2FPGB

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
molecule tags Ligase
source organism Sus scrofa
total genus 123
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fpgB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fpgB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgB03
5BPHA 3E5NA 4Y8VB 2YWVA 4EG0A 2DLNA 4O81A 4YBZA 2FP4B 1JKJB 2DWCA 1KJIA 3R5XA 4XYMB 3GLKA 5FNVF 2CQYA 1EUCB 1GGOA 1EHIA 4ME6A 1IOVA 3HO8A 3OUZA 4FFOA 1Z2PX 2PN1A 1CE8A 5I47A 5D8DA 4NYEA 5KKNB 4O7LA 2I80A 3VPCA 5BPFA 4O7ZA 5LP6F 2YZNA 1VBHA 2R86A 1EZ1A 2YL2A 3BG5A 2W70A 4YJ2F 1PX2A 2IP4A 2PVPA 3MJFA 4MV6A 4IWYA 4EGJA 2NU9A 1BXRA 3G8DA 2W6MA 3HB9A 4ZHQF 4HNUA 4O7TA 1KEEA 2V58A 3U55A 3NUAA 4FGRA 2NU7B 1I7NA 1KC7A 1IOWA 3N6RA 5JVLA 3R5FA 4YAJB 2ZDQA 3KALA 3V4ZA 3TIGA 4FFNA 4FU0A 4Y8VA 4MA5A 3R23A 3MWDA 2R6FA 4IWXA 3JRXA 4MV7A 2QF7A 4XYMA 2NU9B 5LYJF 1EUCA 2FPGA 2R84A 1SCUA 4C5BA 5EZYF 4YB8A 1M0TA 1CQJA 1E4EB 3DF7A 4IIJF 2W6ZA 2W71A 3JRWA 4FFRA 2YZGA 2YS7A 2Z02A 4MV4A 2CNQA 2PBZA 3KAKA 4YJ3F 3MWDB 1JDEA 4FFMA 1KJJA 2XD4A 2GLTA 2YW2A 5JVDF 4YAKA 2YS6A 3V4SA 5C1PA 2VR1A 2FPGB 4TUYF 4O4LF 5BMVF 1B6RA 3Q1KA 4XYLB 1SCUB 3WO1A 3VMMA 2W6OA 4YB8B 1KJ9A 2NU8A 4O84A 1Z2OX 1AUXA 1CQJB 4ZI7F 2HGSA 5HV6A 1CQIA 3R9RA 2YYAA 2NU7A 1UC8A 2XCLA 2R85A 4IZOA 1KUTA 3VPDA 4YAJA 3R5HA 5JH7F 4C5CA 1DV2A 1A9XA 4C5AA 4O7SA 4I50F 4YAKB 2FPPA 5DMXA 3Q2OA 2GQSA 4ZQIA 2WYOA 4HQ6A 4MAMA 2VPQA 4QSHA 3KAJA 4M9UA 1C30A 2NU8B 5C8YF 3TINA 2V59A 3ETJA 4XZ3A 3RUPA 2CNUA 4HNVA 2GPWA 1CQIB 1OBDA 4HNTA 2NU6A 4O7YA 1EYZA 5HBRB 1E4EA 4FFPA 5LOVF 2ZDGA 2R7KA 1M6VA 4O82A 1EUDA 2FPIA 3WNZA 4O86A 4ZOLF 1KBLA 1Z2NX 4L1KA 2FPPB 3JZIA 2VQDA 2OLSA 4MV1A 1W93A 2W6NA 2CNVA 3U9TA 5C1OA 1M0WA 3RFCA 5KX5F 4XYLA 1OI7A 4I55F 2W6QA 4XZ3B 2R7NA 3LWBA 2V5AA 2NU6B 1AUVA 5J2TF 4WD3A 5K2MA 2I87A 5IYZF 1JDBB 1EUDB 3RV3A 2YV1A 1VKZA 2FPIB 3UFXB 3ORRA 1KJ8A 3JZFA 2FB9A 1GSAA 2R82A 5JQWA 2QK4A 5JQGF 4FFLA 4MA0A 4O4IF 