2FPGA

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
305
structure length
305
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 116
structure length 305
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fpgA01
1X1TA 2YW9A 5GZ3A 2VQ3A 4TZKA 2IODA 1U3VA 4IZHA 4J1SA 5FF9A 3KHUA 2HAEA 2AG8A 2C2XA 1HDOA 3FWZA 4CLXA 3DZHA 5BQFA 5IN4A 1E7MA 1Q7BA 2BMAA 1YRLA 4BNZA 4CJXA 2G82A 1HT0A 1Y8QB 3VVCA 4BVAA 4E12A 2YY7A 5DBIA 4ZQEA 4RDIA 1JAXA 1I3MA 4MIYA 1VM6A 1HZZA 3RQSA 5L7WA 3P2OA 4DTIA 4BB6A 1VPDA 1N9GA 4ZD6A 2ZYGA 1LRKA 3MWDB 4OQYA 3VH4A 3O03A 3E5MA 3ZHYA 3ZZNA 1GZ4A 4FR5A 4UULA 4Z0HO 3OM9A 2UYYA 4GLLA 4DMLA 2Q4EA 4CQMD 3OMLA 4J6FA 3FHLA 1E3WA 1VKOA 4NJMA 4L8VA 3JQBA 1D7OA 4FC7A 4D3DA 2EJWA 3E1KA 4BNFA 4EEZA 3GN2A 3IP3A 2CF6A 2ZTLA 3MOGA 1QV7A 1GFSA 1GZ3A 3GY0A 2OBYA 4NK5A 2BELA 3AY6A 2O3UA 3LT0A 1WDKA 2CFCA 1EVIA 2X1HA 2NV6A 4A5OA 3ZWCA 4D46A 2TMDA 3UGKA 3EW7A 5BR7A 1QYCA 1M76A 3RSHA 1SAYA 1GV1A 1XGKA 1YGYA 2A35A 1KEWA 2Q1UA 5B12A 1ONNA 1JA9A 1XQ6A 3K6JA 4GL4A 4CUKA 1SC6A 3SLGA 3PZBA 4DIOA 1YONA 3W1VA 3VZRA 4YAIA 3QWHA 2FPIB 5IDQA 4D43A 2PZKA 1LUAA 1ULUA 3DONA 3LT4A 5JMWA 1E6UA 1OC4A 2G5CA 3TRIA 2GN9A 4LCEA 2PD4A 1R6DA 3JQFC 3HQ4O 1U3UA 4CM6A 1GD1O 3WTBA 2O7QA 2AEMA 2I99A 3CPSA 4J1QA 3WNQA 1UXJA 1O0SA 3SJ7A 4CODB 4BL5A 4BNIA 3WYCA 1V3TA 1CERA 2PGJA 2DTDA 3KLMX 2ZB7A 3BMOB 1P0CA 1B26A 1BXGB 4CM5A 1MB4A 4XX0B 4UVGA 3GUCA 4UVDA 4II3A 3IOYA 2J3JA 1KEPA 2Q50A 1MGOA 4KTTE 4R9RA 2NU9B 4WNCA 2VWPA 1KOLA 3SEFA 4LN1A 4OSPA 1FMCA 4E5PA 3G49A 3O8QB 1QKIA 3MOIA 3PIDA 2CZCA 1OFGA 4OAQA 4R01A 4M86A 4II2A 1P1HA 3F6YA 1ZK0A 4IDAA 4R4JA 1PJ2A 2NADA 1YL6A 5A04A 4YAGA 1GEGA 2GPTA 1NR1A 2P91A 3RBZA 4FOOA 2AQ8A 3CMMA 1J5PA 1C3VA 4RORA 5KJFA 2DUWA 3KEQA 4GH5A 2ZQZA 4BO6A 4U8GA 1K0UA 2NUAA 1KERA 2CDBA 4ZA2A 1HL3A 2JAPA 4DRYA 1E3WB 4BNWA 3DZBA 2AEFA 2WD7B 3D3EA 4NH4A 4ONEA 1DHTA 4ALMA 2NU6A 1WAMA 4INAA 4BNKA 2QYSA 2VYVA 5T64A 1YBAA 1U28A 1Z74A 1BDBA 4FPXA 2A4KA 4JBGA 1TVEA 3S2FA 1P77A 1ZO8A 3M6IA 1SB9A 3PEFA 4OL9A 2VTEA 3GVXA 3TZCA 3FSRA 4E5YA 3DB2A 3GC6A 4J7UA 3BHMA 4FDAA 1C1DA 1YO6A 1P0FA 4DLLA 2ZB8A 3ZWNA 4F45A 1QYWA 4FFOA 4O6VA 3N7UA 3EHEA 3BMNB 3RU9A 3NTRA 1I30A 2WDZA 4OH1A 3QY9A 1UAYA 3UFXA 2DAPA 1Q0QA 2GO1A 3QRWA 3QVSA 1R15A 4HXYA 4ND4A 1YQDA 3QWAA 4QO7A 5JO9A 3UOGA 4EEXA 2C5EA 1YKFA 1GUFA 1Q2XA 3X2EA 1XIVA 1J0XO 3BZUA 1P45A 4IDGA 1E1MA 3DWFA 3B70A 4YJFB 4BO7A 4OXYA 3HHPA 2YUTA 1A7KA 4K6FA 3TQHA 3WOHA 4IMPA 5JCXA 4ITUA 1BXGA 3PJGA 4PZEA 5L7YA 1U3WA 4EBFA 4XX0A 3A14A 1EUCA 1GEEA 3PDUA 5JC8A 2FPPB 4PLFA 4CM8B 3H6KA 3AW9A 1WZEA 3Q9NA 3JQFA 1DLIA 3LYLA 3OP4A 4YYZA 2FMUA 4WUVA 1JLLB 3S55A 5I8ZA 1UP4A 3JQAA 4IDDA 3S8MA 1HDYA 3D5TA 3ST7A 3UH1A 4PZDA 4TQGA 4PLTA 5EINA 3DMTA 1DIBA 1U5CA 1I3KA 1MC5A 5B4UA 1QXSA 4RZIA 3OQBA 3GNSA 5IN5A 3GPDG 3L07A 2HMWA 2PGLA 2DTXA 2SCUA 2NNLD 3T4EA 3V2UA 1UH5A 4NMHA 1HDZA 3B1JA 1E3LA 2GUGA 3IJRA 3CMCO 4N5NA 4S3MA 1DEHA 2QHXA 1TT5A 4QQRA 3OJFA 4Y67A 1Y8RB 5F1PA 4WECA 1PJ4A 1X0XA 4JXKA 5IJZA 4PLWA 2DVMA 4DC0A 4IIVA 3U4HA 2FP4B 1MX3A 1PQPA 1VC2A 4G5HA 1NQAO 2RCYA 1AN9A 4OM8A 3QE3A 3U0BA 1EDOA 3WGGA 4F6CA 5CEFA 2UUPA 1EVJA 5JY1A 3ZW9A 1LBEA 1P44A 4JBHA 4BNYA 3A28A 3DL2A 1LLDA 1SB8A 1DPGA 1Z73A 2WE7A 1FJHA 3ADOA 3C7CB 3JD1A 2DUUA 4BO1A 2AE1A 3OEWA 4K28A 2Q99A 5L4SA 3Q2KA 1ZXLA 5TLSA 4XD2A 4XRGA 1PEDA 1YE3A 3G79A 2JD0A 3RUCA 1JKJB 3SLKA 2EJVA 4RZHA 3MCVA 5JMPA 3BIOA 3OQ6A 1PJ3A 1ZMTA 1XKQA 1HYHA 2AEJA 1UXGA 4ND3A 3ZWVA 1DC4A 4J7CA 4Z0PA 1E3SA 1GADO 1TLTA 3F47A 1WW8A 3HN7A 4YJFA 3H9QA 4CQMA 1HE2A 1XLTA 4OQZA 3JQEA 1Z45A 4TMFA 4NFYA 3I6QA 5COQA 2PY6A 1GV0A 4CM8A 4UUMA 4E33A 2ILTA 1P1RA 3UVEA 3QVTA 2EGGA 4PG8A 2HO5A 3RJ5A 4BO3A 5IAAA 1TT7A 1EUZA 4IPTA 1UJMA 2NU7A 1MFZA 4Y98A 1HDGO 4BNGA 1N5DA 1D1SA 1H94A 2QZ9A 2VWQA 1ADCA 5JNLA 2YDYA 3WR5A 3EZLA 4LGVA 3GVCA 5C5IA 1P74A 4E2ZA 1O9BA 5G2OA 2ZJ0A 3WG9A 1P33A 4ZJUA 5HTOA 2X58A 1L7DA 1V0JA 3GGOA 3GOHA 3MJTA 4ND1A 4NHEA 4Q3CA 5TX7A 3RUHA 5FEUA 4NFHA 1U1IA 5IXYA 5JAQA 3H7AA 1NAHA 4YXFA 3JYOA 3DBVO 3P5SA 4NFSA 3DAPA 4O0LA 2UVDA 4NBWA 3WSWA 2O3SA 1NQTA 3E9NA 3MWEA 1NASA 1OMOA 4GGPA 3HDQA 4FJ1A 3GAZA 1BGVA 3MWDA 3ENNA 5L4NA 3PQDA 5IXSA 2G76A 4JQCA 4J3FA 3JQ9C 1ONPA 1T2DA 4J0EA 1A9ZA 2POQX 4Z9FA 1DIRA 1ZBQA 4IMRA 3EUWA 1K3TA 1CYDA 1HLPA 1I8TA 4BQPA 2DPHA 4W7IA 4E2XA 4FW8A 5CDSA 1ZUD1 4U0KA 3M2TA 5AXCA 4ZVVA 2AW5A 1UP6A 1JKIA 4DQVA 5GZ1A 4B4UA 3HDJA 2BD0A 3H2SA 4L73A 2GN8A 3AY7A 4PG5A 3UF0A 3W4IA 3ZN2A 1P31A 4KMSA 1J4AA 4DLBA 2E37A 3OIDA 1PX0A 3K96A 2JCYA 4F6LA 2PA3A 3DBLB 3LT1A 1ISHA 3OA0A 3U4IA 4DREA 3NT4A 1RYEA 1YQXA 1AHHA 5AYVA 4MVJH 4H7PA 1PZFA 4ZN6A 4YEDA 5TF4A 3VTFA 3GFBA 2EWMA 4H16A 1MLDA 2ET6A 4GPD1 1A7AA 2Y1DA 3WIEA 5I7SA 4WPGA 2EW2A 2J5QA 4IDFA 4AJKA 5JDIC 5JLAA 4WLNA 3U4DA 5DOZA 4C4OA 3DXFA 2VNAA 1LDYA 3C85A 4CQMB 2B4TO 2RHRA 4YB8A 2GNAA 1EUDA 3D64A 5A5FA 1DC3A 2E48A 5I7EA 5CG1A 2CD9A 2O3RA 4B4OA 5I9MA 3ONEA 3ZU3A 4PLHA 1B0AA 3JYPA 2NTVA 2HMSA 3OJEA 4GVLA 4NZ9A 1KYQA 4CM7A 1A9YA 3BTUA 4I1IA 1IB6A 2RIRA 3EVNA 3PRJA 1LQUA 2C5AA 5CFZA 