPZ A;  4YZ1 A;  3AMS A;  4FPG A;  2FPB A;  2HU0 A;  4GB1 A;  4UF7 A;  3LI3 A;  4HW6 A;  5HUK A;  4WA3 A;  3SOB B;  4YW2 A;  2VVZ A;  2HQS A;  1NN2 A;  1MZ5 A;  5FWW A;  4AHA A;  1CVM A;  4HZW A;  4FPK A;  2QWK A;  3HLI A;  3IAX A;  3K39 A;  2BER A;  3TC9 A;  2QWG A;  4GNC A;  3SLI A;  4K1K A;  4ASC A;  3B7E A;  2H2U A;  1VCJ A;  1MS5 A;  2F12 A;  3LI5 A;  5GX3 A;  5F9T A;  2XZI A;  2HT5 A;  4GN7 A;  5HX0 A;  2GVV A;  3WW9 A;  1N1Y A;  3CL0 A;  4L7D A;  2C4A A;  5GX5 A;  4L7C A;  3H71 A;  3K38 A;  1KIT A;  3D11 A;  1MZ6 A;  2HTW A;  1N6D A;  4MWY A;  1Z4X A;  2SIM A;  1C5K A;  2P4O A;  4I00 A;  5HUN A;  4ZLR A;  4HZX A;  2IAU A;  4IFN X;  2IAR A;  4AGI A;  4JF7 A;  2IAO A;  5EO7 A;  1N1S A;  4A0P A;  1CQ1 A;  2F25 A;  2ZW9 A;  4GZO A;  3GVJ A;  2AGS A;  1PJX A;  4FPL A;  4KS1 A;  5B2D A;  3PJQ A;  1EUS A;  4XJQ A;  2IVZ A;  1NCC N;  2DG0 A;  2IAX A;  4NN9 A;  1Z4V A;  4MWL A;  5GX2 A;  3K37 A;  1XOG A;  1U6D X;  3TIB A;  2F11 A;  2YA7 A;  3D12 A;  4FP3 A;  2F24 A;  5B2C A;  2VK6 A;  3SOQ A;  2AEP A;  1X2J A;  2AEQ A;  1INF A;  4IMB A;  4YZ2 A;  4YZ3 A;  4K1I A;  3SRG A;  3ALX A;  2CML A;  2VSM A;  3H72 A;  3TI6 A;  1MS4 A;  4XJW A;  4DGR A;  1DIL A;  4X4A A;  4IN4 A;  2G8S A;  1F8B A;  3ALW A;  1L7G A;  4CSD A;  4MWX A;  5GX4 A;  4B7N A;  4M4V A;  4NCS A;  2XCY A;  1E8T A;  1NNC A;  2F26 A;  2IAV A;  3II7 A;  1INV A;  2OJH A;  1N6E A;  3WN7 A;  3INB A;  3G4E A;  4MWV A;  4X6K A;  3V65 B;  2VW1 A;  4FOW A;  1INY A;  2QWB A;  2GVW A;  1BJI A;  4XJA A;  3A9H A;  1F8E A;  4UOU A;  4ZGC A;  4XIL A;  1IVB A;  4H53 A;  4WA4 A;  3ZGC A;  3W09 A;  2F27 A;  1USR A;  2DG1 A;  2XZJ A;  5JYY A;  1EUT A;  4QN4 A;  2SLI A;  3A72 A;  1W0O A;  4M3M A;  4XJR A;  4H52 A;  2W8B A;  1MS3 A;  1MS1 A;  4XMI A;  2W8B B;  1WCS A;  1V0E A;  1V04 A;  1L7F A;  3V64 C;  1DIM A;  4KS2 A;  1SO7 A;  4K1J A;  2VK7 A;  4XJ8 A;  2BAT A;  1W1X A;  1NNB A;  2ISM A;  4GEZ A;  1V0Z A;  1CRU A;  4CPM A;  1WP5 A;  4QN5 A;  4IYG A;  4GZQ A;  4QN7 A;  1IUC A;  1EUU A;  3Q6T A;  5FNT A;  1IUB A;  3NO0 A;  4FPF A;  1NNA A;  4D52 A;  4XHX A;  1F8D A;  4D52 B;  4JML A;  1W8N A;  3HRP A;  1N7D A;  4GZT A;  4IFL