2FPGA

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
305
structure length
305
Chain Sequence
b'SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 116
structure length 305
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fpgA01
1SOVA 3OJEA 3JQDA 3AUTA 3KLPX 4D45A 5DP2A 2AEFA 3ZHXA 5BT9A 3ZNPA 2AEMA 4QO8A 4CLRA 1TB4A 2NU7B 1YH3A 4NIMA 1BTOA 5BSHA 5TQVA 3WGGA 1YXMA 3P5SA 5K6AC 2I6TA 5JAMA 1W73A 1BW9A 4QTZA 3E18A 1LBEA 1ISJA 1R4MB 1LC3A 1ZNQO 2NSDA 4R54A 3QSGA 5I9LA 3L9WA 3KTDA 2TMDA 4J3FA 5TS3A 2FSSA 1WMBA 2FR8A 2HO5A 1KETA 3AI2A 3QP9A 4OXKA 5DULA 4TKMA 3VZQA 1R16A 4YAEA 4A03A 4WCFC 4BNNA 3LK7A 4ROSA 5F3RA 2WTBA 2OUIA 4Z0TA 5L95A 4M87A 3GVCA 3DBHB 4CM7A 5JAQA 1U3WA 4CUKA 3OBBA 1BVRA 1PX0A 1VL8A 3NEPX 4DA9A 4NBTA 5IZCC 2J5KA 3F3SA 1YRLA 4R16A 1ID1A 3E82A 4H15A 5JS6A 4RVFA 3I23A 2E49A 3D4OA 3Q1LA 4CMAA 3JQ6A 4NI5A 3TDKA 3G0OA 1HDZA 3KVOA 4LK3A 3ZU5A 1U1IA 4MVJH 2Z1NA 5IF3A 1CQIA 3HFGA 4HY3A 4IGEA 3IKVA 5JO0A 3D3WA 3GHYA 3WWYA 1LRJA 4DGSA 3INGA 4J1QA 4YAIA 2HJSA 5I8ZA 1LSJA 4OMUA 1VKOA 3ZH2A 5AXDA 1PZHA 3I9MA 2OBYA 3OQBA 4RVHA 2VHVA 2BRUA 3WYEA 4CL8A 4IIVA 1Y81A 3PJEA 4JJFA 4XR9A 4F6CA 5FI5A 3ZI0A 3TOZA 3GG9A 1GUZA 1N2SA 3NX4A 3PZRA 1HSZA 1OMOA 4JBGA 2W2KB 3KEQA 4R01A 4WCFB 4CJXA 1DEHA 5KJFA 3KYDB 4J9UE 3QVXA 2JAHA 1BSVA 3IP1A 2Y0CA 4GPD1 3L9XA 1LTHR 3K96A 3OJ0A 4R5HA 4QFCA 5KKAA 5A1TA 3F5SA 5IXSA 5JY1A 2PD4A 3ENKA 1P44A 3ADOA 2DQ4A 3IC5A 4B4WA 5JC8A 3WGOA 1OOEA 2NU8A 1ZCJA 2HCTA 3BMQA 4UUMA 4JX8A 3DZBA 3RC2A 1PGPA 1KERA 2ZB3A 3DQPA 4IQ0A 3JQ7B 3QY9A 1ISFA 4MP8A 4D44A 4CM6A 2OMEA 4WK6A 4EDFA 2DTEA 3JYPA 1UXIA 4J16A 4RF3A 4GKBA 1XKQA 5G0TA 1IL0A 4KMSA 3PGJA 5F5LA 1NYTA 2WJPA 1PGJA 1EBUA 2YFQA 1UXHA 2FWMX 2QW8A 3CH6A 2HMTA 3KBOA 4RVSA 4AJLA 4ZN6A 2J3JA 2VOEA 3QWHA 3LZ6A 3WS7A 1HL3A 1ZSVA 5DT9A 5GY7A 1I36A 4GH5A 4YJFB 5JFOA 2FHSA 1XYGA 1ONPA 4I5FA 2PD3A 3PHIA 3VPXA 3L6EA 4XA8A 3JD3A 1H0KA 5DCUA 1LLUA 3PLNA 4Y6RA 1W8DA 2OBNA 2AG5A 3NYWA 5COAA 2RCYA 4MVJI 3H9UA 3AY6A 4JIGA 2PZLA 3ICCA 4CMIB 2DU8A 4FN4A 3BHJA 4GGOA 4I08A 4AJ4A 4NBWA 2C82A 3WB9A 3CPSA 3FNHA 1XQ6A 2IXAA 5I7SA 3DEYX 1C0IA 3DBLA 3VPSA 5FFFA 2C2YA 3ONDA 4DLBA 3VOSA 4B4OA 4YRDA 4LMRA 5I8WA 1O8CA 2X0RA 3CMCO 4CM4B 3S2EA 1NVMB 1BDBA 4JP2A 1HF3A 2D5AA 1U9JA 4IIUA 4R9SA 3H2ZA 1LSUA 3PRJA 5L51A 2YHIB 4XZ3A 5CFZA 1OI7A 2DUWA 3DBVO 1DAPA 3HFSA 4Q3AA 1S6YA 2PZKA 3ASUA 1UP6A 2JAPA 3OQ1A 1Y5MA 2HK8A 3WLFA 4ZQFA 3GUYA 3PDUA 5A5EA 5JAZA 2XOXA 4B3IA 3PYMA 4C7KA 3IUSA 4I5EA 3DAFA 3GG2A 2VZ8A 2O3RA 4O5OA 2Q45A 2V6GA 4IQ8A 2H9IA 3AI3A 4GVXA 1AN9A 4PLYA 3UF0A 4FJ0A 2J5RA 1ENOA 1RJWA 1DRUA 5C7OO 1VE9A 1BDMA 3W1VA 1M76A 3MJ4A 4MKXA 1Z74A 4II3A 3RFVA 3CMMA 3Q2KA 3ZNNA 1PZEA 1NP3A 1V6AA 5JPIA 2OGUA 3RUIA 3S2IA 4DPLA 4DQUA 4RCVA 1FMCA 4J1TA 4W9NC 4LCEA 4A27A 4F6LA 1C1XA 5CDSA 4WASA 4CM5A 4UEJA 5EINA 4FB5A 5A9TA 3DZJA 3HADA 2X4GA 3EGOA 3GH3A 2O7SA 4JGBA 3PHHA 5ILOA 1SB8A 2P9CA 2X58A 3K8ZA 4BV8A 4OH1A 1ZO8A 2YDYA 1YJQA 3NT5A 4QUKA 2FPGA 4YCAA 1KS9A 3ZWXA 2OP0A 2P91A 3GRKA 3KV3O 2UUPA 1MG0A 4QEDA 2HK7A 4HWKA 4ALIA 3PJFA 4LVCA 5EERA 5HM8A 3INRA 1R66A 2GYYA 4BO6A 2RHRA 2WM3A 4ND1A 1H9BA 2A35A 4NFYA 1QYVA 1Q7BA 4L73A 3NJ8A 4M8SA 2D3TA 1B0AA 3RUHA 1HDCA 4J90A 5GZ1A 5U4QA 1R0SA 5B37A 3HUDA 3MEQA 4DXHA 5HS4A 1A71A 4MVJD 1WPQA 5A04A 4R1NA 1E92A 1GCUA 3HQ4O 1NBOA 1T24A 2P4HX 4RF4A 4E31A 3DOCA 2DBRA 3LC7O 4UVIA 4AJOA 1JWBB 3WGQA 5COQA 1XLTA 5A06A 4PCVA 5JMWA 4BO1A 4FOOA 4DUPA 2FPPA 1ZH8A 2P9EA 1KY5A 4I9UA 3PTZA 4OGWA 5CEJA 3LDHA 3LU1A 4AG3A 3FD8A 3JYNA 4RPJA 4J4TA 2RBEA 4GSKA 3ABIA 5ITWA 3DBRA 4IGFA 5HWSA 3KOUA 4R68A 5T8KC 4N54A 5CAEA 4UUOA 4CM1A 2WD7B 3U62A 3VZRA 1NFRA 3SBOA 1V3UA 4KUHA 1C0KA 5G4LA 4ZQEA 5JCXA 4FPXA 3F5QA 5TRTA 3R3SA 1ZUD1 4WEOA 5KVVA 1ADCA 1NASA 3G1TA 5IN4A 1HE4A 3GVIA 1K2WA 3O8QA 4LN1A 4B7CA 3TN7A 1HE2A 1YQDA 1I10A 3E6AA 3PWKA 1K6XA 1IULA 2VWPA 4NU6A 4BGIA 5L9AA 3NGLA 3DONA 3ZWAA 4XYBA 4BNMA 1N1GA 2D1YA 5ER9A 3BMNB 4FC7A 3K31A 4E32A 5ES3A 4FFPA 2VCYA 1QLJA 4RF5A 5IZCA 1DO8A 1XGKA 3VH3A 2FZEA 1D7OA 3EK2A 2CDAA 1O94A 3F46A 2NU9B 2J3IA 3N7UA 4YBZA 4K6CA 4PZDA 1Y9AA 3GVPA 4A7PA 5JY6A 2C2XA 5IXYA 3JQ7A 3PIDA 3OP4A 3E03A 3GK3A 4WLUA 4FFMA 3O03A 1GZ3A 3FTPA 1TXGA 1P1RA 3E9MA 4INAA 4ZVVA 3I9NA 2OO5A 1OC4A 4J7UA 3PJDA 2NACA 1XQ1A 2GO1A 4CQMD 4CLRB 3GLQA 3OFSA 2HRZA 4CM3A 4LRSB 3OIFA 1EUCA 3UHAA 5TT1A 2JHFA 4YT5A 4QXMA 3WG9A 4XB1A 1X7GA 4MP6A 4YAKA 1T2AA 1MFPA 1C0PA 3V2GA 3NDJA 1NPYA 2X0JA 3AM4A 3L4BC 4Y6PA 5TX7A 1E3EA 4CMGA 1I32A 2PKRA 4FDAA 3PZBA 3LC2O 2ILTA 4B7XA 2QRJA 1QR6A 2QX7A 4FBGA 5IDYA 1ZKMA 4YDRA 1DIBA 2JCVA 1BXGA 4FJ2A 4PLTA 4EUFA 3P2YA 3FPLA 2CF6A 1GEEA 2HLPA 3AUUA 1IE3A 3LT0A 3KM0A 5T57A 4J4BA 1KEWA 5IN5A 3EZYA 3TNLA 1U5CA 4G65A 1PZGA 1YJ8A 3ZV3A 2GERA 1HDXA 4B4VA 1JA9A 3OICA 1BHSA 1NHWA 1UP4A 4TVBA 5JCJA 1CQIB 1PQPA 2PY6A 2C5EA 1N7GA 3GOHA 4CM4A 3D3WB 2CSUA 3M2TA 5ENDA 5GZ6A 3GUCA 4ITUA 1GL3A 4PLVA 3UAGA 4XYEA 3GAZA 1ZVMA 2WDZA 1TT7A 2GF2A 4RDHA 3MTJA 2ET6A 4IINA 2VHZA 1SNYA 1QLHA 4PG4A 1U4OA 1E7YA 1LRKA 5L7TA 3D1LA 4IBOA 4RO0A 