3G17A 4UUNA 1EQ2A 1CEQA 3GA0A 3WQSB 1NP3A 3KRTA 2HRBA 5JDIA 1B3RA 5EERA 4Q3DA 4N54A 5L9AA 2X0IA 3TZHA 1JDJA 2PFGA 1YVEI 1IULA 4QFCA 2W98A 3QJ5A 4J43A 3ASUA 4KDEA 2BH9A 5A4DA 3KUXA 2AMFA 1RKXA 5T67A 1MA0A 4NU5A 4IS2A 5AVOA 5DF1A 3WLFA 5DP1A 1GY8A 2BKAA 2DU8A 3PWKA 4TZTA 5JO0A 2EKQA 2EV9A 2GYYA 4D44A 3E6AA 1PL6A 3B1FA 4KWIA 4YAEA 1YBVA 3O9ZA 4HKTA 4EDFA 2QYTA 1VL8A 4QXMA 3U62A 3QWFA 5K0ZA 4FBGA 2V6MA 3VPHA 4E30A 2WD7A 1X7GA 2NTJA 1L1FA 3ZCXA 2D59A 5ILOA 1ZMOA 2IZ1A 3E9MA 3GG2A 3PLNA 4MVJE 1DO8A 3L6EA 3QWIA 2F1KA 2ZYAA 3KSDO 4B3JA 3KYBA 2QRKA 2PGDA 3IQDB 5THQA 2HCTA 4B4VA 2DFDA 3DBRB 1E1NA 2IDZA 1CIVA 4LRSB 4ND5A 3GMDA 2YFQA 3JQ8A 1EQUA 3DTYA 1K6IA 3L6OO 1XYGA 3TWOA 1A27A 3FR7A 1HEUA 3DMTC 3WS7A 4RF5A 2Y1CA 3RUFA 4D45A 2OMEA 3WIDA 1UP7A 4A7PA 3PHLA 1ADBA 2NTNA 3UFXB 1K89A 4NBVA 4P4LA 4U7WA 4MKXA 1A72A 4E21A 1PR9A 1FDWA 4J4TA 3PI7A 1R16A 3DQPA 5G0VA 1CDOA 5JAIA 1ZJYA 1N1GA 2W4QA 3BHIA 5KWEA 2FWMX 3VZPA 4FC6A 1SZJG 1KEVA 1UZMA 3L4SO 4FIZA 2C0CA 1QG6A 3PYXA 2EGHA 1BXZA 4BNVA 1JN0A 2VZ8A 1IPFA 1B7GO 1FK8A 4FJ0A 3UHAA 5A3JA 5JYEA 3KSZO 1BWSA 3E03A 3I9NA 1X7HA 4D79A 1H9BA 3NKLA 3TPCA 4XJSA 5TNXA 1E5LA 4XYMA 1TI7A 3DAGA 3BMCA 4OXNA 2J8ZA 3JYQA 1PJQA 1JLLA 5CEEA 1AHIA 3JQ6A 5B4VA 4PVDA 1WZIA 2UDPA 2WM3A 3C3XA 1C0IA 4BO0A 2ZKLA 4XGKA 3INRA 1NFRA 5ITWA 1VLLA 3HG7A 4UAGA 3L77A 1NWHA 1CRWG 4FN4A 1J49A 4I9NA 4R54A 4WLEA 3ZWPA 3G0OA 1E5QA 3BAZA 4RL6A 3WWYA 3U09A 3PK0A 1E77A 3I23A 4CV3A 2GASA 1NM5A 3ETDA 3GDOA 2D1YA 1JVSA 4E0BA 2Z1MA 4BNMA 1HDRA 4CM1A 1YDWA 3WGYA 2Y05A 2OO5A 1EK5A 5AXBA 4LSMA 2P9CA 1T26A 4JCOA 1YXMA 1XEAA 2GCGA 1K6XA 3JQDA 3ROMA 2OP1A 1Y9AA 1D1TA 2Y0CA 4GKVA 5L51A 3O8QA 4YPOA 4MINA 1WPQA 4WEQA 1PQUA 2IEBA 1VL6A 3CXRA 4CMEC 4BNJA 2NVBA 2UUOA 1B8VA 4GI2A 4EGFA 1P1KA 5IZCA 3DFZA 4BO5A 2O2SA 1HE4A 4IJUA 5EQFA 1DFIA 1Q0HA 2B0JA 5TQVA 1QORA 4BNXA 1L7EA 1ISGA 2OGUA 5BNFA 4AVYA 3LK7A 2B4QA 3I6IA 1XA0A 5K6AA 4RVGA 4YQYA 4TSKA 1H2BA 1PQWA 3H5AA 3NX4A 2HKIA 1GDHA 4IXTA 3V2HA 5DN9A 3WFJA 5K6AC 2NU6B 2Q1TA 3LDHA 3FR8A 3AOEA 3D0OA 1R4MA 5B37A 1WLYA 2CDAA 2FRDA 4HFMA 4R3NA 5LCXA 3I3OA 5IZCC 2VHZA 1NHWA 5A03A 3W6ZA 2FPGB 1ZNQO 3AUTA 3AOEC 1EVZA 1U4OA 3OH8A 1HKUA 4BOYA 2DT5A 3BMCB 4KOAA 3WDSA 6LDHA 1H93A 4BO8A 2GERA 4WCDA 1P9LA 3FI9A 5CG2A 2ZCVA 3H2ZA 3QHAA 2VYND 1VSUA 1PWXA 1LJ8A 3DBHA 9LDTA 2ZATA 3CE6A 2NWQA 2VUUA 3PFWO 2VOJA 1QRRA 3HN2A 1EFLA 3PGJA 1FDVA 3TZQA 3OBBA 3WWZA 2X6TA 1R0SA 4A73A 2NACA 4KUEA 3SBOA 3ZV3A 1GCUA 1TA4A 1F8FA 2PTGA 1EDZA 3DDNA 1H6CA 2X9VA 3MJSA 4A27A 5KOIA 3GAFA 2X86A 3ADPA 1UZNA 5JAZA 3QV1A 4B8WA 1MFPA 1LXCA 3A4VA 5AXDA 3I4FA 1SNYA 2BI8A 2RAFA 5CAEA 3ETEA 3S2IA 3VH1A 4JNKA 3AK4A 4OIMA 3AUUA 4IM7A 4TKMA 4FGWA 5A9TA 5HM8A 3RJ9A 4MVJF 4ZU3A 2VRCA 4PVCA 5C7OO 3V1TC 4TVBA 2F00A 3EC7A 3FN4A 3S2GA 1SCUB 5BT9A 4XYBA 3WNVA 3JQAB 4JJFA 4RF4A 1NTOA 3H3FA 3W4JA 1NQOA 5G0SA 4Q9NA 4BS9A 3AY3A 4GSLA 2D8AA 1JQBA 4NBUA 4EI2A 3QQPA 4E5KA 3FF4A 4M49A 3RFXA 2ZB4A 3ROQA 1HE5A 2W2KB 5CPFA 3UN1A 3ZHXA 3DBLA 4XQEA 1T1SA 2Y0EA 3ZU4A 2QG4A 2SCUB 2NU8B 1XG5A 4FS3A 1O94A 3HWRA 4BGVA 3RKRA 5EQDA 2X23A 5KKAA 4TRRA 2E6UX 3TZ6A 4WKGA 5TGDA 2V65A 4CMGA 5I9NA 5JE8A 4MIEA 2JFHA 4ZQGA 1A5ZA 1IY8A 1CQIB 3KYDA 1VKNA 2V6GA 3H9EO 4O59O 1LRLA 4JJIA 3AU8A 1HZJA 4BO4A 4ZGWA 4RLHA 1IHXA 2R00C 4HUJA 3WMWA 3C1TA 4A2CA 1K5HA 2HLPA 3ONFA 2YHIA 3DMYA 1LDBA 2B5WA 3L6DA 2C82A 5JXWA 3F1KA 4E5MA 4NNJA 3U9LA 1DAPA 1G1AA 1KVSA 1UDAA 4KZPA 4A10A 1QLJA 3COSA 4UREA 3EGOA 1Y1PA 3V1YA 4J1TA 4A0SA 5BNIA 4R1UA 4R69A 4Q39A 1SOVA 3RIHA 4F3YA 4FFMA 4H15A 4WGGA 4Z0TA 3DBHB 3RFVA 2D5CA 4B7XA 4UUPA 3D1LA 1VJ1A 3IL2A 1NXQA 1PZGA 4YT2A 1YJ8A 3I9JA 3GGGA 3GVIA 1DAOA 2B69A 3GMSA 4GX5A 1C0LA 3EVTA 5EJ2A 1M67A 1ZK3A 5FI3A 1R4NA 2FSSA 3NT2A 1IOLA 1XSEA 5FFFA 2IXBA 2JCVA 2PR2A 4MP8A 1IZ9A 1Q7CA 1JTVA 4IS3A 3TN7A 4GAEA 3RUEA 2ZCUA 5KIAA 4RJTA 1U8FO 1IPEA 4YT8A 4DPKA 4XQCA 3RWBA 1EE2A 1P1IA 3KSUA 4E13A 4IJKA 3E5RA 2C20A 4FFNA 4J4BA 3PYLA 1Y6JA 1LLQA 1Z6ZA 2X0NA 3C7AA 3JSAA 4ZQHA 3WFIA 3C7DB 1V3UA 4QEDA 4R68A 3GUYA 3LC7O 1P1JA 3LZ6A 3P19A 5HS4A 5JS6A 2P2SA 1KETA 1AXGA 2RH4A 4FGSA 4OXKA 4ZQBA 3VOSA 3GEGA 4U6QA 4B3HA 3IDSA 2I3GA 1KIFA 2J3IA 3I9LA 1FF9A 4UEKA 2Q49A 3BTVA 3I9OA 3EDMA 4GX1A 4CMKA 2YJZA 3WQRA 1T25A 3K8ZA 2P4QA 2ZB3A 1JU9A 1IZ0A 4KUHA 2QQ5A 2VRBA 3MEQA 4PLPA 5T57A 3MWEB 2X5JO 2J3KA 3UW3A 4OJNA 4U0JA 2A94A 3ORFA 5DNAA 4OMUA 2Y1OA 3LVFO 1EFKA 3BA1A 3MJCA 1D4FA 5KVQA 3QLJA 3PHJA 4EYEA 3NYWA 4D7AA 4CUJA 3ASVA 3GHYA 1S6YA 1AUPA 5I7FA 2FZWA 1HSZA 2FR0A 1E3EA 2YHIB 2D2IA 5DBGA 5C7LO 1H6DA 1I33A 4HFNA 1Y5RA 4L4XA 1RPNA 4CM4A 2BRUA 1E0DA 2BI7A 3FBTA 4BV8A 1NX6A 4AJHA 1I2ZA 4M54A 2ZYDA 3GPIA 4MVJD 1SPXA 2DQ4A 3WB9A 1C1XA 3FCOA 1DHRA 4QFDA 2WE8A 1T2CA 1DXYA 3IC5A 4XEHA 5ICSA 1F06A 4P22A 3SJUA 3GHHA 3ZV5A 5MGBA 5J23A 4JIGA 1UZLA 4M55A 3PGXA 3WX0A 4TRMA 1UUFA 1YOVA 3W8DA 2G0TA 5L40A 3DHNA 1BVRA 3IUSA 3ICCA 4OOEA 4WLOA 5JY6A 2PD3A 4Q3EA 2DLDA 5HWSA 2HJRA 2HMTA 3B1KA 3EMKA 3RI3A 3WICA 1E3JA 2QIOA 1EK6A 1WNTA 4CLHA 1ZJZA 3TSCA 4AICA 3WGOA 1LDGA 8LDHA 3MJVA 1J6UA 