2FPGA

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
305
structure length
305
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 116
structure length 305
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fpgA01
2AMFA 4OSOA 1ZJYA 4BNYA 1DJNA 4WASA 1JVSA 4BKRA 1YL5A 1RJWA 2ET6A 3NUGA 2HJRA 4ZU3A 4PG6A 4IBOA 2AE2A 2J8ZA 1LNQA 5AXBA 3LSYA 1KETA 1CQJA 2PA3A 4B3JA 3MJEA 1RM3A 3E9MA 5G4KB 4D0SA 1GYPA 5JXWA 4JLWA 5COQA 1XA0A 1YB1A 3K5PA 2OFPA 3RUCA 1ONNA 3PHGA 4INAA 4JQCA 5G0SA 3BMQB 4D45A 2OO5A 3F5SA 2ZKLA 4NK4A 4A7PA 2VZ8A 3ZWWA 5CP8A 4R1TA 1GTMA 3K9QO 1KBZA 4KQWA 4EEXA 3M6IA 4TVBA 1J5PA 2R2GA 3FBGA 4NNJA 1IB6A 3N58A 4EJMA 3D5QA 3RJ5A 4P8RA 3UFXA 2X86A 4RLSA 1ZK1A 3COSA 3IJRA 4UVHA 3OEWA 2PV7A 4AJOA 3L4BC 4CUZA 2FN7A 2H5LA 5CPBA 4WOJA 3WG9A 5MGBA 1R0KA 3HWRA 1YGYA 3JD0A 2Y66A 4RCVA 1Q0QA 4CM4A 4E2YA 2IEBA 1J0XO 2AEMA 1EBFA 5KOIA 3PYMA 2X7HA 4XGNA 6LDHA 4R54A 4HWKA 3T4XA 4B7CA 1K89A 5AQ1A 3GC6A 4XR4A 5EL0A 1ZMOA 3K2BA 4RZIA 5U9CA 5A3VA 4JBIA 3W4JA 1T26A 2BMAA 1LRLA 3GY0A 3PJFA 2OBNA 4PLZA 3E8XA 2FR1A 3LU1A 1ISHA 1E1KA 4KDEA 1E3SA 4HFRA 1FDWA 1FXSA 1PGPA 3ZHZA 4W99A 1R4NB 2VQ3A 2ZCVA 2DTDA 1J4AA 4E2ZA 1A4UA 3I9OA 1KVUA 2Q2WA 1J6UA 5DN9A 4DYVA 2VRCA 3S55A 2BF7A 2B0JA 2FHSA 1D8AA 2VZ9A 1Z74A 3KTDA 3OJ0A 1EDZA 4MIYA 1O0SA 5ENDA 2PH3A 4FDAA 3MTJA 4XKJA 3TL3A 3KXDA 3AK4A 3CZRA 3JQAB 4IDGA 4WLEA 3TOZA 5T64A 3QIVA 4F6CA 1CQJB 1SEVA 5JY6A 3HNPA 3TZKA 1BVUA 2ZYGA 3UN1A 1BW9A 2FPPA 3V1UA 5G0VA 5CDYA 4LRSB 5EPOA 3OH8A 4IIVA 2QYTA 3I9MA 1LXCA 3DEYX 3GVXA 4F45A 3GRPA 1PIWA 4BO3A 3WGYA 1GYRA 3TNLA 3LLSA 4ALLA 4CM7A 2AA3A 3PIIA 3RU9A 1R66A 1DB3A 1JU9A 4A5OA 5A3JA 1W73A 4IUYA 3GNQA 2GF2A 1FJHA 1SBYA 3B1FA 3L9WA 3ZHXA 1GZ3A 3S2FA 3IOYA 1BDBA 3WS7A 5G2OA 2NU6B 3HDJA 5TGDA 4DGSA 3JQBA 4DIOA 2RHRA 4IZHA 2X5KO 1BSVA 2A35A 4GWGA 3FD8A 1DIRA 4KUGA 1XQ1A 3WGHA 1KVQA 3I4CA 5KVQA 5HS6A 4DQXA 4BNVA 2VYVD 2NNLD 2CUKA 2AQIA 5A04A 2AQKA 3VH4A 5DBIA 1B2LA 4CV3A 2P5UA 4C4OA 1EUDA 1IE3A 4UEKA 3VTFA 1ONOA 1LRKA 3V1YA 5JS6A 3SVTA 4QSMA 3P2YA 4BB5A 1YBAA 5I7VA 5A06A 5TRTA 4F46A 4YAGA 1YS4A 1A9YA 3GGOA 2CNBA 2X9VA 1OC2A 1VSUA 3AUUA 4HFJA 3OECA 5DULA 3IS3A 2CF6A 1RM5A 1Y9EA 4J4HA 4WCDA 3DBRB 4UAGA 1MFZA 4LSWA 3ZH2A 1X13A 3Q11A 4CJXA 1UDBA 4XYMA 3FHLA 3JCZA 4Q3EA 1Y1PA 3VZPA 1DRVA 3OMLA 2IZZA 3UHAA 2VHXA 3JQAA 3DTYA 4R3NA 2ZIZA 3D1LA 5T8KC 1VKNA 2OORA 4OJNA 3HUDA 3B6ZA 1ZEJA 1GV0A 4WJZA 1BWSA 1R37A 1R0SA 4PLVA 3UH1A 4NK5A 4MDHA 2CDBA 1NFQA 4CM1A 5BSHA 2ZTVA 3Q1LA 4D43A 1E3LA 2GZ2A 1D3AA 1U5AA 3DZFA 4AJLA 3DOJA 3GPIA 2WMDA 4CLRB 1DLJA 3ABIA 3ZV3A 4FCCA 1D7OA 1T2FA 1WZIA 2DAPA 4PLWA 3EZLA 2QX7A 4W7HA 1PGNA 1F12A 3U4CA 4R9RA 1KEUA 4AJIA 1HDRA 1PJTA 4BUCA 1RYEA 3A1NA 1N9GB 3O38A 3VPSA 2IODA 4XRGA 4I8XA 2D5AA 3PFFA 3JYNA 1QV7A 4ID9A 3NT5A 4ND1A 2YQ5A 4JJGA 1I5RA 2X22A 1TT5A 4RVFA 1ZEMA 1ARZA 4ALIA 4YJGB 1N7HA 3JYPA 3OA2A 3WQRA 1WDMA 5C5IA 4A10A 5JO0A 5L7WA 1U1IA 4YEDA 4BO4A 2Q99A 4E4YA 2C5EA 4XJTA 3VVCA 3TZ6A 2G5CA 4J16A 1KOLA 3C1OA 4HNHA 1YL7A 1B14A 1BXGB 1XYGA 1EUDB 4LVCA 1JW9B 3GAZA 4P4LA 3D3WB 5G0TA 3E1KA 5BT9A 3RBXA 3BHIA 1HDOA 2FZEA 2X9GA 4TZKA 1LBEA 4OO3A 4E2WA 4D7AA 2HQ1A 3CUKA 3AUSA 3VOSA 5KVVA 5CFZA 5ER9A 1H9AA 5HRUA 3E9NA 2OBYA 2DT5A 3BMNB 1XSEA 4PG7A 3A4VA 5HA5A 4DIBA 1IPEA 5A1TA 2X5OA 4LCEA 4XQ9A 4D3SA 4TRRA 5GY7A 4G5HA 2D0IA 4OXNA 1OZAA 4IDCA 2BELA 2PWZA 1I2ZA 2NM0A 1M6WA 1PS9A 3R1IA 1BTOA 3K31A 1W8DA 4HY3A 5I8ZA 1Q1NA 2ZQYA 5IDXA 3QY9A 3I52A 3PDUA 3QVSA 1UDAA 4Q9NA 4XCVA 3VZRA 4K26A 4NH4A 1EQUA 4QUKA 2NACA 4YVFA 1K3TA 3CMMA 3N7UA 3NDIA 2JAHA 3VVBA 2SCUB 1P1KA 1XGKA 5ADHA 2J5QA 5EESA 1YH3A 3E9QA 4OQYA 2POQX 2X23A 5C3MA 1H6AA 5KTKA 2YJZA 3F6YA 3Q2IA 1B3RA 2NWQA 4L0QA 4B7UA 4E31A 3H6KA 3DBLB 2QG4A 1O9BA 3P19A 3ZWNA 4B3IA 3ROQA 1ZVMA 2CD9A 1SCUA 1MB4A 5IJZA 3EHEA 2BFOA 2I67A 2ZK7A 5JLAA 4B4WA 3CXRA 1JVBA 2HMTA 1AHIA 2B35A 3GEGA 3IJPA 5TC4A 1YB5A 4KMSA 3BTOA 4KTTE 3NYWA 1VC2A 3ZNPA 4B4VA 3D7LA 1M67A 4BNHA 4DPKA 1UZLA 4FGWA 3GUCA 4MINA 1LC0A 1WMBA 4IIUA 3VKUA 2VTEA 2I9PA 2E48A 3H4VA 4NJMB 2JJYA 4ZICA 4B8ZA 3FSRA 1ZW1A 1FK8A 1GQQA 2B36A 2BFAA 4WE3A 1DPGA 4MIOA 1SMKA 2W2LA 5TT1A 5IFLA 5BSGA 3WSWA 1EVZA 3TN7A 5KVCA 1KVSA 2B4QA 4MVJD 3FI9A 5CEJA 2Q4EA 2X0IA 1T4DA 2DC1A 5JBIA 3GLQA 1PJBA 4Y6RA 5I9MA 4B4UA 1ZSVA 1IL0A 2WYVA 3S1LA 4DWVA 4CLXA 2JD2A 4CODB 2AQ8A 3RUFA 4DBVO 3INRA 2GDZA 3NT2A 5COBA 3ZHBA 5JY1A 4BQRA 7ADHA 1MV8A 1VRWA 4YRAA 4R01A 4M1QA 1DIAA 3JQ8B 2WWRA 3S8MA 5ICSA 5L4NA 1PJ3A 2NLOA 1S6YA 2RBEA 3BMCA 1NFFA 1T24A 3D0OA 2J6IA 5FI3A 1CRWG 4DLBA 4K28A 4MVJE 5JPIA 1Z6ZA 2AG5A 2ZB7A 4EGFA 1F14A 4J9UE 7MDHA 2J3JA 1U8XX 2E49A 3V2GA 3WYBA 3I5MA 4AJ1A 5L53A 1JDJA 3JQGB 1K5HA 1JAXA 4I5GA 4NBVA 5DBGA 2TMGA 1JLLB 4NBUA 1GD1O 4NU5A 2ZB4A 3U4HA 3LLVA 2PZMA 2YDXA 2HRZA 1SCUB 4AJEA 3VC7A 3SXPA 5BR7A 5CEFA 2B4RO 1JKJA 5EJ2A 3I23A 4HP8A 3WX0A 1XELA 2YFHA 3WMXA 3WSVA 1UXIA 1LEHA 3PYLA 2HKIA 4R5MA 5THKA 2VHVA 3H3FA 3ORFA 3PZBA 3F5QA 4RV9A 3C7AA 4KUHA 4B79A 2Y1GA 3TZQA 3HB5X 4EZBA 4I1IA 1QR6A 4ZQFA 3DMTC 1HDGO 3FNGA 3NTOA 4RGBA 