2YZMA 3N8DA 3AW8A 2SCUA 2W6PA 4MV9A 1WR2A 4O7NA 4O7WA 4MV8A 3GIDA 4RZQA 4DLKA 1GSOA 2NUAA 1BNCA 1JLLB 3WO0A 4TV9F 5HBRA 2HJWA 4O7RA 2Z04A 3U54A 3MWEA 3AX6A 3TW6A 3LP8A 1GSHA 2P0AA 3ORQA 2YV2A 1A48A 2SCUB 4I4TF 3RV4A 2YZLA 2R87A 4YBZB 3VA7A 2CSUA 2R7LA 2NUAB 1I7LA 2DZDA 2J9GA 1CS0A 2R7MA 4E4TA 5GONF 3U9SA 3K5HA 4XX0A 2YRXA 3MWEB 5H80A 5CA0F 3K5IA 3UFXA 4TV8F 3K3PA 5CAEA 3HBLA 5LXTF 5J2UF 3OUUA 1T36A 3ETHA 1PK8A 2GQRA 3I12A 3TIIA 3SE7A 1DV1A 2X0SA 4EGQA 1OBGA 2GPSA 4HR7A 1B6SA 1ULZA 1UC9A 5LA6F 2YRWA 1JKJA 2FP4A 2C00A 3DMYA 4IHJF 3TQTA 4MV3A 4O4JF 1JLLA 3QFFA 4XX0B 1GLVA 4O4HF 5CB4F 4O83A 3G8CA 4FE2A 1W96A 2DIKA 4O2AF 2I8CA 5CAEB 3VOTA 3VPBA 3PFFA 2ZDHA 4O7VA 2CZGA 1VBGA 5CA1F 4WBNF 4O2BF 1C3OA 1KJQA 4DIMA 3KREA 1DIKA
chains in the Genus database with same CATH superfamily
4EOGA 3AWIA 3T1YH 2WIFA 3R5TA 5HUQA 4Q4DA 3AFIA 2CYAA 5BWWA 5IMSA 3LGXA 1RWPA 3QFCA 4ECEA 2AK2A 1NVEA 4YRFA 4G0ZA 3IT3A 4RL6A 2HCRA 3HWX1 2AUMA 1FUKA 5ALRA 1Z62A 2GBLC 3TNFA 2XCUA 1DJOA 2CXHA 4G3IA 1UKBA 1NJGA 5LKAA 2X15A 3QX8A 4B84A 2MSDB 3SZMA 1OC2A 2B5WA 3LBAA 1RQGA 4BFZA 4IMJB 1ILEA 3TM5A 2BFEA 5HJEA 5CH8A 3KR2A 3O2JA 3K9LA 2QVZX 4PLYA 2P1DA 2PEYA 1PJQA 4K6HA 5CX1B 3WWDA 1T8RA 2J5BA 1I7NA 2WSIA 1QM5A 4TSKA 4TV9A 3EXFB 2ZDQA 3IRUA 4GQBA 4WPGA 3INRA 4C2MA 1JYFA 3QV1A 3DLHA 4KFTA 3G0OA 3OP4A 4XYEA 2GEFA 1V6CA 3MTGA 1JAIA 1W19A 4XYMA 1D7AA 4Q9DA 3DMRA 5B1DA 2YOFA 1JEYA 4M0CA 1OI4A 1RRFA 1NVBA 3COYA 1GAXA 2D7DA 4ND3A 3QEKA 2AG8A 3BH7A 1U5BB 4G41A 1OCEA 1N5KA 4EAAA 3EXIA 1L6RA 3GNLA 5FBLB 2OFWA 1QCDA 1E4FT 4EBEA 3HYTA 3V8RA 1QGOA 3ZHTA 4C08A 2IYLD 1NQVA 1FU4A 2PY6A 2VQ3A 2X5RA 4FDAA 4F12A 4RQAA 3VSAA 2AQ8A 5BWVA 1EFAA 1VLJA 4X1KB 3GQCA 2QHXA 5I4KA 5FUXA 4WV3A 4RD2A 4P5PA 3I0ZA 1EUZA 1YJQA 2JGNA 2DERA 3AI2A 4JKOA 3L0SA 1SCDA 4MWSA 2OEPA 1GKLA 4IEIA 3GFVA 3Q6MA 4RF3A 1U3TA 1VHJA 2NVOA 4EY8A 3OM8A 3WAKA 1U4NA 3D31A 3LLCA 4R3UC 5AR1A 3Q3CA 2AKYA 4WBNB 1U2SA 5AIAA 3GRRA 