X;  3DR2 A;  1RWI A;  2X9M A;  1MS0 A;  4QNP A;  3KGG A;  1V0F A;  3SAN A;  2HT7 A;  3O4P A;  4MWW A;  4L7B A;  4MJU A;  1V3C A;  4XMA A;  4B7Q A;  4YW5 A;  3E5Z A;  2F28 A;  4QN6 A;  2FPC A;  4AGT A;  1SNT A;  4SLI A;  4CPZ A;  1S18 A;  4FPJ A;  3GVL A;  1OFZ A;  1S0I A;  2W5N A;  4HZY A;  3A9G A;  3KYA A;  2XZK A;  2POO A;  3Q6K A;  4YZ4 A;  4YZ5 A;  3S8Z A;  7NN9 A;  1Z50 A;  4CPO A;  4M4N A;  3VNG A;  1A4G A;  1E8U A;  3DAS A;  1NMB N;  1IJQ A;  1B9V A;  4O5S A;  1SLL A;  4MWQ A;  2IAP A;  5GTQ A;  1EUR A;  4XIK A;  4GNB A;  2ZB6 A;  1NMC A;  4DG6 A;  2HTQ A;  2RKC A;  1V3E A;  4N1B A;  1POO A;  2QE8 A;  3ZGD A;  4HIZ A;  3TIC A;  2QWH A;  2B8H A;  2VWD A;  4GZP A;  5CGJ A;  3CL2 A;  4HZZ A;  1B9T A;  3H6J A;  4NC5 A;  3AMR A;  1V3D A;  2AH2 A;  3K3A A;  3CKZ A;  4BBW A;  1Z4W A;  2QWI A;  3FVZ A;  1H6L A;  5D9C A;  2JKB A;  3V1S A; 
#chains in the Genus database with same CATH homology
 3LI4 A;  2W8B A;  3WW9 A;  1C9U A;  5D9D A;  2W8B B;  1V04 A;  3SRE A;  5GX5 A;  3V64 C;  3S2K A;  2ISM A;  1CRU A;  4IYG A;  1C5K A;  1RWL A;  2P4O A;  3Q6T A;  4ZLR A;  2GVX A;  4GN8 A;  3FW0 A;  4O5T A;  2IAU A;  2IAR A;  1QBI A;  2GHS A;  2IAT A;  4JML A;  3S94 A;  2IAO A;  3HRP A;  1N7D A;  4Q1U A;  2IAW A;  3DR2 A;  1RWI A;  2V91 A;  4A0P A;  3KGG A;  1CQ1 A;  2IAQ A;  3O4P A;  1PJX A;  3S8V A;  1E1A A;  2IVZ A;  1QLG A;  2DG0 A;  2IAX A;  3E5Z A;  2GVU A;  5GX2 A;  4HHO A;  5GX1 A;  2FPC A;  3BYC A;  4GNA A;  3P5B L;  2DSO A;  3SOQ A;  4IMB A;  3HLH A;  3A9G A;  3KYA A;  3SOV A;  3SRG A;  2FP9 A;  2POO A;  5D9B A;  3Q6K A;  1NPE A;  3S8Z A;  2G8S A;  1Q7F A;  5GX4 A;  3DAS A;  4R40 A;  4HHQ A;  1IJQ A;  4O5S A;  1CRZ A;  3G4H A;  2IAP A;  5GTQ A;  5EX7 A;  2IAV A;  4GNB A;  3AMS A;  2OJH A;  4DG6 A;  2FP8 A;  2FPB A;  3G4E A;  3LI3 A;  4HW6 A;  3V65 B;  1POO A;  2QE8 A;  3WWA A;  3SOB B;  3I1C A;  2GVW A;  2HQS A;  5FWW A;  3A9H A;  1CVM A;  3HLI A;  3IAX A;  2IAS A;  4GN9 A;  4PWZ A;  3AMR A;  3TC9 A;  4GNC A;  2DG1 A;  3LI5 A;  2VAQ A;  3Q6P A;  5GX3 A;  4GN7 A;  3FVZ A;  3U0S A;  1H6L A;  5D9C A;  3V1S A;  2GVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...