1BRMA 3B70A 3DBHB 3GZNA 4R41A 5H82A 2GLXA 2Z1MA 4TMFA 4P4NA 4YBZA 3WMWA 2HMWA 4J1NA 5EN4A 2Q2VA 2HO5A 4I5FA 3PI7A 4LMPA 4WCFB 1GPJA 2PY6A 4I9UA 1HL3A 3F3SA 3KSUA 3RBZA 4OIMA 1X0XA 4BGVA 4BNWA 5ITWA 1W4ZA 4RORA 1P31A 2JHGA 1EZ4A 4CL8A 2DTEA 2BGMA 1CETA 3ASVA 1U4SA 3QWIA 4R1UA 2PD4A 1XEAA 1QYXA 2HMVA 4N5MA 5A9TA 4IQGA 3C1TA 2Q50A 3RD5A 3RVDA 4BV8A 2W2KB 4WCFC 4Z6KA 1WW8A 3IAHA 3CKYA 5LDGA 3UAGA 1WWKA 1ISJA 1UR5A 4NG5A 3A28A 3PEFA 1IPFA 2QZZA 2F1KA 1ZK2A 1E3WB 2IXAA 3AJRA 3NV9A 3ZI0A 4Z3DA 4CLDA 1A4IA 1T25A 1P33A 3M1AA 1NQTA 3BMCB 3TZCA 2DU8A 1YOVB 2QZ9A 4GLOA 4FFOA 2YDYA 1AXGA 2GERA 4U5QA 1U5CA 4MP3A 4TWRA 5A03A 3X2EA 4XR9A 1H9BA 1ORRA 4ZRNA 4D3FA 3PWKA 1JKFA 1E0DA 1P9LA 2ILTA 1HLPA 1GYQA 2QIOA 3BMQA 1YL6A 1GCUA 3CH6A 3NJ8A 4EEZA 4W82A 3ZW8A 4QO7A 4ITUA 1LC3A 1JKJB 2EG9A 4FFRA 4XGIA 1C1XB 4J1TA 4GVLA 3TFOA 2J3IA 3AY6A 4DIFA 5H81A 4FGSA 1EE9A 4ALMA 2Y1CA 3WXBA 4IDFA 4AG3A 1KEVA 3GNTA 3IKVA 1QYCA 3G49A 1P1FA 5IZ4A 3ZNNA 1DXYA 5F5NA 3V1TC 1R16A 2G0TA 1ADFA 4PLHA 2Y05A 3FR7A 5L51A 1LA2A 2Y1DA 1T4BA 1NQOA 4YWJA 1U7HA 2DPHA 4WCFA 3OJFA 1PEDA 3CTMA 4QQRA 3DZBA 2HK7A 4AJKA 4PFJA 1HF3A 2DFVA 4W9NC 1I3KA 2YZ7A 3I3OA 3ADOA 4YCAA 1ENZA 5GMOA 4DLAA 3PLNA 1RWBA 4LRTB 2EW8A 3KYCB 2BGLA 3JQ9C 4Z9YA 1YDEA 3RFVA 1X1TA 5JDIA 2Y0CA 1TVEA 1R4NA 3OQ6A 2NQTA 4BNJA 2W2KA 3BMOB 3PFWO 3FPCA 4GGPA 4ZRMA 3TL2A 5I7FA 3LYLA 4PLCA 2C29D 1DLIA 1N92A 2X9NA 3H65A 4E2XA 1MP0A 3HFGA 3DZGA 5EIOA 4M86A 1RM4A 5JAZA 4RF5A 1TT7A 1BXZA 4YRBA 3EMKA 2G76A 4UUNA 1PL8A 4NFSA 2AE1A 2WYUA 4IMRA 3LC2O 2BGKA 1GEEA 3L9XA 3E48A 1PJSA 1C0IA 5I7EA 3VDQA 5DCUA 2C59A 4IJVA 2O7QA 3BIOA 3GN1A 2FR0A 3NDJA 2IXBA 5IAAA 4QEDA 4D3DA 4RPJA 2RHCA 1EDOA 4RO0A 2VYNA 3GG9A 3DMYA 1LDEA 1GDHA 1GUYA 4Y9DA 3ZWAA 1HDZA 2UVDA 1AHHA 4IPTA 4CQMA 2ZATA 1C1XA 3O9ZA 3GT0A 3V8BA 3H3JA 4DA9A 2AEJA 1YVEI 2V6GA 5B4TA 1Y5RA 4O59O 1N1GA 3W4IA 4QO8A 1VKOA 3LF1A 3RQSA 1LSOA 1DIHA 4OOFA 4RPKA 4JP3A 3VH2A 2HUNA 4FFMA 5CDGA 3LT2A 3I9KA 3FF4A 5DCWA 3E03A 4AFNA 2WSBA 1EVJA 4CM8A 2FPPB 4RDIA 2JL1A 2A9FA 3G0OA 3AU8A 2DLDA 4IJWA 2GZ1A 3GH3A 2AQHA 4MOWA 3QW2A 2ZQZA 4P4GA 2IZ0A 1DAPA 9LDBA 1NNUA 2NTVA 3ONDA 4IY1A 5L3ZA 3U9LA 3PJDA 1E7RA 4BMSA 1PR9A 2ZTUA 1H5QA 1ADBA 3A06A 4FSHA 5FF9A 3RJ9A 1VL8A 2FRDA 3VPHA 1B3BA 1KIFA 1JTVA 2CVOA 4H15A 1H0KA 4N5NA 4JX8A 2EGGA 3FTPA 4J4BA 2ZTMA 3AM5A 1ADCA 4WUVA 3PJGA 1EFLA 3WIDA 4P38A 5JDCC 2Q2QA 4PVCA 4BNIA 4E5YA 5KJFA 4NZ9A 3I4FA 2GCGA 3GGGA 5JDIC 1V8BA 1WMAA 4HADA 3AOEC 2D2IA 2DBQA 3UGKA 2OXIA 2PKQO 4ZQEA 2CVQA 1VSVA 5AXAA 3ETDA 4XB2A 3WDSA 4CLOB 1QP8A 1AE1A 3ZWPA 4L9RA 3NEPX 4WNIA 3H5AA 4WLUA 3GPDG 3FPLA 3EDMA 3WGGA 5JDCA 4M89A 4CMKA 3WBBA 3LVFO 2Y93A 5DP1A 5CDSA 4MPDA 1E6WA 4Q39A 2JHFA 2Q4BA 3G17A 5C7OO 4FD3A 1G1AA 1IOLA 1E6UA 4UEOA 3H9UA 4CMHA 3QJ5A 5CEEA 4YQYA 4CQMB 4JIGA 2D8AA 4MIEA 2FZWA 4PCVA 1Y6JA 2X1HA 3IDSA 1HEUA 4L4SA 1ISGA 2AG8A 2PTGA 4E13A 3GN2A 3DHEA 3ZV6A 4RPHA 4IQ8A 4BV9A 3GUYA 3GEMA 3HQ4O 5B4VA 2FR8A 3HE3A 4HFNA 1E77A 1MA0A 3DZJA 3DR3A 1XG5A 5DT9A 3SC4A 4HKTA 4BNZA 3ENKA 2YV1A 1YQXA 3RC2A 4UULA 4FB5A 1PZEA 4Y98A 5T67A 3JV7A 1SC6A 4J90A 4UUMA 4D44A 3ZGYA 5JCJA 4L4XA 4TRMA 3DOOA 3STHA 4JJFA 3U62A 1GUFA 1T1RA 4EBFA 3RC1A 5BQFA 3U4IA 4RVSA 5ICMA 1B16A 4PRKA 2PD3A 1Y8QB 1U3UA 3DTTA 4DVJA 4ZD6A 1DEHA 2PKQP 1GZ6A 5DZSA 2ZTLA 3HHPA 3KV3O 4BNGA 2DKNA 3D4OA 3DAPA 3L77A 5B12A 1N9GA 3EY4A 4K6CA 2AHRA 3WLFA 3TSCA 3UVEA 4J0EA 4PLTA 4EUHA 2OHXA 3KB6A 3RKRA 3BMNA 1DAOA 1DSSG 3RFXA 1LLUA 2C07A 3R3JA 4CM6A 2HK8A 3MWDA 1QMGA 2Y1FA 4PZCA 5JAIA 3AI1A 4MVJA 1NR1A 3UCFA 1G6KA 5TF4A 4CLOA 2VUTA 3X2FA 1CEQA 3A9WA 3R0IA 3JQ7A 1LLDA 2FPGB 3D3WA 5FWNA 3JQCA 3MEQA 3LDHA 3NTQA 4YT8A 3DONA 1GU7A 5JNLA 5KCZA 1OOEA 1CWUA 1KY5A 4J2HA 4ILKA 4KWIA 4B3HA 2C2YA 1DC6A 2PLAA 3DBLA 1F0YA 3GAFA 3HFSA 4CMIA 3OFSA 3WTCA 5U1PA 3G1UA 3ROMA 3PWSA 2H9IA 3F1LA 1XWFA 1A7AA 3WYEA 4D79A 4LGVA 3W8DA 4CMCA 4G81A 2YQ4A 4H16A 4K6FA 1NASA 3VZSA 1I0ZA 2Y1OA 3DZHA 3I6QA 3H7AA 4OMUA 1DHRA 4YAJA 4LSMA 3OSUA 3WBFA 3ZWMA 3I6IA 4Y67A 5ITVA 2NVUA 1I3MA 4ZJUA 4UUPA 1MLDA 1NPTO 5EQFA 1NFRA 3DBVO 3JYLA 2O3UA 4OGWA 5K0ZA 3H5RA 1QLHA 1JA9A 1TXGA 2I99A 4FJ0A 1FDSA 2O7SA 2VOJA 3C24A 1T1SA 2EP5A 1NQAO 3SLKA 3ZWOA 1V35A 3IP1A 5A02A 5A5FA 1KC1A 5IXYA 1Q0HA 1ULSA 1UH5A 1C14A 1O94A 5ES3A 4DQUA 2X58A 2XPCA 1U2DA 2D5CA 4LISA 4IINA 1VM6A 2Y1EA 5JMWA 2O2SA 2GN4A 3TZHA 1LJ8A 1GZ4A 1Z45A 2W90A 3VHRA 1LUAA 2EW2A 2WM3A 5CG2A 2YV3A 3NRCA 1E5LA 4MP6A 1Q0LA 3RAJA 4E5PA 3GVHA 4R9SA 4OAQA 1E7QA 3IIEA 3WTBA 4PLPA 5BNIA 2JD0A 1X1EA 2B37A 3ETGA 3FCOA 4FN4A 2WJPA 4KTVE 1VE9A 4EUEA 1E7YA 1UUFA 3CZMA 1BVRA 3AUTA 5DNAA 1SEPA 1P1IA 1U3WA 4FQ8A 1HRDA 2BI8A 2I3GA 4R69A 3NJ4A 4LVUA 1M6HA 4I5DA 3K2EA 1EEHA 1LLQA 1DFHA 1ZMTA 3ZHYA 2F00A 2Y99A 4GVXA 1PZGA 3I1JA 1XDWA 1D1SA 1N1EA 3JQGA 3WR5A 4E30A 1N8KA 1ID1A 2PR2A 2R6JA 1Q2XA 2PGJA 2BI7A 5EMHA 3O8QB 2FPIA 1PQWA 3KEQA 3AUAA 2DTXA 5A9SB 3R3SA 4C7JA 4XX0A 3BTSA 4XWYA 4PVDA 1F8GA 1P44A 3DHNA 5LC1A 3LF2A 1HETA 4JROA 5AOVA 2XXBA 2VYVA 1PGQA 1V3TA 3AOGA 3QP9A 1IZ0A 4AJ2A 2AW5A 4XQCA 1E92A 