4EW6A 3QHAA 3U5TA 4LSMA 1YE3A 3HSKA 1YKFA 4K26A 1A7KA 2UV8A 4J0EA 2QRLA 4ND4A 4BNZA 4NFHA 1I01A 1Q7CA 3EHEA 3HN7A 3MTGA 2YW9A 3TZQA 4E3ZA 4OHUA 5TGDA 3CE6A 5C3MA 4IUYA 3ETGA 1LDMA 4RL6A 1JVBA 1AXGA 2NU8B 2Y99A 1LSOA 3BMQB 4EYEA 4LSWA 5A5FA 5CDGA 3TF5A 1DFGA 2NUAA 3WGHA 2BFPA 2VUTA 3ZHBA 3HDQA 1YDEA 4GLLA 1U3UA 3QV1A 3DZIA 4UREA 3EMKA 1ZK4A 4AJ1A 1EMDA 1N92A 1ISGA 1UP7A 1Z7EA 2JCXA 3RKRA 4H3VA 1LXCA 4G2NA 1LU9A 4GX5A 2O2YA 3ROMA 4IJVA 3RVDA 1VSVA 3AJRA 4OSPA 4RQTA 2I9PA 4XRGA 3VVCA 1ZEMA 1O0SA 1UXJA 2DTXA 1F12A 2Q99A 2Y67A 3U4HA 5B4UA 1GQYA 2JFFA 1Z75A 2TMGA 1ZZEA 3KUXA 3GPIA 1B3RA 4XGIA 3ZWCA 5KJ6A 1H2BA 4EJMA 2JD2A 3IQDB 2BFOA 3L0DA 3TWOA 2VYNA 4O59O 2PV7A 2PR2A 4UVEA 3ZWWA 3KSDO 1QRRA 1IHXA 2EWMA 4MIEA 2HUNA 1KVTA 5A4DA 2HJRA 5COBA 3PIIA 4FFNA 3VPFA 3WIDA 2P5YA 3OA0A 4TRRA 1NPDA 2Y1CA 3X2EA 1U4SA 1MUUA 4Z0PA 2BI7A 4CV0A 2BLLA 3NKLA 3F6YA 3AWDA 5CDYA 2C29D 3ZHYA 3AM5A 1PJ4A 4UULA 2AQKA 2DVMA 3EDMA 3LT1A 5FYDA 1I5RA 1GYQA 3DBLB 2PH5A 3PHLA 1HYGA 2NV6A 4W9NA 5BNTA 4TROA 4FGSA 3H9JA 3KYBA 2NQ8A 4I9HA 2FZWA 3UW3A 3A4VA 3L6OO 1UUFA 4HFRA 2E6UX 2GZ2A 4HFMA 4XQGA 3ETDA 2BH9A 3OJOA 2HMVA 2RH8A 4Y8VA 1CERA 4OKIA 1HZJA 2IXBA 4LISA 1T26A 1VKNA 5MDHA 3FR8A 4ZD6A 2D0IA 5KJCA 2FY8A 2I99A 4LRTB 3JQBA 4FOSA 4UUNA 1DC5A 1J4AA 5B1YA 1C0LA 4R51A 4Z6KA 3ANNA 1D3AA 2Q49A 2NADA 3GN2A 3LQFA 3N74A 1IUKA 4PG5A 1SO8A 1GYRA 3FWZA 7ADHA 1DFHA 1N8KA 3SLGA 1PJBA 1HETA 4RPKA 1G6KA 1R0KA 3IOYA 2ZJ1A 2YV1A 4GX0A 3GC6A 1AUPA 1O9BA 1PSDA 2LDBA 3GDFA 1P1KA 1UR5A 1BMDA 2P9GA 1LQUA 1YVEI 3Q0EA 3V5NA 3H5RA 1LA2A 4RVGA 3JQAA 1ZMTA 3GVHA 3OMLA 4J1NA 1UH5A 2C5AA 3BHIA 3H3JA 1ZBQA 4PIVA 4F45A 4PGFA 2GD1O 4EI2A 1TLTA 1E6EA 1C1XB 5I7EA 2ZTUA 2J6IA 3KEOA 1GDHA 3Q3CA 2H5LA 3MZ0A 3OJFA 3CINA 1EQUA 3D5QA 1C3VA 4DLLA 1MA0A 3PFFA 2CVOA 4P8RA 1ADGA 1ML3A 4JLWA 4ZRMA 1UAGA 3JD1A 2VOJA 4OM8A 4F46A 1U7TA 5ICMA 4IZHA 3K30A 5KVSA 1C1DA 4IDDA 1WLYA 3B1FA 3BA1A 5T8KA 2GNAA 1PS8A 1I8TA 4IS3A 4J7XA 3WLEA 2H6EA 2VZ9A 1WWKA 2X5OA 1Y6JA 4GLOA 4AFNA 3NUGA 4CR8A 3DZFA 3VZSA 3WTCA 5DP1A 2A92A 1CETA 4Q9NA 1J0XO 4A10A 1CRWG 1C14A 4UVDA 2O3QA 3AW9A 2ZTLA 1E7QA 3WR5A 1GUFA 1YGYA 7MDHA 5JC1A 4MJLA 4L75A 4M54A 4BQPA 2DC1A 4NMHA 2E37A 3WOHA 1DIGA 4D41A 1R4NB 5KTKA 5G2OA 4RQUA 1H6DA 1M6HA 4YXFA 1IY8A 1FDTA 1VM6A 3P7MA 5AXBA 4J7CA 1PIWA 2ZQZA 4CV3A 1TT5B 4RDIA 2JD1A 3BAZA 3OEYA 4RGBA 1H5QA 3TFQA 4OO3A 2LDXA 3KLMX 1HYEA 1J6UA 1DHRA 5T6BA 2FPPB 4BKOA 1IHYA 4Y9DA 4MDHA 1HLDA 1FXSA 1G1AA 3HZZA 1XU9A 2GCGA 1Q0HA 1DDOA 2ZYAA 4FCCA 1EVZA 3H5NA 1U5AA 3DBRB 4QQRA 1D1SA 2GASA 2NLOA 1JAYA 1JLLA 1ZFNA 5CAEB 5CP8A 4O1MA 1T25A 2EGHA 3INTA 4JJIA 3PPIA 4QX6A 2GRAA 1ISMA 4E5NA 4GWKA 2EP5A 4XIJA 4CMHA 1MP0A 4XJTA 4YVFA 5H82A 1WP4A 1LX6A 4HFNA 3V1YA 3HE3A 5K9ZA 2B83A 1H9AA 1GPJA 1A9ZA 2H1SA 2IRWA 4W7IA 3WQSB 3O8QB 4IDAA 2X5KO 4ZJUA 4BOYA 5JYDA 1T2EA 2W4QA 2F00A 4ALLA 1E1KA 4R1TA 4DREA 3L4BA 4MKRA 2SCUA 3WICA 1E7SA 2C0CA 1WZIA 4B8ZA 4WLFA 4FSHA 1F8GA 2W8ZA 1HDRA 2ZCUA 3DFUA 2Q3EA 3A1NA 1KYQA 3GF4A 3IUPA 2O7QA 4AJJA 5MGBA 1LEHA 4MIYA 4EJ6A 2BKAA 3C24A 2JKVA 3HN2A 1EK5A 3F4BA 5A3JA 4EUEA 1TA4A 1LNQA 2CDBA 4CQLA 2UYYA 4PZEA 3DWFA 4UVGA 4OOEA 1QV6A 4U0JA 1PGNA 3FSRA 1B8UA 5TF4A 2PZMA 4PLFA 3K92A 5L4LA 1PL8A 1Y8QA 3PQFA 4H7PA 3CTMA 3F1LA 4K6FA 2PK3A 4BMSA 9LDTA 1L7EA 1H94A 1XEAA 4CLHA 4ZGWA 5AXAA 4AVYA 4XWYA 4UAGA 5F21A 5TIIA 3HDJA 4PLZA 4ID9A 4CLDA 2FP4A 4ND5A 1W6UA 4M49A 5EL0A 4BKRA 4CLOB 3JYOA 3S2GA 4E2YA 4E5MA 3E9NA 1Q2XA 3OH8A 1GV1A 2I76A 2EKQA 4QO7A 3UN1A 2G82A 1EUCB 4GI2A 3VTFA 3BIOA 4L4RA 1HE3A 5DOVA 2HAEA 2NTJA 2QYSA 3I83A 2X23A 2C7VA 3K73O 1ISIA 4CUZA 1KC3A 2CD9A 3I9KA 2XXBA 3FNEA 1YL5A 4DIOA 4QSMA 2XXJA 2YY7A 4XX0B 4IMPA 5JDIA 3WFJA 1MX3A 3RJ9A 1E6UA 3GT0A 3SX2A 1NQAO 4WEQA 3VKUA 4ALMA 4BV9A 4R1SA 4O6VA 4DBZA 2Z95A 2ZATA 1YB4A 5JE8A 1I3NA 3S8MA 3DO5A 1MV8A 3H5AA 5A9RA 1BXGB 1NXQA 3ZWVA 1V8BA 1Z7BA 1GQQA 3HG7A 5C37A 5ER6A 2DPHA 3RFTA 3D3EA 3JQ8A 4I9NA 2GGSA 2EIHA 5KOIA 1LC0A 1GFSA 4EBFA 1IOLA 1P45A 2HQ1A 3DR3A 4NBVA 5DOZA 3RU7A 4DC0A 3MJCA 2P2SA 3AFNA 3PK0A 1GR0A 4DRYA 4M55A 4HNGA 3RJ5A 4OOFA 3SVTA 4NHEA 1NFQA 2J5QA 2OHXA 2Y1OA 5EJ2A 4QECA 5THQA 3WDSA 5ICSA 1HEUA 1R12A 4BHTA 4IXTA 3TFOA 1PJTA 4ZQHA 1M2WA 1VL0A 2Q4BA 3HDYA 2B5VA 2V6MA 1E5QA 3WWZA 1LJ8A 1XHLA 2GUGA 3PQDA 4R9RA 1O95A 1Q7GA 3W4JA 1KVSA 1WDMA 4DQVA 4PRKA 4YRBA 2WE7A 1I24A 2FRDA 4IJWA 2EKLA 3OA2A 3PYXA 3VVBA 3QRWA 3FNGA 4B3HA 2CVQA 2DM6A 3IDSA 2FSVA 4J1SA 4TRNA 1MFZA 2EV9A 1UDCA 1TEHA 2CUKA 1PJLA 4L4XA 4E21A 1X0VA 3JQAD 4ILKA 4ND2A 2G76A 1WZEA 4GAEA 1F14A 3CSDA 4E5PA 3MJVA 2E4AA 4ONEA 4D7AA 1P0CA 1NWHA 1HDOA 2NUAB 1A27A 3OETA 3LLVA 4OSOA 2DBZA 3T7EA 1GTMA 1T2CA 2C07A 3O9ZA 4XJSA 1YL7A 4B4UA 3PJGA 2B0JA 1Z82A 1KEVA 2PGDA 4BIIA 1PL6A 4DMMA 2O4CA 2YV3A 1A7AA 3WBFA 4IQGA 2G17A 3GDOA 4XB2A 3OM9A 2DT5A 1RM4A 4ZHSA 5CG2A 1UDBA 4PLHA 1Y5RA 3AOGA 1BRMA 2X86A 3QJ5A 1UDAA 3JQBC 5LC1A 1DRWA 1YDWA 2WD8A 3U4DA 4E33A 1K89A 4WLVA 2OOSA 1B3BA 3F9IA 2CZCA 2EG9A 5L53A 1QORA 1MXHA 2CMDA 2YUTA 2ZKLA 4U0KA 5AQ1A 3MOGA 4FFRA 1A9YA 4BNLA 