2FPGA

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
305
structure length
305
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 116
structure length 305
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fpgA01
1H5QA 4ZQEA 3RUCA 1XQ1A 2PD6A 4DYDA 4D0RA 2J3KA 1DFHA 1H9AA 4NZ9A 4E12A 3WOHA 4RQTA 3NGLA 1HXHA 2Y1OA 3IMFA 4J6FA 1FDSA 3CUKA 3UXYA 3DOOA 3WGOA 4EDFA 3VPFA 2GZ1A 1NVMB 2GASA 1M67A 3M1LA 2AE2A 5FI5A 3RBZA 1X7GA 1QLHA 4RF3A 3VH4A 3K96A 3DHEA 1VM6A 2JD0A 1E3JA 1CDOA 4ZQBA 5TQVA 1E1MA 2VHYA 5KKAA 2CZCA 4NQZA 3ROKA 3IUSA 2A9FA 4NFYA 5BSFA 4EBFA 4JX8A 2J8ZA 1VJ1A 2OBYA 3JQCA 4NHEA 1P1KA 4MKXA 1R0KA 4FR5A 3RUDA 3V1UA 3NDIA 5JFOA 3E03A 4CLHA 4CQLA 3TFQA 2AE1A 2H9IA 2YHIA 3ZZNA 2ZATA 1LRJA 2IODA 3IUPA 4J49A 4YJFB 4DXHA 1PS0A 5L40A 3LZ6A 1ULSA 3CE6A 4LRSB 5C37A 4RF5A 2GUGA 3JYLA 2JAHA 8LDHA 1SPXA 4WJZA 4FFMA 4CUJA 1DJQA 5JXWA 4Y67A 5MGBA 3TL2A 1J5PA 3Q9UA 4XKJA 2EP7A 2QHXA 2OO5A 1IUKA 3M2TA 4KMSA 4U0KA 1UZNA 1IYZA 5KVSA 3QQPA 1DIHA 4JNKA 1WDLA 1BXKA 1R4NB 4YBZA 1WMAA 2X4GA 3HWRA 4LISA 5CDGA 7MDHA 1JW9B 3PP8A 4YEDA 1LNQA 1GAEO 2AHRA 2OL4A 4K26A 3BIOA 3WLEA 4I5FA 3GEGA 3O4RA 3MWEB 1KEVA 2UUPA 5DT9A 1T2CA 2PGLA 1YBVA 2I9PA 3TJRA 3DZGA 1O6ZA 4K9DA 4L4RA 4TRMA 3X2EA 1W73A 3F5QA 1YB5A 2QX7A 3PXXA 2W8ZA 4K6FA 5F5LA 1LSOA 1D1SA 5L53A 3QRWA 1PZHA 4NJOA 1DBVO 5IFLA 2VYNA 4RPJA 1NPTO 3DBHA 5CEEA 4BVAA 1Q0QA 3V2HA 3OH8A 4XGNA 3ST7A 1E3LA 1R0SA 4P4LA 1A7KA 2JFGA 3Q2KA 4H3VA 4OM8A 4RQUA 4A5OA 2NADA 4DVJA 4BGEA 4PG4A 1SCUA 4TZTA 1JWAB 4CM3A 3ZCXA 4B7CA 1D3AA 1HWYA 1LX6A 4PG5A 3DZIA 1FF9A 4FCCA 4L76A 4Y6SA 2NM0A 1JAXA 4J1SA 2YQ5A 3HB4X 2C5AA 4RLSA 1KVSA 2NVUA 4UVGA 1I2ZA 4PIVA 3KYDB 2D2IA 5AXDA 2AEFA 3JCZA 3IOYA 3VPHA 1NQTA 1ZEMA 3FR8A 2P9CA 3ETGA 3OECA 5KVCA 5L9AA 1ONOA 5IDXA 1ADBA 3VZQA 2X0RA 1B15A 3HQ4O 3NKLA 3W8DA 4BKQA 1RYEA 1XHLA 2NVBA 2IXBA 4ALMA 2CSUA 1WNTA 3ZHYA 4E2XA 5T57A 5A9SA 3QHAA 4G2NA 4R9SA 4QT0A 4J7CA 1UDBA 3GAZA 1N7GA 4A26A 1PIWA 2DTXA 3CINA 3E9QA 4W9NA 5CPBA 5DDIP 3B70A 1LC3A 1RM4A 5A02A 2FPIA 2AG5A 4MIOA 3B1KA 1KVUA 4IDBA 4BOYA 4UVEA 5AXAA 4YR9A 7ADHA 2E6UX 3L6EA 4F6LA 3V2UA 1ISGA 4RZHA 3PDUA 1V6AA 2HJRA 3GFBA 4UAGA 1U28A 5TSDA 1M76A 2W90A 2EG9A 2X5KO 3GVCA 1B8PA 2ZCVA 4ALLA 4XIYA 1EBUA 2CDBA 2ZQYA 3JQ8A 3JD0A 4UEJA 4XQ9A 3VDRA 4BQPA 2DU8A 2HKIA 5F21A 3SEFA 4G65A 3OJOA 3CXRA 3I52A 2IZ0A 2IEDA 3AOEA 4JBHA 1TEHA 2HRBA 3DOCA 4RVDA 3QW2A 2RHCA 5B4TA 3I9NA 3DQPA 2JAPA 1GQYA 4FPXA 4DLAA 5HRUA 4CPDA 2O7SA 1T24A 2WE7A 4EI2A 2PA3A 3HN2A 2IDZA 4EEZA 1ZCJA 2RIRA 4FS3A 4QSMA 1PJ4A 3F6YA 1B16A 3K31A 5BNTA 3A14A 3P19A 1QRRA 4UVHA 2EJVA 3PQEA 2HUNA 2VTDA 3GVXA 4XJTA 4DIFA 1YDEA 4WLVA 3C7AA 3DZHA 3VPGA 4DPMA 4QEDA 1P1RA 2RH4A 4RVHA 4HFMA 3ZNQA 3K9QO 1ZNQO 2UUOA 3NJ4A 4FW8A 3WBFA 2O3JA 3ONFA 5BSGA 5IZCC 2NU8A 2CDCA 4E13A 1LLCA 3NEPX 4PLHA 3JYOA 4GI2A 2HJSA 2Z5LA 4J1NA 4YXFA 2DBZA 3OQ1A 1HRDA 1UH5A 3HZZA 3RROA 1Q1NA 4FGSA 4WKGA 3IKVA 1YDWA 3ENNA 5B4VA 2A4KA 2X86A 2X58A 1U3WA 3DAPA 4J4BA 4D7AA 3AK4A 4EUHA 1EMDA 2C0CA 1O0SA 3K92A 4IBOA 4IDEA 4KTTE 4Y6PA 4BB5A 5KKCA 2I6TA 4MVJG 1AGNA 4RVGA 5TT0A 4UUNA 1ZK1A 5A4DA 4CQLB 3FWNA 4U6QA 4CM7A 2YHIB 3BMOA 4CMHA 5CG1A 3LLVA 3TZ6A 4IZIA 2PGJA 2P9EA 3Q1LA 4IXTA 3C8MA 4F45A 1F8FA 1Q0LA 3C24A 1DIRA 5DF1A 3NTRA 4ZGWA 4B4WA 3CMCO 4MDHA 2I76A 4PLTA 3O03A 1DHTA 5TJHA 1WPQA 4X54A 2Q1TA 2CF5A 4I08A 4ND1A 4ZQFA 3WGHA 4CLEA 4YB8A 4W99A 4YRDA 3WGIA 4NFSA 3C3XA 3FHLA 3BMNB 3G3EA 4GGPA 5LCXA 3TRIA 2YW9A 1GUZA 2FR8A 4D3DA 1KEWA 1TB4A 4JJGA 5F1OA 4RCVA 4TROA 1HE3A 3GG9A 4JROA 3UGKA 4AJPA 1I10A 4A2CA 5FEUA 3QVTA 4AJIA 1KEUA 1B3RA 3F4LA 4QQRA 5EINA 5JCJD 1CEQA 5COQA 4J43A 3PLRA 4HFJA 3BMQA 1X0XA 1HLDA 4BO5A 1I30A 2EJWA 5EESA 3W6ZA 1L1FA 2WYVA 2OXIA 1P3DA 3RBVA 2EGHA 2H6EA 4AJNA 2TMDA 4Z0HO 2W2LD 1IPEA 2BD0A 2FWMX 2ZTVA 4IQ8A 2V6MA 1Z82A 1PSDA 1U2GA 1E3SA 1ENOA 1EVZA 3RI3A 3VHRA 4AJOA 4JP3A 3JQGA 1QP8A 5EERA 3D5QA 4O63O 3JQBC 1HDCA 5F3RA 4U7WA 1QG6A 4EJMA 3GNQA 4WNIA 3HHPA 4KUEA 4F6CA 3U62A 3HUDA 1NQOA 4OKIA 3OHSX 4WEOA 2CVOA 3LC7O 3NDRA 4JIGA 3RKRA 1A71A 3ZNNA 2IZ1A 1O9BA 1IB6A 1N92A 4JBIA 4RLHA 4IDGA 4NBVA 4AICA 3VVCA 4YAEA 4AJ1A 3H9JA 5KOIA 4RJTA 2ZQZA 4Q3BA 1JU9A 1PZEA 1JKJB 2Q45A 5EPOA 1Y8RB 3DAGA 4YJHA 3AI3A 4NBRA 3ANNA 2Q1WA 1OAAA 5CDUA 4N7RA 4AG3A 1D1TA 5JDCA 4LCEA 3KEOA 3HFSA 4L4SA 3S2FA 1EVJA 2ZYDA 4I1IA 1SB9A 2GR9A 3AU9A 1QORA 4CLRA 1KETA 5L4NA 4RVFA 1LRLA 3GHYA 1A9YA 4RL6A 1TLTA 2FPIB 1MC4A 4NG5A 2W98A 4R1UA 3WQQA 4IJUA 1ORRA 4FDAA 4WE3A 5A3JA 2DT5A 2PLAA 3UAGA 4WLOA 5B37A 1NAIA 4QUKA 5EQFA 4WECA 4BO0A 4BNIA 3TN7A 1IL0A 4ND2A 1HE4A 3D1LA 3VKVA 1I36A 3CZRA 1V3VA 3DFUA 2BFOA 5G0SA 5TT1A 4WPGA 1JLLA 5A3VA 2J3IA 4NH4A 4G81A 3O26A 3RJ5A 2NU9A 1Z6ZA 4BNFA 4E33A 3IS3A 1UXIA 5A05A 4YT8A 1MXHA 5A9RA 5L95A 3DO5A 1PJBA 5L45A 2GN9A 4XGKA 1XDWA 5GMOA 1ISHA 4BGIA 4CV1A 5I7EA 2Y0DA 3QWBA 1BGVA 1OZAA 2VTEA 4O5OA 4CM5A 4FC6A 4M55A 1OI7A 1DDOA 2YUTA 3FCOA 3INTA 2AQKA 2IXAA 2BMAA 2VOEA 1QR6A 2ILTA 3I9LA 2SCUB 1J49A 1GCOA 2OP1A 1RWBA 3MZ0A 2X5OA 3AI1A 1UJMA 1E7WA 1KVTA 3AM5A 