2W2LD 4GMFA 1YRLA 1AGNA 3Q2KA 1E6EA 1J49A 1GFSA 1X7HA 1H93A 3ONEA 3QE3A 1EUZA 4Z3KA 5K6AA 2BRUA 2WD8A 3PYXA 4QX6A 2OZPA 3GFBA 2HMSA 1ZK3A 3JQ9A 3V2UA 3U5TA 3ITKA 1JLLA 2I3AA 5L4SA 4EYEA 4RJTA 1GR0A 4MVJH 1Z7BA 2C20A 3WQSB 1NAHA 2BH9A 2EF1A 2NADA 3IQDB 2A94A 4XYBA 3AWDA 3G1TA 1YE3A 4CR6A 2O3JA 5G0WA 3QWAA 4OHUA 3RROA 4NJOA 4K1LA 1MGOA 4J3FA 1GY8A 4CUJA 2Q1WA 2WYWA 5BNFA 1WNTA 3ZDFA 1JKIA 1TEHA 3OQBA 4C7KA 4RF2A 1YBMA 5C7IO 4NI5A 5TIIA 2IZ1A 2OOSA 1V3UA 4YTEA 1PJ2A 5KKCA 4RZHA 3FR8A 4D41A 8LDHA 4N18A 4NU6A 4BO5A 1GPDG 2NU7A 1N7GA 1HE2A 1CYDA 2NUAB 3VPFA 1LRJA 2TMDA 4GQAA 5CAEB 3MJTA 1OC4A 1Z73A 3BHMA 1GAEO 3NKLA 3O26A 1DO8A 3PP8A 4XJSA 2JCXA 4BL5A 4BO2A 1YOVA 2PGLA 1WDLA 2Y68A 4GX0A 1MXHA 3H2SA 3GK3A 1LSUA 3PQFA 4IJKA 1G0OA 5AXDA 3GDFA 4BNNA 4BO9A 1JWBB 3HADA 5T57A 1IHYA 2YFQA 4R5HA 4HX5A 1XCBA 5BSFA 5GZ1A 3BAZA 3AI3A 2FPIB 1MX3A 1A71A 4GSLA 3ZU2A 5IDQA 1XIVA 4A73A 3DAFA 4P22A 2R00C 3RUAA 1G0NA 3NGLA 3H9EO 4N54A 3K96A 5BNTA 2VTDA 4JNKA 2ZYDA 4OXYA 1QLJA 4GL4A 1PSDA 4XIJA 4JBGA 1I3NA 4TKLA 1LQUA 1TB4A 2HAEA 3E82A 4NQZA 1I2CA 3W8FA 3RFTA 3KZVA 3ZCXA 1DOHA 4AICA 3P7MA 2ZCUA 1BW9B 4XRRA 1R12A 2OMEA 3ZWYA 5L45A 3UICA 2PNFA 3DWFA 3EC7A 3GVCA 1ULUA 2GRAA 2JKVA 4N7RA 5F1KA 4IM7A 4GSKA 1EMDA 1YJQA 2WE8A 2ZB3A 4KOAA 3BZUA 5IDYA 3VH1A 4BNKA 5L95A 2RH8A 2EWMA 4FFNA 4CQLB 2BLLA 3LK7A 2WEKA 3S2IA 1OBFO 1HKUA 2GASA 1PJQA 5FI5A 2X0RA 1ZK0A 3ZWVA 1EQ2A 3EK2A 4Y6SA 2EGHA 4D0RA 1C1DB 1X14A 2VNSA 4LN1A 5DCYA 4GI2A 4IGEA 2Z95A 4EJ0A 1ZK4A 2Q1SA 2DFDA 2GGSA 3IUSA 1QORA 1HWYA 1I01A 2YV2A 4CR8A 3F46A 3FN4A 3FRJA 4CLHA 1F06A 3GQVA 5CAEA 3SBOA 2CDCA 1WP4A 2YHUA 3IP3A 4J43A 5TJ9A 1P45A 4GH5A 3ICPA 4FR5A 3S2EA 2V6FA 2I66A 2J5RA 3Q3CA 2R00A 4O1MA 5HM8A 4XDYA 4D46A 1WPQA 4N5LA 3ZNOA 5IZCC 3LT4A 3PDJA 2DBRA 3L0DA 1F8FA 4UVIA 3OETA 4FC6A 2JFFA 4U7WA 5IN4A 3CINA 4UVEA 3IKTA 4F3YA 4BNTA 3HN7A 4BS9A 2P4QA 3QWBA 4MVJM 4GKBA 4J0FA 4OXKA 2FWMX 4OSPA 1B0AA 5C37A 3BMOA 1I8TA 3ETEA 2Y67A 3VPXA 4YB8A 4M87A 2PZKA 1E7WA 4MVJP 1SB9A 1FDUA 4RQTA 4CM3A 4YAKA 4OYRA 1UAGA 2GNAA 3VZQA 5K6AC 4HUJA 4U0KA 4GAEA 3WQQA 3E5MA 1UAYA 2LDBA 2C5AA 1QXSA 3OIDA 3PWZA 5JC8A 2NTJA 1LDMA 3FWNA 2GN8A 3IUPA 3AU9A 4QECA 1QYVA 4CV1A 3TDKA 2WE7A 2QRJA 4DXHA 1EVYA 1KS9A 4XD2A 3GMSA 1M75A 5FYDA 1NP3A 2QRLA 1A7KA 2JCYA 4L74A 4FFLA 3U3XA 1QKIA 2EP7A 1PR3A 2CVZA 2EXXA 2VWGA 1DC5A 3D4NA 3GRKA 5THQA 1NYTA 1BGVA 1CDOA 4CLRA 3WNQA 3I9JA 4CLEA 1I2BA 4U0JA 1RM0A 1I32A 5TS3A 4BKOA 1QG6A 4Y6PA 3F9IA 2CMDA 1M76A 3MCVA 3FNHA 3HDYA 1H2HA 4U6QA 4NPCA 3AFNA 3QVOA 4WLVA 5AYVA 1ZKMA 2P68A 1U8FO 1EUCA 4JJIA 3T7CA 4DQVA 5IDWA 4DMMA 3KVOA 3PGXA 1L7EA 2C0CA 3K6JA 4XZ3A 4IDBA 3C8MA 3JD1A 4YJGA 2I65A 3GG2A 4TKMA 1VL6A 3CPSA 1IUKA 6ADHA 3ON5A 3TOXA 4YDRA 3E5RA 4Z9XA 4BO0A 1NXQA 4LW8A 1KVTA 1LLCA 5DOZA 5K9ZA 4FC7A 4FPXA 5G4LA 4BO7A 5DDIP 4AJNA 1PGJA 1UZMA 1BXGA 1P3DA 4R16A 4YJFB 4MP8A 2VRBA 4ND3A 4CMBA 2D59A 2FP4B 2PH5A 3E6AA 1CIVA 2UUPA 2X5JO 1NVTA 1Q7CA 1U9JA 5TQVA 2YHIB 1H6DA 1A72A 3BA1A 2H6EA 2EIHA 1PTJA 1N5DA 5B37A 1SPXA 4W9NA 2Y0EA 2B5WA 4LK3A 4AJHA 4YAEA 4BO1A 1TA4A 4BKQA 4J7UA 4YJDA 2O50A 3QQPA 2Q1UA 1GEGA 4NBRA 3BHJA 3D4PA 1ZCJA 2PGDA 5LDHA 4IJUA 2W98A 2P9GA 3Q6IA 3WWYA 4E3ZA 3WGIA 4URFA 1DIGA 2OUIA 3PPIA 2GSDA 4RPGA 1PS8A 5JE8A 1PX0A 5I9LA 5I8WA 4OH1A 2HMUA 1EE2A 1E7MA 1OFGA 1SB8A 1CJCA 1U4OA 2BHLA 2NQ8A 4YJHB 4BNFA 3M2TA 4ONEA 1HLDA 1NQ5A 3DZKA 1CERA 3ZNQA 1Y8QA 2BKAA 1JWAB 1UJMA 3SEFA 3GEDA 3OA0A 3Q9NA 3KBOA 5DP2A 2DBVO 5L9AA 5ENVA 3HG7A 2IYOA 1ZZEA 3M2PA 3OQ1A 2IE0A 4OQZA 4AJPA 4DLLA 4CM5A 5FFFA 4IDEA 4WK6A 1LDYA 1DC3A 5H83A 1U7TA 2VWHA 3RIHA 4O0LA 1GL3A 1B8UA 1DDOA 3KEOA 2RIRA 4BOYA 3WOHA 1GUZA 1MG0A 4Z0PA 3BTVA 5BSEA 3L6OO 3MWDB 2H63A 2VUSA 4E6PA 5JYDA 3PHIA 4YAIA 1BDMA 3GF4A 1HYGA 4AJ4A 3GFGA 3DXFA 2GZ3A 2E4AA 1NTOA 1XLTA 1UP4A 4RLHA 1GADO 2FPGA 3WNVA 4RF3A 1T2AA 4MKXA 4UVDA 4YT4A 2HU2A 4RF4A 2YHIA 3RASA 4B8WA 1NHWA 4EUFA 1ONPA 3EAGA 2JFHA 4DMLA 4DREA 2P2SA 1DRWA 2EKLA 3OP4A 1I36A 1LU9A 3RUEA 4ALJA 5L40A 2VUUA 4PLYA 3T7EA 4J1SA 1EVIA 4KUEA 3S2GA 3QSGA 3FWZA 2DQ4A 1L7DA 3KYBA 3OJOA 2B83A 4A0SA 3C3XA 1HDYA 4PIVA 1K6XA 4YT5A 4JGBA 4BGEA 3JQEA 4CV2A 1Y5MA 2ZJ0A 1WXDA 1BHSA 1SAYA 3ANLA 2FY8A 3GHHA 3JQ7B 3K73O 4WOKA 3V5NA 4DBZA 3MWEA 1B7GO 1W6UA 2HSDA 1PQPA 2WTBA 2GYYA 5IXSA 2HDHA 4FFPA 1K6IA 1E3IA 1HE5A 1ZH8A 2AEFA 3UXYA 1ISFA 5KJEA 3QHAA 3BTUA 1XKQA 4GPD1 4HBGA 5TX7A 5CG1A 1M2WA 3EZYA 5CHEA 1P0FA 3ENNA 3ULKA 5L7TA 5JSFA 3ZU3A 3PRJA 3DFUA 1UXKA 1MC4A 1UXJA 2I5PO 3DO5A 4ROSA 5IZCA 1JAYA 4BO8A 1GCOA 4S3MA 2VNAA 3OICA 1GQYA 3JYOA 1HSOA 3U49A 1I10A 1HYHA 3PHLA 4GBJA 3RKUA 4U6SA 4M49A 4ND5A 1H6CA 2VRCD 4HNGA 1L1FA 4CMAA 2C7GA 4ZQGA 3UUWA 1VJTA 1PWXA 4HFMA 4IMPA 1IHXA 2D1YA 2EKPA 2B4TO 2DBZA 2FMUA 1BXKA 2HLPA 1HXHA 3CIFA 1PJ4A 3AY3A 1DJQA 4JXKA 2O23A 1VJ0A 3O8QA 2VZ0A 4F6LA 4II2A 3G3EA 3GOHA 4XYEA 3H9QA 2P9EA 3MJSA 5U4QA 4MVJF 4ALNA 4L73A 3WICA 4HXYA 4BMNA 4CM9D 3AY7A 4A2CA 3F1KA 5AXCA 4Q3BA 1NVGA 5HTOA 1ZXLA 2VHZA 4MJLA 4MKZA 3PHJA 4PRLA 2CZCA 5JAQA 3QRWA 3K8ZA 5HWSA 3ZWBA 3WGTA 