4CQLB 3ONDA 1ZEJA 2P5YA 4R51A 3PJEA 5DZSA 4N5MA 1DRVA 2J3HA 1KY5A 3JQ9A 2WYVA 3AUSA 1E6EA 4PGFA 3ZWXA 5CDTA 3H5RA 3NDRA 1HDXA 4YJDA 2XAAA 2EKPA 5DULA 2EG9A 4OSOA 5ER9A 2OXIA 1GU7A 1U9JA 4DBZA 1ZK4A 4J1NA 4PLYA 1ULSA 2X8LA 7MDHA 2B5VA 1F14A 1KC3A 3SX2A 4XGIA 3BXXA 4BKQA 4FFPA 4ALJA 4L4SA 2HJSA 2PH5A 5BNTA 5JCJD 4O63O 4XB1A 4UUOA 1B14A 4CMIB 3NUGA 4CMHA 5LDGA 4NU6A 3OECA 4DMMA 2GLXA 2CUKA 4WCFA 3PPIA 1LTHR 4NI5A 2CDCA 1ZCJA 3GVPA 3HSKA 3U5TA 1EEHA 1W0CA 5EESA 2GN6A 3UAGA 1O8CA 1Y9EA 3K73O 3IJPA 4MKRA 4C7JA 5CEJA 3W4KA 2D5AA 1K2WA 4HBGA 1R4MB 4M1QA 4Q3NA 5DCYA 3VPGA 3VZSA 5JPIA 4BO2A 4AJEA 1TEHA 4MP6A 3PXXA 1LI4A 5DCUA 3HB5X 4IZIA 1GQ2A 1D8AA 2GR9A 3DOOA 3ZWOA 1QLHA 2FPGA 2EXXA 3AU9A 3NDIA 3DBRA 4J16A 4WE3A 4YVFA 1DC5A 3K9QO 2E4AA 3JQ8B 5F1OA 1SO8A 3H65A 3DOCA 3PWZA 1CQJB 3WGTA 3AI2A 5L95A 1RM4A 2X9GA 4PIVA 4ALKA 2B37A 1IYZA 2VHYA 4YAKA 4LSWA 4PG6A 2Z95A 1NPTO 1ZIDA 5F5NA 4OKNA 3ICPA 4PG7A 1GR0A 1H0KA 1I10A 3JD4A 1MP0A 1PZHA 2BGLA 3AUAA 1HTBA 1OAAA 1QP8A 2Y1FA 3RC2A 1KVUA 2G17A 3RKUA 3KM0A 3OJ0A 4PLVA 4UVHA 1S7CA 2NSDA 2GZ1A 1GYRA 4ZQFA 2PK3A 3PJDA 1DJQA 5B4TA 3PHHA 1ISMA 1NAIA 4B79A 1YDEA 2Q46A 4PZCA 4UVIA 4E4YA 4FFRA 3K92A 5L3ZA 3MJEA 3G1UA 3ANLA 3RCBA 1QYVA 1N9GB 4UVEA 4WOKA 4NJOA 1NFFA 2EP7A 2I66A 3CTMA 1LDEA 1VJ0A 1SCUA 3N58A 3S1LA 3WQQA 4DLAA 1M75A 3CZMA 4FFLA 5BSFA 4MVJA 4B7CA 1DRUA 4OO3A 4JP2A 2OL4A 5MDHA 3M1AA 4L75A 5DP2A 4NJMB 2YZ7A 4RO0A 4B7UA 4ALLA 4C7KA 1PL7A 1SBYA 2JFGA 3RD5A 1T2EA 4I8XA 1O6ZA 4FD3A 3HADA 4WASA 4XYEA 4R9SA 1NBOA 1W8DA 1PIWA 2XPCA 4EJMA 3OIFA 3DC2A 3TNLA 2W8ZA 1YB4A 1U2GA 2WEKA 4BHTA 4YRBA 1WMAA 1UXHA 3GDGA 2WYUA 2YYYA 2C07A 5JDCC 2OP0A 4N18A 5BSGA 5KJ1A 3NAQA 3Q2IA 3R0IA 3NGLA 2JJYA 4ID9A 4AJJA 3H5NA 1CQIA 3KYDB 5G4LA 1DSSG 1DRWA 1W4ZA 2Y93A 3CUKA 1NVMB 4N5LA 3WXBA 1ENYA 1T24A 4CMAA 1U3TA 4KUGA 5U9CA 1V6AA 1PSDA 3ZNQA 1GTMA 5KJEA 1T4BA 4PN3A 5IDYA 1EBUA 3D7LA 3RUDA 2WD8A 3JQAD 1XELA 4IGFA 2B35A 1DIHA 5BSEA 2IRWA 4BV9A 3AWDA 1ZK1A 5EIOA 2O50A 4LMRA 2FY8A 4XB2A 2E82A 1ZFNA 2GF2A 3BMNA 3PQEA 2OOSA 3KLPX 1BMDA 2D3TA 3BMOA 1PGNA 3VPFA 3IMFA 4Z3KA 2JD2A 4DPLA 4MOWA 1NFQA 3ULKA 4D41A 3I5MA 2AA3A 1R37A 4ESOA 5IZ4A 4MPDA 3KBOA 5K9ZA 3SVTA 3RBVA 4B3IA 1B16A 1I2CA 1ADGA 4TRNA 4E31A 3V5NA 1PWZA 3OSUA 4YACA 4QT0A 4BKPA 1HRDA 1YH3A 4J7XA 3H9JA 3T4XA 4BKRA 4RQTA 4YJHB 2WJPA 2IYOA 3PLRA 4AJLA 4BMVA 5IG2A 2HK8A 4KP7A 2C59A 4DPMA 3A9WA 4CLDA 4NK4A 3GZNA 2VZ9A 4ND2A 1GL3A 3HJAA 2IZ0A 5ICMA 4GMGA 1EBFA 4XDYA 4KQWA 3H8VA 1DB3A 3EZYA 3FNHA 2NUAB 5ENDA 5GMOA 2C7GA 1NPDA 2Q2WA 2QX7A 2WSBA 1KBZA 3JD3A 4XA8A 5KJ6A 3ANNA 5JDCA 1M2WA 3I52A 1DLJA 4LISA 2H6EA 4W4TA 4XWYA 1PS0A 1X14A 3OHSX 3X2FA 3W6UA 1PU2A 3NTQA 2EP5A 4I5EA 4QO8A 4R41A 5TSDA 3F4BA 4O5OA 3OJLA 4AJNA 4B4WA 3JQCA 3GG9A 3IKTA 2EEZA 2HSDA 2Y67A 5CAEB 3NTOA 2GZ3A 5JW6A 4CV2A 3TL2A 4N7RA 5LC1A 1GYQA 1GCOA 4L4RA 2FP4A 5ADHA 4R5MA 1ZZEA 4LVCA 5LDHA 1LLUA 1PR3A 2JCXA 3C8MA 1U2DA 2YHUA 2J5RA 1UR5A 3NJ4A 4CM9A 8ADHA 3O38A 4YA6A 3TJRA 1C14A 1XDWA 1KVRA 4Y6PA 4CLRB 2I9PA 3E48A 1HXHA 1EMDA 2EERA 2O3JA 1Y7TA 2D0IA 2X5OA 1ML3A 4ZRMA 2VYNA 1Z7EA 1YWGO 3KVOA 1IHYA 1E7WA 2AHRA 3VH3A 4O1MA 3H4VA 4GMFA 4GBJA 3R1IA 4GWKA 2X0RA 5H81A 2JFFA 1H2HA 4AL4A 2P5UA 3GN1A 1F8GA 4XIYA 3WBBA 1NHGA 3T7CA 4YJGA 4RVUA 4ALIA 3GR6A 3TFQA 2IXAA 1MC4A 2W2LA 3CH6A 2RH8A 4YJHA 4H3VA 4R3WA 3PHGA 1A4UA 3WTCA 2JL1A 4D0RA 2QRJA 4DQXA 3EAGA 1T4DA 3HB4X 5U4QA 1OBFO 4BNTA 2A92A 4CR6A 2DBRA 3ENKA 3TL3A 2YV1A 3ZWBA 3OQ1A 3Q0EA 1QR6A 1VRWA 4L76A 3WYEA 4LVUA 1U7HA 2NQ8A 4MVJP 5F1KA 3ZWAA 3JQ7B 3DTTA 2OBNA 3KOUA 1M66A 4OOFA 2ZTUA 4HY3A 1TT5B 3DZJA 4I9UA 2JD1A 4HP8A 1HYGA 1CWUA 1MUUA 3GGPA 4EJ6A 2HU2A 1OC2A 3WBFA 1KVQA 5U1PA 3WSVA 3F5SA 3PYMA 1M6HA 1R4NB 4HFRA 3QP9A 4P8RA 4W7HA 1G0NA 3QVXA 4LMPA 1E6WA 1W73A 4IBOA 2PKRA 1QV6A 4NQZA 3NT5A 2VZ0A 1I24A 4BGIA 1T2FA 1E7YA 4D0SA 3ANMA 3OA2A 4EW6A 3DAFA 1E1LA 4WCFB 4BQRA 3F3SA 2EIHA 4MDHA 1PJCA 2PKQO 5ILGA 1X1EA 4DVJA 4WLVA 5F21A 5T8KA 3A06A 3UUWA 1CF2O 3VTZA 3OF2A 5IFLA 1C0KA 1QYXA 5AQ1A 3WJAA 4CLRA 1CJCA 1JKFA 3OEYA 1BW9A 1I2BA 2O23A 3BTSA 4PG4A 4BNUA 2OZPA 5L45A 2HK7A 4MKZA 4QUKA 5G4KB 3RUIA 3AI1A 3BYZA 3UKOA 1ZSVA 4W9NC 4OYRA 4DIBA 2Y66A 4AJIA 1YQGA 4I5DA 1CQJA 3ZV6A 4WLUA 6ADHA 4DIFA 4U6SA 1Z7BA 4DUPA 1EZ4A 3WMXA 4HADA 1Y5MA 1AGNA 1KS9A 1VL0A 2XF8A 1GYPA 2Q2QA 4KQXA 5FWNA 4A03A 3I1JA 2EHDA 3VAZA 4G65A 1A71A 1UDBA 4AJOA 3K31A 2DKNA 2QZZA 3PIIA 4NDNE 4U5QA 3L4BA 1EUDB 1F12A 2Z5LA 5ER6A 1T2AA 3I4CA 3GNQA 1ZSYA 3FNFA 2CMDA 4RDHA 3IUPA 3FTPA 3P2YA 2NQTA 4GKBA 1VJTA 4CLOB 1NNUA 1WVGA 3K2EA 2B83A 5EL0A 2GN4A 3Q1LA 4UEJA 1R0LA 3GLQA 1HF3A 2O7SA 2Q1SA 4ZHSA 3KETA 1CETA 5C37A 3LF1A 1C1XB 4YWJA 4CL8A 2XOXA 2FZEA 1ZVMA 1LQTA 2Q3EA 2BGMA 3F4LA 3DO5A 3D5QA 1LC0A 2PNFA 3CINA 4M8SA 2G1UA 4E32A 5I9LA 1I32A 3PZRA 2X7HA 5F3RA 5G0WA 3INGA 2DBZA 4DQUA 3AFMA 3P7MA 4XKJA 4W82A 1DC6A 1PS9A 4D42A 2VTDA 5A06A 2VCYA 3QW2A 3Q6IA 2BHLA 1JWAB 2ZK7A 2V6FA 2W90A 3NDJA 4XRRA 2Q4BA 4JJGA 3T7EA 4CL3A 1BRMA 1Y81A 4PRLA 4BKOA 1KY4A 1G0OA 1ONOA 3V8BA 2JKVA 3F5QA 3G1TA 