3PJGA 4CMJA 5K9ZA 3KEQA 3E5MA 1A4UA 4HFRA 1ZEJA 4HP8A 4B8WA 2IZZA 1E7YA 2VRCD 2YFHA 1QSGA 3E8XA 4CQMD 4YJFA 3TOZA 1T1SA 2PZJA 1GEGA 2NU8B 4OXNA 3PHGA 4RDHA 3Q0EA 4DWVA 3JQAB 4GSLA 3H5AA 3ICCA 5KCZA 3JYNA 5KWEA 4ND4A 4HADA 3BHJA 2HRZA 3B6ZA 4YTEA 3DBLA 4GX1A 5DP2A 2RH8A 5I9MA 2ZYAA 1LC0A 2YYYA 1KY5A 1ZK3A 3INRA 4A10A 4CMCA 2YV3A 4LGVA 4AJHA 4CMKA 2YDXA 2H5LA 3VH1A 4UUOA 4ROSA 5TX7A 1E7QA 2NLOA 2YJZA 1R37A 2XAAA 3K2EA 3OICA 2Q2WA 3L4SO 3BAZA 5TC4A 4RORA 4J4TA 1WMBA 2C29D 4YAKA 1A27A 2UAGA 3HG7A 2OZPA 4OSPA 4FFPA 3BMOB 4YJGA 4BNMA 3MWEA 3G0OA 2NSDA 3C1AA 4Q3DA 5GZ3A 5IAAA 3CTMA 1I33A 4FOOA 5H83A 3WGQA 1KC3A 3ZU3A 1Q7BA 3UICA 3AUAA 3KUXA 3CMMA 5EJ2A 1HE5A 3GZNB 2Q1SA 4DBVO 3GMDA 3JD3A 3TSCA 2PTGA 1MG0A 3LF2A 2O3RA 2GGSA 2JHFA 5KIAA 4BUCA 4Z9FA 1P1IA 3ZHBA 1E77A 1GZ3A 1ZSVA 4K28A 4P4NA 1N5DA 3ZWAA 4BO8A 3GQVA 3WQRA 2PV7A 1YBAA 4MPDA 1W4ZA 4Q9NA 1YVEI 3H5RA 2EP5A 4RGBA 4R16A 4RF2A 3KZVA 1W0CA 4PLPA 2UVDA 1V35A 1AHHA 4ALKA 3U4DA 2HMWA 1LUAA 3BMQB 4R4JA 5JBIA 3NTQA 1W6UA 1DRVA 2VQ3A 3R0IA 1NR7A 2CNBA 4UULA 4PZDA 1SEVA 3F3SA 3SLKA 1NFRA 3M1AA 3WBBA 2NV6A 3WGZA 3VAZA 3WQSB 1ZK4A 3JD1A 1FJHA 4BO2A 1PWXA 4E5KA 3ORFA 4WLEA 1HDRA 2FMUA 3GGOA 3SJ7A 1F12A 3D64A 5JAIA 1ONNA 3GVHA 1HSZA 4CR8A 3JQGB 4XX0A 3N74A 3D7LA 1J6UA 3F1KA 5G0WA 4BKOA 2A94A 5HS4A 4CMEC 2WM3A 2V7PA 4O0LA 2C07A 3HN7A 3O9ZA 4BNXA 3RC2A 4BQRA 1LQTA 1EE9A 1XELA 3RU7A 1YRLA 4J2HA 4LMPA 4ND3A 3ZHZA 1XYGA 3GK3A 4RF4A 1FDTA 1NQAO 4MO2A 4FFLA 4MINA 5KJCA 2GYYA 3PGJA 4Q3CA 5ENVA 5JNLA 3FRJA 3ROPA 5TRTA 4YA6A 3TDKA 2PH5A 3ETDA 3DAFA 1NASA 3L4BC 1EFLA 1R16A 3O38A 4BO6A 4XRGA 3WX0A 4U6SA 1WW8A 2PKRA 3E9NA 4PLVA 2OORA 4YJHB 5EN4A 5ER6A 4E5MA 4L8VA 2VUUA 4DUPA 2GZ2A 1NPDA 3RC7A 1JVSA 4IS2A 1IULA 4RPLA 5G4LA 1Y7TA 2X9NA 3GAFA 4OXKA 4IDDA 1O94A 3AW9A 1MG5A 1Y9EA 3JD2A 3OQ6A 2BELA 3FF4A 1AHIA 2Y99A 1X7DA 1MFZA 1TT5A 2CD9A 3PHIA 4WCFC 4WCFB 3EZLA 3WS7A 2VYND 3EVTA 4BO3A 1DPGA 4BNWA 4O1MA 5IZ4A 1NHGA 3VVBA 5C5IA 4BNKA 3UKOA 5ITVA 3JQ9C 3LT0A 4M1QA 1JLLB 1AN9A 4OOEA 5IDWA 1FMCA 3AUUA 2NU9B 3FD8A 5IZCA 4HNGA 3ZV6A 4PLWA 3BTOA 1L7EA 2VT3A 3G49A 1VPDA 1ZZEA 4PGFA 4DQXA 1H2BA 3MJ4A 1LDNA 5A5FA 1ISFA 2G1UA 2IYPA 2P5YA 5COAA 4UUPA 3RUHA 1EE2A 2NTVA 3F5SA 3I3OA 5U4QA 1SAYA 3MOGA 5JO9A 5FYDA 2Q1UA 1PQUA 3OJ0A 2EKLA 3MJCA 1BHSA 1PU2A 3FN4A 4YACA 4XR9A 1E6WA 4CLDA 4PFJA 4E31A 4KDEA 5ICMA 1K0UA 3PWZA 1HYGA 1QXSA 4ZD6A 4RDIA 1VSVA 1NM5A 1C3VA 2Y67A 2JL1A 1BWSA 1ENYA 4AJ2A 3DHYA 5DOZA 3T7CA 1ZIDA 3K5PA 5T67A 3H3JA 2VRBA 3DBLB 5DOVA 2NU6A 4JLWA 2XOXA 3ZWBA 2X0IA 3HB5X 4L73A 1X1EA 4Z0PA 1DC4A 3ONEA 1NXQA 4XGIA 4M89A 2ZB3A 3DL2A 3M6IA 5ILOA 2QRKA 3NT2A 3GPDG 1ZO8A 1GDHA 3BMNA 5FFFA 2ZTUA 4L75A 5IF3A 4TSKA 5BSHA 4IY1A 4YVFA 3FTNA 1U8XX 2VWGA 3FWZA 5T6BA 4J4HA 4CR6A 4YJGB 2VUTA 3Q3CA 3QA9A 5DZSA 5G0VA 1ISMA 4KUGA 3OF2A 4YRBA 1HF3A 2HMSA 2IRWA 1PJ2A 4JK3A 3H4VA 2D3TA 4KP7A 3KSDO 3P7MA 3LLSA 1GYRA 3NAQA 4IQ0A 3S2GA 1GADO 3OP4A 5CEFA 2B4QA 1HYHA 3UW3A 2PD4A 5KJEA 2OGUA 2IE0A 4J7XA 5IN5A 3AY3A 2FOIA 4C4OA 3NDJA 4WK6A 5CDYA 3LSYA 4II2A 3L6DA 1GPDG 4D46A 4Q39A 4IQGA 4D44A 1C0KA 3IL2A 2C20A 2YHUA 1CWUA 4JQCA 4ALNA 5L7TA 1K2WA 1PJTA 3CH6A 3VZPA 1PJQA 5LDGA 5L51A 2VWHA 1CERA 4J16A 1GQQA 1N2SA 1I3MA 2D4AA 1VJ0A 3QWIA 1EUZA 3BXXA 1U3UA 4LK3A 4CODB 1ZK2A 4J91A 4YT4A 9LDTA 4FFOA 4TVBA 3BTUA 3DBVO 1KVRA 2PH3A 4R5HA 3LT2A 2E49A 3CKYA 1QYXA 3IJPA 4AJEA 1CIVA 4EJ6A 3JYPA 1RKXA 1R15A 5JO0A 1JAYA 2FZWA 3FBGA 3ULKA 3I23A 3STHA 5TLSA 1JKJA 3AFMA 3H9EO 1HE2A 5DBIA 1Y8RA 3OBBA 1YKFA 1X1TA 2DVMA 3BTSA 1VRWA 2G76A 3FBTA 1X7HA 4PRKA 3TQHA 2X7HA 2QZZA 3ENKA 2P2SA 3GFGA 2W2KB 3BZUA 1YQDA 4GSKA 3JTMA 4XX0B 1CQIB 3HNPA 3MOIA 1GV0A 1S6YA 5AXCA 4WOJA 2QW8A 4QFCA 1T25A 5IXYA 3QVWA 4J0FA 4WEQA 3FSRA 3BHMA 2NQTA 2PZKA 4FIZA 4B3IA 4CJXA 1FDWA 4I8XA 2GD1O 3T4XA 4D42A 4GWKA 1KS9A 4CV0A 1HZJA 1R6DA 1R66A 2HDHA 2TMGA 4HV4A 1EVIA 3QP9A 1O89A 1Y5RA 4MVJI 1VJTA 5TJ9A 1E0DA 1JTVA 1GFSA 3ICPA 1U5CA 3WJ7A 1I32A 4NPCA 3SBOA 3ZV4A 3D0OA 1ZVMA 2HK7A 4ID9A 3AUTA 1MGOA 1NFQA 1C1XA 1HDZA 5F1KA 4BO4A 2Y1CA 1C0LA 1H6AA 1N8KA 4GVLA 1HDOA 4YJDA 3A28A 5JC1A 4MVJH 1PR9A 2ET6A 3SXPA 3C7CB 3LYLA 2EF1A 1R12A 1S7CA 1ZFNA 3GC6A 4BGVA 3RUFA 3PEFA 4KWIA 1HT0A 1AXEA 1LSSA 1SNYA 4JJIA 1YWGO 3PTZA 3GF4A 1TT5B 1PGPA 1X15A 4WLNA 2SCUA 1MUUA 2P9GA 2ZB8A 4NDNE 3DBRB 2CMDA 2NWQA 3A1NA 3KTDA 2PK3A 2ZK7A 5JS6A 2FR0A 1A5ZA 1PJLA 1U1IA 4R3NA 1LQUA 1SC6A 3W6UA 2NNLD 1RM5A 1Y9AA 3ZNOA 4PVDA 1BDBA 2B69A 4H15A 3DEYX 5U9CA 3LDHA 3OEYA 4EEXA 3L0DA 3LU1A 3DHNA 4H16A 4QECA 1GZ4A 3O8QB 4WCDA 2Z1NA 1ZMOA 3JQAA 1Y81A 2Y0CA 1KY4A 2R6JA 1K6IA 4ZQGA 4O59O 1E5LA 3IKTA 1DLJA 3L9WA 4XQGA 4B3JA 1GU7A 4CMIA 2FPPB 4NJMB 3RJ9A 4DMLA 1I3KA 1RM0A 2VZ9A 4HNHA 1E3IA 2C2YA 3PK0A 3NX4A 4J2OA 1PGOA 2UV8A 3WXBA 3MTGA 1YQXA 3VH2A 4LSMA 1GPJA 3GVIA 3L6OO 1T2AA 2WJPA 3PWKA 3F1LA 1T26A 4PCVA 4PZCA 3WTBA 5KJ6A 1UXJA 3A06A 3OETA 1CF2O 2I65A 1U7TA 2EIHA 4DC0A 4WOKA 3SC4A 3PFFA 3IP3A 1YL5A 2X5JO 5BSEA 1EUCA 2PKQO 2JCYA 3IQDB 3K73O 4AVYA 3GA0A 1U4SA 2GF2A 1JWBB 1XGKA 3KYCA 1GUFA 4CM8B 