3DB2A 3STHA 1E7WA 4JBIA 1B26A 2D8AA 1PJ2A 1YBMA 2IODA 3UKOA 2DBQA 3K2BA 1O6ZA 3WQRA 4BKQA 2IZ0A 3DZGA 3JQCA 5H83A 1NX6A 4D3DA 2X0NA 5IDXA 1QYDA 1R4NA 3ADPA 4WCDA 4WLOA 2ZTVA 4WLEA 4OJNA 4TMFA 3ZW9A 1TT5A 1VJ1A 4P4NA 4D0RA 3TZHA 4FJ1A 4XDYA 2EHDA 1JKJA 1CYDA 3RUCA 4BNFA 4J49A 2PTGA 3GGPA 1IPFA 3L6DA 3WIEA 2YJZA 4NH4A 3ST7A 4JK3A 4PG7A 2RH4A 4CM9A 4DTIA 3OHSX 1BXZA 5L3ZA 3NV9A 3DHEA 5L4SA 3KO8A 2JCYA 3A14A 2NVWA 4DLAA 4WNCA 3WXBA 2NWQA 1WXDA 2DFVA 4R5MA 3M6IA 4J2OA 1V0JA 2B5WA 4BNIA 1ARZA 3FBTA 2A9FA 4GQAA 1RWBA 3WTBA 1UZLA 1TVEA 3BYZA 1K6JA 3QVSA 1PJQA 3RUAA 3G49A 3IS3A 1JU9A 3I9LA 1U3VA 1QYWA 2B35A 4R1UA 4YQZA 3JQAB 3ZWNA 1UXKA 3DMYA 3BMOA 3C1TA 4CM8A 1ZW1A 3LSYA 2Y68A 5FWNA 1PJSA 3IJRA 1SC6A 4XDZA 1JQBA 5CPBA 4G5HA 2HRBA 4BB6A 1SOWA 4JNKA 1MXFA 3E1KA 3WSWA 4W7HA 1QMGA 1YOVB 1E3LA 3T4XA 4CR6A 1AE1A 1RYDA 3LT4A 4LMPA 2JJYA 4PLGA 4YYZA 1A4IA 2R6JA 4MVJF 1GPDG 3ANLA 4KDEA 1UAYA 2AA3A 1C1DB 2UVDA 3WNVA 2GR9A 3RFXA 2QIOA 3I4FA 3RASA 3V1UA 4P22A 1DIHA 4BO9A 2YYYA 3ZWOA 2QZ9A 1WMAA 3AUAA 1SEPA 3PVZA 3RUFA 1QXSA 5CEFA 1YB1A 5IDQA 4M89A 1W4ZA 3D0OA 4CLOA 2UAGA 4NJMA 3ORFA 3K6JA 2ZJ0A 4LVUA 3W4IA 3S2FA 4HX5A 5C7IO 1V3TA 2CVZA 1HDYA 3PHJA 3E8XA 3I4CA 1NQOA 3AY3A 3RQSA 1VSUA 4WOKA 4J91A 1PL7A 1LDYA 3R3JA 1BWSA 5KVCA 3QLJA 4II2A 1DIRA 1HXHA 4XX0A 2DLDA 1FDVA 1NVGA 3B20A 3AY7A 4AICA 1ADFA 1RM0A 1PQWA 1U8FO 2Q4EA 4YJHA 4DQXA 3OJLA 4I5GA 2Q1WA 4L4SA 3H7AA 4CLXA 3IMFA 1G0OA 5B12A 3NJ4A 4IDEA 3ENNA 3EZLA 2PGLA 2B69A 5DBFA 1ZXBA 4DPMA 4F3YA 1GD1O 2C20A 4EGFA 5F1KA 1NPTO 3PP8A 2EERA 3ZNOA 2J3HA 3WFIA 4W82A 4PFJA 4RPHA 5A9SA 1I3MA 1LDBA 2I65A 3AU8A 1SBYA 3EYWA 4CV2A 4XIYA 2JD0A 4K28A 2DPGA 6ADHA 3DXFA 5G4KA 3V2UA 1JLLB 1KVRA 3UXYA 2EKPA 1U3TA 4IY1A 2VYVA 4IPTA 3ZWPA 4BGEA 5A05A 3R0IA 1E3WA 3D64A 4XCVA 3EVNA 3ZW8A 5BQFA 1WNTA 3H9EO 1XELA 5HBRA 1T2FA 1WW8A 1XG5A 1PR3A 1WDLA 5F1PA 5KNLA 1ZJZA 4XRRA 1D4FA 5BR7A 4J43A 3DOJA 1X1EA 3C8MA 4NG5A 3ICPA 5A02A 3B6ZA 3C7CB 2EJWA 1T2DA 4XYGA 4E2ZA 3FBGA 3PHGA 3H9GA 3ROQA 1X13A 4YJGB 2SCUB 1ZMOA 5TNXA 2GZ1A 3ETEA 2NVUB 2WE8A 3KZVA 5JDIC 5A03A 3GFGA 1I3KA 3GN1A 5I7VA 2QZZA 3UICA 3MWEA 2YDXA 4WLNA 3ITDA 2X5JO 4RPGA 5G0WA 3W8EA 4BNTA 2VHYA 3F4LA 4JP3A 1R6DA 2C7GA 3GNSA 4GL4A 1ORRA 4CQLB 3UGKA 5ENVA 4PLWA 4Z9FA 1I0ZA 1UZNA 1JN0A 1UXGA 2O4UX 4IDGA 4K1LA 4E5YA 5DBGA 1Y8QB 1Q0QA 1DC6A 3I5MA 3MWDA 1EDZA 4RZHA 3NAQA 3Q9UA 4KWHA 4FIZA 4GGPA 4KTVE 4KZPA 4XEHA 1RM3A 2FP4B 4OQYA 3QVTA 5IFLA 5J23A 1PS0A 4CMKA 3OECA 4BMNA 5IZ4A 2G5CA 4TRJA 1P1FA 1E6WA 3IKTA 4M1QA 5ITVA 2EP7A 1DIAA 3BTVA 3SC6A 3U49A 4AJHA 2NQTA 4GKVA 1I3LA 3VC7A 2AQHA 3ITKA 3N58A 4MO2A 1UZMA 2AQIA 8LDHA 4FW8A 3IJPA 4O0LA 4WOJA 5BSGA 3ZU4A 3JQEA 2D2IA 1XA0A 3A06A 2YQ4A 3KHUA 1JKFA 1Y8RA 4IDCA 1JW9B 1P33A 2AHRA 2VZ0A 2QYTA 1XIVA 4A2CA 4Q3NA 3ZDFA 3G17A 4OAQA 3WMWA 1DLJA 3PWSA 4YPOA 2I66A 1E1NA 1QG6A 3GRPA 4NZ9A 4BVAA 1KVUA 2P4QA 2EJVA 3L4SO 1JTVA 1ZIDA 5TJHA 3AI1A 2X1HA 1H6AA 3JQ8B 1KEUA 3LLSA 4YAJA 1ADBA 2FOIA 1HT0A 1LUAA 2AQ8A 3GGGA 4E2WA 1F17A 4LW8A 2GN8A 2Q2QA 4AJNA 4J9VA 3UH1A 5DNAA 4D42A 1ENPA 4XGNA 1GAEO 3ZU3A 1B14A 3G79A 4B3JA 3MJTA 4A26A 5KWEA 1P3DA 3QW2A 3ZWBA 3FWNA 2RIRA 2Y1GA 3PEFA 2W98A 1E3JA 2V6BA 5F1OA 3T7CA 5BNIA 3KYCA 3VH2A 3C7AA 2WYUA 4DVJA 4Y6SA 3V8BA 2BGLA 4C7JA 3TJRA 3EY4A 3JYQA 5EESA 2Y66A 5EPOA 3UCEA 4ESOA 3UFXA 3GA0A 3QWAA 3UVEA 4Q3BA 4W4TA 4R3NA 3RBXA 3W6UA 5JBIA 4E13A 3ON5A 1VPDA 4B7UA 5LDHA 4U5QA 4IS2A 2VQ3A 1BGVA 5FEUA 3LVFO 1V9LA 4BNVA 5JXWA 4YJDA 1MC4A 2PFGA 4L74A 1HSOA 2BMAA 2DUUA 1WDKA 5TT0A 3RC9A 2GSDA 4KUGA 5EQDA 4E0BA 4FC6A 4RV9A 5KVQA 4YR9A 4CV1A 3RSHA 5JDCA 4DYVA 4XD2A 3H3FA 3P19A 4YT4A 2YZ7A 4UVHA 4EUHA 2O3UA 5L45A 2VTDA 4U6SA 4YB8A 2W2LA 3EW7A 3D7LA 1CQJA 1B16A 3GAFA 3CIFA 3MCVA 4B79A 4XGKA 4U6QA 1YOVA 4XQCA 1EZ4A 1XCBA 2D5CA 4BNGA 1GADO 2DAPA 2ZCVA 2X7HA 3JTMA 3KSZO 4FR5A 1JVSA 3H8VA 4FFLA 4PRLA 5U1PA 2GN4A 5I9MA 5T67A 1LQTA 5BSFA 2C54A 3KB6A 2DBVO 2VWHA 2PZJA 3GPDG 1T1SA 3WGIA 2YHUA 4JBHA 4MP3A 3NDRA 1X7HA 2FPIB 4L0QA 1A72A 1EE9A 3CXRA 4I8XA 4EEZA 4BNWA 3B1KA 4O63O 4XKJA 1ISHA 2VRBA 4H16A 3AOEA 4NK4A 1PQUA 1IPEA 5AVOA 4FGWA 3JQFA 1VJ0A 3DTYA 3ZHZA 4Q3DA 1P9LA 4BO3A 4CMJA 2EGGA 3DFZA 1X1TA 3WBBA 1LLQA 2JHGA 1DOHA 2ZIZA 3BTSA 4AJPA 3QIVA 4KUEA 1CDOA 2O3JA 3DZHA 2HMWA 3OF2A 3NTOA 3U0BA 4RPLA 3W8FA 2P5UA 4D79A 1JKJB 1ZSNA 3QVWA 1DXYA 3I6QA 4CODB 1M66A 3VAZA 2Y1FA 5K0ZA 4BUCA 1OFGA 1S7CA 2VT3A 3ZWYA 1LRLA 4OL9A 4TZKA 1Z45A 5JCJD 5TSDA 4CL3A 2VYVD 2XF8A 4LGVA 3JD0A 4D3SA 4ZA2A 3WYBA 3PGXA 4MVJA 5AXCA 4OQZA 1PEDA 3RAJA 1AXEA 3RBVA 1EUDA 1IYZA 4NDNE 3GDGA 3CEAA 3C7DB 4NK5A 3ZU2A 4BNXA 1N7HA 4DIFA 5C5IA 2POQX 3UOGA 4BNYA 3D4PA 1NFFA 2I3GA 4CMCA 4YRAA 4FS3A 3GR6A 1HE5A 2NNLD 5T5QA 3RUEA 1OBFO 3GNQA 4HUJA 1HLPA 3ZV4A 4BGVA 1E7RA 1EEHA 3GEMA 3DL2A 1EFKA 4XR4A 4PN3A 5L7WA 3GEDA 3SLKA 1JKIA 2PNFA 4YJGA 3WYCA 3TSCA 1R37A 2NVUA 3BMOB 3SJUA 3NT2A 4CM8B 3DHYA 3JSAA 4TKLA 4GX1A 4IM7A 4E6PA 2WEKA 3VZPA 2AE1A 1I30A 2V6FA 5ILGA 1CIVA 1DHTA 5IG2A 3ZZNA 1M67A 2IDZA 4NU5A 2HK9A 4B8WA 1N9GA 5G0SA 3OSUA 4EJ0A 