4L4RA 1A27A 2NVWA 5LCXA 1V3VA 4QFDA 4GGOA 4IS3A 4R4JA 4W7IA 2AXQA 2P91A 3NGXA 4XQEA 1D4FA 3AFMA 1E1LA 3C1AA 2X6TA 3RC9A 1ZFNA 4R68A 4ZN6A 1U3VA 2WD7B 2ZJ1A 4WLNA 1P0CA 1WLYA 2XOXA 4J9VA 4TROA 2Q49A 4XX0B 1LSSA 2O3SA 4XYLA 3U0BA 1X7GA 4XYGA 3UF0A 1VI2A 1M66A 2EKQA 4Q3NA 1QSGA 2OP1A 1HYEA 1PL6A 4I9NA 4DC0A 4FJ1A 3W4KA 3SJUA 1WAMA 2IYPA 4J7XA 3OHSX 2X4GA 1I24A 3KSZO 1YB4A 1YKFA 4ZGWA 4NJMA 4BNUA 2P5YA 2B5VA 4J6FA 4XB1A 3P5SA 4XEHA 2NU7B 2HJSA 1K6JA 1HSZA 3HZZA 3GNSA 1AN9A 1W0CA 1GV1A 2Z1NA 4YPOA 2NU9B 4D42A 1YO6A 3KM0A 4ALKA 4E12A 3WLEA 3VDRA 3OJEA 4CL3A 1PJCA 4KDFA 1SOWA 3KYCA 4PLFA 2IDZA 4RVUA 3Q0EA 3SX2A 4BKPA 5GZ3A 1CQIA 3E18A 2EEZA 1NPYA 4RDHA 1DFGA 1VJ1A 4GKVA 2JD1A 1P1HA 2OGUA 1UP6A 3QA9A 3FBTA 4R1SA 2X0JA 1N2SA 1E7SA 2J3HA 4EI2A 3PZRA 2NV6A 1EK5A 3LC7O 3WJAA 4BHTA 1HE3A 5F1OA 3PQEA 3RCBA 3R6DA 4ND4A 2CY0A 4L75A 1LDNA 4FS3A 1ZNQO 4B7XA 1LQTA 1Z75A 1HTBA 1EK6A 2YUTA 1YQGA 4L76A 5G4KA 4WLFA 1YWGO 3QVWA 5KNLA 1KVRA 1KC3A 3GVPA 4TSKA 1PWZA 3DFZA 3DL2A 4CUKA 4IGFA 4YA6A 5DOVA 4BO6A 3DMTA 3RI3A 3L4BA 1HDCA 4QT0A 5MDHA 5IN5A 3FNFA 4CPDA 1JQBA 3PGJA 1DIBA 1E1MA 1SOVA 5FEUA 4CQLA 2V7PA 2W4QA 4DPLA 1ENPA 4B4OA 1IULA 1QYDA 2QRKA 4E5NA 3H9GA 1O5IA 5TJHA 3HDHA 4WLOA 2VHYA 3TWOA 3L6EA 4U8GA 3U4DA 1ZO8A 2QYSA 4MKRA 1Z82A 8ADHA 5JAMA 5I7SA 4FW8A 1OAAA 3TRIA 3SLGA 2JAPA 3JQFA 4DUPA 1YDWA 4O5OA 1A5ZA 1VPDA 3GVIA 4IZIA 4NDNE 4OKNA 2X8LA 4WKGA 4TRJA 3EW7A 4NR0A 4XDZA 5A05A 3VTZA 3EUWA 3QWHA 1LDBA 4J4TA 4TRNA 4UVGA 4CMEA 4GX2A 4DRYA 3NX4A 1X0VA 4Q3CA 4OOEA 2BFPA 1FMCA 3WFJA 3UKOA 3EGOA 3TPCA 4J49A 1I30A 5IG2A 1LTHR 1EBUA 4XGKA 4R3WA 4BMVA 3OBBA 4ZVVA 1C1DA 4XQGA 5IF3A 3UFXB 1DC4A 1DFIA 3FNEA 4RL6A 4AVYA 2ZB8A 5KKAA 4EDFA 4CR7A 5KJ1A 3PVZA 4NBTA 4X54A 1K2WA 2DUWA 4IXWA 2DM6A 4NMHA 1C0LA 1XR3A 1RYDA 4PZEA 4PN3A 1E3WA 3L6DA 3C85A 3ROKA 3MJCA 1HZZA 2VOEA 1YJ8A 1PZHA 4BB6A 3F4BA 1SO8A 5F1PA 4QXMA 1MXFA 4IDDA 2I76A 1IZ9A 4IDAA 4NBWA 3WWZA 4GMGA 3EVTA 2O3QA 3KRTA 4PZDA 3AM4A 4OM8A 4M54A 3W8EA 3M1LA 4IS2A 2XAAA 3C7DB 2VT2A 1U28A 1YXMA 3WGZA 1R0LA 5KIAA 3DQPA 2NVBA 3ZWCA 2VT3A 3GGPA 1QYWA 2C82A 5TT0A 2BFMA 3RBVA 1Y81A 2NTNA 4OL9A 2VCYA 4KQXA 3A14A 4BNMA 1X7DA 3L07A 4GX1A 1B26A 4YYZA 2VHWA 1PS0A 5DBFA 4E0BA 2WDZA 3LQFA 1R15A 1LSJA 4LMRA 2OP0A 1HE4A 1NX6A 1XHLA 4ZHSA 3AM3A 1DRUA 4FJ2A 3CE6A 4Q3DA 4CQMD 4CM9A 4BGUA 3JSAA 1SZJG 4H7PA 4BKUA 1EUCB 5A9RA 3KLPX 4CV0A 1A9ZA 1QV6A 2ZYAA 2EERA 2GN6A 2GO1A 3ICCA 5ER6A 2NU6A 5I9NA 4J7CA 3WFIA 2EJVA 4NFHA 3ZN2A 4J91A 4FOOA 4E32A 1O6ZA 2UYYA 1P74A 4EW6A 1ISIA 3PXXA 1XQ6A 4WGGA 1O89A 3KUXA 1I3LA 1KYQA 1NR7A 1UZNA 1ZXBA 4R1NA 3PIDA 5T6BA 1T2DA 4YJFA 2P9CA 2FP4A 3ANMA 3AOEA 5DF1A 4Z0HO 1CF2O 5F21A 4MVJG 3ASUA 3GA0A 1EFKA 5EINA 3WYCA 2GN9A 4W4TA 3NAQA 4Z0TA 2I6TA 3PLRA 5B4UA 4CMEC 1V0JA 3OIFA 4NIMA 3KETA 4A03A 2RCYA 5HBRA 3RU7A 3DBRA 3IC5A 3V2HA 4KWHA 3UCXA 2QHXA 1ZUD1 3HJAA 2HCTA 3WIEA 4CMGA 3JD3A 1ZSYA 3O03A 1NBOA 1P1JA 1KY4A 3RUIA 3H5NA 4S1VA 3QV1A 2CF5A 1YQDA 3KYDB 4BGIA 3JQAD 3JTMA 1NPDA 3ANNA 1JN0A 2C2XA 2LDXA 3T4EA 2IEDA 3G79A 3JD4A 4E33A 4Z9FA 2E82A 5T5QA 1VL0A 2Q3EA 3QVXA 3L4SO 4TVOA 3F47A 5TLSA 4YXFA 3OEYA 1NWHA 2GUGA 2HK9A 3MZ0A 3RUDA 1DHTA 4YJHA 3TJRA 2VYND 2UAGA 3DB2A 5A5EA 1WZEA 3D5TA 4FBGA 1E1NA 2V6BA 3MOGA 5CDTA 4RQUA 1AXEA 1H2BA 1S7CA 3H2ZA 2RAFA 2YW9A 1TI7A 2VWPA 4IXTA 4GX5A 4DL9A 3QLJA 4JCOA 2UV8A 4WPGA 2RH4A 3KLMX 5KWEA 4PG8A 1TT5B 4CM8B 1XU9A 4M55A 1PL7A 4YRDA 5ILGA 4EJ6A 5COAA 2G17A 4NFYA 3B1KA 4XA8A 5KJCA 1PU2A 4BNXA 2BD0A 4WNCA 1ADGA 4LCJA 1MC5A 2GPTA 3JQFC 4BQPA 3INGA 4H3VA 3W6UA 2D3TA 3PTZA 5CDUA 3I83A 1BMDA 3ST7A 1O95A 2FSVA 3JQDA 2O3TA 3JQ6A 5B1YA 3NTRA 4YR9A 2G1UA 2XXJA 5G0UA 2O4UX 1V9LA 1ZBQA 2A4KA 2VN8A 1Y7TA 3GHYA 3KOUA 5AVOA 5F3RA 3OM9A 2CSUA 5JFOA 3LT0A 1DBVO 3WGOA 2O3RA 3MTGA 2QQ5A 2Q45A 3KYDA 2OL4A 1GQ2A 3WGQA 2EV9A 1ML3A 3JQBC 3W6ZA 3MWEB 1HT0A 3INTA 2Q46A 2A92A 1I33A 5EERA 3GZ4A 4EITA 1LI4A 3TF5A 2CDAA 2EHDA 2JCVA 2E37A 1PQUA 3IL2A 3BXXA 3AW9A 1KERA 4WEQA 1PJLA 5F5LA 2NSDA 1AUPA 3NDRA 2UUOA 4BNLA 3H8VA 4BIIA 4G2NA 4HV4A 1YBVA 1MFPA 2GR9A 3PK0A 3VKVA 3B20A 5A4DA 3K92A 4MVJI 4R51A 4ESOA 1P77A 1H94A 2XF8A 5HS4A 2P4HX 1C0PA 2Z5LA 3HDQA 4W6ZA 5KVSA 2YYYA 3KHUA 3LZ6A 2PZJA 2HRBA 4GWKA 3H9JA 4YT2A 4RVHA 2SCUA 4MO2A 3ZW9A 3GDOA 1UXHA 4UEJA 1QRRA 4RVDA 2PK3A 3CEAA 2PFGA 1ZSNA 1R4MA 2PZLA 4E21A 3CMCO 4ZQHA 4J1QA 4RPLA 3PQDA 2C7VA 2JFGA 3P2OA 2Y0DA 4KZPA 3DDNA 5L4LA 1IYZA 1WDKA 2B69A 2GD1O 2UDPA 4NHEA 1KEWA 1T2CA 1ENYA 3B1JA 3ZU5A 1LX6A 4BVAA 1B15A 4AJJA 5JYEA 1YONA 1UDCA 2PKRA 1H6BA 1T2EA 1LDGA 3GMDA 4UUOA 3DAGA 5ILOA 1FDTA 3K30A 3TFQA 4CMJA 3NT4A 3IMFA 2DPGA 2QW8A 3VAZA 1NHGA 3ROPA 4YACA 3ZV4A 1OMOA 2NUAA 3ITDA 1NM5A 4QFCA 2J5KA 2FOIA 3JQ8A 2NU8B 1Y8RA 1RKXA 4OKIA 1R6DA 3D3EA 3FTNA 4G65A 3OIGA 4Y8VA 3BYZA 3GDGA 2IRWA 4FIZA 3CSDA 3I9LA 5J23A 3VH3A 3VPGA 4UREA 4II3A 3HSKA 1HZJA 5JO9A 4JBHA 4DC1A 1E5QA 1UXGA 4FOSA 4JK3A 2J3KA 2O48X 1UP7A 1ZIDA 3ZWXA 2X0NA 4YQZA 1F17A 1FF9A 1WVGA 2O4CA 4PLGA 2V6MA 4DTIA 4ZA2A 4TZTA 1TLTA 1ISMA 1NVMB 1IY8A 1RPNA 4CMIB 