1YB4A 4E0BA 1NWHA 1Z7EA 3KLMX 1EBFA 3GN1A 2VNAA 4YDRA 4J0EA 3GLQA 4BIIA 1B8UA 5B12A 2FPGB 2NU6B 1VI2A 3PYXA 3WYCA 3BMCA 3A4VA 4R68A 2EHDA 3I6IA 2F00A 1M6HA 3UUWA 3LQFA 1TXGA 2XPCA 3GZNA 3Q11A 4IUYA 2O3TA 4E5PA 5JSFA 2BRUA 4J1TA 2ZJ1A 3U4HA 4CUKA 1M75A 4R1TA 1UXKA 2C54A 2Z95A 3S55A 1G1AA 1UXGA 2HAEA 3GG2A 1T4BA 1WP4A 3PYMA 1YOVB 2A92A 1YO6A 1DFIA 3V2GA 1B7GO 3D3WB 4R69A 1NAHA 1MX3A 1DEHA 3PLNA 3GGPA 1XEAA 4XYMA 3F9IA 4XZ3A 5ER9A 5F1PA 3RSHA 4B8ZA 1PTJA 4D43A 3H9GA 4P8RA 3ZWXA 3QWHA 3X2FA 4Y9DA 3D4PA 4YT2A 4MJLA 2ZTLA 3ZH2A 5JDIA 1I3LA 2AEJA 4XB1A 2JKVA 2P4HX 3EAGA 3PPIA 1BW9A 1YXMA 4IINA 4KTVE 2DPHA 3PI7A 4GKBA 4E21A 4DIBA 4XR4A 1LRKA 2PD3A 3R3JA 4PLCA 1DIBA 2PKQP 1U3VA 5G4KA 5BNIA 2RAFA 1XKQA 1MFPA 1PL6A 3I5MA 4LW8A 1DIGA 1ZSYA 3QVSA 2DPGA 2NTNA 4IGEA 3NTOA 1UZMA 3ZV5A 1NTOA 2BFMA 3H9QA 4RVUA 2BLLA 4NK4A 2DUWA 3GDFA 4FD3A 4IDFA 4OQYA 1B0AA 4YT5A 2EV9A 3WMWA 1RM3A 2DM6A 4BMVA 1DAOA 1VKNA 1GD1O 3EZYA 3RASA 3RKUA 2D1YA 3L4BA 3TFOA 3WWZA 4EUFA 3GR6A 5DNAA 4J1QA 3UH1A 5MDHA 3OJFA 3P5SA 2AXQA 2E82A 2QQ5A 4Z0TA 3VZSA 3DZKA 2BH9A 2POQX 5HS6A 5JMPA 1H0KA 2DBVO 4BNJA 4F3YA 1O95A 3F47A 2HMUA 1N7HA 2VN8A 2B4RO 4EUEA 1K3TA 1FXSA 1KIFA 4GVXA 3U3XA 3PGXA 2NUAA 1EK5A 4GMGA 4WCFA 2DTEA 2V65A 2WTBA 1GTMA 4Z9XA 4U5QA 3WLFA 1PQPA 2BGMA 2Y0EA 1H9BA 5A04A 1GV1A 3VH3A 1I8TA 2FHSA 3K6JA 2C59A 4BO9A 2NQ8A 3GMSA 4W7IA 1DAPA 3ZWCA 1GYPA 1EDZA 3VOSA 5T64A 1X0VA 1ZXBA 3BA1A 3DC2A 1P0FA 1NFFA 2UDPA 4IPTA 3GDOA 1C1XB 3WDSA 2VHVA 1MLDA 5JPIA 2JCXA 5ICSA 3ZWPA 4BNLA 4L9RA 4E2WA 1HZZA 1YJ8A 1BG6A 3K8ZA 2CUKA 3OIFA 3HDHA 4E4YA 3WGTA 5T5QA 4BV8A 1PX0A 1NP3A 2ZTMA 2AEMA 3KRTA 1XWFA 4CUZA 1VC2A 2EGGA 2WSBA 3D5TA 4YYZA 3OA2A 2G5CA 3UF0A 5GY7A 3QY9A 5DP1A 2HK8A 3PJDA 5HTOA 5BQFA 1KVQA 3MCVA 1P1FA 4D3SA 5JCXA 2LDBA 5FF9A 4JJFA 4XCVA 5JAQA 3EHEA 5KVVA 2VYVA 1U2DA 1P45A 3PRJA 4ONEA 4TMFA 3DONA 3SVTA 2FP4B 2Q4EA 4IJVA 4B4UA 2PFGA 1XR3A 3H9UA 1I2CA 1YS4A 3G79A 3GUYA 4MVJA 3RVDA 4U0JA 1UDAA 3VDQA 2PR2A 1D4FA 2UYYA 4E32A 4OH1A 2R00C 4D79A 2QYTA 4DQUA 5L7WA 3H7AA 2NU7A 3S2EA 5G0UA 4ALJA 1WLYA 2VT2A 4GLLA 1ZMTA 4CMIB 3RUEA 2P91A 1M6WA 4TKMA 4NFHA 3QSGA 5I8WA 1EFKA 3E6AA 3ZI0A 5KJFA 3U4CA 3U4IA 1HEUA 2C2XA 4XWYA 5EIOA 3KHUA 5I7FA 3EC7A 1AE1A 1U7HA 4GBJA 4GPD1 2GZ3A 1LLQA 1WZEA 1ISIA 3AI2A 2JFHA 1N9GA 4NNJA 4I5GA 5A06A 1M2WA 4MVJF 1LLDA 3DMTC 4R01A 1EUCB 5DN9A 1PJCA 2I67A 4D3FA 3KYCB 1LEHA 2B83A 1G0NA 2FSVA 3NV9A 1U4OA 4RO0A 3PZBA 3UN1A 1XIVA 5GZ1A 4TRRA 3S2IA 4PLZA 2G82A 1UP4A 4XB2A 5L3ZA 4PG6A 2Z1MA 3BMCB 2WWRA 1BDMA 4Q3NA 4ZICA 5JAZA 5F5NA 1KERA 2ZB7A 1F06A 3RC9A 3ZWMA 1F14A 3H8VA 2BHLA 1C14A 3CPSA 1WDMA 2DKNA 3F4BA 1OC4A 4IMRA 5C7LO 1T2FA 3FNHA 3WG9A 1BXZA 3LF1A 2ZIZA 2DFDA 4UVDA 2CVQA 2D0IA 2ZKLA 4Z3KA 3DB2A 4CMBA 1HETA 2OFPA 3AY7A 5L4LA 3W8EA 3KO8A 1XQ6A 3C1OA 2I66A 1WAMA 3GPIA 4LN1A 4MP8A 4IZHA 4FOSA 1DC6A 2VWQA 4XRRA 2A35A 3RAJA 5BR7A 2I99A 3V1TC 2B37A 4P4GA 1C0IA 3GDGA 1WWKA 1OC2A 2FN7A 1QYVA 3I83A 1ZK0A 4UUMA 1DOHA 1O5IA 1IHXA 5G2OA 3Q9NA 4NIMA 2B0JA 5CAEA 1ENZA 3ZDFA 3PIIA 3HE3A 4S1VA 4GLOA 3AJRA 1V0JA 1BW9B 2AW5A 3QJ5A 2H1SA 4LMRA 3VZRA 3WFIA 4N5MA 2QRJA 4YQYA 2VWPA 2J6IA 1P74A 5A9TA 1I2BA 3AM4A 2DC1A 4BS9A 4PN3A 4JN6B 4J3FA 1UUFA 2RCYA 5G4KB 1CQJA 3EDMA 2GSDA 2X22A 4IXWA 4M87A 2D5CA 2W2KA 1E92A 3ON5A 4QFDA 2OBNA 3LC1O 3ZU5A 1CQIA 1Y5MA 2WEKA 1ZBQA 1SBYA 3ZW8A 5CEJA 4HX5A 1K5HA 1SOWA 1Z45A 1CRWG 4M8SA 3NGXA 2AMFA 4GGOA 1KOLA 3TZHA 3SLGA 2X1HA 4TVOA 4N54A 4NK5A 4QXMA 3VKUA 4ZQHA 3HFGA 1JKFA 3IC5A 4IIVA 5DBGA 2B5VA 2WD7A 3QV1A 4FB5A 3D3EA 4PG7A 2Y05A 4FJ0A 4OO3A 5EL0A 4HKTA 5J23A 1JDJA 3DZBA 1L7DA 3PYLA 4O6VA 4TRJA 1T4DA 4J9VA 4NBUA 5IXSA 1FDUA 4B4OA 4ND5A 1DJNA 3WICA 2VHWA 3L07A 4XEHA 3PJEA 3WTCA 3IP1A 4PVCA 4UEOA 1JKIA 4DLLA 3R1IA 1E7MA 2NUAB 1DRWA 4CM9A 1HYEA 3KETA 2FRDA 4IM7A 4CLOB 1E6UA 3DBRA 2PY6A 4NMHA 4CLXA 3ZNPA 4BO1A 4CV3A 3KLPX 2J3JA 4HWKA 3H6KA 3Q6IA 5JDCC 4R1NA 4DMMA 1PWZA 4OL9A 1A9ZA 1Q7GA 2HK9A 3AY6A 4BKRA 1VL8A 4FGWA 4YCAA 1ZKMA 2XF8A 1LBEA 3W8FA 4ZJUA 6ADHA 1LU9A 5ADHA 1ARZA 1U3TA 1Z74A 3O8QA 4Z3DA 5JC8A 4DIOA 3RQSA 4DPKA 3KB6A 3DR3A 3RUIA 1HLPA 4WGGA 1GYQA 1E1KA 4R1SA 4KUHA 1U9JA 4B4VA 3NRCA 2FPPA 3N58A 4GL4A 4NJMA 3RFXA 5G0TA 1TA4A 4I5EA 5HWSA 1T2DA 5KJ1A 1GZ6A 5EQDA 5LDHA 4A7PA 1DB3A 2QYSA 5AVOA 5T8KC 1BXGA 5H81A 1JQBA 3WYEA 4KWHA 4M86A 3Q2IA 3GT0A 4BHTA 3L77A 3ROQA 5K6AC 3EW7A 1BRMA 5I9LA 5KTKA 3ABIA 1KC1A 3QVXA 3A9WA 3WNQA 1UZLA 5JYDA 1E7SA 1ZJZA 4TZKA 2WD8A 1X14A 4FJ2A 4S3MA 4U8GA 3HSKA 1NYTA 4MOWA 4YAIA 4CM8A 1A72A 4YQZA 1GL3A 3FR7A 1P44A 4CM4B 1CYDA 4CL3A 1NHWA 2FPGA 2NU7B 3T4EA 1SZJG 2GPTA 2X0JA 4PLGA 4GX0A 1Q2XA 2VHXA 4CM6A 3INGA 2HO5A 2X0NA 1B8VA 2AQIA 3MWDA 3G1UA 3MTJA 3UCFA 2DBRA 4R54A 2J3HA 3KBOA 4XYEA 3LT1A 4XD2A 2HU2A 4IDAA 5C7OO 3VPXA 4I9HA 2O4UX 1B2LA 4XYGA 2YV1A 4UREA 3JD4A 1YOVA 2DLDA 2H63A 3KSZO 1N9GB 3AUSA 3D3WA 5L4SA 4JP2A 2BFAA 2LDXA 4BGUA 1AUPA 4CMAA 1PJSA 3LK7A 4BNVA 4WASA 3N7UA 4PZEA 2CFCA 3ADPA 1VL6A 1MC5A 2JCVA 2V6GA 1P33A 2EW2A 2X6TA 3ONDA 5CDTA 1LDYA 3JQEA 2B5WA 1JA9A 3ZWYA 4RPHA 