3Q2IA 4JJGA 1I2BA 3GMSA 5JW6A 3I3OA 1U28A 3JQ9A 3QVOA 4NQZA 4PG8A 3IAHA 4HADA 3GVXA 4NPCA 1OAAA 1P31A 1I33A 3OIDA 5TLSA 5KJ1A 3SC4A 3P2OA 4AJEA 2DKNA 4DPKA 1EUZA 4YAGA 4YWJA 4RORA 3SEFA 2QHXA 3TL2A 4DBVO 4KDFA 1XWFA 3TZ6A 3V2HA 1PJCA 5IAAA 4NJMB 1DC4A 3DTTA 1GCOA 4QFDA 3C1AA 2IE0A 4ALJA 1P1HA 4UEKA 4KWIA 1DC3A 2D4AA 4EITA 4OXYA 1VJTA 2XPCA 1NTOA 1QKIA 1YONA 3WX0A 4BQRA 3NTRA 2UDPA 2VYND 5B4VA 3HB4X 4IXWA 5DF1A 2ZK7A 1YQGA 1HKUA 4TZTA 4NJOA 4A0SA 4YJHB 1KC1A 3RC7A 3IL2A 3A9WA 3JD2A 4TRMA 3D4NA 3K5PA 3ANMA 4RF2A 1UJMA 2JFHA 4CQMA 1XU7A 3HWRA 2B4RO 3NT4A 5A9SB 5EMHA 3OQ6A 5L7YA 4IJKA 2NU6B 1FJHA 1QP8A 3H9QA 2V7PA 1VRWA 5F5NA 2BD0A 3DAPA 1ZK0A 1CEQA 1MGOA 5G4KB 4Z0HO 2VWQA 2VRCA 1E1LA 1FK8A 4DWVA 3WSVA 2ZYGA 2B4QA 1FDSA 1E3WB 1SMKA 4HNHA 1E0DA 4IMRA 4N18A 3TPCA 4CUJA 3VH1A 4KP7A 3PWZA 4LCJA 3ZCXA 1FDUA 2GLXA 4E12A 1LDNA 4TQGA 2GDZA 2Y05A 3NGXA 4YQYA 2DTDA 3WJAA 4PVCA 5C7LO 5IDWA 2CY0A 4URFA 1DJNA 5JSFA 1RM5A 4CMBA 1F8FA 3VHRA 1HWYA 2X6TA 1AHHA 2EW2A 4U8GA 3UCXA 1EK6A 4BB5A 1CJCA 5G0VA 5DN9A 2A4KA 2ZTMA 1U2GA 4ND3A 1SB9A 3MWEB 1XDWA 4M86A 3JQGB 3LF2A 2EXXA 5JNLA 4TSKA 1DB3A 5TC4A 1P1JA 5JYEA 4AL4A 3H6KA 2ZYDA 4GSLA 1K0UA 2AE2A 3KSUA 4G81A 3WGZA 2O2SA 1SAYA 4TWRA 2Y0DA 3MWDB 2ZQYA 4HXYA 2ZB8A 3CZRA 3RROA 2PKQO 2W2LD 2WSBA 1KVQA 1BVUA 4WUVA 1EBFA 4RVDA 3IIEA 3GZNA 1H2HA 3TZCA 1M75A 2VHWA 2XAAA 3BMCA 1MC5A 1PWZA 1P74A 3RC1A 3RWBA 4GMGA 4PZCA 1K6IA 1I2ZA 2Y1EA 3C85A 3F1KA 3CZMA 4KOAA 1H93A 1LDEA 2BFAA 1ONOA 2X22A 1Y9EA 3WGYA 3ZWMA 4YTEA 3FRJA 4ZRNA 3VH4A 5I9NA 4YA6A 3I9JA 4Z9XA 1T4BA 5TJ9A 1IB6A 3RD5A 1O89A 4NBRA 3B70A 5FI3A 3C1OA 4L8VA 1E7MA 4AJ2A 5CPFA 2Q2WA 2X9GA 5IJZA 3K2EA 1R0LA 3W6ZA 2H63A 4BGUA 5CDTA 3Q6IA 1LLDA 2Q1UA 3VDRA 4J2HA 3VTZA 3WNQA 2CNBA 1FF9A 1GYPA 5AOVA 2QRKA 1Y8RB 4CMEA 5L40A 1HDGO 1AGNA 1VI2A 4IJUA 4XQEA 1U7HA 4I1IA 2FPIA 1G0NA 3ONEA 3ONFA 4R41A 1U2DA 1U8XX 4KQXA 4WECA 4HV4A 1P1IA 2PLAA 2R00C 3S55A 1PJ3A 3I1JA 1ZXLA 2AG8A 1H6CA 1NR7A 3FPCA 1EFLA 4A5OA 2PH3A 3U09A 4P4GA 2D59A 1X15A 4FD3A 4OKNA 5GMOA 5EQFA 5JDCC 4U7WA 4YEDA 3AU9A 2O23A 5HRUA 3RIHA 3NRCA 5JO9A 3PI7A 2NU7A 1I2CA 3GMDA 3DMTA 2EEZA 1T4DA 3QWBA 2GN6A 5CEEA 2BFMA 3LT2A 2RAFA 1BXKA 1EVJA 2BI8A 2NTVA 2VUSA 1QV7A 1J5PA 2ZB4A 1SEVA 4KTTE 1R4MA 4YT8A 2BGKA 1H6BA 3GFBA 3KYCB 1DBVO 1NQ5A 3DHNA 2OORA 3FNFA 3G3EA 2VUUA 3A28A 1ZK2A 4OYRA 4UEOA 2WMDA 3DC2A 1PZFA 3UFXB 2WYWA 3BHMA 4XYLA 1EDOA 3VPGA 1IZ9A 1YQXA 1E77A 4JROA 4MVJE 1XR3A 4Q3EA 3VPHA 3DBHA 1JWAB 3ZV6A 3B1JA 1SCUB 1D1TA 2B36A 5BNFA 1KY4A 2PA3A 1B8PA 3ULKA 3JV7A 3FF4A 1NM5A 4W6ZA 1V3VA 1DAOA 5DDIP 4D43A 4E2XA 2I67A 2CDCA 1NR1A 4N5LA 3COSA 5I7FA 2Q2VA 5B4TA 3AOEC 4BO8A 1OZAA 1NAIA 3HJAA 2HMUA 2Y93A 3RKUA 1RYEA 3JQFC 4J4HA 5ADHA 3JCZA 4C4OA 3WQQA 3EVTA 2NVBA 4E4YA 5KIAA 1NAHA 5JLAA 1LLCA 1GUYA 4EZBA 3PYLA 9LDBA 1E3IA 4GVLA 2OZPA 3M1AA 4Z3DA 4WPGA 1CQJB 1Q1NA 5KKCA 5K6AA 1Y1PA 4HKTA 1MB4A 2G1UA 1EVIA 1OC2A 4HP8A 1B15A 3JD4A 2RHCA 2W2KA 4WCFA 4K9DA 3KYDA 1T1RA 4FQ8A 4PLCA 4JN6B 1ZK1A 2PD6A 5DBIA 3ROKA 3DZKA 4DIBA 5GZ3A 3E48A 1NNUA 3FI9A 4R3WA 4BS9A 4L76A 3E9QA 3IP3A 3L07A 4BO4A 2FMUA 2VT2A 2BGMA 4GBJA 3SJ7A 2HSDA 1DRVA 3QQPA 4NFSA 2OFPA 2Q1SA 2EF1A 1F0YA 1EVYA 3PLRA 2VN8A 1LI4A 2FR0A 5HA5A 1B8VA 4YACA 3BTUA 1NVTA 1GQ2A 1XSEA 5EIOA 2J8ZA 3E5MA 1NWCA 1EQ2A 1K5HA 3AK4A 4NBUA 3U3XA 3U9LA 2QG4A 1CF2O 4NR0A 5DCWA 1D8AA 2E48A 3T4EA 2UUOA 3MJEA 2GPTA 2X9NA 3CUKA 5L4NA 1F06A 3PFWO 3GNTA 1NQTA 3WJ7A 1MLDA 2WWRA 5G0UA 3HDHA 1BW9B 3D5TA 3QA9A 4YJFA 1L1FA 2FR1A 3HB5X 1KEPA 4WE3A 3JQ9C 2Z5LA 2NU6A 1VL6A 2VRCD 2ZB7A 2VNSA 1V35A 3R6DA 4WKGA 4BO0A 4BNUA 2VHXA 8ADHA 1KIFA 1NHGA 1M6WA 4IDBA 1GY8A 4MINA 3SXPA 1N5DA 2OP1A 1EUDB 3FTNA 3I6IA 2BHLA 4I5DA 6LDHA 1DJQA 1PS9A 5LDGA 3O26A 3RBZA 5HS6A 3VKVA 1ENZA 2R2GA 4CMIA 2B37A 4R69A 4L9RA 2PWZA 3QWIA 5H81A 2HKIA 2X8LA 3I9OA 3WMXA 5BSEA 3F47A 2A94A 4BO2A 4CLEA 2Q50A 4D3FA 5DCYA 3DAGA 3W4KA 1W0CA 1HTBA 3R1IA 1JAXA 1K3TA 1GZ4A 3H4VA 2JL1A 2X0IA 3BZUA 1CWUA 1SPXA 3AM3A 3QWFA 4P4LA 1VC2A 3TQHA 4JQCA 3JQGA 2YHIA 4MVJG 3Q11A 1BG6A 4N5MA 1N9GB 1JDJA 3RI3A 2GN9A 1ZJYA 5LCXA 2AXQA 2GZ3A 2EW8A 2PGJA 3X2FA 2O3TA 4OXNA 4N7RA 2AEJA 4N5NA 3TL3A 1DLIA 5HTOA 1EE2A 4RJTA 2NM0A 3FHLA 4NNJA 1YBVA 5AYVA 2BF7A 2E82A 5A3VA 5JAIA 3PDJA 1QYXA 5JMPA 1KBZA 5KCZA 4E5KA 1WVGA 3JYLA 3LF1A 3KETA 3Q9NA 1GU7A 2FN7A 2B4TO 1LSSA 1PGOA 4MOWA 1HZZA 1FDWA 3PXXA 4Z3KA 4Q39A 4BKUA 2BELA 2DFDA 4KQWA 1YWGO 1HRDA 2Q1TA 2OL4A 5FF9A 1E3SA 4MKZA 5CHEA 4FFOA 3OEWA 2J3KA 1E5LA 2HU2A 5CDUA 1PR9A 2IYOA 4IDFA 4ZQBA 3I52A 1J49A 1LDGA 4Y67A 1ZSYA 1ZK3A 3FCOA 2NTNA 1YS4A 3M1LA 1GEGA 1R15A 3UCFA 2O3SA 3NDIA 3EC7A 4RLHA 4BMVA 3HHPA 5DZSA 4ZICA 4MPDA 4UUPA 4JXKA 4RLSA 4CQMB 2AW5A 1Q0LA 4HFJA 4MVJM 5THKA 3GEGA 3RCBA 4J0FA 4WNIA 4BKPA 2AMFA 4EEXA 2Y1DA 2WYVA 3O38A 4GWGA 4Q3CA 3EAGA 3QE3A 5EN4A 4ALKA 3WGTA 3U4IA 2Y0EA 1PTJA 2HDHA 2C59A 2YQ5A 4WJZA 1YL6A 2CFCA 2QQ5A 2VNAA 4AJKA 5U9CA 3BTOA 3EUWA 4BNKA 4S1VA 1Z6ZA 4QT0A 1Z73A 4JCOA 3TRIA 1B2LA 4XYMA 2W90A 3V1TC 4CM9D 2O48X 3CKYA 1A4UA 4WGGA 4Y98A 1A5ZA 1ENYA 