3MTGA 4MP3A 2R2GA 5GY7A 4AJ4A 1ZKMA 4CQLA 3U49A 4GSKA 1ENPA 3W8FA 2HDHA 2DPGA 3GNTA 4BUCA 5KVSA 3LC2O 3N74A 2ZQYA 3IS3A 4JX8A 4RPKA 3E82A 4Y6SA 4ROSA 4LW8A 3VKVA 1K6JA 2EKLA 1NWCA 3Q9UA 5KKCA 3OJOA 4FQ8A 2PD6A 3KYCA 4J9VA 1VI2A 3IP1A 1LSUA 2C54A 1W6UA 3FD8A 4XYLA 4CUZA 1E7SA 2VHVA 3A1NA 3WGHA 5I8WA 4IUYA 2AXQA 2VT2A 1NR7A 3PHIA 4DYVA 3VZQA 4BIIA 1UAGA 5G0TA 3O4RA 5FI5A 4HNGA 4PLGA 3TFOA 4CMIA 4CM9D 4RVSA 3PFFA 1F17A 4JBIA 3TF5A 3QA9A 2VT3A 2BFOA 1BHSA 4OHUA 2VWGA 2O3TA 4YBZA 1N7HA 1RWBA 2GSDA 4URFA 1P3DA 2D4AA 3LF2A 5CP8A 5DDIP 3JYLA 5CDUA 4PLCA 3PDJA 2AQKA 2X9NA 1GUYA 3DFUA 3C24A 1LSOA 1PGOA 3GZ4A 3R3JA 4CLOA 1Y8QA 1PGPA 4IGEA 1LLCA 2YQ5A 3JD0A 1GAEO 4XR4A 3CKYA 5C7IO 3AM4A 1A4IA 1UXIA 5H83A 3FTNA 4CMCA 1O89A 4DC1A 3CZRA 2FN7A 1FDUA 2WMDA 4DA9A 1RYDA 1LEHA 3DEYX 3RC9A 1YL7A 2X0JA 1U4SA 3G3EA 5HA5A 2R00A 3ZU5A 5JC1A 3TDKA 4XZ3A 4FOSA 2J6IA 3ZNOA 1T1RA 2FOIA 3F46A 4E6PA 4GQAA 4BMNA 1ZH8A 4P4NA 1LC3A 1NYTA 1PJTA 1WMBA 4GX2A 1DOHA 1G6KA 1MV8A 3Q11A 5T8KC 1JVBA 2CVOA 3FWNA 4CMJA 1I0ZA 2UV8A 5GZ6A 1PL8A 2AQHA 3FPLA 1PJSA 2VWHA 2YDXA 2HMVA 3L0DA 4L0QA 1GPJA 3D4PA 1H5QA 4J0FA 4X54A 5EPOA 1N1EA 3V2GA 4P4GA 1SEPA 1I3LA 3GRKA 4AFNA 2YFHA 4WOJA 2W2LD 5IF3A 4J9UE 3VHRA 1ZK2A 5TRTA 1Q7GA 4JN6B 2VRCD 4TROA 5F5LA 3MJ4A 4F46A 7ADHA 1Z82A 4BNLA 3GFGA 5JBIA 3KEOA 1QSGA 3HNPA 3KB6A 4HX5A 3OFSA 4J90A 3WJ7A 3QVOA 3ZWMA 3DZGA 3GRPA 3KV3O 4CPDA 3RC1A 1ADFA 3CEAA 2PKQP 5L4LA 9LDBA 1YBMA 4YAJA 2PV7A 3CIFA 3JV7A 3LT2A 2H63A 3WLEA 2ZJ1A 3VPSA 3LQFA 3HZZA 1DJNA 1ORRA 1N92A 4OGWA 4RCVA 3FNGA 2UAGA 2WTBA 4ALNA 4D3FA 3HFSA 4RV9A 3HDYA 1FDSA 3QIVA 4XDZA 2P9GA 3UCXA 4BNNA 3WGIA 3UICA 1SOWA 3R6DA 2H1SA 4RPLA 4AJ1A 2FSVA 3PQFA 3ON5A 5AXAA 2B4RO 2I5PO 1IL0A 1AE1A 1V3VA 3BMQB 3PTZA 1ENOA 3DZKA 5CHEA 1I36A 4ZRNA 4EJ0A 2QW8A 1XU7A 4EUFA 1V8BA 1ISIA 1E3IA 2DBQA 1YJQA 3AI3A 3GH3A 3WGQA 4K6CA 4Z9YA 3ZNNA 4YJGB 1V9LA 5KTKA 3C1AA 1EE9A 1LRJA 1U8XX 5L53A 1YB5A 3RVDA 3C1OA 2DM6A 4CR8A 5HRUA 2P9EA 3JTMA 4R1NA 1IUKA 3GVHA 4NBRA 3RU7A 3K30A 3AOGA 4CV0A 4EUHA 3HFGA 4I5GA 2OORA 1JAYA 3B6ZA 1PTJA 1EVYA 1R12A 3LLSA 5HS6A 4PFJA 4ILKA 3KZVA 4Y8VA 4NG5A 3AM5A 2I65A 1U5AA 4BO9A 4NPCA 3ZW8A 5COAA 4RPGA 2WYWA 3JQ7A 4IJVA 4EUEA 4HV4A 4G81A 4L9RA 2BFMA 4R1SA 5HBRA 1TB4A 4K9DA 4JLWA 4XIJA 3BTOA 3F1LA 1LDNA 4TRJA 1BG6A 3KO8A 5AOVA 3VH2A 2TMGA 5JFOA 1H6BA 4WK6A 3FPCA 3GEMA 3PJFA 1QMGA 1GQQA 2VUTA 5DCWA 2HK9A 4QECA 2NLOA 3VPXA 4I5FA 1NPYA 1JWBB 1KVTA 1PS8A 3QWBA 2AG5A 4Z6KA 2YQ4A 1DFGA 1XR3A 3W8EA 2QRLA 4NIMA 3ROPA 1I01A 3H3JA 3JYNA 2DBVO 4E5NA 4L74A 3DZFA 1DFHA 5KJCA 4M89A 1C1DB 3H9GA 3L9WA 4IINA 4YT5A 3ZV4A 4Z9XA 2CVZA 4R16A 2PWZA 4CMEA 2V6BA 1ZXBA 4BGEA 4RGBA 1ZEMA 4Q3AA 3GZNB 3HUDA 1NQ5A 5ENVA 4G2NA 2O2YA 4JGBA 5IDXA 2CF5A 1DDOA 3VVBA 4PCVA 3NRCA 2RBEA 1HE3A 2CVQA 2FR1A 3LC1O 4M87A 3UCEA 2I76A 1XU9A 3FRJA 2Y1GA 4YCAA 4J49A 1X13A 3GDFA 3ZHZA 4WLFA 3IIEA 3M2PA 3VDQA 4WNIA 3S2EA 2VHWA 4YQZA 2I67A 4QX6A 4QSMA 2W2KA 5ES3A 1OI7A 1NVTA 3BMQA 5A1TA 1BTOA 1XHLA 2GZ2A 3HDHA 3HE3A 4AJ2A 4P38A 4TVOA 4JROA 3RROA 2CNBA 3PVZA 3RBXA 1IE3A 2NU8A 3ETGA 4IQ0A 4TKLA 2FPPA 2LDXA 1ARZA 1B8UA 4DGSA 3JQBC 2IYPA 3TOXA 5KVCA 3PP8A 3KTDA 4AG3A 5ITVA 3B20A 1WWKA 1C0PA 4MJLA 4J2OA 1PGQA 1YS4A 1GZ6A 1PGJA 2EF1A 2JHFA 3E9QA 3FNEA 4HWKA 4OKIA 3RC7A 1B8PA 5KCZA 1TXGA 4FJ2A 4DL9A 4K26A 2CSUA 3ZWWA 1XQ1A 2LDBA 1E7QA 1B15A 5KNLA 1Q0LA 3ITDA 5A9SA 1ISFA 4CLEA 1PJLA 4NR0A 2PH3A 2AQIA 2OFPA 3E8XA 3KXDA 1HETA 3PWSA 3DR3A 3F9IA 3H9UA 1H6AA 1ID1A 1WDMA 1Q1NA 4J2HA 2O48X 5TT0A 5EN4A 3ZDFA 1YB1A 3AJRA 4YRAA 2GGSA 4WEOA 1MG0A 4IDCA 1N2SA 2Q45A 2PZLA 1UXKA 2IZZA 4GX0A 4IIUA 1Y8RA 2WWRA 4BGUA 1HWYA 4BNHA 1X0VA 3GEDA 1R0KA 2GRAA 4E2WA 1RM5A 3Q3CA 4KTVE 5T6BA 2NU9A 4RVFA 4Y9DA 4PLZA 3RUAA 4FB5A 1B3BA 4GVXA 5A05A 2C29D 4A26A 2Q2VA 1BVUA 5FYDA 1RM0A 4XR9A 4XJTA 3OETA 4YTEA 2YV2A 3U3XA 3RAJA 4GGOA 2NVUB 4MIOA 4MO2A 4MVJM 4Z3DA 5THKA 4GWGA 3WGZA 2R6JA 1ZSNA 4LCJA 4PRKA 1AXEA 2ZTMA 4WJZA 1E7RA 1DIGA 3NEPX 4IQ8A 4JK3A 5G0UA 5DOVA 3ZHBA 3STHA 1SEVA 4RF2A 4Q3BA 5CDGA 3ZWYA 3ZH2A 2BF7A 2C7VA 5JCJA 1MXFA 4KWHA 1ENZA 5A9RA 2H9IA 3K2BA 3DHYA 1V35A 1BDMA 3I83A 1PJBA 3AFNA 3RASA 1FXSA 4RPJA 1BSVA 5TJHA 2ZTVA 3DZIA 3JCZA 2RHCA 4MVJI 1HLDA 4IDEA 4ZICA 3L9XA 4XQGA 4XQ9A 1RJWA 2EW8A 1MXHA 4Y6RA 4NBTA 3K5PA 3QSGA 1Z75A 3JD2A 1HDCA 1R66A 3M1LA 4R1TA 2V7PA 5DT9A 1LNQA 3VC7A 4BKUA 3DOJA 1UDCA 4IJWA 5TJ9A 1NVGA 3IAHA 5TT1A 3EK2A 4XCVA 2NU7B 3IKVA 1VSVA 3GT0A 2CY0A 2PZJA 4FCCA 1VE9A 3D3WB 1DIAA 4HFJA 3LSYA 3BHJA 3EYWA 5TS3A 1ISJA 2HQ1A 2Y0DA 4BMSA 1WDLA 2GD1O 4RF3A 3SXPA 5I7VA 5JYDA 5KVVA 5A9SB 3VDRA 4AJPA 3JQGB 4QTZA 3TOZA 4CR7A 1B2LA 1O95A 2BFPA 4CM4B 1H9AA 2E49A 1SMKA 2I6TA 2X22A 4DWVA 1BW9B 2NVWA 3ZNPA 1PZEA 5G4KA 4TWRA 2HUNA 1O5IA 4UEOA 4IY1A 4XYGA 2O3QA 3ROKA 5C3MA 4FSHA 2J5KA 1RM3A 2IE0A 1EUCB 3ZU2A 2OUIA 3GF4A 1XWFA 4CV1A 3U4CA 2X5KO 2HMUA 4GLOA 2X4GA 2VOEA 3GK3A 4I08A 1I3NA 1WXDA 3OIGA 3I9MA 4WCFC 2FHSA 1LA2A 1DBVO 2NVUA 4E3ZA 4YDRA 2BGKA 3UCFA 2FR8A 5A5EA 2DTEA 1LU9A 3DHEA 3LU1A 4D3SA 3D4OA 1LX6A 1KEUA 