3EYWA 1VLLA 2FSSA 1U3TA 2O2YA 1MUUA 1KEPA 3HB4X 1Q7GA 3KSDO 1SNYA 3N74A 2C54A 1C3VA 3DHYA 1ENOA 3DC2A 5C7LO 2G82A 3F4LA 5GZ6A 3O4RA 4E5MA 4M8SA 4RVGA 1ZJZA 2NVUB 4Q3AA 3I9NA 1MG5A 4ND2A 3KO8A 4QTZA 3GZNB 4PG5A 2H1SA 4I9HA 4WECA 4I08A 2V65A 5JC1A 4JN6B 4WEOA 5TSDA 2WD7A 1R4MB 3GR6A 3DOCA 3C7CB 2E6UX 5CPFA 2NU9A 5T8KA 2PD6A 5JCJD 3RWBA 3Q9UA 2W8ZA 1X15A 3W1VA 1OI7A 1NWCA 1E3JA 3RSHA 3OJLA 1Y9AA 3OF2A 4I5EA 2CFCA 2DVMA 3ONFA 3QVTA 3RC7A 1NAIA 4O6VA 4KP7A 5JMPA 3ZV5A 4AL4A 1CQIB 4TQGA 1FDVA 3JYQA 1Z7EA 3LT1A 2VWQA 4PGFA 1XU7A 3PJEA 1BG6A 1B8VA 3UCEA 4A27A 3DBHA 4GLLA 5JW6A 1U2GA 3WJ7A 4CM4B 3UW3A 3DZIA 3LC1O 4O63O 5KJ6A 2YY7A 1D1TA 1PGOA 3AI2A 2NU8A 1Y8RB 2EJWA 5TNXA 3TQHA 2Q1TA 3EVNA 3MOIA 4K9DA 4IQ0A 1PZFA 1E3EA 3ZU4A 2DUUA 3PHHA 1Q7BA 3ADPA 1C0KA 3HN2A 3RUHA 4J2OA 3WB9A 5L7YA 3MJVA 1K0UA 4E5KA 3MJ4A 9LDTA 4PG4A 1P1RA 4A26A 2D4AA 3U09A 3QWFA 5EQDA 4ZQBA 1HDXA 4DYDA 3SC6A 5A9SA 4XIYA 3SJ7A 3ZZNA 3UOGA 4JP2A 4DPMA 4L8VA 3JD2A 1B8PA 1V6AA 1O8CA 3D64A 5JCXA
chains in the Genus database with same CATH superfamily
1M2OA 4O2BB 2DULA 3MERA 3ER8A 4DA4A 1N2IA 4WASA 3ABZA 4PC7A 1BS1A 4BKRA 1RAAA 3LUAA 1C2YA 3DE6X 1G17A 4ZU3A 5CLQA 1CU1A 3GT3A 3DMRA 2PZFA 4PG6A 4ZVRA 2IHUA 2VP9A 3NDPA 5JZBA 3TCXB 2CB0A 1L7BA 1VBNA 5KI6A 2P9JA 4TWJA 2PX6A 4J03A 2PA3A 4ZGBA 5CT4A 5G4KB 1T8UA 2DQYA 4B6JA 1Q6ZA 1WUJS 4POAA 4DLRA 4KFSA 3M5DA 2HLHA 3ANTA 3IUEA 3K5PA 6YASA 1OH8A 3W5DA 5M29A 2L0XA 2Q5FA 1T8YA 3ZC3A 4B46A 1DS6A 2ZKLA 2AZMA 2D1FA 1EHIA 1N3YA 2ZJ4A 3NM6B 5JMOA 5HRCA 1U1CA 2Q07A 4KJXA 4R1TA 4QBFA 2OYSA 4WZAA 2NZ2A 4TTIA 4MHOA 1EVQA 2C4WA 3G89A 4GP6A 5E9WA 4QOSA 3U31A 3M6IA 4TVBA 4EEXA 3J80A 3CZCA 1H1LB 3FBGA 2BBTA 2E87A 1IB6A 1Z6YA 3DE0X 4CKBA 1J1UA 2GM5A 3PFIA 4P8RA 2X86A 4Q7KA 4TV8B 4F5EA 4D57A 4BTEA 4G0QA 4MI6A 5BVGB 4X7PA 2H5LA 4UDNA 2FQYA 1YCGA 3BXOA 1SFRA 3LRTA 5MGBA 3HGQA 4FM9A 2DX7A 2O05A 4HUQB 1M0EA 1LVGA 2PKXA 3DDSA 1T3TA 1Q0QA 4OG2A 3C3WA 2IEBA 5KTRA 3BB1A 4O4IA 4FT2A 2FFHA 4P5PA 3C5VA 3PYMA 4XPIA 1J8DA 3B48A 4R54A 2IYFA 4QDKA 3HWX1 2ANBA 3L7YA 5E4FA 5F73A 4B6GA 5FULA 3ZEAA 5EL0A 5C1BA 1FX0A 1ZMOA 3R74A 2JLRA 4FNMA 3MLBA 3W4JA 2BMAA 1PT7A 2QD2A 2RHLA 3ORQA 3PJFA 4LYJA 4MIKA 1QKJA 3E8XA 4X6XA 3LU1A 3RBAA 5BN3A 5BXYA 2ODWA 4KE6A 3ZZ1A 1RQXA 2WJ6A 4NEQA 2I6FA 1T5DX 3FSEA 4DW8A 2ZCVA 3A05A 3IT2A 5HUQA 2ZUEA 1Y3AA 3DKKA 1A4UA 1P2FA 3E2IA 3V42A 2O2JA 4F5YA 2ZJFA 2LWIA 1KVUA 3D2BA 4PX2A 3OT1A 5B1HA 1DQRA 2ZWIA 4D45A 2BF7A 5AVYA 2BR4A 1D8AA 2FEWB 5LZ7A 1EDZA 1TQ4A 1RQ7A 1UPAA 4OLHA 4QDOA 1KFJB 4KL8S 1R1DA 2HIMA 3F3MA 3IUBA 1W0JA 1JNYA 2ZSDA 4LBWA 3ZWQA 2D74A 2BC9A 3IEXA 2YN2A 1E9EA 1Z13A 3CZRA 1JJAA 3KSRA 1HURA 3GLHE 2JBHA 2LTAA 3AF1A 5A3SA 4C29A 3SQXA 1YQEA 3DF9A 2P6PA 2YWDA 1XVVA 1P9RA 4P82A 4F6CA 4ZYXA 4OHYA 2J0UA 1THTA 1PUXA 2VAWA 3MWLA 2C9ZA 5D3MB 4UXIA 1VQ1A 4X7BA 3R20A 1T9KA 2EX0A 5G0VA 3K1JA 4G1CA 4O2RA 2PIDA 6GPBA 1Y1LA 1PQYA 2CDRA 3E3AA 3FKSA 1XNHA 4D96A 3GVXA 4G1VA 4HWOA 4R84A 1U8CB 1ONBA 1D1QA 3GRPA 5K0LA 3HXTA 2YL2A 4QAJA 5DJ5A 1M8PA 2FW8A 3TNLA 3WGYA 2PE5A 1Z4PX 3IV9A 4ALLA 2AA3A 4X62B 3PIIA 5K8TA 4L27A 4URWR 1JTFA 5EIWA 2C78A 1W73A 2DOKA 1LNZA 3GNQA 2YHAA 1SU6A 5DHAA 1FJHA 3GLUA 3PJRA 1VJDA 4U9IS 3ZHXA 2AG1A 2DLNA 2QAIA 3WS7A 2A6PA 2NU6B 1X9IA 2BCJQ 2F1OA 3HDJA 4M9UA 3F0TA 3UTDA 2X5KO 5AI9A 3FD8A 2OQIA 2DHRA 2OEPA 3U1VA 4EMUA 4KMOA 3W90A 3ZEIA 3RAFC 2R5FA 3N59A 1DU4A 1ZP6A 2IEZA 3CA8A 4UARA 2EFGA 4KGXA 3ELUA 4V0OA 5KVQA 1KI1A 1HV8A 3EQ2A 3HWSA 3O0DA 4PAOA 1CTQA 2VJNA 4HWRA 5HS6A 2I2CA 2CUKA 4RTJA 3NHSA 2FTKE 5B1DA 3TW4A 4F84A 3DT8A 4UHJA 1U98A 4FVTA 2OENG 5EUMA 4XX1A 2F4VB 4AU1A 1KOFA 1TF7A 1XN1A 2H2AA 1YD7A 3OZTA 3PNOA 4UEKA 3V1YA 5BMVA 1XCGB 2C7OA 3P2YA 2XYHA 3VR5A 1YS4A 1M0WA 1ZM9A 4O4LA 4TKZA 2WM9B 3W77A 3UAWA 4M2LA 2QM3A 3FJ1A 3AUUA 3RG8A 4AURA 2NT3A 4HFJA 4NZNA 5AJTA 5DULA 4EVQA 4WCDA 1MFZA 4GM1A 4QASA 1REQA 4Y2UA 2F3RA 3Q11A 2F9LA 4MYSA 4YRIA 3ZDEA 3O3NB 3FHLA 2BHTA 3EDOA 3GLTA 1JJVA 3AKDA 3S8YA 5B36A 1BEUB 2IZZA 2KLHA 4ZWNA 2Y9PB 3AL3A 5JJLA 5IRCD 1UPXA 1KYIA 4R3NA 4P7BA 5DV9A 3OC6A 2C31A 2Q6VA 2XVZA 5DNCA 2ILVA 4RAOA 1VKNA 5DMXA 4HD8A 5HZKA 2OORA 4FZRA 2JDIA 2VDWB 1ZEJA 1K86A 3W1WA 3NCHA 5HFAA 4S1NA 2ZS8A 4GG1A 3Q8KA 4WZ6A 5JD3A 1O9GA 2CHVA 4J0DA 3HU2A 4GO1A 3RYHA 5BSHA 3WZMA 1WEHA 1OWOA 1YI1A 3WOVA 1WE2A 3KLBA 1NTRA 4LOIA 4YV2A 4AJLA 1JDTA 4NS4A 1QQBA 4CLRB 1PL0A 4HC4A 5A4IS 3ABIA 3D6TB 4O2AA 2RBKA 4RYLA 1RFGE 2OGSA 3RS7A 1D7OA 2E7ZA 2V55B 3RK4A 3RSOA 2PSEA 1ZGGA 3BRCA 1C8LA 4PLWA 2PM8A 5KPJA 4ZVSA 1W49A 4W7HA 4DTCA 1YBHA 4MRVA 5HHTA 1KAGA 1YCHA 1XNJA 4MR8A 3JALA 2HR1A 2HA0A 4L95C 2FZ4A 1NZDA 2A4MA 4K1XA 3ZCPA 3A1NA 4LF8B 1U2RA 2W6IA 4NESA 1LK7A 3FUUA 1NW7A 2WVHA 3HWWA 4R3UC 2A58A 2C2ZA 3A9RA 2JNWA 3F4KA 4RAQA 4TV9F 3KWFA 4ND1A 4BU1A 4KQGA 3G7NA 2VKQA 2X22A 4OQNA 4E4TA 4RVFA 2PO7A 5CMLA 4ALIA 1TW2A 3SQLA 3O2QB 3TGLA 4CKXA 3DEHA 3WQRA 1WDMA 3W6PA 4EATA 2VXYA 4YEDA 2PX5A 3D3KA 2NX2A 3AF2A 2QLBA 2M1ZA 3RYIB 1G3QA 4G36A 4XJTA 4F2WA 5BUCA 3HY6A 2G5CA 4IYJA 3TFWA 1HNXB 1RW4A 4HNHA 1YL7A 2O0MA 