2IZZA 4PLPA 1DPGA 3E5RA 4BL5A 1DSSG 4PG6A 4RVUA 2OXIA 3H65A 3K9QO 3RU9A 4D0SA 1B7GO 1MG5A 1GZ6A 3ROPA 1GV0A 2F1KA 2IYPA 1X14A 3TOXA 4BNJA 4R4JA 3ASVA 3G1UA 3DDNA 1TI7A 4RZIA 4TVOA 1SCUA 1X0XA 2IZ1A 2VWGA 2Z1MA 3M2PA 3U4CA 4CMEC 3S1LA 4DMLA 1ULSA 4X54A 4DYDA 1N1EA 1YO6A 3AFMA 2HMSA 3KRTA 1QSGA 1AHIA 4GMFA 2X9VA 4MVJP 1PU2A 5KJEA 2R00A 2P68A 1DFIA 4CR7A 3L77A 1Y7TA 4W99A 3UUWA 4YT2A 3KXDA 3GQVA 2G0TA 2Q46A 2WD7A 3VDQA 3OIGA 3ZN2A 4J6FA 3ZV5A 3RUDA 1YBAA 3GZNB 3GGOA 3BMCB 3O4RA 2I3AA 4A73A 4E30A 4PVDA 4ZQGA 3LYLA 1IZ0A 4P38A 2O50A 3DMTC 5T64A 4BO7A 4AJIA 4HBGA 1YB5A 1O5IA 4BNHA 3FR7A 1ULUA 3PQEA 1ONNA 3H2SA 3LC1O 1L7DA 3ZNQA 3C3XA 2V65A 3MJSA 4ALNA 1P77A 1RKXA 2YV2A 3GY0A 3NTQA 1PGQA 3FN4A 4S3MA 4DC1A 1HYHA 4D46A 4OIMA 3W8DA 4BO5A 1WAMA 4GX2A 4ZU3A 2I5PO 3BMNA 1E1MA 3TZKA 1KOLA 2YFHA 1SZJG 1ZEJA 3BXXA 1RPNA 3GHHA 3HNPA 2PKQP 1QYCA 4XQ9A 2IEBA 2IEDA 4CPDA 1X7DA 5CG1A 2NU9A 1P0FA 3DOOA 4IZIA 1VLLA 4DL9A 2VTEA 3AUSA 4MIOA 2FPGB 2CF5A 3GZ4A 3MOIA 2JFGA 1PWXA 4Z9YA 3ZGYA
chains in the Genus database with same CATH superfamily
3M6FA 4IICA 4Z7QB 2EBFX 3UAZA 2BKXA 2XUFA 3HKDB 3MWLA 3H5LA 3DD5A 4EYOA 3RYCB 2VDWB 5HUHA 2IEIA 2AEFA 5DP2A 4EKYA 2HQBA 2QU8A 3KKQA 4GQIA 5KU1A 3P9YA 2BGIA 2D62A 4QO8A 1YH3A 2NU7B 3LUCA 3ZGVA 2ECOA 3RAEC 1OB2A 4YCNA 4R1OA 3UOAB 3OMXA 4JXJA 3VI4B 3JYHA 5BSHA 1ZNXA 5JZMA 4PNHA 5F4BA 1T10A 2FXVA 1QCDA 1YXMA 2VQ6A 4HWTA 1FFSA 5HFAA 3TMKA 1ZJ5A 3I6YA 5KYUB 4F96A 3ICEA 1ISJA 1R4MB 1SVLA 1ZNQO 4UCWA 1VPTA 5I9LA 2FOLA 3WLHA 2PX6A 2YY6A 5HUJA 5TS3A 2HO5A 2WRZA 2FR8A 3HL0A 3AHFA 4PAQA 1NC1A 3QP9A 1FNCA 1WF6A 4TLEA 4BNNA 1K6MA 4I6JA 4KXVA 1GDDA 2FMFA 2GARA 3FSGA 4JL6A 2WTBA 4LJ5A 5JZVA 5KYGA 3Q72A 4JLKA 4M87A 3DBHB 3WLNA 5JAQA 1Y98A 1ZCFA 3OBBA 5BW4A 1QCYA 2R1ZA 1PX0A 2W4IA 2MINB 4NBTA 2C2HA 2J5KA 3I42A 3MAAC 1Z6XA 3HYNA 2JAOA 3LNCA 3CZ5A 1HDIA 4H4CA 4JODA 3VAAA 5KYKA 1V5WA 2YIMA 5FPHA 1YR7A 5C18A 2VF7A 3JAWA 1JJIA 4GOND 4I55B 3R9WA 3UANA 2HYDA 1QIHA 1YACA 3JQ6A 2XNHA 2QRZA 2C4TA 3T15A 2VSFA 4QA9A 4LBZA 4D9BA 2CB9A 4LK3A 4QOJA 4OQXA 3EARA 3ZCVA 5KOHA 3GYBA 4LY9A 2Z1NA 5IF3A 1YMQA 3HFGA 3I30X 3IKVA 2R65A 3D3WA 3SHOA 3IDZA 4OGLA 3RSSA 3EQ6A 3WWYA 1CVLA 2FWAA 2R7AA 2C9OA 3FJ1A 1KMMA 4ZT6A 1T0UA 1Z0IA 4ZAVA 1VKOA 1VJRA 4KOEC 3ZH2A 3VX3A 4POOA 1OAOC 3KJEA 3GFTA 5FTNA 7YASA 1PZHA 2OBYA 2ZZNA 1HORA 3FY4A 1PEAA 4XR9A 3NHPA 3O7MA 2AV6A 3FCYA 5FBRB 3FJOA 4BRSA 5K8LA 4OJKA 1Y4AE 3KOOA 4UHEA 3OZFA 4X64B 2VAVA 2GK6A 3SSAA 4GE0A 2PRZA 1NXSA 4JBGA 3KEQA 1DEHA 2XLCA 4M6WB 5KJFA 3KFVA 5LZ7A 7GPBA 3Q98A 2V5VA 2G6BA 5CW2A 3EH2A 1C4KA 5SYAA 5B6JA 5BNWA 3IP1A 1GXSA 1RMYA 1E18A 4DSOA 1J2JA 1VP9A 3L9XA 2RHJA 1Z4QA 3OJ0A 5KKAA 4QFCA 4YJKA 1N2IA 1SHKA 3O1JC 1JXMA 2NAPA 4QOFA 3ENKA 2V03A 1OLSB 2DQ4A 2OV6A 3M4ZA 5IPFA 3GFOA 1GGVA 4UUMA 2HCTA 1C8BA 2Z09A 5AW6A 4X0EA 1PGPA 1KERA 2H52A 3DQPA 3AP2A 3QY9A 4D44A 3K1TA 2BTOA 2GWHA 2PAAA 3BIJA 1ORDA 4CM6A 4LV8B 1YQQA 1XROA 3JYPA 4RF3A 4R7GA 5FTWA 1GG2A 2H1RA 3BH0A 2J0VA 3PGJA 2C84A 4MWEA 3OCUA 1K4YA 1P5FA 2IUYA 4PTLA 4HB2A 2JVIA 1EBUA 3GPLA 4UZSA 1DT3A 1UXHA 3CH6A 1PHPA 3UZUA 1YRWA 2Y76A 1DDGA 3OE7D 1DRJA 3OTIA 4EBBA 2YJTD 2Z3VA 4LPSA 1TYCA 3LZ6A 3MM4A 1RLUA 4X00A 5GY7A 1NKSA 4TTIA 1I36A 4GH5A 4UNNA 4G1UC 4OV6B 3WRVA 1ICEA 3PD7A 1C0EA 2Q7OE 2XGOA 1W5TA 3PRHA 3G6KA 2CXTA 1KEKA 5LU8A 3VPXA 2LCFA 3L6EA 3EIWA 2VPIA 3Q7EA 5GVSA 3TIGA 4DR1B 3PV0A 1QAQA 4C29A 1UPCA 4Q0MA 3V3KA 2PUBA 2DH6A 2OBNA 5F33A 4BQIA 2X0EA 4DNXA 2AG5A 2FMIA 3U4QA 1Q22A 2RCYA 4MVJI 1Q1EA 3GCWA 2XOKD 4R98A 4JIGA 4WKNA 1WSBA 2PZLA 2QTHA 2R68A 3G9QA 1J33A 3OEHA 2IHKA 3U17A 3WYFA 2OGZA 1FVHA 4MYDA 3MS2A 3DXZA 4HQLA 4RL4A 4BC1A 1BROA 4HDSA 4BWVA 3CPSA 4WOPA 2P3LA 3DEYX 3DBLA 2GAJA 5EVJA 2QGFA 2C2YA 3ONDA 3IURA 4YV7A 5DX8A 3SYTA 2I4OA 4B4OA 4YRDA 2AOVA 2REQB 5I8WA 2X0RA 3FIUA 3RLFA 5IVPA 3S2EA 1XVAA 3DULA 1XA4A 3SGLA 3S5UA 3W5DA 1HF3A 2D5AA 1U9JA 3IYLW 4X20A 1H2YA 3V46A 1VYUA 3DFIA 3H2ZA 4HPXB 4R9SA 1X94A 4UASA 2IP2A 3PRJA 2FUKA 5TEWA 1WXXA 1O08A 2RAUA 1T8UA 1OI7A 1W0JD 3CKKA 1L7OA 4UTNA 1YUMA 2XZOA 2PZKA 3BWCA 1KYWA 4YUWA 3ASUA 5BQXA 5HIAA 4UQOA 4OGKA 2VJDA 5JH7B 1LPSA 2BC9A 3H2GA 2ES4A 3OAAD 1AK1A 1IB0A 4DEVA 2XWPA 4FM9A 2L18A 2NZWA 3DKKA 2Q5JA 4L4UA 5FBKA 4JR0A 1AG9A 1BYIA 1JEYA 3PDUA 4FZ3A 1ECPA 4RD1A 1MIOA 1ZAYA 5DBHX 3QF4A 1ECBA 1OU4A 1E1RD 2ZUUA 3DAFA 3F49S 5AUPB 5KX5B 1X7YA 4V0ME 3T61A 2H9IA 5CK4A 4U1RA 1DP4A 1Z4KA 3PXBA 4ZEWA 1U9YA 2QPAA 3L06A 3PGA1 1GM5A 3LPMA 4O4HF 1RJWA 1DRUA 4WZBA 3EPHA 4MV6A 3L8HA 2K2WA 1BDMA 4JJ4A 1NMYA 3N5KA 2QJRA 4XUEA 2XVYA 5IHPA 4EZEA 3C97A 2JJ1A 3IXLA 1XTPA 3R75A 4MB6A 1DBWA 2CSXA 2LCQA 3RFFA 2HTFA 2IQ5A 1SUPA 1D1PA 1Z5UA 4G3XA 5LA6A 3SR0A 3CMMA 3EOAI 3LZCA 1TA9A 1NP3A 5BUCA 1C1HA 2NXNA 5JNRA 4WXMA 2RC5A 3S2IA 5HHTA 1ONSA 3L93A 4RSMA 4RETA 3TLJA 3M9WA 5HRAA 4W9NC 1A1VA 4LCEA 1A96A 2V7VA 1JSLA 2F3PA 1H2FA 2JGJA 1ONBA 2V54A 3KDAA 4G41A 4WASA 4D1YA 4Z51A 1Q17A 5EINA 3NCHA 1X9HA 2CLFB 3WYDA 4A0RA 5C32A 3AH8A 4EVQA 3OEEA 3VJMA 4B2PA 3EPKA 4RA9A 1QFMA 3FHTA 3DLHA 1V1JA 3IT2A 2X58A 