2VYVD 4S1VA 1X7DA 2B36A 5COBA 3ABIA 3E18A 2PLAA 2VN8A 5EMHA 5CDYA 1WP4A 4LK3A 4HNHA 3R3SA 4IQGA 4J91A 4W6ZA 4K1LA 4B8ZA 2P68A 4KDFA 4I9HA 3O26A 3FBGA 4LRTB 2XXBA 2VNSA 4DYDA 3L4BC 3INTA 2H5LA 2PZMA 2VHXA 3ZGYA 3TZKA 1GQYA 1GUZA 3LLVA 1E1KA 1LSSA 3SC4A 3AM3A 1M6WA 1YL5A 4R5HA 1N7GA 2VUSA 2GDZA 2OHXA 1MG5A 2JHGA 3SC6A 4IDBA 5T5QA 2DFVA 2Y68A 5A02A 3QVWA 1E92A 4YT4A 1BXKA 3UXYA 3I9KA 2BLLA 3NGXA 5B1YA 1FDTA 4EZBA 2C2YA 4RLSA 4W9NA 2Y1EA 1HYEA 4JP3A 4CMBA 4YR9A 3OICA 1QYDA 4DBVO 4CM3A 5BSHA 3D3WA 5JAMA 5TIIA 2JAHA 3ITKA 4YRDA 2O4UX 1X15A 2IEDA 1ZW1A 3EY4A 2BFAA 1JW9B 1OZAA 1D3AA 3JQGA 5DBFA 1OOEA 3MTJA 5CPBA 1JKJA 2HRZA 3VKUA 3CSDA 5JSFA 4J4HA 4IXWA 3ZI0A 2FPIA 4RVDA 5IDWA 1GPDG 2ZIZA 3MZ0A 2P4HX 2O4CA 2A9FA 1YOVB 2XXJA 3NJ8A 4RVHA 3RFTA 4XGNA 5A3VA 4W99A 4MVJG 1LSJA 3KYCB 2Y99A 5L7TA 2Z1NA 2I3AA 2YV3A 4E2YA 3WYBA 2AE2A 1F0YA 2DC1A 4EITA 4RQUA 3V1UA 4BB5A 1P1FA 3D4NA 3GQVA 5TC4A 2NM0A 3NV9A 2Q1WA 4DXHA 1LDMA 1HSOA 1N8KA 1XCBA 4RPHA 5H82A 1KC1A 1U7TA 1I5RA
chains in the Genus database with same CATH superfamily
4ZC8A 1YJBA 4NAVA 2YW9A 2VQ3A 4TZKA 1PT5A 3IT1A 3MGAA 5EGNA 3KHUA 5PGMA 4AZTA 2HTEA 2AFHB 2BFNA 3UMYA 3WLQA 1XZQA 2BEWA 2VK8A 2AG8A 5IN4A 5C4MA 1AZSC 2W6MA 3II6X 3OX1A 4IRUB 4AZ3B 2X1LA 1Q7BA 4WVLA 1IRIA 2BMAA 4GKAA 1OY1A 1TF2A 1EDDA 1MOPA 3FOCA 3IAS6 4BVAA 1T2UA 1QFXA 5LNK1 3USCS 4BASA 4E12A 1JTEA 1T5OA 2YY7A 5ESWA 4JI6B 2IIVA 2W6JD 2PWAA 3BWCA 2AOUA 3DMHA 2J7KA 2FLVA 3I45A 3PB3A 4AIIA 1I3MA 2VPIA 3HZHA 1VM6A 1Z16A 4H1VA 5LDDC 5JEDA 2XMSA 1J07A 3KJQA 4RL4A 2FUEA 3T3EA 2QLTA 2C9MA 3VOAA 4HQFA 3IGFA 4XH9B 1ZAKA 3VTAA 2FSPA 2PYIA 4GLLA 5CT8A 5EIHA 4DMLA 3RVOA 2CLEB 4CQMD 4J6FA 3EWSA 1KP3A 1M2OB 1AGYA 1W76A 2Z5GA 3FHLA 5IHPA 5JNTA 2VYCA 4ZI7F 4JP1A 1U9ZA 5IYZF 4KQCA 1XKXA 2EJWA 1MVLA 4EEZA 2D2EA 3ROEA 3IP3A 1IBLB 4WD3A 5AKYA 1T5BA 1Z25A 2CF6A 2Z43A 2FCAA 4KX5A 4C03A 4G37A 3MOGA 4UAUA 3QYAA 4ZZ2A 2OXCA 4INOA 5CFMA 1YZNA 4AMZA 4NK5A 1C9JA 5KZMB 5JSUA 3AY6A 2O3UA 1QONA 2OY0A 4URWR 3RARA 1AT1A 5K0TA 1EVIA 1D09A 1A8SA 2NV6A 3NBZC 4D46A 2TMDA 4N1AA 2HB6A 5FLKA 3EW7A 1K3FA 2A35A 1GV1A 1SAYA 1YGYA 3QFFA 3QX7A 2DETA 1ZJ5A 3EF0A 2RH9B 4EB6B 4YRQA 2Q7DA 1CQXA 4DNPA 5LYJB 3DEJA 1E9BA 1IIRA 3SIRA 2MSDB 1CY2A 1JU3A 2CFIA 4X94A 1Z12A 3ITEA 4NV3A 5L6MB 1DV1A 2RGWA 1ACJA 1X3SA 3G0BA 3QWHA 3R24A 4HDAA 3K9HA 4MUKA 4Q4HB 3TJMA 4DWOA 4C7MA 7MHTA 2A7XA 3AETA 2B6NA 3LT4A 1N34B 3NRBA 1O77A 1OC4A 3WADA 5DM70 2PD4A 4UXIA 1MZPA 2IELA 1W1WA 3G02A 1CEEA 3CLRD 3WTBA 1KMMA 1JYSA 2O7QA 3ELWA 1Q50A 2I1VB 1JDUA 3CPSA 4J1QA 2QMYA 3WE7A 4YDHB 4RZ2A 3VR6H 4RW0A 3WYCA 3ZBTA 4MGHA 1Q1AA 5AIAA 4K5QA 3D4LA 2AN9A 3IV7A 3OCYA 3IPYA 3OSZA 2LCFA 3THOA 4ZZIA 4ZAVA 2FH5B 2ZB7A 2VP0A 1ZLXA 1ISRA 5EZ6B 1BC5A 2ZGVA 4ZYTA 2XX3A 3ZJVA 4LJKA 4ECEA 1MB4A 2HXYA 2O2HA 1I9CA 1ZUHA 3GUCA 4UVDA 2FPMA 2MYPA 4II3A 4HDCA 1ESCA 2J3JA 2VF5X 4KTTE 3HA5A 1NJGA 3D2AA 1UT8A 2HHCA 3PDCA 4N65A 3SQDA 4YRKA 3CGWA 2PSJA 4HSGA 4UMFA 2I7XA 1FMCA 4E5PA 3G49A 4RV5A 4YRPA 1V48A 4V3CA 5KPDA 1L7MA 1YZKA 3P9YA 3B6KA 1YIAA 1S2DA 4XM0A 3GFSA 3NUQA 4OAQA 3GO4A 1L7RA 2FXVA 3UYLA 3ZOZA 2OHVA 2XA1A 4ZVNA 2NADA 2FQQA 2GJKA 3C3EA 4YAGA 4ZYYA 1NR1A 4RXMA 3RBZA 1K5DA 4KI7A 4Z9BA 2ZRNA 4EBBA 2FK7A 1DIOB 2B8WA 5G1NA 4EK9A 1J5PA 4DGQA 3AEKA 3SQXA 4I4LA 3ZY2A 3GI1A 2F4VB 5IHXA 4P3NA 1V47A 5L3SB 1CF4A 1KZ7B 2ZQZA 4GH5A 3IQZA 4MUMA 1T0PA 1KE2A 3DULA 2AIRA 3JQQA 4KGVA 3H5OA 2O0LA 1KERA 1MT0A 3HKDA 4YFYA 2REXB 2DPXA 3VUFA 1FJ2A 2CDBA 3BBPA 3H0CA 3HO8A 3MPUA 3QHPA 3DOIA 2KQUA 2QT1A 4BNWA 5GADl 2WD7B 4NH4A 4LOIA 4QARA 4TTIA 5DW3A 4IJ5A 3IAFA 3N2GA 4BNKA 2Q7XA 2VYVA 4FHGA 3WRVA 1QK4A 2EX0A 2Q3CA 3DEKA 1VLZA 3QF4A 1E20A 1OTHA 4S12A 9ATCA 1AMUA 4MWCA 4JA0A 2KBEA 3HRIA 1HH4A 2PKYX 3ESZA 3TTUA 5EYPA 1XZKA 3OTWA 1RMQA 3GVXA 2HR1A 1NDUA 3FSRA 2ZB2A 3N0RA 2HA5A 3GC6A 4IF4A 4M0KA 4OQEA 4QEKA 3BHMA 5IT9A 1L8XA 1YO6A 2Z5VA 4RIEA 4RIFA 3DR5A 3N7UA 2PMEA 3I34X 1VMAA 3EZNA 4U2FA 1GNRA 1QUFA 2WUDA 3NTRA 1E59A 4MUHA 4H31A 5DGXA 4LDZA 3WHIA 1XXHB 5LMUB 4E5SA 1IZ7A 3QY9A 3BB1A 2BP7A 3OLXA 1UAYA 3T7KA 3BHNA 4EWLA 3NEJA 4YMSA 1IZ8A 1N5MA 4IH1A 5A4FS 4X8HA 3T1NA 4YIKA 2H5IA 1TM4E 1O0BA 4GOOD 4UFPA 1NXTA 4BY9E 5SV2A 2HSGA 2ZP1A 1V11A 4HDNB 1NXXA 1A95A 1WXGA 1Q2XA 1YKFA 1YCDA 1CR2A 1U0FA 1SIWA 2QV7A 1J0XO 2BZ0A 1MQAA 1E1MA 4IDGA 3E84A 1TJ3A 4DR2B 4TS3A 4UASA 5JANA 3HHPA 2YUTA 3P9NA 3VDMA 3QM1A 1YQEA 3GFFA 2UZ1A 1VYUA 1M2FA 3AF5A 4QGHA 2IS6A 1T29A 1U3WA 3V7WA 1ZD1A 3EIXA 4PFQA 1GEEA 3PDUA 3ZWQA 5JC8A 1QHHA 3K15A 2IHKA 3P27A 1CZRA 1SBTA 1MV5A 2G4CA 4FX5A 4IMJB 3AW9A 1JECA 1N8NA 4LF5B 1TYEB 4QLAA 1O3YA 4HB4A 2BHTA 2AWOA 1WPRA 1E8NA 3LYLA 4GI1A 1I3CA 1S1MA 1V1RB 3OP4A 4OU4A 4QYIA 5DYIA 2FMUA 2AEEA 1JLLB 1UJBA 2O06A 4XD7A 5LBUA 4D1YA 3ZQ4A 4UOQA 2EZ9A 4YXWA 1SKYE 5F23A 2J5XA 3HACA 6GPBA 4NCAA 1WXQA 1SG9A 1ZI9A 1G7CA 3S2SA 1Z35A 1V2HE 4CGYA 1JHOA 1ST2A 2VPQA 1U5CA 1VE6A 1MC5A 3H8WA 1JE1A 4AECA 1QXSA 4G5RA 4RZIA 3OQBA 1DRKA 2Q6IA 2WAYA 3FW1A 1YGPA 3GNSA 5IN5A 5CA1F 4R83A 3IIIA 3T4UA 2NX2A 2R97A 3AI7A 5L3SA 1LW6E 3WSTA 