1H6DA 1GY8A 3DFZA 3TNLA 4KQWA 1YBMA 1W8DA 4HXYA 3DOJA 4I5DA 3SJUA 1LI4A 1QYCA 3JQ7A 1KYQA 3PHJA 1YE3A 4W7HA 2Q4BA 2Q3EA 3QWAA 3E1KA 5L7YA 1ZUD1 3HJAA 1YJQA 3JQAD 3JQBA 4IDCA 1P1HA 4IIUA 3KV3O 1YH3A 4FFRA 1ONPA 4E30A 4TKLA 3OM9A 3U5TA 3ADOA 1SB8A 1VLLA 4J90A 3TWOA 3AFNA 1Y8QB 1BSVA 2YY7A 2I3GA 2B35A 4LCJA 5FI3A 3EUWA 5C3MA 4ZRMA 1YB1A 5CAEB 4R3WA 3TZKA 4EZBA 1LSJA 1IZ0A 3WJAA 1HDXA 1YL6A 3RFTA 3S1LA 3HDYA 3WFJA 1OOEA 3RC1A 3PJFA 3UCXA 3ZN2A 2VZ8A 3D4OA 4OHUA 4PLFA 3IAHA 1XCBA 2BI7A 5CPFA 1BTOA 1DO8A 1CQJB 2WYUA 5B1YA 2OP0A 4DPLA 1HTBA 4XQEA 3ITKA 1BVUA 2O23A 5JYEA 1EK6A 4BO7A 1E3EA 3DDNA 1TI7A 2O3SA 4L4XA 5BNFA 2GRAA 4AJJA 2GN6A 2BFPA 4MP6A 3FPCA 1QKIA 4M54A 4MIYA 1I5RA 4BNYA 4LVCA 2JFFA 3PWSA 2VHZA 4BV9A 2WD7B 3KOUA 1DLIA 1VE9A 3GZ4A 3RD5A 4R41A 4CQMB 3WGYA 3FI9A 1MP0A 2J5RA 3WR5A 1PJ3A 2FR1A 4M49A 6LDHA 4DL9A 1ADCA 2Y93A 5U1PA 5JLAA 3D4NA 4TQGA 3DTTA 3RU9A 5JMWA 1MB4A 4FQ8A 3JSAA 4AL4A 3OIGA 1P1JA 2NVWA 1R4MA 4N5LA 4MVJE 1C1DB 3UHAA 3R6DA 4NBWA 1E7RA 2FY8A 1D8AA 1OBFO 3JYQA 1UXHA 3CEAA 1Q7CA 1SMKA 4D45A 2D59A 1YGYA 4KDFA 2Y68A 3QVOA 3E9MA 3QIVA 4BNHA 4W6ZA 3V5NA 3ZU4A 1EUDB 3VPSA 2BF7A 3AU8A 4R5MA 2C7VA 3UCEA 4FSHA 3E82A 2AA3A 4A03A 1LTHR 2X23A 2VUSA 3P2YA 3PHLA 1X13A 3UVEA 3UFXA 3R3SA 3CZMA 3JQFC 1F0YA 2WDZA 4LSWA 4F46A 3ANMA 3PFWO 3SC6A 4HUJA 1Z73A 1DFGA 1QYWA 2J5QA 4OKNA 2FP4A 4OMUA 3H65A 5DBFA 3PDJA 2WE8A 4IGFA 3K2BA 1NNUA 3C85A 4XJSA 4FFNA 1FDVA 1NVGA 4MP3A 5I7VA 2DFVA 4YRAA 3IIEA 1F8GA 1GCUA 1LLUA 4P22A 4CR7A 2O2SA 4WUVA 1SOVA 2R00A 5K0ZA 2Y1FA 4TRNA 4Q3EA 4D0SA 4Y8VA 3K30A 3CSDA 3H3FA 3V1YA 4IJKA 1K89A 2D5AA 4OYRA 4K6CA 1E3WA 3OQBA 1BXGB 1RYDA 3UOGA 1J4AA 1PL8A 2FSSA 1DC5A 3EK2A 2HCTA 3OMLA 2DTDA 5HA5A 1PGNA 1DSSG 5ITWA 4GQAA 5IDYA 2WMDA 4GAEA 4MVJP 3KVOA 2HMVA 2Y1DA 4N18A 1PZFA 2X9VA 3DMTA 4INAA 4YAJA 3ZW9A 3PQFA 3JV7A 3PQDA 3U0BA 2EEZA 5IN4A 2AG8A 3EVNA 3GRKA 1XSEA 5IDQA 4XA8A 1F17A 1UP6A 5DULA 3L9XA 3RCBA 1ZW1A 1EQ2A 3I4CA 2VNSA 3KSUA 4EW6A 1H6CA 3I1JA 1E6EA 1LSUA 4GKVA 1YQGA 5KVQA 2Q2QA 5A03A 2IYOA 3MWDB 4EJ0A 3MJTA 1UAGA 2CY0A 3W1VA 3OA0A 1G6KA 1DHRA 3I9JA 3G17A 2O3QA 5C7IO 2E37A 3H2ZA 1ISJA 2GDZA 4ZU3A 2QRLA 2DQ4A 2I5PO 1HDGO 4EGFA 5AOVA 3CIFA 3ZGYA 1V3TA 1EEHA 3TZCA 4FBGA 4HFNA 3WIDA 4E2YA 3U09A 5KNLA 1WDKA 5HBRA 3FNEA 4PG8A 2GERA 1V8BA 2Y1GA 2YV2A 2Y1EA 1K6XA 3GGGA 4NU5A 1I01A 3GY0A 4BL5A 3M2PA 3AOGA 1LDGA 1E1LA 2GO1A 4N5NA 4R9RA 4L0QA 4I9NA 1IE3A 3W4IA 1Y6JA 5I9NA 3WGGA 3SX2A 1ZSNA 9LDBA 4YAGA 3BTVA 3KM0A 4DLBA 3I9OA 5AYVA 4NR0A 3WIEA 4DA9A 3GVPA 4WNCA 2VYVD 3JQ7B 3ITDA 1ADFA 2XXBA 1PQWA 1MXFA 3I9KA 3RIHA 1OFGA 4WLFA 3OIDA 3RBXA 1DRUA 3MJSA 1EVYA 2ZB4A 1UAYA 3QLJA 4HBGA 4A27A 3ZU2A 2OHXA 1T2EA 4UEKA 2B4TO 2CDAA 1E5QA 2I3AA 3GNSA 4MVJD 5ES3A 5DCUA 1SO8A 4K1LA 5CFZA 2AQHA 4OAQA 3TPCA 2P4QA 5TGDA 4BB6A 2V6FA 1EDOA 4CMEA 3WMXA 4NI5A 2O50A 3DBHB 4JCOA 5JE8A 3WSWA 4ESOA 3ZWWA 4AJLA 2PZLA 4QX6A 1QV7A 2JJYA 1HL3A 1MA0A 1JN0A 3NYWA 1U5AA 2EKPA 4A0SA 3HADA 1VSUA 3TL3A 4IMPA 2AQ8A 5JY1A 4IS3A 2JD2A 4MKZA 1SCUB 1QLJA 3JQ6A 4WLUA 1H93A 3WNVA 1GUYA 1QV6A 3F46A 1IHYA 3EYWA 4JBGA 5CHEA 2R2GA 5TNXA 1QYDA 4BNNA 1XA0A 1Z75A 2HQ1A 2NVUB 1N1EA 1H2HA 2ZJ0A 3KXDA 4OSOA 3ZHXA 5LC1A 4BMNA 3TOXA 3IJRA 2VOJA 3OEWA 4YWJA 4DREA 1EZ4A 1T1RA 3OJEA 3PIDA 3ZWNA 3W4JA 3RWBA 3AWDA 5DCWA 4RPGA 4QO7A 3E5RA 3PZRA 4P38A 2O3UA 4CLOA 1C0PA 2P5UA 4IJWA 1FK8A 3VC7A 4G5HA 4OQZA 1GR0A 3GUCA 4URFA 2WYWA 3ROMA 5A9SB 5IG2A 4CL8A 2CVZA 3JQ9A 1IPFA 4W9NC 2V6BA 3LC2O 3H2SA 1CETA 1K6JA 3T7EA 1ULUA 2Q99A 3EMKA 3RUAA 4FN4A 3GOHA 1JVBA 1VKOA 1HKUA 5GZ6A 3KYBA 4ZVVA 4Z9YA 1R4MB 2EERA 2Q50A 4GX2A 4XIJA 1M66A 1AXGA 2X9GA 4RZIA 2VZ0A 5COBA 4E3ZA 2J5KA 5AQ1A 4KOAA 3DZFA 2G17A 1Q0HA 1J0XO 4DC1A 1IZ9A 1XU7A 5T8KA 3COSA 3JQ8B 5HM8A 4E5YA 1P77A 5AXBA 5THQA 4AJ4A 3WB9A 5K6AA 3UFXB 3OFSA 1PR3A 2DBQA 3AOEC 1XLTA 2PGDA 2IEBA 3MJEA 4DBZA 3G1TA 1V9LA 4DQVA 1NPYA 1NVTA 3NUGA 1A7AA 5JCJA 1H94A 5I7SA 1PS9A 3VTZA 1I3NA 3DTYA 5A1TA 1NQ5A 2YZ7A 3LVFO 2O4CA 2CF6A 4OJNA 4CM4A 3EY4A 4A73A 5A5EA 5JY6A 2F1KA 4JXKA 3B1FA 3MEQA 3OJLA 4C7JA 5TIIA 4LVUA 2Q2VA 4H7PA 1P9LA 4ILKA 5TS3A 3GEMA 2BKAA 1E3WB 2W2LA 2HMTA 4J9UE 1LDBA 1CJCA 4BNUA 4OOFA 2YQ4A 2QG4A 2B36A 4MIEA 1NR1A 1TVEA 3ZWOA 3C1TA 2BI8A 4FJ1A 2RHRA 1I24A 1UDCA 4GMFA 5DCYA 1UR5A 2OUIA 3WYBA 2O2YA 2EXXA 2ZYGA 4J7UA 3VTFA 5JW6A 4MKRA 2GN8A 3ZV3A 3WWYA 1QMGA 4CM9D 1D7OA 5FWNA 5JAMA 4AFNA 3NJ8A 1ZXLA 1WVGA 1B3BA 4II3A 1R4NA 4OIMA 4PRLA 2QZ9A 4D41A 4Z6KA 3B20A 3IDSA 3ASUA 3BHIA 1PZGA 1I0ZA 4B7XA 1VL0A 2OMEA 2ZCUA 4Y6RA 1O8CA 3WSVA 4CM1A 4RV9A 1Y1PA 5ENDA 2HSDA 4Y98A 4DYVA 1B26A 1NWCA 5ILGA 1ML3A 2Y66A 3LT4A 4OXYA 4BNTA 4E2ZA 4ZN6A 4W4TA 2JHGA 1PL7A 4KQXA 4C7KA 1TT7A 1A4IA 1GEEA 4L74A 5CP8A 3GRPA 1H6BA 4BMSA 2BGKA 3ETEA 4RVSA 4GH5A 3FNFA 1WXDA 2C5EA 1KEPA 3JQDA 3ANLA 1ADGA 4TWRA 1PGJA 1WZIA 1Y8QA 2Q46A 3I6QA 4NU6A 4QO8A 1RJWA 2C7GA 4ALIA 3B1JA 5BT9A 3DXFA 4XQCA 5EMHA 4DGSA 5CG2A 3FPLA 4BNGA 3I9MA 2E4AA 2PWZA 2EKQA 4R51A 4CMGA 4I9UA 4AJKA 1GQ2A 4OGWA 1IOLA 3H5NA 5TF4A 3KYDA 4ZHSA 3FTPA 4EITA 2NTJA 