3OD1A 1RYMA 4YAUA 2J6CA 4PANA 2CYAA 5EJIA 1EUDB 1S9DA 2NT4A 5EKSA 3AVXA 3DS8A 3GAZA 2P2GA 1ZGZA 2H8KA 1M2GA 1Z29A 5BT9A 3CF2A 3W5HA 5JNRA 2W2TA 3AWIA 5JAPA 2FZEA 1JDZA 1I5OA 2RGXA 1KJ8A 1OLOA 2IXFA 2ZUBA 5J59A 4BN5A 3CUKA 3M6UA 4WCVA 4HLQB 3VOSA 2D4HA 3TLGA 4R1LA 5KVVA 2Q2OA 4EMSA 3N1UA 4IHJA 1YZ3A 1C9EA 4DIBA 1W76A 3I42A 4IKPA 2FK7A 2PJRA 5A1TA 2GCIA 1DAHA 3KQHA 4DQLA 3F9CA 3GFQA 4DCJA 2B8NA 4G5HA 4OXNA 1OZAA 2XW6A 3HCEA 1M6WA 1BTOA 3QBTA 2WM8A 2ZQYA 4DCMA 3IELA 1U8UA 1FA9A 3I52A 2QTMA 3LCUA 1UDAA 2XOEA 3PDUA 4Q9NA 4K26A 4XCVA 3VSDA 1UBCA 4B35A 1EQUA 2XBUA 2AX4A 3LCJA 1ZR2A 2GCNA 2IQ5A 3R5JA 1K3TA 3CMMA 3VVBA 4O8CA 4WUTA 1Z6AA 1F60A 2SCUB 1KTVA 4GXNA 5ADHA 2J5QA 1YH3A 4YV7A 2XSZD 3E9QA 3UOWA 4RANA 4OQYA 4BWFB 2X23A 5C3MA 1A9XB 1H6AA 2YJZA 4ED9A 5KTKA 4LJ8A 1B3RA 4JSYA 1NLFA 2OE2A 3MCUA 4H7IA 4KWTA 4LFCB 3DTVA 1RQRA 3C0KA 3TI9A 3F96A 1S1MA 1O9BA 1CS0A 3ROQA 1ZVMA 1D1PA 1MB4A 2W22A 2AOUB 3HV2A 4G4SP 4I50A 4MWGA 3D6UA 2BFOA 4Q9AA 4XWTA 2OQVA 4F7DA 4HQKA 1R0XA 3JPYA 2W8BA 2HDWA 2ZK7A 1BOOA 5FKJA 1G7SA 1MNAA 5ALXA 4B4WA 1IBCA 2AN9A 3CXRA 5F7JA 4F1WA 2HMTA 1AHIA 3L8YA 2IYUA 1O0BA 4XXHA 5K0SA 1YB5A 4OB6A 3BTOA 4X6UA 3NYWA 4OHWA 3CSUA 4Q4JA 3TAXA 1M67A 2PGXA 2RHBA 1CUEA 3C3BA 3GD7A 3NORA 2V7BA 4M76B 3VKUA 1ST3A 4Q93A 4NJMB 2XNDD 2QAGB 4RIEA 1RRCA 3K94A 4ZAYA 4KXMA 5SYNA 1KAMA 5BOSA 1VIAA 1VSBA 5TV2A 4ND7A 2XYQA 4ITRC 1TJPB 1CUFA 3DSRA 3OPYB 1QK5A 4R8LA 1NBHA 1X42A 2CNDA 4WE3A 4X64B 5GOZA 3G6KA 4HYEA 1J0BA 3WSWA 5CLJA 5KVCA 1I4EB 1QHFA 1OJLA 5FQOA 2BFFB 2WM2A 2Q4EA 2J07A 2WHPA 1T4DA 3P32A 4QWMA 6CHYA 4NXNB 1WSAA 5JBIA 4Y6RA 5CA0B 2F17A 3PC2A 5FPTA 2FN9A 1FNSA 5JSZB 4IOKA 4AP5A 1ABBA 2JD2A 4F9EA 3PXBA 1QIJA 1L1EA 4FKZA 3B51X 2FLKA 2GAIA 1IQ0A 2Q5CA 1U9IC 2BL4A 4FYIA 4JOCA 4N49A 3CRZA 2GDZA 2F48A 3NT2A 3R4VA 2E55A 5COBA 3ZHBA 4FW9A 1I9GA 1GVNB 1MV8A 2DECA 3OHMA 5H80A 3VZCA 1FFDA 4TT8A 1MN6A 1AMOA 4FFVA 3JZAA 1MJ5A 5H0IA 4EPYA 3KAJA 4LZLA 2UUCB 1PJ3A 2GILA 3EJWA 3EN0A 4WESA 3TG8A 2ODPA 1YACA 2D2VA 3BMCA 1GUDA 1EUYA 3IAFA 5FI3A 2JLQA 1CRWG 4UFPA 4ATNA 1Y6GA 3DOHA 4K28A 4MVJE 1Z6ZA 2OXFA 4P86A 3KDPA 1XVTA 2H1CA 3MRTA 3H6GA 3MM4A 4MR7A 4Q00A 3LS2A 3MA0A 4J9UE 4QUHA 5CNJA 5C32A 1KR2A 4XASA 2J3JA 4M1OA 1CEYA 4AJ1A 3I5MA 2B4KA 4C0QC 1P8JA 3NC4A 2G67A 4A8JC 3ACCA 1J8FA 1JLLB 4OQ4A 5A0FA 3GOQA 2ZB4A 5HJ2A 3U4HA 3SQWA 4N76A 2PZMA 4JC0A 3DTVB 4CG2A 2GFQA 1CQZA 2QN1A 5HDBB 3ZHRA 3U7EB 3L8CA 5IUJC 2PJDA 3AI7A 1NF8A 2FPSA 1BWRA 4RD3A 4JI3B 2W8BB 1JKJA 1S89A 3PKJA 4HP8A 5YASA 5IJ9B 2XXAB 3BRWA 1U0RA 2JVKA 3KZ1E 1UXIA 2RHGB 3PYLA 2HKIA 3ORFA 5I48A 1FC0A 3F5QA 2ZJZA 4I4TF 4Q4JB 4RV9A 3C7AA 5E1MA 1GM5A 1JQ5A 1EWRA 2W6PA 3KOYA 2C3PA 2GDJA 1JFVA 3V7YA 1VLHA 1DI0A 2AF3C 3DMTC 4LBVA 2BOVA 2HA2A 4PAQA 4QZVA 1YRAA 1VKHA 2HU5A 2XR1A 2BGTA 3NV7A 3TSYA 4A92A 4OLBA 3R7AA 5JI3E 3FE2A 4P4NA 2VTKA 2RGYA 2Y2VA 4J1NA 1AQJA 2Q2VA 1HY3A 3OZRA 1C81A 1FSSA 1DEXA 1UKBA 2GJAA 3L4EA 4FX5A 4I5FA 4J0CA 4MV6A 1N1MA 4R8KA 4WCFB 3A2KA 5K8UA 4DQKA 4D5GA 5FUMA 5AKXA 3H2HA 1X94A 4OIMA 1X0XA 3RBZA 1NRJB 4RFSA 3SSMA 2GN1A 3VKGA 4W5QA 1E6CA 3LUFA 3SJZA 4B48A 1JHMA 1CETA 4OUDA 1M5RA 3ASVA 7REQB 3ELDA 1I3CA 1UKAA 2PD4A 3RT7A 3MS7A 5ERXA 1VCMA 1GNTA 2JCBA 2PMWB 4KR7A 1QB7A 5AW7A 4HCJA 3UMFA 3E7WA 1TL7C 5F1YA 4OF4A 5DX8A 2Q50A 4BV8A 1WZ2A 1M6VB 5BV0A 3M4YA 4Z6KA 2I8CA 3BULA 3OI7A 5KX5B 3T5MA 3QVKA 1U94A 5LDGA 2R6R1 3ME5A 4R9UC 3UJAA 4AN4A 1P2DA 3T1HB 3EPHA 1FMFA 3A28A 2QZZA 1J33A 1ZK2A 1E3WB 5EZ6B 3MMNA 3NTUA 1WL8A 2PUHA 1T25A 5EP3A 4P7FA 4ZJPA 3EVBA 4B3MB 3OFKA 4K5QA 2UU9B 3PCXA 4ZJYA 3SF0A 1M2HA 3C7KA 4AKEA 2VDMB 1RLMA 4JBLA 3A3OA 2EQAA 1I2DA 2VTBA 5CT5A 1SXQA 4LAFA 1VYVA 1T0UA 1Y33E 1U5CA 3C3JA 4Z86A 3P9RA 3WHLA 4R6XA 4QDZA 2A9KA 1QFSA 3I28A 1DXOA 4TWRA 4XR9A 2ZZKA 4HXGA 5G3YA 1GGHA 3RRMA 4DLVA 4ND6A 3WYAA 4DC9A 1Z2CA 1C7JA 1O77A 3PC3A 1W4RA 4NE9A 3IBGA 4MUHA 1XFAA 4RHXA 2WY2D 4WN3A 3F7TA 3T12A 5THXA 1A9SA 3GRVA 3D31A 5MHTA 1IQRA 2QI9C 3DCJA 1T5OA 5EJ8A 2EG9A 1U0FA 4FFRA 4WX2B 1T5BA 2EFEB 2EGUA 2FZVA 4A82A 4CG0A 3AM1A 5J9FA 1FOEB 2I3BA 1P7VA 4CIYA 3NPMA 4PXYA 3V8RA 4PAWA 3RSFA 1EYZA 4QJIA 5SY9A 1MB0A 1A77A 1YFKA 3QFTA 3KR1A 3GNTA 3QMPA 4LHYA 4MUMA 2IIVA 4A16A 1RTKA 3N6RA 1DXYA 3BS4A 3K5HA 5F5NA 3ZNNA 3QU7A 1R16A 5DRTA 5TQ2B 3U61B 2G0TA 1ADFA 5DHPA 2Y05A 3RSLA 4HVCA 2ATCA 1SUEA 3FR7A 4FMDF 1PLKA 5KTTA 3OE7A 1ORTA 1U7HA 3CUYA 4PZAA 2VDKB 4HI0E 2FFAA 1KA9H 3OJFA 3FYDA 2GPNA 3DZBA 2WUGA 1D6NA 2FDCA 3DG9A 4PFJA 4Y1RA 4FIDA 2QL6A 1TZ2A 2ZRPA 5HG0A 1LNSA 3ADOA 1Z5OA 4BXOB 5I3CA 1G8FA 5DK6A 1T4MA 2UZ1A 2ZJ2A 5EHNA 3JQ9C 1H1LA 4ZMRA 3KUCA 1A8IA 1K4KA 4Z4GA 1P4RA 1ISRA 1TVEA 2Y0CA 2Y92A 3OQ6A 1EBBA 2Z08A 4ARZB 3RRFA 3K7EA 2FZ5A 2I7XA 2QTHA 3SGLA 3BMOB 1N0HA 2R97A 2PQMA 1R0BA 3LIPA 3N8NA 3TL2A 5I7FA 4ZIRA 4D2IA 5KYXA 3QKUA 1PTKA 4N41A 1N92A 4E2XA 2VP5A 1JECA 2ZSUA 1RHKA 1KHHA 3LM8A 1V48A 4H3KB 4LDRA 1GILA 2IUSA 3IA7A 5EIOA 5B64A 1ZOOA 3B6JA 5KYKA 2QM7A 3D6JA 4OI2A 3E0XA 4G56A 2UVQA 2JIRA 4LYDA 1KDOA 2G76A 2CLCX 4CFYA 2GXUA 5F76A 1HYQA 3SF8A 5K01A 4IMRA 