3GEBA 1WKVA 3HPQA 1UH5A 1X7YB 3B9PA 1G4UR 1BOFA 3B1JA 2R8ZA 4N5NA 1ORIA 4R8KA 2IWHA 1TKAA 4MMXB 1W59A 2CHQA 2GVNA 4NL4H 4ZMSA 1DC8A 1XV5A 2RGGA 3BM5A 3GDWA 3M8KA 2DUMA 1X0XA 2JRCA 4JXKA 2POCA 2XIJA 5IJZA 4JVSB 3W1EA 4Q03A 4X63A 3D0KA 4D80A 4DCJA 1D03A 2QWXA 5C8ZA 4F93B 2GBFA 3NBYC 5DMHA 5E2AA 1TRKA 4EHAA 4UW9A 3REQA 4IRXA 3WLLA 5EYPB 1IY9A 3ZW9A 1D8TA 4XWWA 4JBHA 1EFVA 4ZJPA 4GRAA 1C0EA 1PWHA 2IOFK 1F0PA 4HX2A 2YV5A 4TV8F 3PHCA 4E51A 2H9YA 4MWGA 3D6HA 4FLMA 5CFOA 4YJ2B 1D4AA 4EPRA 1TIBA 3FB4A 1KI7A 3W8NA 3QPUA 2DUUA 2AE1A 3OEWA 1YVUA 2Q5IA 3EX7C 1OF1A 5F64A 1Z07A 2W2NA 1P7WA 4GF5A 1ZXLA 1FMTA 3K32A 3QF7A 4XD2A 2YX1A 3HLKA 1PEDA 3G79A 1POWA 1G21E 3RUCA 3W06A 1YB2A 2R5WA 2XMQA 3S3TA 3EUFA 4MR8A 3MS2A 2WSLA 4GP7A 1ZISA 3C1UA 5EXTA 3BIOA 1P2BA 1S3SA 1PJ3A 4MYUA 5EC8A 1HYHA 1ODLA 3PA8A 4DA8A 1SOAA 3HCOA 2NUPB 4O8CA 4JBLA 4ML3A 4TL6A 4XWTA 2GPBA 2KPOA 2FNAA 3V4ZA 4B6OA 1XLTA 4OQZA 3UW1A 3JQEA 3CRRA 4G5QA 4TMFA 4C4YA 1XZHA 5I01A 1GHTA 1H1LA 3I6QA 3OZAA 5JI2E 1LVGA 2PY6A 2QRQA 1GNVA 3WWCA 4UUMA 1E1QD 5IC6A 5TPZA 1P1RA 3WMRA 3QUTA 3OZRA 3CRZA 2KYRA 5FNZA 4RFSA 3IUNA 5A7GA 3ANTA 3AF6A 2EFCB 1RLIA 5AM0A 1HDGO 3D54D 3U16A 1D1SA 2EW1A 3MTEA 1RP1A 2DEUA 3BXFA 1M1UA 3JW8A 4QBFA 3EZLA 5LP1A 3EZ9A 2ZS8A 4LGVA 2GAIA 4N0EA 1O9BA 1QX4A 2NN3C 1R6XA 2ID8A 2QXUA 1NF9A 3DQZA 2VNHA 3CF0A 3Q3IA 3ORYA 4NHEA 1L7DA 1V0JA 5DTRA 5F2KA 1Y3FE 2ZUUA 1YAJA 4Q3CA 3W7AA 1X7WB 2FEOA 3ZH9B 4NFHA 1P75A 1D1PA 2PRYA 1NAHA 2V55B 2Y3IA 3I3SR 4AZ0B 2OCLA 1OU4A 3DBVO 4C06A 3P1JA 4ZYUA 4XVCA 3V3TA 4DY4A 1LW7A 4NBWA 4H6WA 2QM7A 5EKUA 5IAKA 5AP9A 3V8QA 3LCRA 5C32A 2ATVA 3E9NA 3MIZA 2JFZA 4TLDA 4DRXB 1NBMD 3FMFA 4HEA6 5JYCA 4ZDIA 1BKSB 2HZBA 4FJ1A 3A4NA 4B80A 1GSAA 3MRVA 2ZWPA 5L4NA 4P31A 3BJMA 5C1BA 5IXSA 3ENQA 4JQCA 1T34A 5AKXA 3VQTA 1ZCFA 3PE3A 3R4CA 2HYDA 3N2NA 5CFRA 1TL7C 1U0OC 1FE8A 5FL7A 1RC1A 5IVPA 1DWPA 1HLPA 1I8TA 3AYZB 2ETXA 1XD8A 4R7GA 3QLEA 2IHYA 5KYKA 5CTJA 4BC0A 2C7QA 3VJRA 3F8TA 4YUAA 5TQJA 1YI1A 5BWMA 2QB5A 1VGRA 2AW5A 4HL6A 2PRIA 3OM1A 4JI0B 4AMYA 5TDHA 4DQVA 3LZCA 4I8IA 4PSUA 4E1VA 3DUWA 2BD0A 3H2SA 3I2YX 4IX1A 4PYIA 3ZN2A 4PCAA 1U0NA 4CKWA 3HJNA 2IU0A 1J4AA 1C4XA 1PT8A 2E37A 3H1AA 3OIDA 1A5AB 1A7JA 1RABA 3DBLB 4BCBA 4CFSA 2XE4A 1AM4D 5DM0A 3V8VA 3OA0A 5JZSA 1CZNA 3FH0A 1AQJA 2D1QA 3P9SA 3VV3A 1SPBS 1P4JA 1PZFA 1QH8A 2YMMA 1WLSA 3PRKE 1P9RA 3MMZA 5TF4A 4YH1A 2EWMA 3V4RA 2Y1DA 4LRXA 4LPSA 5AM3A 2HHAA 3DBIA 2J5QA 3KZKA 2GPJA 1Y8ZA 4A0FA 5JLAA 3PEYA 4OUDB 1QZZA 4PHHA 1W6RA 4RHYA 3GFTA 3DXFA 3EQ2A 1LDYA 1OAOC 2ZRGA 1BS9A 3C85A 3KR9A 3R6LA 3GLGE 2EZ4A 4P58A 4MHSA 1XRRA 4KXLA 4BTVA 1V4VA 4LXXA 5KNDD 3M9LA 3RYCB 2JRLA 1CRZA 2PWYA 4JQOA 4FYVA 1JB9A 3IDOA 1M2GA 2J0UA 2ZRBA 3DS8A 3T35A 3KZOA 1NU6A 1UK9A 2ENUA 4TYQA 4Z5XA 3ZVNA 1RVDA 4PLHA 4XLZA 5LQAA 1WHTB 2HMSA 2NTVA 2V98A 3H5VA 3OJEA 3QVKA 4GVLA 4JJ8A 4KW7A 3Q15C 3RRBA 3EVNA 2Q5JA 3INYA 2QPAA 3DPSA 5CFZA 1YRHA 2VFAA 3LH5A 4UUNA 3P32A 4C07A 1N5RA 1CEQA 3GA0A 3WQSB 1VPLA 2FSGA 1TA9A 2CNKA 4NJEA 2RHOA 3T3IA 5JDIA 2ZZNA 3AVTA 1KRXA 3RC8A 5EP1A 2WWWA 4JEMA 4N54A 1CQWA 4JS0A 5L9AA 1YVEI 3N3BC 2MR6A 4JYCA 3DKVA 4QFCA 1XRQA 4LQLA 6CHYA 1BJRE 1J2JA 4D4HA 3MUFA 3DOFA 5YASA 1SC1A 4AUKA 4DIEA 2KB0A 5KYNA 3VO2A 3FA2A 5DF1A 4Y6QA 5FBQB 2GZRA 4YDQA 2O2XA 2BKAA 5JCZA 1D9XA 1P2SA 4TZTA 1FP1D 5C2JB 2EKQA 2GYYA 2YH2A 4HGYA 4RAOA 4RJIA 4U63A 4D44A 4US2R 5ADWA 5JSZB 3KUUA 1E3MA 1T3HA 4G8DA 2XTNA 1OWOA 3B1FA 4YAEA 3WDMA 1I51A 4QDJA 3SJZA 2E2WA 1NBIA 3O9ZA 4AO8A 4AROA 4GMDA 1Q7TA 5HKLA 4RHCA 4E4TA 1IY1A 5K0ZA 1TAQA 4HEHA 1PK9A 1AKWA 1OWNA 4LV5B 3VPHA 1VE7A 3SN6A 3C74A 3LCUA 2NTJA 2UUBB 4PE5B 1ZMOA 3GG2A 2VAPA 2QLBA 1UM8A 4ARIA 2J9FB 2XRMA 2H48A 4YGYA 2LXNA 2F1KA 3B8HA 3LNCA 4AN0A 3BIJA 1BDIA 2ZYAA 3KSDO 3ED1A 3GP3A 4M88A 4B3JA 1I13A 3KYBA 4QC2A 6REQB 1NU8A 1Z08A 3IQDB 3E9ZA 3IALA 3PL5A 3U9TA 1XZMA 3ZXIA 3C3YA 5EP3A 1Z39A 4DNXA 2DHEA 1FIUA 4KR3A 2FMHA 4ND5A 1ATIA 3OTIA 1K6IA 3TWOA 2B2XA 3U7EB 3BFXA 5FTWA 4M83A 1DEKA 2IC5A 4RF5A 4UHKA 2GBGA 1HA3A 2O9JA 3RUFA 1C9DB 2BOVA 3N6XA 4HWOA 4GI3A 1QFSA 5FOWA 3CKMA 2H0RA 1VIDA 3N0XA 1C8KA 1ATZA 2CW5A 4XGQA 1AGPA 3QVMA 1TE2A 1U8YA 1XUOA 1W49A 2G9VA 3A3PA 1PHRA 3AR5A 3DVAB 1R16A 4UZSA 1W25A 3RYTC 1CNFA 1N1GA 3LLMA 4OQFA 1NVEA 4MDEA 4QJ3A 1KAQA 2I1QA 3MGCA 4FC6A 3KU4A 3VPAA 3UKJA 2PN1A 3FOZA 1OGJA 1DG9A 2WILA 1USVA 3FZYA 3MTBA 1I94B 4X1KB 2C3UA 5J2UA 1JN0A 2VZ8A 1FK8A 4FJ0A 1TPYA 3ID6C 4MCIA 4F72A 2O2CA 3NHWA 2YINC 4FFVA 3KKMA 4UQLA 3TPCA 3WY9A 3K9NA 4JDUA 4NCKA 2WF9A 5KWIA 1FUUA 3WNDA 2E18A 5K0LA 1Z8HA 3VNVA 2JIMA 2OE2A 4H4CA 4HF7A 5C46F 5CEEA 4HDRA 5DM60 4PVDA 4MQFA 1EM6A 4RKFA 1MJ5A 2GM4A 1FFBA 1S2NA 1Z5ZA 3QMWA 3A4IA 3CT6A 4RENA 5BMVB 4M9QA 2ZKLA 4XGKA 5CXUA 3HY4A 3QEJA 1GUAA 3M6LA 1VE5A 3EDRA 3NBAA 3T1HB 3EQ8A 4WESB 1VFPA 4P80A 6Q21A 2I7CA 5HM6A 2A1TR 1T5DX 2QMZA 3E22A 2LP4Y 4QU9A 4UU8A 1YDHA 1FYVA 2XCOA 3ELDA 3WL8A 5LA6A 2OLEA 3U4GA 3G7NA 4NZZA 1YK0A 3LRXA 4BU1A 1ZOLA 4LZOA 4ZOLF 3G0OA 2X8AA 1RAIA 3BAZA 1NE7A 3CF4G 3HCEA 2CN1A 1ZU5A 3NPAA 4RL6A 4BFLA 