2R97A 2X77A 3ASZA 4QJBA 3I1YA 4JYMA 4QUKA 1Q1ZA 4HB3A 4TLDA 1TZBA 4P9NA 2SHKA 2OP0A 3GRKA 3HTXA 1CRLA 1FP4B 2UUPA 1N4AA 3TMAA 2ZJ6A 1HT2E 1NONA 2MTBA 4HWKA 4K9OA 2WT4A 3FCUB 3PJFA 4JU8A 4ALIA 4BLQA 4RTLA 4HDCA 1BEUB 3INRA 4JVLA 1R66A 4D26A 3U3RA 1NI5A 2G7ZA 3K05A 1KGDA 5DGIA 1XDBA 4HF7A 5CLGA 2GK4A 4DA7A 2A35A 4NFYA 4FTWA 4FX2A 4ZT3A 1Q7BA 3ZIUA 4NDAA 3IPRA 1U0RA 1B0AA 4Q9AA 5JNWA 4BLVA 1FJXA 1ZM7A 4F9TA 5B3KA 3GT3A 3HUDA 2R6ZA 3MEQA 3SFVA 4QDTA 5TV2A 4JP5A 1T13A 2HNKA 3P52A 3U39A 4A8JB 1TZMA 2G9VA 1WPQA 1O03A 4R1NA 2R60A 5BT8A 2HBZA 1NBOA 1YSCA 2OFOA 2ZT8A 1UDRA 4H6XA 3ED5A 5HZHA 4DV1B 5DYYA 3LC7O 1QH8A 4UVIA 6CHYA 3RANA 4DV6B 5COQA 2RK4A 1DAMA 1L7BA 2GPAA 3C6ZA 3HUTA 2ZLBA 4QYMA 2QX4A 1U7DA 3ZHCA 4E22A 2AIRA 2I2DA 4PCVA 3RM3A 5AVWA 1F7UA 1DKUA 2O5RA 4LXUA 3ZE8A 5JMWA 2PUFA 3ISJA 5BWMA 4DUPA 3GELA 2FPPA 2J3QA 3LMKA 5AICA 4YXWA 3PTZA 5DMHA 3VAYA 3LDHA 3WKDA 1FLDA 3CR7A 1PG5A 4LTDA 2JKZA 2RBEA 3ABIA 4GSKA 2VLIA 1MMFB 2VK8A 1AIPA 1F6BA 1SVOA 4BAZA 3KHSA 3WYNA 5ERGB 4R68A 2OFFA 2DX7A 2YOFA 2R8XA 3KCQA 3R40A 5CAEA 1VXOA 3STVA 2WD7B 2OV1A 1XTKA 2WVJA 2P65A 5HIJA 4LPKA 2M6LA 2BGRA 3U62A 1NFRA 1A8PA 3SBOA 3ZJTA 3DGFC 2YWEA 3QG5A 4C88A 2DEUA 7REQA 1BHO1 1Q74A 2JVKA 3PUHA 2OYSA 3FLAA 2PYDA 3CKLA 1ZUD1 4HMPA 2FSGA 5KVVA 4NMWA 2R62A 3G1TA 3OZEA 2IHTA 3GVIA 2AOTA 1Y63A 2J6HA 3CH7A 4C0HA 5LR6A 1MENA 1HE2A 1RWWA 1F2TB 1SOAA 1IAQA 3GFFA 4MUXA 1X1CA 2QW0X 4F8EA 4RZ2A 3TX6A 4NU6A 2OVBA 1FMLA 4Q1CA 2GN1A 2E4VA 4I5IA 1RKQA 4LHZA 2A0KA 1B0PA 1E1DA 2C5LA 4OHFA 5FIUA 1KK1A 2Q3DA 1KI6B 3H17A 2VJNA 4Y7DA 4FC7A 2J6BA 3T34A 1AS3A 5ES3A 3JRWA 4QPDA 1T3GA 2QD1A 5KREA 4II7A 4F2PA 4FZRA 3RYFA 4Q3LA 4XM1A 1DO8A 2JRLA 2C2KA 3HH8A 2X1VA 3EK2A 3K16A 4EVSA 4EHFA 2CDAA 1KDVA 3F46A 5HQ3B 1FMJA 1UOQA 3FCXA 1WBDA 2QG9A 1RS0A 2WIDA 2ZRMA 3GVPA 5JY6A 2C2XA 2O14A 3A05A 1Q3KA 3N3BC 1JBQA 4RK5A 4HXEB 1T6NA 1T9GR 2V7EA 4KGVA 4DR3B 1TXGA 2JFXA 3E9MA 4ZVVA 4KNVA 2HSZA 4WA8A 2I80A 5ALZA 5FR2A 4BQEA 1EXDA 4RYLA 3CZQA 4FNAA 3CNEA 5HF6A 2ZVQX 4AWBA 3ACCA 5IK2D 2I34A 3GLQA 5A5DA 2Q27A 4F9GA 1WZCA 2AKAB 1Y3FE 4IHJF 3B6EA 4JB8A 4TVKA 3U9TA 1HC7A 2EZUA 3C14C 2ZBPA 4LRSB 5D86A 3SIXA 5CA0B 3HXMA 1U2TA 4N7MA 3X2SA 3IDAA 3LS2A 3ORYA 4KQHA 5F7JA 5K6TA 4LV6A 3WG9A 1GNQA 1KDRA 1X7GA 5SZHB 1EYZA 1C0PA 2FF7A 4KGXA 3QFRA 1MDBA 1VE7A 1FMFA 2G88A 4R3UC 1YD7A 3BE6A 1G6HA 1SG6A 2H8KA 3C16C 4C0QC 2VT7A 2OPHA 4GPIB 4OQLA 2Z3WA 4FDAA 3TXXA 4PQEA 5DLPA 5JQGB 3LC2O 1CRPA 4B3SB 2ILTA 3TNFA 1QR6A 2GEFA 2PGXA 2P9FA 2WOOA 4YDRA 4GI1A 4AYWA 2OZLB 1BXGA 1L4YA 4M1KA 1A8QA 4KODA 3FMVA 5CT6A 4KDCA 3GFSA 3IDQA 5CB4A 2CF6A 3PXEA 5BV1A 1GEEA 2DLNA 2HLPA 1IE3A 3AUUA 4B33A 1USGA 3KM0A 5T57A 2PKXA 1HI9A 2CJXA 2YWCA 3TNLA 2WF8A 2QE6A 3D3KA 3LRTA 4OX9B 1RXSA 1XEXB 1TNDA 3GI1A 1ZUIA 1YJ8A 4KN9S 1H1LB 5ECWA 1Q1AA 5F35A 2VSXA 4B4VA 1AK9A 1JA9A 1BHSA 1NHWA 1XJWA 1XZ8A 1MTOA 1ZD1A 2CXPA 4J16C 4TVBA 3UHPA 3IE1A 1BVYF 4NMLA 3VYWA 3CB4A 1KK2A 5GZ6A 4H08A 1GL3A 3FVWA 4GYKA 4KV7A 4PLVA 4XYEA 1ZVQA 5LYJF 1W88A 2R4UA 5ALSA 4B44A 1QNFA 3L2OB 1TT7A 3MTJA 4FFWA 4IINA 4PG4A 2Q3HA 1U4OA 2GJ4A 4IVQA 4M8NE 1LRKA 4UAVA 3C8ZA 4IBOA 2NG1A 4TWBA 4EB6A 4YRMA 5DRTA 3TD9A 1IBKB 3SDSA 2JDIA 4B83A 2GI4A 4B6OA 1UBRS 2QLJA 4NYMR 4FYHA 3F71A 2DF8A 3A1FA 1YKFA 3HSKA 4K26A 4UBOA 3TQCA 3NATA 3NVAA 3R0JA 4P3YA 3R7BA 4I19A 3W5BA 5IC4A 4EAQA 3JZFA 4NDZA 2Q0SA 1Q7CA 2F62A 2Q0HA 2YW9A 3TBFA 3K70B 2H16A 4OHUA 4P5DA 4RMHA 1UT6A 1YV9A 5C3MA 3TG2A 2X14A 3AVVA 1DBQA 4RL6A 3WI7A 2C7QA 4CKZA 3ODPA 3NFRA 4AWAA 2BGGA 2NU8B 1H5UA 2XD9A 4EYEA 1QOZA 3UK0A 4B46A 5A5FA 3PDHA 3O7WA 3TF5A 2TSYB 3P4XA 1WXHA 3WGHA 2VUTA 4D56A 4EKNB 5CM8B 4TX1A 2GXQA 4XIIA 4KRGA 4ZJZA 2GO7A 1XCGB 2JEZA 1ZVJA 5C0OE 3D6NB 4QJIA 1EMDA 2JZOA 1ISGA 1UP7A 2ORIA 5EWLB 4DCCA 4PSKA 2H31A 2R1VB 3AUFA 3L0OA 4N76A 1H22A 4H3VA 2P2ZA 4KSYA 2Q3JA 4FEYA 1KP9A 4MJ7A 2NYUA 2NUTB 1N2CA 1VSVA 3C5HA 1STOA 4TYPA 2A33A 2A14A 5CFPA 3ZX5A 1W87A 1T6YA 2BDEA 4YRQA 4EA8A 4XRGA 3D8HA 4C14A 4L15A 2A2ZA 2E5WA 1UXJA 3HUFA 1C3JA 4GM0A 1F12A 3DAYA 3ITEA 4F4HA 5KB3A 3PFGA 1V2HE 1WXFA 3DHWC 3KE9A 4S1WA 1UKZA 2SECE 3MGBA 3H2HA 1KOFA 2RFLA 1GQOA 3EIEA 4P53A 3TE7A 5JISA 3CX8A 1CZNA 2BOVA 1HY3A 5IYZB 2GCEA 3IEXA 4YJ2B 1F2UA 4TL6A 3AKZA 1C9EA 1KI9A 4NYJR 5A4DA 2HJRA 2CV2A 4FKZA 5COBA 5AJZA 2JC3A 4IG9A 5BWOA 4B81A 2N3ZA 1N6HA 4FFNA 4G36A 3OA0A 4I1YA 4TRRA 4WN9A 3VPFA 3DR5A 1M1YA 2Y1CA 3G2HA 3PNOA 3ZJVA 1U4SA 4OHXA 1X39A 5KTMA 1LJLA 1E1CA 1XZLA 1ORHA 3NKLA 3AWDA 2C29D 4QWMA 3SE0A 4R9VA 1XMVA 1NOJA 5FPKA 3KAQA 1AKEA 4UULA 1CUSA 2P7IA 4ZARA 2HF9A 3TNDA 3PHLA 1IRIA 3BKXA 4W9NA 3M4YA 5BNTA 5LWQA 3ECCA 2GOYA 3H9JA 3KYBA 2NQ8A 3DLAA 3LVBA 3UW3A 2ICAA 2IIPA 3BXZA 1EB8A 1EWTA 2UZIR 3NJRA 1IN4A 1J7KA 3EVCA 4HFRA 5TQ0B 1TYBE 1G19A 1SCQA 1ZZGA 2I4MA 4XQGA 2P5SA 2BUCA 3N70A 1APBA 3C3BA 5H8WA 3LY8A 3L43A 1DO0A 2GAOA 2Q8PA 3KOYA 1TM2A 1CERA 3TW6A 3BE4A 2YQZA 3IPLA 4G01B 4NENA 3AEUA 5J59A 4F21A 2IXBA 1G9TA 1RHKA 1Y80A 4F1KA 3QJYA 1TCBA 5MDHA 3FR8A 4ZD6A 2GCOA 3GUZA 1YU9A 5ICCA 4LRTB 4UUNA 1J4AA 5B1YA 1II9A 