4B7UA 4RPKA 3ASVA 2OOSA 5H82A 4BKPA 5JDIC 3HDQA 4W82A 2JD1A 4LRTB 1P0CA 2Q49A 3I4FA 2E48A 2BGLA 2O7QA 4BKUA 4ZA2A 1U8FO 2O48X 5THKA 3QE3A 3GH3A 3V8BA 4HY3A 1ID1A 1B14A 1LJ8A 5B4UA 1ZH8A 2X8LA 4XDYA 3GHHA 2VRCA 4QTZA 1R0LA 4CQMA 2W4QA 2GLXA 4XYLA 2YFQA 1ENPA 4GX5A 1RPNA 1NBOA 1BVRA 4ZRNA 1UP7A 3FNGA 2EWMA 3P2OA 4MVJM 1Z7BA 3MJVA 1BMDA 3S8MA 4E5NA 2GN4A 4Q3AA 2G0TA 2YDYA 1YL7A 4GWGA 1C1DA 1DC3A 1XG5A 2NACA 4B3HA 4E6PA 5IJZA 3EGOA 3GN2A 2EW8A 4JGBA 1V3UA 4KZPA 4DRYA 1LDMA 2D8AA 2P68A 4FC7A 4BNZA 3DWFA 1G0OA 1PEDA 3HDJA 1LDEA 2GCGA 5I8ZA 3C7DB 4B79A 3BYZA 1YONA 1EUDA 1N1GA 2RBEA 3PHHA 8ADHA 1PS8A 2PZMA 3ZWVA 4UVIA 4XDZA 3U9LA 4DTIA 1OMOA 1HSOA 2FZEA 3NT4A 1XU9A 3OSUA 4YPOA 2C82A 1DXYA 2GNAA 3RFVA 4CV2A 3NT5A 3JQFA 1MV8A 1E1NA 3TF5A 4CLRB 4PLYA 3PVZA 4XYBA 3QWFA 3E48A 2PNFA 1EQUA 5CDSA 2HLPA 1PGQA 1IY8A 1KBZA 1P31A 2DAPA 3E18A 3GNTA 3GEDA 1NX6A 3DMYA 2QIOA 3DZJA 1ZJYA 1LXCA 1SEPA 3AM3A 4ITUA 4NBTA 1DIAA 3W4KA 4EYEA 1LA2A 2VCYA 3TZQA 2DUUA 1HDYA 3U49A 2XXJA
chains in the Genus database with same CATH superfamily
2ORED 3UNXA 1H5QA 1QF9A 3AL3A 4JNCA 3DH0A 1LBTA 5JMTA 4HJXA 4M1MA 6AT1A 4O08A 4Z4GA 2J3KA 1M2JA 4EKNB 521PA 1J9GA 3DLIA 4N8SA 2WJIA 4U3JB 4W1SA 3EVEA 4R3UC 4NZ9A 1Z2NX 3LCRA 3WOHA 2JIRA 2MOKA 4UFNA 4E3WA 5AVZA 1TQ4A 2D5LA 2Y1OA 5DPMA 3ZE9A 5C8YB 1TEXA 4I50F 1NSYA 2DJIA 1JYFA 3ZK8A 3KDSE 2DHDA 3L7KA 5HJEA 1I2MA 1WABA 2WABA 1L6IA 3VPFA 4FE4A 4IJQA 3AHEA 1A9XB 4HL6A 5DLEA 5C34B 2GASA 5FI5A 3O8OB 4WFJA 1FY2A 4EPWA 1G8PA 5K20A 1BX3A 5DU2A 2E6KA 2DPYA 7AT1A 3WC4A 1T43A 4ZQBA 4OMDA 1KYTA 2H2DA 3LRTA 2VHYA 1DT3A 2G4VA 3PC8A 4TV9A 4V0OA 4X5OA 2IYLD 3FFAA 3IUSA 4NFYA 4DJDC 1KSHA 3HBNA 4JX8A 4RLFA 1QGED 1VZ2A 2AI1A 1E1QA 2OBYA 2UKDA 3CRNA 4NHEA 5CCEA 2D0DA 5FFNA 1TQHA 4MKXA 1R0KA 1HV8A 3NUZA 4PO1A 3AL2A 2PAFA 3H3XA 1ZS9A 1C2TA 3C6MA 4RA9A 4B8YA 3FRIA 1HPLA 3ZZNA 3BN3A 5HKKD 4IH4A 1NMXA 3IUPA 1RAGA 1WEHA 2WIDA 3I1FA 4J2TA 1WSAA 2EYQA 3LZ6A 4XUEA 4AO8A 3ACCA 3CE6A 4TN1A 3FYTA 1UC9A 4WK0B 1XJWA 4G37A 3WMEA 1XXHB 2GUGA 4GE0A 1IC6A 2VP5A 3IVGA 4KVZA 1NJ2A 4X3CA 4E46A 1VDMA 1U2RA 1DQYA 2FX5A 1T8UA 5ALKA 3Q3IA 3E4DA 4Y9TA 3RBAA 2DHRA 1CLEA 4TV9F 3DEAA 4FK8A 5IT9A 1NN3A 2QHXA 2OO5A 1S02A 3TD6A 1IUKA 1GNQA 2PYDA 4JBNA 1DARA 2VDUE 4KMSA 3UWOA 3VSDA 3WGJA 2BBTA 4DCPA 5EIAA 1BQEA 4CCYA 3P2JA 2B98A 1WMAA 4RK5A 2XYHA 4AIIA 2YJ6A 2AT1A 7MDHA 1J7JA 3PP8A 3E2PA 1LNQA 3L7BA 4OP1A 4F3TA 1ZINA 1KO7A 4MVXA 2C9YA 1OFTA 2C5BA 3O4RA 1F2UA 1G6OA 3IT1A 1XVVA 2UUPA 1G9TA 4P4SA 4CN9A 5EOVA 1T2CA 2PGLA 3DC7A 3WIBA 3K0HA 3SHTA 4BXOA 2JLZA 3HDTA 3L7AA 1YBVA 1RIIA 4FZ5A 1MBZA 5SY9A 3DZGA 2FSGA 1O6ZA 4KRXA 3EF3A 5DXFA 5J63A 3X2EA 4AULA 5C81A 4XEUA 2VT7A 2QBYB 1QTNA 4MYUA 4LJYA 3QRWA 3ZZ0A 3TZBA 4B34A 2DR3A 1DBVO 3KQSA 3EEFA 5CEEA 2QXYA 2PMBA 5H9VA 3D59A 4KPYA 3ZQ4A 2OPBA 1M3SA 5JSUA 1RWXA 3W8NA 3OH8A 4CDNA 3EMVA 4MDEA 4PO3X 3SDZA 1OSNA 3UJHA 2I9KA 4P4LA 2F3RA 2OVFA 3O4FA 1MAAA 2JFGA 3Q2KA 3U80A 3UW1A 2R6AA 4L4UA 2NADA 2O8FB 3PBKA 1GPMA 4ZK2A 1EWTA 5AD1A 4LJ5A 5I8PA 1EAMA 2GQ0A 2XY4A 1JWAB 2PGOA 3OFND 2QMEA 3ACBA 3T3PB 1BKSB 1CE8A 1Z88A 3AF4A 4QREA 2ZI9A 3WLMA 3N0VA 4OHCA 4L6AA 3VYVA 2ERXA 2NM0A 3C3DA 3T6KA 1N2CA 3DE1X 3NP7A 4IUCS 2YQ5A 2OZLB 4G63A 5KYXB 1HTWA 4RLSA 2DFKB 4C7OA 2PZAA 3KYDB 3SNKA 2X5XA 4XOIA 4YHBA 3IBGA 4C04A 1YDMA 1P0MA 2YWRA 3VNBA 1P61B 4A36A 4OM7A 1RPZA 4FYHA 3U16A 1UJBA 4L8WB 1K66A 1QBGA 4FKMA 4X8HA 4EUNA 1W5FA 2JZOA 3T3NA 3QG1A 1OXKB 2EZ8A 3ETGA 3FCUB 1Y33E 3OECA 1I3OA 2F8LA 2IFTA 1MNAA 2WQZA 2FF7A 4I6JA 5L9AA 3O9VA 1H65A 1ADBA 2LVBA 2X0RA 1B15A 3NXKA 3B36A 1Z4MA 3M3DA 3W8DA 4ZI7F 3RS9A 2NVBA 2B92A 1WNTA 3ZHYA 4E2XA 3MHTA 3LUKA 5KB3A 2BGJA 3AUYA 3S4YA 4L6IA 2QT9A 1H2XA 3LTNC 3BZWA 1M2EA 1NJFA 3EWNA 1SG6A 5A9SA 2XGGA 4R9SA 4ZYLA 1UFRA 1JSLA 5BV1A 4XWWA 5DTQA 5E7JA 1D4OA 1X9HA 4QUDA 5TPWB 3T5PA 1SUEA 2AFIE 1OWNA 5CPBA 2R751 1QGUB 2H5EA 1RM4A 2QD1A 3L7JA 5CT4A 5DNYB 1ZN9A 2QE7D 4HRAA 5HUQA 2C1ZA 3B1KA 1T1IA 4LWQA 2QUJA 5DKFA 4V1CA 2E6UX 2LE0A 1KOGA 4ZCIA 3U1BA 1NIPA 4HAWA 2X2OA 3BL5A 1TA9A 4X24A 2P8SA 5CIWA 1RZ3A 5TSDA 1M76A 2HBZA 3P0HA 3QEMB 2EG9A 4G8JA 1C8BA 1ZGGA 2R1VA 3FIJA 1Y4ZA 1JJFA 1II0A 3VQTA 4X7MA 4ALLA 4XIYA 3DKIA 3V42A 1RZRA 1XZGA 2CDBA 1F7VA 1T1JA 4RKYA 4UEJA 1GAQA 1DAKA 1EFVA 1FXUA 2DU8A 2E85A 5HIJA 5F21A 3S40A 4IG9A 3ZLTA 3KZCA 1O6BA 2VJLA 1FDRA 4GDFA 1TEHA 3BIWA 4U7JA 5K0TA 3PPWA 4NMLA 3X3HA 1UL1X 2PWAA 2ZSDA 1NJGA 4CPDA 2QKYA 4QDXA 4DS3A 2JLSA 1FP4A 1XHEA 4MUXA 5IJ0B 1DDGA 1EAYA 4A82A 2Y9MB 3OX2A 2E55A 2B78A 2F1IA 4NZPA 3WWCA 3JVEA 4QQFA 1T5BA 2ETVA 2EJVA 3EGCA 2QTTA 5CLGA 2BFFA 3B6EA 3C3JA 3E35A 1XZKA 5IARA 1FFDA 1I9CA 1E8MA 3HACA 2VDWA 3E58A 1GILA 3E9EA 4M83A 2WWVD 1TTHA 3DVSX 5KOJB 5AO9A 2ZIFA 4E03A 1XPOA 1P1RA 4MWGA 3F6RA 1GU1A 1A50B 1YQTA 1N0VC 1V39A 4YC7A 1D2GA 3CW2A 2Q0XA 3IPXA 3NC0C 1U2SA 1T2VA 3PT9A 5ICGA 5A2GA 4FW8A 1JQAA 1YNOA 3DMPA 3LWNA 4PRZA 4FB5A 3TIGA 5K2OA 4BTVA 3ONFA 3VNVA 1OFHA 2JS7A 2NU8A 2CDCA 4E13A 1G38A 1CS4C 1NXSA 1UM9A 4XI9A 4B3GA 3VJMA 3LUAA 4QOIA 2W6IA 1DQZA 4CKZA 3JYOA 