1E77A 1J39A 3BGDA 2DPYA 1B42A 3I23A 3RREA 4BQEA 3GL9A 4NCBA 1JSRA 1G18A 5F98A 3X2SA 2Q6TA 1NM5A 1ZJ6A 4TKUB 2CDNA 2QSYA 4P36A 2YVAA 4HMPA 3IQXA 4KLAA 1BZYA 1JVSA 3VU3A 4BNMA 3DF9A 1Z4QA 4CM1A 2PTHA 3PFIA 4LYFA 3SF8A 3GD5A 2VJCA 2GBIA 2H52A 2CJFA 3S8EA 5KU1A 1GPH1 5CNIA 1OIVA 1PF7E 2H5JA 1ZBDA 4JCOA 1XEAA 2Y71A 1T9ZA 2GCGA 4NENA 4X1IB 2R5NA 4NNOA 4RMNA 1R2QA 4WZBE 4D5GA 2JVJA 3M4JA 3PFCA 1Z8DA 3O8QA 1VMEA 1F4PA 2A33A 1ZXXA 4HCJA 1QGAA 4OHFA 4WY2A 4YCJA 3CW9A 2IEBA 1VKZA 4MZXA 2GNPA 3MB8A 2C3PA 1L4NA 1OZFA 4ZK6A 1VMDA 4EGFA 2WTXA 4DLWA 3OHMA 3JALA 4TSRA 3RSOA 4OFWA 1AU9A 1KA9H 1BHJA 2XD9A 5EQFA 3GEPA 5TQVA 1W0JA 4BNXA 1L7EA 1XN4A 3FDZA 1XQVA 2A88A 2OGUA 3ESRA 4MITA 3D6JA 5BNFA 5AVYA 2OCXA 1IM5A 3IELA 4IDHA 2B4QA 7AT1A 2AOTA 4YP5A 3GLHA 3PGA1 3T95A 5K1ZA 1KOFA 4M0EA 3CW2A 4C01A 3EIEA 5FWXB 3FCSB 3NX4A 3TDNA 1W1IA 3F73A 3V2HA 4LHYA 1HT1E 1LWNA 4ENVA 1QPZA 2L82A 3ZDXB 4G0PA 1PBNA 2FEPA 2ZYIA 2EGUA 5CB0A 3RANA 4P32A 2B8EA 1R4MA 2E55A 1NKSA 3LL4A 4LJ7A 4ZYLA 3QLVA 5A5VA 1L7OA 2CLOB 3BKXA 5LCXA 2YRFA 1Y3HA 4HFMA 3VJKA 3I3OA 3IMEA 1XYVA 3L3BA 4IGKA 4I55A 4YMLA 5ALPA 1M54A 1ZNQO 4EW3A 2XE8A 3H0KA 3L46A 4WK4B 5CGQB 5EWLA 3W79A 2D1SA 3K1AA 5E6UB 2R1VB 4TWBA 2YOGA 1EDBA 4Z51A 6LDHA 3P9ZA 3PKZA 4BO8A 1PKXA 4JMLA 3WP1B 3OWHA 4OKSA 2PUDA 2CXSA 4ZMBA 3N76A 2WZDA 3DKIA 9LDTA 1PWXA 1LJ8A 3DBHA 3F5MA 4HAVA 5KQLA 2H8KA 2G71A 2JFXA 2ZATA 2VYQA 2WQ6A 2WF7A 4Q00A 4IGAA 1A97A 2GHTA 3HEMA 4KUEA 4YPFA 2QL6A 3QU9A 5DYTA 4J2TA 3CVJA 1AX9A 1JHAA 5KDLA 2XCQA 3RS3A 2QBYA 4HD8A 1U7UA 2PTGA 1L4YA 4YS6A 4QQ8A 1DCMA 3HGMA 4A27A 1HRKA 3GQBB 4JLJA 4DUGA 3HK2A 3GAFA 3CM0A 5FOXA 1ZD2P 2Z56A 3QV1A 3FFBA 2CZQA 3ADCA 2NT3A 4JASB 4OGKA 1E0KA 2HJVA 3VR2A 4DMHA 4HNQA 3OIVA 2XUKA 4E09A 2WG2A 2QGFA 1SNYA 4U8HA 4RFVA 1GU1A 1RE1A 5SY4A 4IVQA 1PJAA 1PK8A 5LWHA 3ND9A 4OIMA 5HM8A 5J2UF 4RM2A 2CHUA 2GM3A 2AJDA 3TW0A 4YALA 4XTCS 3CWCA 4Y6OA 3P52A 1XCLA 4F4IA 5JU6A 4TVBA 3FN4A 2BPOA 4EF6A 3UWPA 3A3KA 4AO7A 3RAEC 4CU5A 1NTOA 4N9QA 4KQ6A 2M1XA 3HWX1 4S05A 4Q9NA 3NHZA 4R31A 4KR0A 4EG4A 4GSLA 3QUQA 3ZK7A 1N33B 2JF0A 2O1XA 3JVUA 4E5KA 4KIFA 4Q66C 4JBYA 3B1XA 4G97A 5HMLA 4QGBA 1NUSA 3PG5A 1HE5A 2W2KB 4U7JA 5CIWA 3ROQA 1UKEA 5TVKA 3J7AC 1PR0A 2Y0EA 1UMCA 2X6RA 1KIAA 1UIMA 2J7PA 2ZDGA 2A86A 2RC6A 3NYIA 2QG4A 4ND8B 5LA6F 4A0QA 3AHIA 4DR3B 3O93A 1UXOA 3X1YA 1P0MA 2AZDA 3VNSA 4CDRA 2X23A 2W00A 1FCJA 4AYXA 5DXFA 4C78A 3KPJA 5TGDA 1YK1A 2NW6A 4ZREA 4HDKB 1IY8A 1QGDA 1KO8A 4H77A 4J3JA 4CI9A 4JJIA 3UJ6A 2BFFA 5HQJA 1PVOA 1HZJA 1XU4A 4OFZA 3GRVA 4TMYA 3TCXB 1M1YB 3OPXA 4HUJA 3C1TA 4A2CA 2WHRA 2OB1A 3N8KA 4ZZ3A 2YHIA 5IU6A 2G9RA 3L6DA 1P4GA 3WLOA 4RZ3A 3VU1A 1Z2CA 1IJEA 4A10A 1UDAA 4B33A 3A1TA 1QLJA 4OMCA 1KK2A 1WCV1 4UREA 3F6SA 2OEPA 4J1TA 3V1YA 1XTJA 4R1UA 4FFMA 2HXSA 1ZNWA 3IB6A 4PYLA 2AN5A 1G6Q1 3NOQA 5IH7A 2O7VA 4K9MA 1YIDA 3DBHB 3SZLA 3SMQA 2XNDD 4Q34A 1ZVVA 3G8DA 3ROXA 4M3NA 2VBIA 2G4LA 3R3ZA 4TX1A 3LP6A 3O90A 3IL2A 5EPEA 1G5QA 4YT2A 2CFRA 4W1PA 3THSA 2GD0A 2QUAA 3KD3A 1GZSA 2AI1A 3LZDA 4AW9A 2Y6VA 1BXRB 3KJGA 1NJ8A 5BQ5A 3GMSA 4GX5A 1KIMA 2XEDA 1C0LA 1M67A 3D3NA 1C9YA 5TR9A 3OOEA 4Q4AB 4C6HA 3IHKA 3GQBA 1RHQA 4A8JA 1H8EA 3SLRA 4CKEA 1U1GA 1C2TA 1WY5A 1A7UA 3FIJA 3G6WA 4RD4A 4CG0A 4FYIA 1T5TA 2YUIA 5FFFA 1K7FB 2QW0X 3LPMA 3ZZ0A 4WNAA 1VJGA 3TB4A 3W9UA 1Q1BA 4A8TA 2VDNB 3GP8A 1GSOA 4HAOA 3HUUA 2GKOA 1UODA 3A2NA 1IPEA 3A9TA 4Z9AA 1UK8A 3JAKA 2IIPA 5K0SA 1TD9A 3RWBA 5KNBD 4RHTA 1Z29A 2GM9A 3N6RA 4PF1A 1M6VB 4QWWA 3SICE 2Q21A 3E5RA 2EARA 3EARA 4Q4CA 1QU3A 1Y6JA 4QDKA 4TYMA 4XEUA 3CH4B 4MRNA 2BMJA 1EXWA 5TY0A 3QI7A 4PZ9A 3B51X 4QEDA 1E4EA 3MJRA 2P2SA 4H6PA 4QJ5A 5ECGC 1SC3A 2Y8EA 3EMDA 4OXKA 1Q0PA 5D87A 3VR5D 5AVZA 5FLXA 4ZQBA 5EHZA 3IDSA 3PT9A 2P3QA 4MR9B 2H4JA 1MC8A 1Y1SA 2QTRA 2O8FB 1ECLA 2PJUA 4CMKA 1QLWA 1XNQB 4GC5A 3UHFA 1NN1A 2WP8J 3WQRA 2WJYA 2P4QA 4C0KA 1YS7A 2VDVE 2ZB3A 1P8JA 4P6VF 4HNSA 1U9YA 3K9CA 4KUHA 3MEQA 1T9CA 1ZJWA 2QE7D 3MCTA 4J0CA 3MWEB 3RVLA 4O2BB 2X5JO 3QYFA 4UBOA 4PXSA 4JT4A 1VKHA 2R65A 4OJNA 5GVRA 4B5KA 1SVMA 2P4UA 2XKBA 4DV3B 4OMUA 3LVFO 5KNDA 4AQ7A 4D3ZA 1EFKA 1OAOA 1RAAA 3OP1A 2H07A 1TZKA 4EX7A 4UKDA 3L43A 3QLJA 3BMXA 2AG0A 3AR8A 1XMJA 2G9ZA 3CRMA 4OHCA 2NXEA 4UHBA 4ZOEA 4ZVSA 5A0VA 4Z1MA 1S6YA 1AUPA 5CLGA 1AUOA 1ESZA 2FZWA 1HSZA 1UMDB 5I7FA 4YMIA 2QMQA 2D2IA 2YHIB 3U7GA 4P54A 1HI9A 3WFIA 5C7LO 3ORSA 1GARA 3AKYA 4TL7A 3C7KA 4ZEXA 2FX2A 4HFNA 1Y5RA 5K0JA 3DEIA 2XQJA 4UZFA 3EGCA 4CM4A 3FBTA 4BV8A 4UCQA 5ED0A 4I14A 2HFKA 3VR4H 2HNBA 2UYCA 3OCZA 4BKMA 5REQA 2WHXA 1M5TA 1SXHA 3E3MA 4KV9A 4DJAA 4ERXA 5I3CA 5IAJA 2ZUCA 4QU8A 2I4MA 5FPKA 4MVJD 1NLMA 1POXA 1G8SA 2DQ4A 3QVUA 1C1XA 5KHOC 1BQEA 1Y1QA 3D7KA 3A27A 5AVXA 1DHRA 3LYUA 5CB6A 1ZGJA 1NVVR 2IYLD 3QW4B 3EPRA 2P2GA 1M2NA 5ICSA 2OHJA 2P1DA 1JFLA 3CR3C 4MUFA 3ZV5A 1TF7A 2FVYA 4JIGA 4RULA 3HCFA 3OE4A 1Z5VA 3CQ9A 3K4QA 2ZETA 3FJYA 4MS4A 1UUFA 2GPYA 4RH3A 4WOPA 3F8SA 4UHCA 3L2OB 3MQ2A 5L40A 2BW0A 2HJ9A 2WD9A 4KHPB 4ITRC 2IY9A 4K9SA 2IS1A 4MV8A 2AMJA 3F49S 5K5EA 4Q3EA 3EQZA 5CCXA 2OC4A 3V8MA 