3QBEA 4G0MA 3UB3A 5JJ5A 4S35A 1C2TA 3N74A 4H7KA 1BYUA 2B4AA 2WU1A 3D0QA 2F1OA 5BYBA 3STXA 3RFCA 1F4VA 2CBXA 1F2VA 1N8KA 3MXOA 3OZWA 1D2HA 3SLGA 5LP6F 2IDKA 3IGFA 2JA2A 2ZI6A 3R7FA 1YA4A 5BSUA 3W5UA 2QAGB 1UMCA 1PJBA 4RPKA 5BV0A 1WE2A 1OBOA 1OQAA 3ZKWB 3OLQA 3TLKA 4CG1A 2YV1A 1YC5A 4PIPA 1K4MA 1XZKA 5FBLB 1AUPA 1PSDA 3WMEA 2H5EA 3T3EA 5GONF 1BMDA 4L51A 3VKFA 3M4JA 4D57A 3PNSA 3EIFA 2NZVG 1TZCA 2ZU0C 1NVVR 1Y3HA 4NHOA 1BA2A 3SFZA 2XWQA 1G20E 3JQAA 1ZMTA 3CRMA 3GVHA 1CJBA 2QVGA 3QE2A 4ZWNA 4LKRA 3Q8KA 3UG6A 3FUWA 2AT1A 1ZBQA 3LUHA 3M9XA 4D9CA 1DQNA 2VP5A 3F3YA 4JLSA 3FYCA 2F59A 2H11A 4LKOA 4M9QA 1T4CB 3W7BA 4G4SP 2GN0A 4LUCA 5AVQA 1LS6A 3X1DA 5EP1A 3E9EA 3MZ0A 1QHIA 4MULA 2ZSBA 3OJFA 1VLZA 5HKOA 5EKUA 1ZHHA 2W2OA 1GNRA 3BFPA 2HHJA 2HK6A 3PFFA 4P8RA 5JATA 3NU1A 1ADGA 1UBLS 1LNSA 1LBIA 1G3MA 2PS9A 4GOXA 4PC7A 1GZDA 1I5OA 2DFLA 4LTNA 5AHWA 4ZRMA 4DAEA 1UAGA 3DTVA 5JYBA 4RIGA 5ICMA 2CMHA 1XZJA 1P7WA 3K30A 2QTVA 3BRSA 1ZOOA 4CEIB 2BEUB 2ZUFA 4ERNA 4G89A 1M5RA 1V5IA 4D9NA 5B7QA 5HYVA 4YLEA 1AURA 4ENVA 3WLEA 4IS3A 1Z62A 4IUCS 2FE4A 4FYWA 1CR2A 4CIWA 3W04A 3UA3A 1GLGA 3NUGA 3ZDBA 1LX7A 2XJ9A 3RIEA 3RTAA 1XNQB 4NZMA 3RR2A 1TJPB 1CRWG 1C14A 1XF9A 3AW9A 1U94A 4N65A 2ZTLA 3TLYA 3PUIA 2OAQ1 4LDAA 4TKZA 2C7PA 1ZVVA 4DCGA 3IHWA 3WR5A 7MDHA 3H1BA 2VA8A 3THOA 5HFNA 1UWKA 1CR6A 3THRA 2XB4A 3OU6A 4M54A 2R8YA 2XJ4A 3S1SA 4ABTA 2ZRHA 3BM5A 4KLZA 4TKUB 5G2OA 3TRFA 1Y3CE 3OURA 3I05A 4RQUA 4EP1A 2NO0A 2C8VA 1G7CA 2QG6A 4J7CA 3Q3IA 5AH0A 3RRNA 2CXUA 4CV3A 1TT5B 2OHIA 2XB6A 5DI3B 3HVJA 3ANXA 1MOPA 1NXTA 3BAZA 3OEYA 4RGBA 3TFQA 2P2DA 3EIUA 4OO3A 3ZWDA 1HYEA 1ZWLA 3CUTA 1MPTA 4EHIA 1DHRA 4HLQB 5T6BA 4O4JA 3MRXA 1H2AS 2XUKA 4J0GA 3A3OA 4AMZA 1T3ZA 2H1CA 3RNOA 1J1IA 1I4EB 2HSEA 4HHEA 3RS7A 1DDOA 3AL2A 1EFUA 4CFYA 1WU8A 1EVZA 3MIZA 5C8XA 2CNWD 3W06A 2G80A 1J7JA 2GASA 4W9RA 1NDQA 1SKMA 5KNCA 1GPBA 3M33A 2IU0A 5GJVC 1HOTA 3QKRA 4NOMA 4QX6A 3EDYA 3PPIA 2J1LA 2BFEA 4DZTA 4CMHA 2ZJ7A 3BG5A 1WP4A 1LX6A 3Q4GA 4EYSA 1D6SA 4OFBA 4RAQA 1G8YA 1XXHA 3V1YA 5K9ZA 3GU3A 4OQQA 3QKTA 1H9AA 4DZZA 4TV9F 1Z88A 3L79A 1A9ZA 3ZXYA 2JDID 2F67A 3PDWA 2IPAB 2JLRA 4GZMA 3P9SA 4I4IA 3BERA 1E8NA 4KGDA 2MU1A 4FLEA 3WQSB 2LKDA 4BP1A 4BOYA 4YRNA 3H2BA 4DIMA 5JYDA 3GLGE 2W4QA 4UU7A 2OBBA 4ZIRB 3M49A 1G20B 1DG1G 1VHWA 4MKRA 4RH3A 2JCSA 2SCUA 3ZK8A 5FTKA 3OLVA 1DAEA 2C0CA 4PQRA 1P62B 3REGA 3VR5H 2ZCUA 1ZMXA 1KJJA 2CMGA 3DFUA 5EJ8A 3A1NA 1H3FA 4NAHA 3LGXA 4O33A 2O7QA 4CTMA 5JSZA 2EJBA 2WD9A 4RW0A 2BKAA 2VA9A 4QXRA 3KOMA 4RTMA 2X2OA 4MH0R 3E0XA 1RJGA 2H00A 5TMPA 1LNQA 4PYMA 4PZEA 4UVGA 3HCOA 1QV6A 4OOEA 1PGNA 3NALA 4U0JA 4RJKA 1B8UA 2FKNA 1JNXX 4B3FX 2Q7XA 4ODIA 5J4LA 1WB5A 1ZGAA 3MIIA 3U7EB 4NEGA 1LPMA 1VLMA 3FGOA 4ND6A 4XD7A 2XMRA 3TQQA 3A04A 3T1QA 4YCMA 1CY7A 1H94A 4AN1A 4AVYA 1WDWB 1ZMBA 2IYQA 1J39A 4A0QA 5TIIA 3HDJA 1M7BA 4JVOA 2FP4A 4ND5A 4OHMA 2W8BA 5E2BA 2QP9X 4M49A 5EUMA 3HGTA 3IRVA 3RADC 3VKWA 1IY2A 3S2GA 9MHTA 3O6VA 1J09A 1L4HA 4JQSA 2I76A 1CNMA 2BKVA 4QO7A 5CB0A 3EMDA 2YWFA 2J32A 2OM2A 1HE3A 2XX3A 3L1JA 4L0MA 4L4RA 2NTJA 4CTJA 5IJ9A 2XEXA 1L3IA 1E5XA 1C9KA 2X23A 3C74A 4IIEA 2COKA 4HWGA 4MQBA 2FQWA 1ISIA 5TQ2A 3QSYA 4DE5A 5FR1A 2CD9A 2QTZA 1Q7TA 3MWYW 3OZRA 2BTQA 5CBPB 3OHMA 4QSMA 1G17A 2QN8A 3HRKA 4IMPA 4QQFA 1Q84A 4TGLA 4JI8B 4RSHA 1X7WA 2YOHA 5FLEX 3ZY4A 2ODQA 5BW5A 3P27A 3ZW7A 2XLBA 1PVDA 4DBZA 1G2QA 2ZATA 4C4ZA 3MD9A 1NVAA 5JE8A 1KHTA 5DM2A 5L3VA 4FOTA 3DO5A 5A9RA 1R0BA 2YR0A 4JJZA 3UWPA 2MSLA 4G5XA 3O91A 4IMJB 5EE1A 2FQXA 5T3UA 1GGFA 1GQQA 2B1QA 2DPHA 3KDPA 4QUJA 4EF6A 1CQZA 5LLDA 2A58A 1QIIA 5BV8A 4YDQA 4XIGS 2JIBA 3JQ8A 4GPZA 4I9NA 1U6KA 1XZDA 1LC0A 2F1RA 5KSZA 4NBVA 5DOZA 2VCHA 2WIGA 4DC0A 1NXVA 3P9PA 5EQJB 5HF9A 4J75A 3AFNA 1E4EA 3L8EA 4XUDA 10MHA 4DLYA 3PK0A 4EG1A 4H1UA 2IEAA 3KJNA 3RJ5A 1NFQA 2ZSHA 3HUUA 3KKKA 4Y2RA 1T1JA 2O5EA 1JNYA 3N3AC 4DYHA 5FLYA 4AURA 4DV2B 4R7TA 5K0GA 1R0ZA 4BHTA 4BNHA 1PJTA 4ZVLA 5JS7A 1VL0A 2EOAA 3GLGB 5AHOA 3PDCA 1BXRB 2V6MA 3ETLA 4WQMA 3DLTA 3LVQE 2GUGA 4IHQA 3TIVA 5BV7A 1W46A 1Q7GA 4NP6A 1VKJA 1TYEB 5T4FA 3ABSB 2XMCA 4QYXA 4V24A 3N0RA 3IBYA 4PRKA 1QAMA 2WE7A 2QUAA 4Q93A 3H2KA 1N5JA 4NYMQ 2EKLA 3K6RA 3OA2A 3PYXA 3VVBA 2CKDA 1AKYA 4V1CB 3WLOA 1NQVA 2IF2A 2PTHA 4B3HA 2CVQA 4YH1A 3TK1A 4J1SA 4YONB 5KOJB 1HH4A 5K0TA 2EV9A 1GZSA 1DELA 1PJLA 3PFHA 3UW1A 1P3JA 1Y8ZA 1Q5PA 1X0VA 3JQAD 3WL4A 4JKOA 4ILKA 3NWPA 5IC6A 3M6XA 3ZCTA 1VGVA 3K9LA 4KX5A 4L8FA 1VSBA 5F77A 4GAEA 4CKWA 2Q5CA 1PK7A 1E4VA 3CSDA 2ZUDA 1PNVA 4YMIA 3X44A 1CUJA 3GQBA 1L5YA 4NCKA 1ISPA 4D6XA 1P0CA 4HZGA 1MGPA 2JARA 2OXEA 1HG0A 1TD9A 4L57A 1A27A 3DMNA 4Q1FA 4ZAGA 4OSOA 1GTMA 1PNQA 4DDTA 2WFMA 1AQJA 3A4YA 4TOIA 3E4CA 4XJSA 1QZXA 2V4MA 3PXCX 5AKIA 4FE7A 2OC4A 5DIZA 1KEVA 2ID4A 3FRIA 2XCTB 4OLHA 1GZHB 1PL6A 4DMMA 2O4CA 5CLQA 3SU8A 3HU1A 3WRYC 3DTVD 3GDOA 4XB2A 5JAOA 2H2FA 3MBOA 4YMSA 1FDIA 1II0A 5ALYA 2R25B 4QKQA 3WL8A 5CDHA 4RCYA 4IWNA 4YUXA 2PLWA 1BRMA 1L7RA 2AI3A 2X86A 4MQMA 5C8YA 2EZ4A 2X6QA 1XZPA 3M6WA 3SZRA 3BD9A 3WISA 3BK7A 2PLRA 2ZIAA 4E33A 3AB7A 