4B3RB 4MJ7A 2HJSA 3A6LA 2CMGA 2ZIWB 4R8SA 5FUQA 4KWCA 3ZXSA 4EMUA 3RROA 1W59A 4Y6GB 3UOAB 1YCDA 4H7KA 2JFNA 5JH7B 2NT4A 1FUKA 4XM2A 3IAS6 4D4JA 4EY5A 9ABPA 5KU7A 1WBDA 3T8YA 4J0KA 3VC1A 2X58A 3B5IA 4PV7A 2FZCA 3NWPA 2I34A 4IDHA 4NRDA 1AZSC 5CVJA 1M0EA 1EMDA 2VO1A 3HVIA 1EM6A 4L2IB 1JFFB 2VJKA 5EP4A 3L5OA 3T9FA 3OZFA 4IDEA 2JAUA 5TS2A 2D13A 3MJDA 4YNBA 5TT0A 1ZK1A 1W19A 2R65A 3HJHA 2WUDA 5A4DA 2F9LA 1B73A 3OQIB 3EGVA 2QU7A 2YHIB 4TYQA 3BMOA 1FFAA 1QFYA 1IK4A 1SXGA 4G24A 4GXRA 4YP1A 5CG1A 1ECJA 1L9KA 4LDAA 2X5NA 3Q1LA 1Y3HA 3CJRA 1G5HA 2REBA 1BQ3A 3IAFA 1XMSA 3ELBA 1TJNA 2GN1A 1EX9A 3SM9A 3PV0A 4F91B 4ZGWA 4P33A 1IY9A 4K0KB 1Z2CA 3DXZA 3EXHC 3T3MB 3R24A 3T99A 3ZVLA 2R8BA 3R3WA 2X2EA 5EJGA 3GLHA 1DHTA 5FIUA 4QELA 5TJHA 3WGHA 2Q1TA 1GARA 2ZRQA 4I08A 4ND1A 1Z22A 1II9A 2MHCA 1P5HA 4W99A 4DWWA 3PQ7A 4JJAA 4WK2B 5J2TB 1YC5A 2IIQA 4RMHA 2V5VA 4CKYA 5KYUB 2IH5A 3UXEA 1Z12A 2HWUA 2FR8A 4F6RB 5F1OA 1FDIA 4FLFA 2Z08A 3N8GA 1P2DA 1HE3A 1P9NA 3NXSA 4JJGA 4JROA 4KIJA 4RCVA 3UK7A 2DCUA 4AZTA 4DBLC 1JFSA 1SU6A 2EFEB 3DW1X 1PNRA 1O1YA 1I10A 5AFSA 4A2CA 5FEUA 1AK1A 3N70A 3QVTA 4I2VA 4YUAA 2JLWA 3KOZA 5C1BA 1KEUA 3VKHA 2OD9A 2Z5GA 4QQRA 2IYWA 1VBKA 3P94A 4A3SA 2CLHB 4FLMA 3TQFA 3AXSA 4GPIB 3ZGZA 2QSYA 1NI4B 4WXEA 1BIFA 1DKUA 2AOVA 4P4TA 2AHOA 2EJWA 4PZ9A 2XOKA 4R83A 3ZHOA 2GD6A 2G9UA 4UPDA 5J4LA 3AERB 5FCDA 3ZZ1A 4BFUA 1RMQA 4BMPB 1G3UA 3TNJA 1MPTA 1UOQA 3NM4A 4HWTA 4F4CA 3QUTA 4RJKA 4PC2A 4Z0HO 4L28A 2A78A 5F12A 1IPEA 1K7SN 2FWMX 1C7QA 2ZTVA 2XWQA 3EYAA 4BEJA 3PXCX 4HVLA 2GEVA 2EJTA 3P0JA 4Q4LA 1WZUA 3B7PA 3KJNA 3CRQA 2OA0A 1FJGB 3N5KA 2AFRA 1EVZA 2YOFA 4F12A 3F73A 2J09A 1QP8A 4G41A 4M1EA 1JJIA 2E4XA 4D82A 4M36A 4F93B 1FZQA 3Q3GE 4U2GA 1CEXA 5F33A 2Q9BA 3GNQA 2HTEA 3K0FA 1ATIA 1J25A 5CB4B 1DJLA 1GGEA 1AM4D 2WNIA 3GI1A 4KUEA 3U62A 4N3AA 2B0CA 1TFRA 4F6CA 1OH8A 1L7OA 3OHSX 4WEOA 3MBOA 4LJ9A 3NDRA 2B1JA 3QHPA 4JIGA 3RKRA 3BWDD 1IB6A 3N5CA 4ZREA 3KXPA 3C6ZA 4X45A 1XP8A 3ZDRA 2JGDB 2BSAA 3M7IA 1NJ5A 1U7WA 1ZW6A 2A0WA 5KOIA 3GCZA 1O54A 3LI2A 1MVLA 5I51A 1IWOA 2FLWA 4ND8B 1JKJB 1JHOA 3DAGA 2SKCA 3FYHA 3V8RA 2QSUA 2YVLA 4BZQA 1M2NA 4NBRA 1U02A 5JAOA 4UJ5A 4GRAA 1G7CA 1D1TA 4NL4H 4OI0A 2KQUA 5NLLA 4DNXA 5IWAB 3ZDBA 1X3SA 1KETA 3HWX1 2PVSA 5I7OA 2N75A 2V0NA 5HP4A 4TLAA 5DLYA 3LHKA 3THYA 1JWLA 4RL6A 2FPIB 2J9GA 2W98A 1TCCA 4B48A 1JEJA 2EZ4A 4HN4B 4INPA 1JDBB 1L5RA 1CTQA 4MK4A 2X40A 4WE3A 5A3JA 3RRFA 1NVXQ 2LZ0A 5AUPB 5B37A 1CG6A 1NAIA 3EQZA 2O0JA 4US1R 2VLBA 4WECA 2XNDA 4LOIA 3R8XA 1NGSA 4ND2A 2HEGA 3OO1A 1RHUA 2HFKA 1I36A 3VKVA 1Q83A 2H0QA 4HWRA 4WDRA 3DFUA 4HUQB 4ERNA 5TT1A 5JXGA 1XRJA 4KFRA 4YS6A 5DFAA 2XLCA 4E07A 3LX6A 2QM3A 1JLLA 4OA8A 3HMKA 4O4JB 2JI6A 3O26A 5AKHA 4BN4A 2NSJA 3U6KA 3AG6A 3MTQA 1SQ6A 2NIPA 2CZQA 2NYUA 1WXFA 3A4MA 1OGJA 3O3NB 4ZTUB 4B45A 3SQXA 1UXIA 4N01A 1GG9A 5L95A 3DO5A 4RULA 5L45A 1S2NA 2GN9A 2K2QB 4U7HA 4TS4A 4EO4A 5FV7A 4RENA 5CW1A 2CNNA 4WW0A 5FUVA 1PFWA 5GMOA 1ULTA 5BW6B 4C0WA 3OTOB 4U7GA 2Y0DA 3ZYCA 4GEGA 2VTEA 1Z5NA 4O5OA 2YIMA 4M55A 4HGRA 4JI1B 4Q1EA 3SGLA 3B3GA 1SCJA 1PR6A 3NR2A 5CJ2A 3RR2A 1BD3A 2ILTA 3I9LA 2SCUB 4MW5A 3N53A 1KEEB 5CCDA 1L5HA 1J49A 2WV9A 5HQ3B 1DCFA 3PUZA 4GM0A 1GZUA 1RWBA 3NHFA 2BE7A 4H60A 2X5OA 4KVFA 1CX9B 3EDRA 3I0ZA 4OK3A 4PQGA 4DCTA 1H8HD 1KVTA 1RW4A 5LD2B 1CRZA 4JAVC 3E5MA 1YZKA 1E66A 1ZEJA 1JLSA 1OLOA 3AEKA 3DFFA 4HP8A 3QTTA 1E32A 2HU5A 4RXUA 2F8TA 1A88A 1GFWA 1KARA 1XT6A 1L5FA 2QEQA 1OFIA 2QU8A 1VMDA 2YFHA 3BC1A 4DLUA 3PJRA 5ABPA 3TR6A 4QJ3A 1J0BA 4HRVA 4CLDA 4DUGD 1M6NA 5TVKA 3D5EA 4P80A 4ZC8A 2PRJA 3Q0EA 4AKHA 3JQAB 3KPWA 3IP7A 3ICCA 4GSLA 3W04A 5KCZA 3AR4A 4HADA 4BAGA 3B6ZA 1ESCA 5DP2A 2Q3HA 2Q6VA 3F5FA 1JT2A 3ND9A 4G5FA 5CH5A 4N7MA 5E6UA 2DQKA 2YV3A 1L8QA 3EWIA 3Q6NA 4OJKA 1SQGA 3U44A 2XJ9A 3BGWA 3F67A 3IOMA 3ZQ6A 3ZHSA 4Z8YA 1AZTA 1LX7A 4DLVA 1XL1A 4AQDA 3G9UA 4ROSA 1N6PA 2LKCA 2HF8A 2RBGA 1D6MA 3CEHA 3FNBA 2NLOA 2YJZA 4JHLA 4KSCA 1UKCA 1MB9A 4C0JA 1FUUA 3L4SO 3TKAA 4ZCSA 3F78A 3WWOA 5E1DA 1WMBA 4O4IB 2C29D 4CFZA 4YAKA 3HJFA 1R6XA 2ZSFA 3TLBA 2UAGA 4X62B 1WPRA 4W5RA 4QRDA 3H2JA 2COUA 2GPBA 3LUHA 3P9XA 3G0OA 2W22A 3PEUA 5BYJA 1CJVC 3M9WA 4Q3DA 1OT5A 5F7OA 5JD5A 3SDBA 5DW3A 4FFVA 4QYIB 5LQNA 5LXTA 2H2WA 2V6JA 1A76A 4D81A 1GGMA 1I33A 2VXOA 5H70A 3F2IA 1CF9A 1G3IA 4AF7A 3I28A 1BYIA 4P9NA 4RXMA 1UBUS 2QX9A 2B8TA 3C6KA 3WADA 3AUAA 3OEEA 4NZOA 3FMOB 1Q0ZA 4JT8A 2WILA 1CJKC 2MTBA 3VR6H 3BT7A 1THMA 4OHBA 4WWHA 3ROZA 3GMDA 2BRUC 3TSCA 1JBQA 2A9OA 1Q50A 3LF2A 2D2XA 1QK3A 2GGSA 3HKBA 4DDTA 3GUVA 4Z9FA 1P1IA 1RHQA 2ZXEA 4MUGA 1GZ3A 3EZ9A 3AV3A 4KJZA 4LE1A 2QM0A 1V5FA 5IJWA 1V43A 4FOTA 3SQLA 3DL7A 4REQB 3WQRA 1E2LA 1ZITA 4K9OA 4URWR 3TINA 4Q9NA 3D1VA 2JFXA 2PZFA 3H5RA 2EP5A 2H17A 3L7NA 4K05A 1LFDB 4PNZA 5LXTF 5F3WB 4PLPA 2CL7X 2UVDA 1XQ9A 4J3NA 2DLNA 4Q9HA 2L42A 4PICA 3H4IA 1YK1A 1AHHA 5DYNA 5GOTA 4B0PA 1CUJA 1N75A 2NUPA 3IHWA 1XDDA 4FUTA 4JLNA 4LS3A 1KZ1A 5FEMA 2H52A 1LUAA 5I48A 2PKCA 2W2VA 2VQ3A 1AKTA 1NR7A 2CNBA 5FUXA 5KTNA 4MITA 5LPNA 4MKFA 3SLKA 5FO0A 2FN9A 