2GO7A 1W96A 2QVLA 3OTHA 3RI3A 4EEKA 3WICA 5CB4A 5CX4A 1E3JA 2MSCB 2QIOA 4DHWA 1WOMA 1G20E 1G16A 1WNTA 2V7TA 4IZOA 2O2GA 4Z53A 4FFWA 2F1OA 4AICA 1M8FA 3UPTA 2WUGA 1SD1A 3R74A 3AM1A 1Z6AA 2RGDA 4KU4A 3M89A 1D2GA 4N5MA 1X7ZB 2QJOA 1DRVA 2J67A 1FW8A 2WYVA 4B43A 1S4MA 1T3SA 4UDXX 1GCGA 3AUSA 1KFJB 1KI1A 3VNRA 1L2TA 1WV0A 4Z4HA 4I50B 4V38A 4BFXA 1T15A 3FPGA 2VC2B 4YJDA 3VPCA 2B25A 2XAAA 5IVHA 3URMA 4IJMA 2EKPA 1COZA 4OSOA 4P08A 1CUGA 5KOHA 3CBQA 4DBZA 2FWIA 1P6QA 4KLRA 1VSBA 3RODA 2XNSA 7MDHA 1S5PA 3W5JA 1F14A 4JBXA 2D1RA 3TVTA 1ZVJA 4L4UA 2BRUC 3M6MD 3QX8A 3WYNA 3AB3A 3O4HA 2HJSA 3Q8MA 5BNTA 2WINI 3DVSX 1UBLS 3C5VA 4B1FA 1LBSA 3AGPA 3NUGA 3LW7A 2JHCA 1B76A 3LIPA 5LDGA 4CT5A 1RXWA 4E15A 3ILYA 3QJGA 2QZPA 3BDIA 3L4JA 2CDCA 1ZCJA 3GVPA 1VHLA 2WM9B 3HSKA 1AV6A 2HU8A 1EEHA 2NZYA 3EPPA 1U3FA 4ZIRA 3KVNA 2E7ZA 3IPRA 3ICOA 5BWOA 1Y9EA 3RNOA 2CV1A 5JD4A 1TFUA 3IMKA 1IY2A 1J70A 2Q9CA 1GWNA 2QX4A 4C4ZA 5CEJA 1K2WA 1R9GA 2PS3A 2EFGA 5A6SB 3VZSA 3WMEA 5ARCA 4Y0NA 4MP6A 2WTMA 3D4IA 4WZAB 1UZAA 5KQSA 5REQB 1T8UA 1DBRA 1GQ2A 1Z4KA 2GR9A 3DOOA 3ZC3A 3MC1A 2XADA 1GGVA 1D04A 4YVFA 1GTRA 4O2BF 1UMBB 2OLKA 4XDGA 2RBGA 1H2YA 1DBPA 2E4AA 1TD1A 1IFXA 1WUIS 3JQ8B 1SO8A 2YXPX 3DOCA 3EFHA 3DTVA 2QUBA 3D0RA 4MS3B 4QYMA 1FXWA 4ALKA 3N1UA 4MTCA 4FYJA 4OHPA 2PUHA 4LSWA 5HJ2A 4ZXPA 1BN7A 4JCCA 3BH0A 4K9QA 3AP3A 4MUGA 4LX0A 2QS9A 2SICE 3FVQA 4F9TA 5DCLA 2H1HA 2ONYA 3SI7A 2YS6A 4H3SA 1H0KA 1I10A 1PZHA 1HTBA 2JK1A 2AFHA 1OAAA 2Y1FA 3MAAC 3N05A 1BWRA 2ZSJA 4XAQA 3OZTA 5IJ0A 4M7OA 2C4HA 3OJ0A 1TTPB 4UVHA 3AP1A 8AT1A 3U4QA 2GZ1A 2R2AA 5DHRA 2VVTA 2PK3A 1CUSA 1X8LA 2YXBA 1YE8A 3PJDA 4JY7A 4G0OA 1I6MA 4KVFA 4B79A 4CW7A 4L6CA 3B53X 5CK4A 1Z37A 3C3MA 4FFRA 5EXXA 5FOTA 4KH0A 5L3ZA 3FFAA 1P7PA 5LR6A 4ZYXA 4Q12A 1Q1ZA 1X7ZA 2ECOA 2H51A 3G1UA 3MMNA 1GNSA 3PQ3A 1QYVA 4G5FA 3MT0A 4IR7A 4UVEA 3W9BA 4NXMB 4RDCA 1TYDE 1ZHHA 1F2DA 2I66A 4ZWNA 4BCCA 1VG1A 4PSCA 3OLQA 1JIKA 1SCUA 3WDLA 1P1BA 2FTKE 4FFLA 4I50A 4LHVA 4MVJA 4F38A 4WXPA 2ZR9A 2DWPA 1K86A 2EEPA 1JA1A 1RJFA 2CXUA 2IP2A 4KN5A 1KO4A 4JP2A 4OO3A 4Y1GA 5DP2A 4NSNA 1OXXK 2JLZA 4EGJA 1VTKA 2QRHA 2Q4DA 4OG2A 1WULS 2JFGA 3RD5A 1T2EA 3QMPA 5CVTA 3ZD7A 3HADA 4UAJA 1OHHA 2H2WA 2W2VA 1ZN2A 4HN4B 5JVDB 2FRDC 1S96A 3RSFA 3U0VA 1KR2A 1YCFA 3PGKA 1J8QA 1CUHA 4IIYA 4EJMA 2VDWA 5C8VA 2K4MA 4IEFB 4WKCA 2W8ZA 1L6IA 1OXUA 1U2GA 1KI2A 4LTDA 2UYQA 4V0RA 4LQDA 4YRBA 3G9TA 4WZBB 1CZUA 2EC5A 3KQUA 1B2RA 1O95D 4TTAA 1SKUA 3PUKA 2VQDA 4N18A 4PZZA 1J2EA 5JQGA 1DP4A 4Y2GA 3SQLA 2ZXFA 4KYIB 5HYVA 5KJ1A 3IEVA 3AUYA 1DKPA 2DR3A 1NVKA 5LYJA 3H5NA 3KYDB 4L51A 1C4OA 3H0EA 4YRFA 2PO7A 1XK6A 4JI2B 2BSXA 2WTUA 1QMPA 1KOJA 4LJ5A 4YO8A 2FAXA 2GM5A 5A6SA 1JH9A 1T9GR 2VPPA 4Q4HA 5E6SA 1VPTA 1R6UA 1UDWA 3MILA 4IRMA 5FCDA 3BICA 4QGGA 4XM2A 4X64B 1CUAA 4WK2B 2YJGA 3AY0A 4LJAA 1EBUA 3EGIA 3RUDA 5JAHA 2KMLA 4EA6A 1XELA 4IGFA 3UJNA 3Q7IA 3L1KA 1FVHA 1C1HA 1DIHA 3DZ8A 1BU5A 4AM8A 1EFRA 3E2IA 1SXJC 3UAVA 4WKBA 2JGEA 3DAHA 1N6RA 2GF2A 2DSNA 3GARA 5EZYB 2VPWA 1EX7A 1OHHD 3H2JA 4XOUA 2FG7C 1ECBA 1KQOA 3LBAA 1DVRA 2RHDA 1I1QB 4J3NA 1RBQA 1EPUA 1RQ7A 2O2JA 4MI3A 4ESOA 1T8YA 5E4FA 4NC9A 2OT3B 4BFUA 3E4CA 6PFKA 2CXPA 4HPWA 4DEXA 1IUNA 2GILA 1SZCA 5GJVC 4X44A 3WB2A 2VDKB 2XHEA 5JAPA 1GPNA 3QBEA 1IAQA 3D5EA 4QT0A 5FTJA 3RK1A 5KCMA 3ZDEA 3WLKX 1CV2A 4EHIA 1OCEA 3IIKA 1HRDA 1KDPA 1YH3A 2BY4A 2Q29A 2OYRA 2MYNA 1IG0A 4UE3S 4POAA 1DAKA 5I9BA 4WZ6A 4C3ZA 3LP5A 4DQ0A 3PLRA 4BMVA 4Y9RA 5J5VA 3M5DA 3WWOA 5LUAA 1RWKA 5IK2A 3FG9A 1TMGE 3MMXA 4MCJA 3VMMA 4QOHA 3ADDA 3GFVA 3ZE1B 3GZNA 3UWSA 2NXNA 2QPOA 3GCGA 1VDZA 3QU7A 4LX8A 4YRNA 2HRRA 1LB1B 3BBLA 1XEXB 4KRXA 1P7VA 5EXPA 1ISSA 4EFDA 5CIYA 2W48A 4KQWA 2Y4OA 2XMZA 1KJZA 1GT91 2FP3A 3OC6A 2H0AA 5EP2A 1SCQA 2CNWA 4C2AA 4ARSA 2FXIA 4WFQA 4QT4A 3IB3A 1XNHA 1RLOA 1KBQA 5B57C 4LQCA 3O6VA 3OO0A 4PYKA 5HUJA 1PVDA 5JDCA 1ZR2A 2O8DB 1M2WA 1BVHA 2H1OA 2FN9A 2PHZA 2EX1A 3FPAA 4JUIA 4W4TA 1FVFA 3IIJA 3OHSX 2L18A 1UOQA 1C30A 3NTQA 4I5EA 2VQ6A 3A6LA 2WJ4A 4XUDA 3W6UA 5F2NA 4X65B 1QRTA 5ES4B 4X8MA 3TLGA 3JQCA 4N7MA 3SXJA 4RJLA 3GG9A 2HCFA 5G3YA 5HTOA 2EEZA 5CAEB 1U7XA 5CFLA 2WFLA 1AUQA 4MVCA 1FFXB 3RG8A 1SZDA 3PNLA 4L4RA 1KSJA 3AINA 4TQUS 1J22A 4RSMA 4R5MA 1WA5A 1ZZEA 4LI0A 4XVRA 5EUBA 5FBWB 2C1XA 1N1MA 2DWOA 2R3SA 3C8MA 1TZBA 1FFHA 2J5RA 2YHUA 4HTAA 4OQNA 2JC3A 4UDNA 4WINA 3NJ4A 4N0PA 4QYSA 3W5VA 3KK0A 8ADHA 4YA6A 4CE6A 1C14A 3HM9A 3VR6A 4KE9A 3E48A 1YA8A 2G88A 1EMDA 1PRYA 1RWVA 1ST3A 1TZ2A 2EERA 2D0IA 2FZKA 3AEXA 2X5OA 3FLMA 2FWPA 3GWZA 4IF6A 4MEJA 5U4XA 1JHVA 4W5NA 3BQNB 5HFJA 3L06A 4IYRA 1Z7EA 2YNMA 3TMKA 1IHYA 1E7WA 1TEVA 4H17A 2GVZC 3S2YA 1AKQA 3VDXA 1OFHA 1XD2B 2OORC 1QE3A 1V5EA 4GBJA 4P1ZA 4BPBA 1GNQA 1BE1A 2X0RA 4AG5A 3DW3X 1NATA 2PMWB 2PKXA 3BFPA 1Z4IA 4X6YA 3HCRA 3WWEA 2PEZA 3C43A 1GN8A 3FAZA 4LHXA 4X1YA 3WBBA 1DJPA 1G5TA 1NHGA 2ZVQX 3ED5A 1V1RA 2DE0X 3HDGA 2ICAA 2XEXA 4K9LA 5D3MB 4CTOA 2VHJA 4ALIA 4WV3A 4FZRA 1M7GA 1T5IA 3TFQA 2VXCA 2IYRA 2V7BA 4Y7CA 1MC4A 2CE7A 4Y9TA 4F4UA 5JQWA 3F3KA 2COEA 1YR3A 3I53A 3UFBA