2FPXA 1UF9A 5IT4A 3IHLA 1IHUA 2PUWA 2VA8A 3ZZTA 1C0IA 4CCYB 5DCUA 1TNDA 3EOAI 1WR8A 2C3OA 3JQRA 2O8FA 1NVDA 3NDJA 2IXBA 3I01A 3R7SA 4D3DA 4RPJA 4M36A 5EGSA 3L40A 1EDOA 1G8GA 4M21A 5I9SA 1U6JA 2K2QB 2PU5A 3DMYA 5KNDA 1R7RA 2FX2A 3ED1A 3IPAA 3N7AA 3NAMA 3Q4GA 4Y9DA 3S68A 4KR9A 2V54A 2FWBA 1B0PA 3CNEA 4S04A 5EJGA 4PTZA 4ETIA 3H3JA 4LX8A 4JWKA 4DA9A 4YRQA 2G5PA 4M9ZA 4KGZA 3EZGA 1XCPA 1RTTA 1Y5RA 2XIQA 3L6RA 4QOHA 3W4IA 4DCGA 4POOA 1CT9A 2Z6AA 4QO8A 5J63A 3RQSA 4MYTA 1JHAA 1LSOA 3AERB 3PXDA 3CX7A 4B34A 4OOFA 1R0YA 1ZGAA 2G25A 3EGXB 1RCFA 4YP6A 2PBZA 1XWIA 2OO7A 3LT2A 1O6FA 5IHPA 1FYVA 2Z09A 3E03A 3MWGA 4MQFA 4F9GA 4CM8A 2JBWA 1Y3DE 1A5TA 2JL1A 4BY9E 1KYVA 2DCUA 5IS2A 2GZ1A 1J00A 3RFUA 1NNI1 3GH3A 3LFUA 3S4YA 4UHBA 2ZQZA 2ZSEA 5JAUA 5JJKA 9LDBA 5EZQA 4EF5A 1T36B 3C3DA 4F8JA 4IY1A 2JZOA 2ZTUA 4I36A 1S8AA 4FSHA 3RJ9A 1ODCA 3VPHA 3NVKI 5JNTA 2JHAA 4ZVTA 3NHZA 4EGFA 1H0KA 3B6MA 3ZYZA 3MWYW 1ULTA 1GIAA 1JMVA 1UM9A 4XB6B 3TM5A 5GINE 3ZGNA 1RCUA 2ZTMA 3U3DA 1GTRA 8MHTA 3QXJA 1W4LA 1U28C 1KQOA 4TT3D 5J2UF 5BOVA 2HZBA 4FFBB 1EFLA 1PD0A 1VGVA 3OIYA 1QO7A 3TKAA 1WXEA 4OQLA 5C8XA 1S96A 1USWA 1IOVA 4G3XA 3WBJA 3NIBA 4HEA6 3G02A 2O19A 3LRXA 1U1EA 1S2DA 1T9CA 3TUJC 4OIFA 1HTTA 2ACEA 3VR2A 4FYPA 4N0DA 2CT8A 3LPDA 1AGYA 2P3SA 2WTEA 4FFDA 1L3CA 2G70A 2WPDD 4GKAA 1VSVA 4MGHA 1QFMA 5LQRA 5AXAA 3AEZA 3VSBA 4X92A 4FYWA 4CLOB 1NU6A 1TC1A 3ZWPA 1U7PA 2QN8A 3FHOA 1MAUA 3GRYA 4GPIB 3H5AA 4HQ6A 4ABYA 3FPLA 1GUAA 4DRXB 5DI9A 3WGGA 3ZXXA 4NY1A 2YHBA 4M89A 3RNLA 4ESHA 2CJYA 2Y93A 5EE3A 3WQHA 5L3SA 3FLEA 1VG8A 1R0RE 3G17A 5C7OO 2WU8A 3PC4A 4WBXC 3RS4A 3QJ5A 4KLAA 1V1RB 4JIGA 4G8JA 2FZWA 2HHCA 1B6TA 1YMUA 4G85A 1LGYA 3SFTA 3IDSA 3QMVA 2AG8A 3I6ZA 2WQZA 3UMRA 4F2HA 3GN2A 3G13A 4KEAA 1T0BA 4RPHA 1NA5A 4C04A 4J3NA 1WOYA 4BC1A 2FB9A 3BJMA 1V8PA 5B4VA 5LU9A 3CRNA 2GHQA 4JLKA 2A88A 1XG5A 2BGWA 1OXSC 3LGAA 3REQB 4N9WA 2WAMA 4IWYA 1PZEA 4Y98A 5T67A 1TTTA 2D1QA 1L8OA 1ZG3A 3JV7A 2OHGA 4G4IA 4J90A 3V6LA 1SVUA 3ZGYA 1C50A 4HDOB 1JH9A 1DKMA 3BT7A 1PVOA 1MAVA 4L02A 4L4XA 5DHUA 3ICEA 3IEPA 4HH3C 4DXDA 1P0IA 1L5OA 2D5BA 3HCBA 1C9NA 4L2IB 1A9OA 2DSTA 1LFDB 4WOCA 3RYCA 3TDNA 4B09A 3RC1A 5D6NA 3T3OA 3KYIB 3U4IA 4RVSA 2WJGA 3WAGA 1B16A 3VR6A 4JC5A 1JZTA 4LV5B 1EXMA 4EPVA 3Q8MA 3ASZA 9ABPA 1A95A 3HUUA 1SVWA 2XUIA 4DVJA 1JKMA 2D62A 4ZD6A 4CIXA 1DEHA 1IZYA 3KV3O 5J5CA 2C9YA 3D4OA 1EFPA 2D1SA 2W6OA 5BN4B 1NY5A 1RI1A 3PUXA 1N9GA 3EY4A 3KOWA 5CIWA 4MWOA 3WWPA 4EO4A 4BVHA 3TSCA 2H1OA 3G5AA 3W5IA 1L4YA 3L2OB 4Q9DA 5I7OA 4TXNA 3VR5D 2CFSA 3PPWA 5H4HA 1ZITA 1Q1AA 1YZLA 3RFXA 2GM4A 4B3SB 2R2AA 1DAGA 2XTJA 4Q4LA 3BUSA 4CM6A 1EUQA 1LTKA 1RQGA 1WXHA 4DY4A 1R0CA 2WABA 2H5IA 2HF8A 2ZXFA 5JAIA 1PX2A 2OV8A 2ZWVA 4MVJA 2HDOA 4A2WA 3M9WA 1FBNA 1NR1A 1G6KA 4FHCA 1PN3A 1C3EA 1CEQA 4R0VA 3JQ7A 4JVOA 1LLDA 4YJ3A 2FPGB 3WRVA 2XDYA 3M9LA 5JXJA 1CEEA 4HOYA 4WZBA 3MEQA 1AUXA 1WCXA 3NTQA 4GBGA 4YT8A 3ZXIA 1G60A 5LP6A 1GU7A 5JNLA 3NBZC 3ONVA 1X7YA 1QX4A 1QGAA 1NM5C 2GPSA 2F8LA 3Q3HA 4KWIA 3RVMA 4EO7A 2B82A 4UBOA 4KPUB 1DC6A 2PLAA 1F0YA 4BE4A 4FLMA 3OFSA 3WB1A 3WTCA 3WYEA 4R05A 2H9IA 3F1LA 2YHSA 1ADYA 3ZXYA 2A84A 2JRLA 3HN6A 3UT5A 4G41A 2QXTA 4CMCA 3BH7A 5FT9A 5JARA 1E1DA 4K6FA 3HGTA 4KFRA 5AVJA 4QM7A 2KHZA 3VZSA 1EH5A 2W7TA 5JI2E 3UJCA 3RHZA 3ZY6A 4KKVA 2WG2A 3H7AA 1DUIA 3M9XA 1GZSA 4YAJA 5TQ0A 4LDAA 2NXCA 1IZ7A 1T5TA 2VSYA 1SA0B 3CFYA 5BW4A 3ABRB 3GLIE 3S2YA 3V9PA 4O3MA 1AKQA 4R98A 4RXUA 3OJXA 2XMGA 4KG7A 3GMTA 4LNUA 1CDEA 1JIKA 1VLQA 2B2CA 1KRWA 4RS4A 1E3QA 4MAFA 1TXGA 3PD7A 3R3VA 1FDSA 4TL8A 1GSOA 4HX2A 3LY5A 1NQAO 3BD9A 1V35A 3B6KA 1UPFA 3IP1A 4OM7A 1YK0A 1R2QA 4OD0A 3ORRA 5T4BA 3WGLA 5A5FA 5JH7F 3SJCA 1X1CA 5DRYA 3B1ZA 3FTEA 4JJEA 2HXSA 4DQUA 2X58A 3AF3A 3DL4A 1F5NA 1G38A 4IIYA 2G5GX 2Y1EA 2E5WA 3LQ1A 3SWWA 2V3VA 3D1VA 1N3BA 3JASB 1QTIA 1LJ8A 1SQ5A 1UBGA 3MPOA 2F55A 3VHRA 1LUAA 3I72A 1SUDA 3DO8A 1HA3A 3ETCA 2ORWA 1X19A 5G41A 5JCZA 1Y9JA 5KNBD 3QELA 2AMYA 4Q48A 4GGMX 2VAPA 3TIIA 4AMGA 1YDMA 2G88A 2I29A 3GVHA 3PVSA 4OAQA 3B8HA 4IV8A 3EQ8A 3CZ4A 4PLPA 4X71A 3ZI4A 2HJGA 1T2NA 3U26A 1X1EA 2IUTA 4ZO7A 4CHGA 4WOPA 4KTVE 2WJPA 3NKFA 5E3IA 4IR7A 2A5FA 3BFKA 1E7YA 1ZINA 4A6PA 1SEPA 1P1IA 3BMXA 1YQTA 1QO0A 4MR7B 4LYEA 4MWZA 4WHMA 4LVUA 3U37A 3VYVA 4A8PA 4I5DA 3K2EA 2OMKA 4KQ2A 1EEHA 1DFHA 1JEEA 1UOOA 1Z4NA 1ZMTA 1WOMA 2W48A 1F1BA 1Z7YA 2Y99A 3ODGA 4QJBA 1D1SA 3X1DA 2R86A 5KREA 2AKEA 1OI4A 2MSWA 3EQZA 1ID1A 4FE3A 2R6JA 2ZW9A 4KZKA 5JSZA 1GXSA 3OLYA 5EMHA 3R7DA 4AY4A 3LGXA 2CUZA 3LXMA 3DNFA 2HV8A 1NJSA 2NO7A 4UHKA 3USES 1QDEA 4ARIA 5CT6A 3M82A 3SC2B 4KIJA 4BP8A 2Z2ZA 1P44A 1TX4B 5F64A 3ID6C 4TTSA 5AOVA 2XXBA 5IHXA 2VYVA 3AOGA 3TRFA 1AC5A 1IZ0A 1E92A 4OYHA 2B2NA 3WHKA 1KMCA 1ZJWA 2C1XA 2WWWA 3OLZA 4G9EA 4ZCMA 3HGMA 2R8XA 4XD7A 5KYTA 1JNXX 1N8TA 2CHFA 1K92A 1EUZA 5JJCA 4ZTUB 5K6AA 1MMFB 2WD8A 1FNBA 2X5NA 4LC9A 3GRCA 3O4JA 3UMSA 3GIDA 3RPEA 2BM8A 4BQOA 5EKDA 3ITKA 5CD9A 1JLLA 2JJMA 3BB4A 3AR6A 3GFOA 4PO1A 1F3OA 1Z7BA 4PTLA 2C20A 1AUOA 2BH9A 2NADA 3U3JA 2B3TA 1VRCA 3AWDA 3G1TA 1YRHA 