1NOJA 1Z13A 4MQMA 4UUBA 1QYRA 4XIFA 4D9MA 1RCTE 4PZ0A 2D1RA 1Y4DE 3WQSB 2QNIA 4PO8A 3ZDEA 1XNQB 1BA2A 1PK8A 1SBCA 1PWXA 2VVTA 4MV1A 3HH8A 1NBEA 2HU7A 4MCIA 4O2RA 4WLEA 1CJUC 1WKCA 4HLDA 1HDRA 1YIDA 2EIXA 3ESBA 3GGOA 3PPYA 4AAYA 5FPYA 5I4BA 4PYLA 5AKXA 2BFNA 2AEEA 3GVHA 2Y77A 4CYMA 3R6LA 2G5PA 4DUGA 4N8DA 1MDFA 4GP7A 4QGBA 1J6UA 2I7XA 2BP7B 3EC2A 3PICA 1H2WA 5G0WA 1L7PA 2PFKA 3VV3A 5HS4A 2QROA 4MUYA 2V7PA 1GGVA 2Q5QA 5KYWB 3GYGA 3HN7A 1Z0ZA 2IBTA 2ZYUX 3HI4A 3KX2A 3QVLA 4BNXA 1EE9A 3D3KA 3ROXA 1YRLA 1PK7A 4ND3A 3PD1A 1HT2E 4X1IA 3U4GA 4MWSA 2GAAA 3FM9A 4MO2A 1E2UA 3TUIC 5LM3A 3I5AA 5ENVA 2IC5A 2C4MA 3ROPA 1M2FA 3OTGA 1SVMA 5FV4A 2R2AA 2JFWA 3DL4A 2PH5A 3TDKA 1NASA 4UHBA 1EFLA 5K3OA 5DN6D 2OXEA 3O38A 4BO6A 3WX0A 2HJWA 1WW8A 5EN4A 2H0AA 2V9ZA 2VUUA 3HYLA 1FTSA 3PC7A 3PXGA 1K8YB 4X65B 3RC7A 3NOXA 2VSNA 4Q01A 2ASVA 2ISQA 1JVSA 3HA2A 1IULA 2JANA 4RPLA 3T38A 3UY4A 2GTIA 2OYRA 3GBPA 3FDXA 1QP4A 5I45A 5F9HA 1N2HA 1BAPA 3BMXA 4FXOA 5A5GA 5HZMA 4IDDA 4QBHA 1O94A 3AW9A 4QULA 1MG5A 5EJ9A 1XTJA 2BELA 2ZT7A 3TXYA 4YCLA 2X3YA 5DRTA 5IUNC 4UQLA 1MFZA 4WCFB 3SZUA 1JJ7A 4FU0A 4MUIA 1YACA 3EZLA 3OT4A 3STTA 2VYND 1DGQA 4BO3A 3HKCB 1DPGA 1J23A 1XB2A 2I1QA 1QWSA 4ZAYA 3TJMA 1V8ZA 4MPTA 1NHGA 1A2OA 4EX6A 1P7ZA 3UKOA 5AVXA 2IF0A 5JPCA 2XNJA 3GP3A 4OL0A 4WKNA 5IC6A 3FJYA 4RD2A 3JQ9C 1BCSB 5DO9A 2JRCA 1D2EA 1DV1A 2Q3DA 2C57A 2ZYTX 4OOEA 2DR2A 3FD8A 3AUUA 2R84A 1IXZA 5IZCA 2CLCX 3AJ8A 4WKCA 7MHTA 4MLCA 2FEWB 4PLWA 2XSZA 1IJEA 3GX1A 5EIBD 5HKLA 4D74A 2VT3A 2PUGA 2F90A 5JJLA 5JSZA 3U7QA 3THWA 4DQXA 2WB4A 4F71A 1H2BA 2IPXA 3LIPA 2GLTA 3N8IA 1LDNA 1RXCA 4G0XA 4K6OA 2CJXA 4KE9A 2XUHA 3RUHA 1POWA 1MJGM 2E3JA 3AMVA 2NTVA 3H86A 4M38A 1G2PA 5U4QA 2Q07A 3L49A 4DLPA 1SAYA 3EDYA 1GZHB 4H7HA 1N0WA 3CF0A 2JI7A 4ZAGA 1G5IA 1PQUA 2WKQA 3UO8B 4E51A 2CLKB 4F04A 1OX4B 2Y71A 4JI0B 2HGSA 3DWEX 1QC5B 3IRVA 3HDGA 3KOOA 1BHSA 3ZWQA 4NATA 3R0VA 4YACA 3VU9B 4XR9A 2QUKA 4M9RA 3IEKA 1OILA 1M2VB 1QFZA 2FWBA 2GJ9A 2PRIA 1G5FA 4PFJA 4E31A 4YRSA 5ICMA 1GLNA 1T3GA 3FNQA 1F9AA 1K0UA 5E7IA 5ALJA 3SIWA 4DF3A 1CDZA 1NG1A 3N7TA 1VSVA 4QIHA 1DE0A 2CXSA 4RQBA 2N1MA 4UBIA 1C3VA 4MR8A 2A57A 4UPVA 3UV3A 5GONA 1N0HA 5LJIA 3SYRA 2Z8YM 3GARA 5DEIA 1IUOA 2ENUA 2AG0A 2D1FA 1D1PA 1PAUA 3K5PA 5T67A 1A9SA 4LC1A 1NJSA 3JAWB 4FKZA 1QE3A 1E64A 4IGAA 4D92A 2IW1A 1NZDA 5FTJA 4QPJC 1E1RA 1KIMA 1EM8A 5JOQA 2OXFA 1QKKA 4HCJA 2F1RA 2X0IA 1M7GA 1NYRA 2WT8A 2ZRCA 4L73A 1X1EA 9MHTA 3HFRA 1E9BA 2C4NA 3ONEA 1ZZGA 3EZ2A 4UZSA 5SZJA 4F21A 3M6IA 2NO5A 3A4YA 1XOIA 3L8CA 5JD6A 3HV0A 1AS2A 2PGIA 5K6RA 2RB5A 2ZTUA 4QDUA 4FUQA 5IF3A 1KYZA 4MKHA 5AW2A 4BRUA 4FBMA 5GONF 1VJRA 3D3JA 3QOXA 3R7WB 5T6BA 5C8ZA 1J70A 3AKZA 2VUTA 2WKSA 3Q3CA 5DZSA 1FZTA 2CUNA 2HA2A 1HF3A 2Z2XA 4JK3A 1E5VA 1PJRA 4BVLA 1Y7IA 3KSDO 1UBMS 2OK8A 4YRGA 2L2QA 2INGX 4JT9A 3LQ4A 1E0AA 1PQYA 1VP9A 5KYNA 3OUZA 4J7XA 4L15A 1KO5A 4C4OA 3IB3A 5BWCA 1X77A 1F0PA 4Y0NA 1SVWA 4BQEA 4II2A 1GPDG 1R18A 1ZQ9A 4D46A 3HR7A 1HEYA 3O8DA 5BV2P 4BGDA 4DM3A 1RLOA 1NNSA 1C0KA 2QV0A 2ZJZA 2J4DA 4Q1FA 2YHUA 3CUTA 1CWUA 4HO1X 3DHWC 4ABTA 4ALNA 1WPXA 3A2KA 1M0WA 4C1NA 3A1DA 4RA6B 2VSQA 1V4NA 3RSLA 4MRRA 1KI3A 4DRXB 3G13A 5L51A 2GBGA 1N25A 2VWHA 4RM3A 4WN9A 3KC2A 4WFQA 2DJ5A 1N1DA 3WA7A 1I3MA 2R8YA 2XMPA 3M81A 2WWYA 3UMSA 1M34A 3SSMA 3T5MA 3Q3EA 5CT6A 1V95A 1F38A 4J91A 4EHKA 2XZTA 1KO4A 2VQSA 4P2GA 1SXIA 2PMDA 1XZBA 1QYXA 2VK1A 5DCLA 3MRSA 1TKAA 1BE1A 3ONWA 2V4ZA 1CIVA 3N8DA 3WGUA 4HNVA 4LZLA 3B89A 1R15A 1LVHA 4X61A 5I7RA 4AS2A 1C9JA 1FNNA 2FZWA 1V2GA 1TMKA 4KI0A 1CZRA 3ULKA 4N41A 4MUAA 3I23A 1WV0A 2YXLA 4G0NA 1YVDA 3AFMA 2XE8A 3H9EO 3OBBA 4D02A 4HUTA 2DVMA 1A9TA 1G4HA 4JWTA 1X86B 4DLZA 3LTEA 2IH2A 1KQOA 2P6OA 2ZE6A 1ODCA 3KTFA 4MW1A 4DCOA 5LYJA 3GFGA 1YQDA 3RIGA 1TYDE 4P82A 3HNPA 3QI2A 1AUQA 3G2NA 3C5HA 4GO1A 4MULA 3DO6A 2X8JB 2DFTA 1O96A 3GUZA 4UM9D 4NG4A 4J0FA 5IAOA 3ELYA 3FSRA 1DBIA 1JV2B 3K2QA 2PZKA 4M1TA 4FIZA 2ODQA 3TRFA 4D42A 1L4MA 2NZYA 1KS9A 1AMOA 4OFBA 4CV0A 3WLTA 5ADWA 1NUTA 3O9MA 4CTOA 1G7SA 3HRKA 3OUTA 5IM5A 4FWBA 2WSSA 2AMYA 4AO6A 1E0DA 4Q4AA 4JLSA 1GFSA 4NF2A 4C7VA 4RTKA 3FCXA 4NPCA 5ED0A 5CFQA 4JWKA 3EVZA 3R5KA 3R40A 1MC8A 3KLBA 4ID9A 1GPH1 2Y6VA 4F8YA 5HIMA 4Y9SA 1RCFA 1TZ2A 2PX2A 4LNHA 2C03A 3JVVA 4EQZA 1XZCA 1ODJA 1C0LA 3LJKA 1P5ZB 1H6AA 1KP9A 1N8KA 2HNAA 1F48A 4M1OA 3V34A 3E7DA 2QNBA 4NV1A 4XFJA 3LYLA 1AHNA 3DMDA 1ZFNA 3KZXA 1Q1AA 4J0JA 5B3JA 4MGEA 1LSSA 4XPIA 2F8SA 3W2EA 2ZXUA 1J33A 2XVAA 4IV0A 1JR6A 1CUFA 4WLNA 3L2OB 1MUUA 1KZHA 1K8ZB 2ZB8A 2RGNC 4NDNE 2Z3WA 3RHFA 4AKIA 1GRQA 3D4IA 2W6JD 4B75A 4MAFA 5JEDA 2XKAA 1KYIA 1SC6A 4BLQA 1WLSA 2NNLD 4FOLA 1Y9AA 4JC5A 1UJCA 3AUJB 1LFAA 1EVQA 2RGCA 2AI2A 1BDBA 4PVDA 5FT9A 5ESRA 4B73A 3DJFA 4V3CA 4KGVA 4K9KA 4LJKA 3IQZA 4JB0A 3DEYX 3D02A 3CA8A 3OEYA 1D6SA 3DDHA 3MWJA 4QECA 2XDQB 4Y2PA 4CEHB 2REXB 2O59A 1REQB 2GXQA 1L5KA 3O8RA 3SS9X 1YBFA 3MTIA 1OCEA 3UANA 1XLUA 1KY4A 5I47A 1GCGA 1ZOOA 1K6IA 4OXXA 4PO9A 3RRJA 1DLJA 3TOVA 2CK3D 4XQGA 2ONZA 1GU7A 1N3LA 1N9KA 2ACKA 2FPPB 4B3JA 1RM0A 4DMLA 