2OOSA 2JGDB 3B5JA 1B3BA 3F9IA 1TIKA 1CQPA 2JI4A 2C77A 3D6UA 2NSYA 1P9RA 3COYA 4ARVA 2WSMA 1UBNA 1SC1A 2HZBA 2NUPA 3PCXA 1QORA 5FUYA 3E3NA 3GUVA 4AIRA 1EUYA 4BQQA 2J0SA 2ZWMA 3STHA 1E7WA 3EGVA 4ZTBA 5A7GA 3NHAA 1MEJA 1SK8A 2ZROA 4HRXA 2XCRB 2IODA 2DBQA 4E09A 4MGZR 5ALRA 4NYJQ 4O4HB 2QN6A 1J90A 1Q11A 4R2HA 1Z2OX 1MJNA 2H2WA 2H5JA 3IOCA 4LXIA 4JUDX 5K0NA 3U9SA 5EIHA 2X40A 3EFEA 4D3DA 2PRJA 1K7EB 2W48A 4LDNA 3SHFA 5IDXA 2C3PA 1QYDA 1R4NA 3ADPA 4BJ5A 1IK4A 3V9PA 3AX6A 4M1OA 5JR3A 2ZTVA 4HDRA 3UT0A 3CX3A 4OJNA 3ZQ4A 1R6VA 3N2NA 1TL7C 4TMFA 5JI2E 1QIMA 2H7VA 3F6PA 3G2PA 3SN6A 4P4NA 4D0RA 3HM2A 4EUSA 1ACLA 4URXR 4KHPB 4KK3A 5BR8B 3PKJA 3WL7A 4E5DA 3KTAA 3CUEF 4D82A 1QVWA 3HP7A 1JEQA 5FHQA 4BNFA 3E22A 1EWRA 1KQ3A 2CXQA 2XADA 3GGPA 1IPFA 2Q3LA 1OWOA 3L6DA 1AGRA 1D9ZA 3AEQB 3ZDEA 1WV1A 4U7GA 1BCSA 1YC2A 1I1OA 3BXOA 4JK3A 1NW9B 2VPYA 4G0ZA 4JLAA 4TWAA 3ZE0B 2GESA 2QR5A 1PYGA 2JK0A 4CM9A 5KNCD 1U9ZA 4ZTUB 2ZUBA 3DHEA 5HMLA 5L4SA 2FI1A 3B1WA 4LECA 4B3MB 3IMKA 1G64A 4IJMA 2JGFA 4DLAA 1J0AA 4DLXA 2D13A 4Z0NA 3PR1A 1HLGA 3AHEA 4BYMA 1EDEA 4BATA 1YI0A 2ZTSA 3S68A 1V0JA 2FPWA 2PFSA 4BNIA 5D00A 3C4QA 2XE8A 1DKQA 3RAGA 3L7YA 2R85A 1UZLA 3QPVA 1TVEA 2XB9A 1K6JA 3QVSA 1QU2A 3MELA 1M7HA 1I7SB 3B2EA 2IOFA 4I66A 3OQMA 1ZX1A 3QFSA 4MRMA 2VRNA 3I9FA 3LKVA 4JQOA 2K4MA 4BFTA 2PO5A 4TYYA 1O97C 3CVUA 1DV2A 1ZD8A 5CXUA 5JSUA 2O2CA 2IUUA 4WESB 1E89A 4I9GA 5AOAA 4RKQA 2PIDA 3TLBA 4GF5A 1TM3E 4KQ1A 1FRVA 4LNHA 4PNEA 1NVVQ 1I1QB 1DG9A 2WSIA 3BMOA 3SCZA 1RQPA 4M1MA 3LSYA 4P4SB 1CY8A 1SC6A 2BV3A 3N5CA 5CMLA 3RIMA 4GC5A 4NOKA 5IMBA 4JCOA 4BB6A 1SOWA 1IOVA 4K8OA 4MVXA 4RZQA 2Q4OA 2GK3A 1LZKA 1MXFA 2R6HA 5D3KA 2VIIA 1US8B 3E1KA 3WSWA 1H69A 3WA6A 2J9RA 4CR6A 1AE1A 3TI7A 4N4AA 1XVLA 1BEZA 2IPOA 1GPDG 3G2IA 1GVNB 3RPEA 2RHHA 4Z1MA 4LJ4A 2X19A 4LZPA 1HOXA 2GR9A 3RFXA 2X1MA 3IEUA 4M0PA 4P22A 1DIHA 4K9KA 1FYXA 3T99A 4DMHA 1SEPA 2GN2A 5CH8A 3UHOA 3OQVA 1SBQA 2H1VA 1EX6A 5CEFA 1USKA 1YB1A 2X8AA 3AQIA 5TY0A 3M3PA 3LCMA 5FJIA 2H4YA 3K0EA 1P2SA 4R1LA 1MO2A 3ORFA 1HUQA 3W4IA 3ZHRA 4QOGA 2HXYA 4HX5A 1L8LA 3IO3A 5C7IO 4ZEOA 2EFDB 1V11A 3E8XA 1SUBA 4PF1A 4EPWA 4KRFA 4RD3A 3WNBA 1FU4A 5LN1A 1VSUA 4J91A 4M0KA 1IUOA 1OJLA 1DDIA 3AR2A 1N78A 5KVCA 3EEOA 2Y3IA 1GLNA 1NG1A 3QLJA 4G0NA 1DIRA 4GNKA 2HPHA 5D01A 2J5XA 1FEZA 2ZSEA 5D6NA 4C03A 3MGKA 1HFEL 3ELDA 4YP0A 4D9GA 3TAUA 3B20A 1BX3A 1SHTX 1XN1A 4AICA 4UNPA 1PNTA 4FFBB 1U8FO 2Q4EA 4KFRA 4M9ZA 4DQXA 3OJLA 4L4SA 1G0OA 4IDEA 3EZLA 1WCIA 4E14A 2B69A 5ELLA 3LQ1A 1JJFA 2HT6A 4R1QA 1PYOA 3K72B 5DBFA 1GD1O 5H1YA 4EGFA 4F3YA 1NPTO 4H1VA 2VFAA 3WFIA 4F4IA 3GJ6A 2QTAA 3CUSA 4RPHA 5E4JA 3E84A 4KQGA 5IYZA 2HA0A 3ZY5A 4HUQA 1RPZA 3DZ8A 5CVUA 2DPGA 4DHEA 1FW6A 1SXHA 1RYFA 1WMEA 4RPCA 5G4KA 4ATNA 4E6EA 5KC9A 5GIPE 4P3PA 5A2GA 1RRFA 4HOYA 4IY1A 4G0XA 3NS7A 4IPTA 4R8RA 4RGQA 3R0IA 3P71T 4LJ9A 1OWMA 4P83A 5BQFA 1WNTA 3B5IA 2DERA 1TKAA 1UK8A 2VDOB 1WW8A 4H7EA 2ZIXB 1XG5A 3W5SA 4BRUA 1PR3A 5KHLB 2CLIB 2EBWA 5F1PA 3DEZA 1OA1A 1YS2X 5CW1A 1EX7A 1ZJZA 3IAUA 4KVAA 1D4FA 4XRRA 3ZDRA 3SK0A 5BR7A 4ZYXA 1X1EA 3C8MA 4IHJB 4OIFA 4QREA 1SU8A 2Z9DA 1V4VA 3B6ZA 1HK7A 3IR5A 4E2ZA 2OCIA 1BE0A 1O4WA 3FBGA 3H9GA 1X13A 4FZJA 3FKSD 1AQIA 2PKWA 5TNXA 3ETEA 5IM4F 2WE8A 4KC0A 2QUKA 1KZ4A 5A03A 3LQKA 1TU4A 3OX1A 3LDGA 4RH0A 3DE3X 3MWEA 2QTWB 2HL6A 1PT5A 2ZCJA 3RU3A 3IO5A 3VR6H 5HPYB 4CYMA 5HMMA 4FDTA 3R9XB 3F4LA 4G8CA 1R6DA 4GL4A 3JALA 4AF7A 4CQLB 1H4TA 1M2HA 4PLWA 1ZAKA 1XO1A 1RJFA 2WP0A 4G6ZA 3ZD7A 3EXAA 3ILHA 4YGYA 4MZXA 1O7JA 3FNIA 2MOKA 2ZYIA 4MUAA 1JHYA 3I5MA 4TLAA 2ZBQA 1NSTA 1EDZA 5THXA 5FAKA 1MB0A 3VSEA 1TJNA 1V26A 1PR2A 3Q9UA 4H0NA 2QS9A 1FJ2A 3E7XA 4KTVE 4KZPA 4WDQA 4XEHA 1HQCA 3A25A 2XKJE 3EGCA 3J80A 3FA2A 3UPUA 2V4ZA 3C4JA 3CG0A 3EF3A 3K8YA 5LQSA 3ESYA 2D1RA 3QVTA 5J23A 1FFXA 3H13A 2Q6KA 5EVCA 5IZ4A 5A4JA 2RGYA 3IAXA 1CZRA 1P1FA 2W6IA 5HCNA 2EDCA 4M1QA 4EECA 5ITVA 5E6UA 4ARZA 5LYJB 1S2GA 3ZXXA 3U31A 4ARAA 2QXTA 5CK5A 4PBSA 1DCTA 2YCLA 4K87A 5HSGA 1JFSA 3HBLA 4IUBS 3QXJA 2O5VA 3ITKA 1FP7A 3B8HA 4XDHA 8LDHA 2AQIA 3RARA 2I1QA 3BWYA 4BMZA 1C7FA 1NBAA 1S1MA 3SKYA 5IT4A 3WKEA 3ZDZB 4KMRA 2FRDC 3JQEA 1IOZA 3A06A 2YQ4A 5HGJA 5K20A 5KNDA 4L27A 1G66A 3NP9A 4HYEA 4Q3NA 1OFTA 1J5XA 1RI3A 3GRUA 1G8GA 1RBQA 2Q9CA 3G17A 3MLAA 3MA0A 2XDQA 1A3CA 3K15A 3H4MA 4OAQA 2I66A 4X6LA 4JXXA 3GLIB 4JYBA 2HDWA 4E1VA 1HX7A 3L4SO 2EJVA 4HVAA 2CFOA 3BK1A 3T3IA 1YK0A 1J8VA 2WILA 1P9OA 2X1HA 3AI1A 1H6AA 3CUWA 2E4UA 2BMWA 2ODAA 3L1HA 9ABPA 3AB3A 2FOIA 1N8NA 3EFHA 1LUAA 2ISSD 3GGGA 3UJ7A 1EFDN 1F17A 2EQ5A 4LW8A 4N7BA 4KAFA 5EJAA 3UH1A 4AJNA 4WWHA 2ZIWB 3W34A 4D42A 1S8OA 4QTTB 2O20A 4I4TA 4U8HA 1GAEO 4KU4A 3WRYA 1QB8A 2H2AA 1MA3A 2AFIE 1SXJE 2NP6A 3ZWBA 2VF5X 2P3QA 1N8TA 4ZAZA 4BRZA 1ISRA 2ZUEA 4PX9A 2Y1GA 1CU1A 2W98A 1CUVA 2G83A 2V6BA 1YA8A 1HNZB 5EIBC 3T7CA 2FTKE 4PFSA 3LY9A 4WY2A 3C7AA 2WYUA 1MRNA 2GZMA 2OXTA 3DE0X 3EDQA 4Y6SA 2BGLA 4A2WA 2ZE6A 3BXEA 2VSOA 1Z07A 3UCEA 4ZPXA 3UFXA 3KG2A 1P8JA 5ICGA 2J9FA 2ZM6B 3JVEA 2VP6A 3MSCA 2R6CA 3K9BA 3FWPA 3FPSA 1UCFA 1EZZA