2AK2A 5H70A 5CA0F 1N0UA 1GNPA 3VKHA 3LK6A 2IZOA 1MO3A 4BPBA 2RHHA 2A0KA 1MGOA 3CISA 4R2LA 1DAIA 1MKYA 2J9ZB 2C83A 4QQNA 5BNFA 1S4MA 2WILA 1L8XA 4PPGA 4P4SA 3K0KA 4DLUA 2IH4A 2CGEA 1KU6A 3IVRA 4HZIA 4C7KA 4OGGA 1Y7HA 1WB4A 5I7UA 2F9MA 4L22A 1H0RA 2IZ1A 4HGQA 4I9GA 4RGYA 5CLLA 3CLUD 3FR8A 8LDHA 3BQMB 4N18A 2AI2A 1YZUA 2WDPA 1U0SY 1GU0A 4HATA 1BHQ1 4K3VA 4B8YA 4E51A 4CEIA 2F4NA 1MO2A 1SK9A 3VPFA 3VR4A 1Y3CE 1LRJA 1KF0A 2TMDA 3D4IA 5HCNA 3MJTA 2WLSA 1OC4A 1Z73A 2PQ6A 1GAEO 2B92A 3NKLA 3U9SA 2JCXA 4WACA 3U3OA 1YI0A 1B43A 3EXFB 2IHJA 4BO2A 1EWKA 1G5IA 1T6XA 2GBLC 1N2XA 2PGLA 3DV9A 1M2NA 3DDCA 4GX0A 3H2SA 3HRKA 4WLNA 3UV3A 4A8TA 1N4DA 3GDFA 1JWBB 3FOEC 5H8WA 1YUMA 1Z17A 2WG0A 3KC2A 5BYBA 1XP5A 1B74A 2H1HA 3DJYA 3U7IA 4JUBA 2H7VA 3O8DA 5BSFA 3H83A 2RSLA 4MWBA 1ODIA 1R4AA 3AI3A 2Y0BA 4GHWA 4I4LA 3ZKAA 3HO1A 3FOBA 1ZVQA 2QX4A 1RE1A 1TMYA 2XOKD 1YA8A 1XIVA 2I6XA 3WRXA 5IDQA 4A73A 4AG5A 3KD3A 3CUTA 1J7JA 1TADA 2HH9A 3RUAA 2F3SA 3BCSA 4RJIA 2FLVA 2OG1A 3RWOA 4N54A 3U4QB 4Z7JA 1CNMA 4KFUA 4FBLA 2O1EA 2V0CA 2ZYDA 1W0KD 5LZ4A 4UC0A 1QLJA 2RK6A 3EF1A 4DR5B 2PFKA 5CVVA 4BX3A 1U7ZA 4NOKA 1NI3A 3UJ9A 1H05A 1I1OA 1Z4MA 2E4UA 4GMXA 1F6BA 1JLHA 1SUPA 1TB4A 4OGFA 3FNBA 3SS9X 2CLEB 3FVTA 4HWGA 3WKAA 4CTNA 5AI4A 5JPDA 2G09A 3RFTA 1ZJ6A 3NEJA 2C9MA 4UBJA 4BJ1A 2J0UB 3NHKA 4R2XA 3BFXA 2VJLA 3WGKA 5C4IA 1R12A 3PXUA 2VS1A 2P1DA 4BLRA 4OQQA 5J2TA 2FH5B 1ULUA 2JKVA 3KQPA 4N7RA 2NMVA 1EMDA 4KOAA 4BNKA 3A32A 1RWXA 2JGNA 2CVFA 3VH1A 4HRYA 4L9SA 2FF7A 1VCHA 2PQ0A 2WPNA 3MNFA 3MJFA 4ZEWA 1OBFO 5B2FA 2GASA 1PJQA 3A37A 3GJ3A 2FOLA 1ZK0A 5FI5A 1JDPA 1TTPB 3A0RB 2JRCA 4ADSG 2EGHA 5DNDA 1ZUWA 1X14A 1XAIA 3QE4A 1GGFA 5KHOC 4LN1A 3FYTA 1ZM3A 4P7KA 4EELA 1A8HA 4F2PA 1VP3A 3HA3A 3IUSA 2GGSA 5F4ZA 1QORA 4ER3A 1I01A 2QD3A 4Z0NA 3F46A 2QD4A 4FKMA 3GQVA 4FYMA 5DGTA 3DV2A 5KC8A 1G59A 4HDSA 1U8YA 1PR2A 2QP3A 3N6VA 2VHJA 2X8WA 4L51A 2F1RA 4KRGA 2I66A 4HDCA 4I1SA 3Q3CA 3RSCA 4O1MA 1P5JA 4XDYA 5FPQA 4BLQA 2XMZA 3ZNOA 1J25A 3T0IA 2G6BA 2DBRA 3EDRA 4M6WA 1RKVA 4UVIA 1C8VB 1OBCA 3C6QA 2JGIA 1MQ8B 5D84A 3LQ2A 5B58T 3KPVA 3IKTA 1WMEA 1E9DA 2SECE 2V7UA 2CZQA 3ETJA 3ETLA 3GGSA 1UINA 3HN7A 3HXLA 3MBOA 3VPBA 3DQZA 4AZWA 4H0FA 5C37A 1N7JA 1W0KA 2I1LA 1SCAA 2OPHA 2HSGA 1OJ7A 4R1SA 4RK6A 2M6KA 4O4LF 2J32A 2PVCA 2R7MA 3GU3A 4KJZA 4XE5A 2HA7A 1SB9A 2X7JA 1VBKA 3A7EA 3N2KA 3PE3A 4C6RA 4OYRA 1UAGA 1QM5A 2GNAA 1ORIA 3CLTC 4S24A 2BMWA 4YCSA 5EWLB 1TJNA 3E5MA 2LDBA 4AUEA 3HU5A 2C5AA 3WVNA 3OPMA 3PWZA 3PA8A 5DX0A 1PNOA 3T3GA 1LDMA 3FWNA 4Y6LA 1GNLA 2GN8A 3BGOS 1Y5NA 1QFYA 3EFHA 1QYVA 5LSAA 4EGQA 2XUZA 4HZUB 3M83A 3P9QA 4LJ4A 1U1GA 4JQYA 1T6BY 1SXPA 4UTNA 4CGZA 1M75A 4W5HA 2CMHA 3EEQA 3R6TA 3WP0A 1W9MA 3EODA 4BMYA 1J2YA 1PBNA 2EFDB 3KFVA 4CKEA 3F97A 5INTA 2YS6A 1NJ5A 1CDOA 2IBTA 4CLRA 5GJBA 3WNQA 2OGTA 4YWHA 5FHQA 2L17A 4U0JA 4KPEC 4DR2B 1I32A 1CHDA 3ZPXA 1QG6A 2GMWA 4GNKA 3F9IA 1NBEA 3A9CA 3TLAA 1U99A 2VLIA 5GVRA 4DNPA 1NU8A 2FOXA 4H31A 1H2HA 2WVGA 3FDFA 4TV8A 4REMA 4BMOB 4L3VA 1VDZA 4NPCA 5AYVA 4AF7A 1ZKMA 4ZYZA 1U8FO 1EUCA 1S01A 4JJIA 4S35A 4L57A 1VHJA 3D1JA 3ANYB 1TO1E 3PGXA 1L7EA 5H1YA 4IDBA 3GWZA 4XZ3A 1K7SN 4MQFB 1X8XA 4MB0A 3L1UA 4ZTBA 1R5OA 3KUKA 1CUJA 2PGIA 4DWOA 4GYKA 1SVMA 4TKMA 3CPHA 1IUKA 4PPYA 4OQDA 6ADHA 3OZDA 3ON5A 4BO0A 3E5RA 3S1AB 4U7HA 5KNBA 1W4CA 1ND5A 1K3FA 2J9RA 4GPTA 3TB6A 4ZEXA 4AXBA 3I2KA 4FPXA 4H77A 4RESA 3AEKB 3LUGA 1KAOA 2XUFA 3L82B 2B21A 2PLNA 2VBFA 4R16A 4TL7A 4YJFB 2VRBA 3I58A 2GXAA 4GOXA 3G6WA 2NZ8A 3HBFA 3BB3A 1EJ6A 3LWBA 4WKOA 4X1KB 3NH6A 2IH2A 4B44A 2ZYUX 5TQVA 4C3ZA 2YHIB 3NOQA 4DCOA 1XDZA 2EIHA 2ZI9A 4NVRA 1J39A 1Q92A 1RRKA 2ZJ3A 5B37A 5A7GA 2QTZA 4WD3A 1PYGA 4GOND 1UJ5A 3LBNA 3DO6A 4J7UA 1OIVA 3WA6A 1U5BB 3K0FB 1XVUA 2AT1A 3QQPA 4H7FA 4EI9A 5PGMA 4A15A 4WBNF 1RLJA 1IQUA 3D4PA 1H3NA 3KEGA 2QTVB 4GQBA 4DR3B 2PGDA 2YC2C 5FBRB 4ESEA 4C01A 1AS3A 3D3QA 2CLFB 3REQA 3UAYA 3ZGVA 4DRXA 1DIGA 2OUIA 3MW8A 4E3ZA 3WGIA 1GNQA 2FJUA 3GH1A 1T4CA 3IDAA 4EVRA 4NMXB 1ZJ4A 1RXEA 4DJAA 2C94A 1GPLA 5I9LA 5I8WA 4OH1A 4YJ2B 1IG0A 1NIPA 5DNEA 3SHOA 3FAKA 3UKJA 5BRAA 5KSZA 2NP6A 5EQJB 1EA7A 3GUHA 1X7XB 3NHRA 3T0GA 4YJHB 5C8YB 3SMVA 4BQIA 4ONEA 2W6MA 1Z63A 3NGMA 1E1QD 2JGRA 2C03A 1JXQA 4XUCA 4EHKA 3FHTA 1VG0B 1Y8QA 1GLNA 2H07A 4JV5B 1UJMA 3FROA 3NEYA 4FU0A 2GFIA 2OR3A 3CLUC 1YQ9A 3Q9NA 5CT9A 3BZWA 2ISCA 1NYRA 4D4HA 1P2UA 2IYOA 2N1MA 3O8BA 4TN1A 3M2PA 1JQKA 2B0CA 1OYOA 4DYHA 1R9GA 1XF1A 1FZTA 1D2GA 1DG1G 2DMRA 1C8BA 3OOHA 3TOSA 1NUSA 1GCAA 2ZIUB 1U7TA 2LW7A 3IV6A 4FONA 5H83A 2PAFA 1KJJA 3RIHA 5AD1A 2KMLA 4O0LA 3U7HB 3G5MA 1GL3A 1DDOA 1EVEA 1ZN8A 3I1YA 3KEOA 5EIFA 3FOCA 1MG0A 4Z0PA 2H2FA 4ZEVA 1B0ZA 1VJ5A 2EQ5A 3LI2A 3T41A 1X8JA 1SIBE 4KYVA 3VC1A 3Q6MA 3ZJUA 4H1HA 3LXXA 8AT1A 2L19A 2ZETA 1PWHA 1Z5PA 1AGPA 3IUQA 1P4AA 3VO1A 4IIJF 1OGYA 1UP4A 1EP9A 3SZ3A 3AR8A 1OD6A 1ZIXA 2BTOA 4UM9D 5D7BA 1QIFA 4KHPB 2DFTA 4NXMB 3KQMA 2VP3A 3I8XA 1JJBA 1YDGA 5F33A 2HX1A 5M7EA 1EP3B 4M0EA 1QIKA 4MV9A 3IAEA 4EUFA 2R8BA 2VXBA 4ZCPA 3SHWA 4TQUS 4K9PA 5L3RA 3PX2A 2JFHA 4BAUA