2X7XA 4FEAA 2C2YA 4EY6A 4CEJB 4J2OA 3WDKA 4BLUA 3H7IA 3G5UA 1TYZA 3VH2A 5FBWB 1GPJA 1X9GA 3OCCA 4R8KA 3N59A 4RDCA 4MMXB 3UK1A 3QLTA 3GU3A 3I6MA 1EB9A 2X1VA 4I81A 1ZM4A 1PZMA 4PZCA 1HQKA 5JQGA 1U7TA 4DC0A 4KRGA 5EY5B 3SC4A 4D0LB 4PCAA 4EKDA 3ADCA 1KSJA 1T3SA 3IP3A 1YL5A 2F55A 2RGEA 2RHGB 2PKQO 3IQDB 4AVYA 3GA0A 2PZEA 3HCPA 4EJFA 1G5RA 5FXMA 3WGKA 5IMBA 3UBMA 4DTCA 1V8FA 2ZSJA 1EBFA 4B3FX 3DKKA 5B12A 1GRRA 2ZRPA 4AD8A 2QL6A 1VI2A 3EB9A 3K0BA 4INOA 3K6SA 3PYXA 1OR8A 3MB8A 3R5JA 1G7TA 2BVNA 3BMCA 3EXHB 1X6VA 5JZVA 3I8XA 1FU8A 1MIHA 1UKVY 3KCNA 5EMMA 3UUWA 1CUVA 5AVYA 1TXGA 2G07A 2IF2A 2XPCA 3GZNA 3FVTA 2QWXA 3GFOA 4IUYA 5EMNA 1BX0A 3GJ5A 3SNHA 4E94A 5JSFA 1EXVA 5JQGF 1GTRA 1TZKA 3ANXA 5H7XA 1M75A 1UXKA 1KGSA 2I1WA 3S55A 1CJSA 3C3YA 3WLJA 2HAEA 5KQLA 1TPZA 5FLKA 1E59A 4KQHA 1YOVB 4JA0A 4YMSA 1YO6A 1YDFA 3SY8A 3V2GA 4FDVA 1P5JA 2ZRNA 2X9QA 4R69A 2F1HA 1AS3A 1WULS 1WD5A 1IIBA 2VDJA 3S2ZA 1SXPA 3WHLA 4CT4B 3PLNA 4O2AB 3D43A 3JR7A 4XZ3A 3RODA 1PTJA 1N0IA 3C1UA 3H9GA 3SEAA 4KXNA 3VYUB 4TVKA 2GX6A 2LBPA 4JVOA 5H8WA 2IHUA 2DULA 1RXSA 3UKJA 3ZJUA 3PUKA 3Q8MA 2JKVA 2CVFA 1EGAA 3F6CA 4KN5A 1Z5GA 1B1CA 4LRXA 1WVMA 5AIBA 3UWSA 4OHOA 4NS4A 1EIZA 2HEIA 2EYUA 2C42A 3W3AD 4LZJA 2OCBA 2W6JA 1COZA 2WVGA 4L50A 3J81k 3PQ8A 3VR5A 3R3JA 1YZYA 3BRWD 2RI6A 3HDVA 3ZDYB 3TRJA 3LYHA 2NMVA 3I30X 3PEEA 1KMMA 3TG2A 2I4OA 2BGRA 2ODNA 4RY8A 5BNIA 2UVQA 2W8BA 3QTLA 3BSYA 1RZVA 3K4PA 3RHTA 5PGMA 2G36A 2XYPA 2FQQA 5LSAA 4EFKA 3CX3A 5KTTA 4TMZA 1QHHA 5TY0A 2FEAA 1G5QA 1QFJA 3LQKA 1CD5A 1XA3A 1KMHA 3PB3A 3ZV5A 1PVOA 4W1RA 2ZAGA 2YZMA 2EQ5A 2BLLA 4HWGA 4WN3A 1MABA 4KV7A 4J0DA 4IDFA 3AL0C 2ZUFA 3WMWA 3HB1A 6YASA 3C7KA 2P9JA 4UU7A 2QN2A 5A7GA 1VKNA 2YNMA 2XCQA 5A0TA 1Y1QA 3EZYA 1R8YA 1XTVA 1W34A 1AKQA 5HFNA 4GFDA 4D98A 5M34A 2DWPA 5ITSA 3TFOA 3EN0A 3V1NA 4TWIA 5BV0A 2DEUA 4NCIA 3H8SA 1CHNA 3WGLA 1T29A 4B3BA 4Q5IA 3OY7A 5CHYA 4JSRA 3N2GB 3VVLA 1KQPA 3KPYA 4J3JA 3PL5A 2F1JA 5AT1A 3MQ2A 2PJUA 4TKUA 3RSSA 5IAJA 1G8FA 5JMPA 2IIBA 4OLFA 4Q16A 4F3YA 4WGFA 1ZC3A 2HMUA 4C30A 3T95A 2B8EA 1P4RA 4O4LA 2UZAA 3U26A 1LWNA 4RUKA 3I1IA 4PE5B 1BJTA 3ANTA 4G1VA 1KIFA 3IBSA 4IVRA 3FOCA 2IS2A 3M33A 2NUAA 3PGXA 3B2QA 2AOWA 4GMGA 4YV1A 3SKXA 1GTMA 1U6KA 3NBUA 3WLFA 2UYQA 2UZ0A 2Y0EA 3FZNA 5JFGA 3M4NA 1GV1A 3VKWA 3NHMA 1BWQA 1FRVA 5AKIA 3OLVA 5IDVA 2C59A 2QAIA 1P2GA 3FUUA 1XQYA 3G89A 4IIJB 4RHFA 3NEAA 1XFDA 4K46A 3R7NA 4BO9A 4F9EA 1ODTC 2QMQA 4PC7A 1DWPA 3ZKWB 5T64A 2UYCA 4OQNA 3P20A 4EB8A 1NFFA 2UDPA 2BMEA 1CW2B 4KACA 3JY6A 3QNMA 1RIFA 4DEXA 2YV5A 3HCEA 1C1XB 1ESNA 2J67A 3WDSA 2VHVA 4X3OA 1T6YA 2FUG6 1I9GA 1ZIPA 2JCXA 4G36A 4O4LF 5ICSA 4HDQB 4QICA 3VU3A 1HZZA 3K8ZA 1Q2UA 5JT1A 2H7YA 3LO8A 2FW9A 3HDHA 2ZITA 4G5GA 3S2UA 2NVOA 1Y3DE 2R1TB 3LL7A 4LDQA 5T5QA 4E4YA 1G3RA 4BVEA 1Z4LA 2J5XA 1PX0A 1SKBA 1OLUB 2MYNA 4HB3A 3TMAA 2J0SA 3HP4A 3I73A 3PNSA 4QEKA 4CUZA 1VC2A 1KIAA 4NMXB 2W5UA 3V7UA 1AKEA 5GY7A 1VB5A 3OLCX 2YMMA 3QY9A 3E3AA 5EHZA 2VKQA 3DBOB 5HTOA 1AD2A 3PRYA 3DVLA 5AI5A 4D8VA 4TSRA 4U2FA 5BQFA 3VSBA 4WZZA 3HGMA 1JDZA 1P1FA 1T1GA 3O2NA 3PD7A 4KQGA 3DDZX 5JCXA 4MROA 4XCVA 1E61A 4MWBA 1JYSA 1G20B 1TUBA 3KR9A 1U2DA 1QZXA 5KQRA 3EZXA 1RJGA 2DBYA 3AESB 3DONA 4JX9A 3A1SA 4LYEA 5I3CA 1O5TA 4NMMA 2N1BA 1FNDA 1YQWA 2BFCA 3FMGA 5A4AA 1SKQA 2FW1A 1I2CA 3G79A 4K81B 1GQRA 3FCYA 2NO4A 2ZIEA 4TXNA 3VDQA 1B74A 2M1ZA 4ZU6X 2AK3A 4Z7QB 2Q4OA 3FUWA 4OH1A 1QFXA 5IC5A 4D79A 3ORSA 3HA5A 3ZLVA 2CLLB 4DQUA 1FLNA 4E15A 5TMBA 3RQIA 4DJEC 2I91A 4PRYA 3RUEA 3WVNA 2P91A 2VR1A 2C3PA 3KSMA 3OY2A 4NFHA 1G3QA 4CR7A 5I8WA 3E6AA 2HK6A 4W9MC 2HRDA 5KJFA 3EIQA 4MV0A 1AV6A 4QEZA 1HEUA 4ZU1X 3CEJA 3OMXA 2XHEA 3QLEA 1AE1A 4XPZA 5EWJA 3VOAA 4AMYA 1LCIA 1NXWA 1U7HA 2GZ3A 4AUNA 3AVVA 4F5ZA 1HDIA 3FLEA 4E09A 2O1XA 3GLIB 2RGYA 2DUJA 1USVA 3JPWA 1VXOA 2Q3MA 1CY6A 2VJMB 3E7XA 1LLDA 3DMTC 4TLMB 4HQFA 1PJCA 1QJCA 3A3NA 1WF6A 5LB2A 4Z1MD 2I67A 4DMGA 3ZEAA 1Q6ZA 2PIAA 4ADSG 3T0FA 3NV9A 2HWXA 1U4OA 3UN1A 5C18A 1S01A 4HC4A 1MTZA 4Q4HB 3S28A 4FTWA 1UP4A 1WXIA 4MGZR 4XB2A 2CXHA 4I8DA 1V6SA 5GVSA 1W25A 1GSOA 3K1JA 4C5CA 4EKYA 3C6XA 1FMJA 3LY9A 4RTMA 1JAHA 4IVQA 1SUBA 3T1VA 1F06A 4S2EA 5CH8A 1GKYA 3DTVB 2IYYA 5B2ZA 5EIEA 3ZWMA 3DLTA 1CYEA 1HA3A 2X13A 4JDPA 3SBOA 2DKNA 4GYKA 1I14A 4H7JA 2ZJ7A 5C7LO 2C77A 4Q9LA 2X15A 3ZY6A 1BU5A 1W4AA 4DSTA 3STUA 3LCCA 3LF1A 2ZIZA 4XE5A 4ZT4A 2CVQA 2D0IA 2ZKLA 4N39A 4X00A 2OFPA 3VKFA 5HK9A 2IEYA 1G60A 4K3UA 3W8EA 2PRYA 3B6IA 2A5LA 4U9UA 3GGCA 1MR3F 1ZL0A 3GPCA 1Y37A 1L4KA 2YVAA 4DXAA 3BJEA 4GMHA 5TMDA 1QZZA 2G6BA 3O82A 4JJ4A 4LN1A 4BRSA 1CBUA 1YS6A 4MP8A 3VR2D 2WV7A 2V1XA 3I2GA 2VWQA 3MS4A 5DYTA 2IK8A 3RAGA 2JVIA 3K0AA 2I99A 2B37A 4P4GA 1XRLA 2PX5A 2X8WA 1ZIYA 1D4ZA 1ZK0A 2JVKA 4LECA 4K6HA 1WA5A 1C9DB 4D96A 1O5IA 2RKWA 1ZOPA 5G2OA 3PU6A 4F38A 2HF7A 5AKJA 4NSNA 3PXAA 5D5PA 3EXEA 3PIIA 4GZ6A 2R11A 1VE1A 2TS1A 3CLRC 2RAPA 4X6LA 2V3CC 3KKMA 7GPBA 2AW5A 2X76A 4NX2A 4UASA 2GXSA 4GUDA 3A6DA 3NVDA 3IYLW 2VWPA 3A6PC 2J6IA 5E3IA 1I2BA 3V4FA 2FKAA 1UUFA 4YFVA 5G4KB 3R75A 5IM4A 2HNBA 3EDM