5DN9A 4AX4A 1ECLA 2DFPA 4DIBA 1C7IA 3AU8A 4G1FA 1VI2A 1ZYUA 1LWOA 1IUPA 1R7RA 2VSYA 4PG6A 1TFRA 5AKEA 5BN3B 3JR3A 3ORRA 4DV4B 1TJPB 1TIKA 3FDXA 4BVGA 2JD0A 2UUCB 1BWPA 3RT1A 3GL9A 1XCOA 2O8VA 4OU4A 2X3UA 1CB0A 4FLFA 4TV9F 5EIOA 2CD9A 2MSEB 5I9LA 1G2IA 3T06B 2OORA 4OMFG 5KYWB 1G3QA 4LMYA 4CIAA 2V54A 1J25A 1PE0A 1GZ7A 4J0FA 4NPHA 2P67A 2NO9A 3LAWA 4FW9A 4AJNA 1TCVA 2NZ2A 2QZ9A 4YRJA 3U6BA 2PSHA 3V1YA 4J2TA 1H2EA 1JBQA 2DCMA 2QN3A 4BNHA 1FQKA 1IOZA 3GA0A 5I7UA 4G26A 3D7NA 4H18A 1WZEA 4G01B 1G21E 3CZCA 1Z6PA 4P9NA 1NQXA 2GASA 3QFFA 3BB3A 3I2FA 1DHRA 4G9EA 3P32A 1VZ3A 2EJBA 4PLHA 3BIJA 2ZRHA 4JUDX 5ITZB 4FE2A 2H2AA 2GN2A 4F7DA 3BK1A 2ZDHA 4FYPA 5JSQA 2ES4A 1KFCB 5LOVA 4N5MA 2YIDA 3ZUPA 3IG0A 3IDOA 1EQ2A 1XZKA 2P2NA 2XZLA 2GJ4A 5ALOA 1W75A 4RPJA 4JUZA 2X3FA 2EKBA 4A3KG 3R5XA 3ELUA 2HQOA 3B1XA 2R1VB 1TDJA 2HLPA 4IGIA 1BDHA 5EKUA 4JIMA 3NNNA 1TCBA 1E32A 1J23A 1KDOA 3RF6A 5DM4A 1OAKA 2GEVA 3AR7A 5AHWA 4Z49A 2WKRA 1KRXA 4JYAH 1K7CA 3KVNA 3BTOA 2AJTA 5FCDA 2VHCA 1JR2A 1MDBA 4GP7A 5EWMB 3MGKA 1T10A 4YQFA 4FQ5A 4EX7A 1N92A 5T6MA 4DYVA 1C9KA 4ZTBA 4GWLA 5BNFA 4XIGS 5FL7A 3LDGA 5GJBA 4PZ6A 4YRBA 3UENA 5KREA 1O96B 2XUKA 4HRXA 3RGGA 1F2TA 2R8OA 4FZVA 1TK2A 4B33A 3ZJTA 1WX1A 4DM4A 3NT4A 4AF8A 2EZ8A 1WZUA 1T0PA 3P4UA 1DQRA 1JAZA 4YO8A 3SJZA 1HXHA 3FCAA 4LHXA 3CLTC 4Q9IA 3C3BA 3LLVA 1U90A 1JEEA 1E69A 3CZ9A 3RVMA 2WR8A 3DZFA 4BNGA 1DTWB 4RDIA 2YS7A 3O8CA 4DLSA 1G17A 2C0QA 2BT4A 2C42A 1M8PA 1SVKA 1DC5A 2WT4A 2RDIA 1JP7A 5E4YA 4TMFA 1ZWLA 2NVBA 3VOSA 2VPYA 2JGJA 4G3XA 4QRIA 4WCFC 4J9VA 4LBYA 3U3KA 1W36D 1LFAA 3QJ5A 2EARA 4HLUA 4UCQA 5H9WA 1Y3DE 3DL7A 5HIAA 1KOLA 2F3PA 1NOJA 2C4MA 3ZN2A 1MHPA 4F96A 3ZYZA 4CEJA 5KFVA 4PLFA 4ZQIA 4MYRA 4BS9A 1FDOA 4EG3A 4LHVA 4PNPA 2I71A 2NU8B 3JQ9C 2IPLA 3M6IA 5BWMA 3IT0A 1BMDA 4GSKA 3HUDA 1NWHA 3ZZTA 5LOVF 3UK1A 3Q3GE 1GEEA 2H2WA 2PS1A 2IEYA 1XX6A 4KQFA 4HH3C 7ADHA 4HYTA 4ZAZA 2IHNA 1XA0A 4IPTA 2PV0A 5CPFA 4DR6H 1T2NA 1U2QA 8MHTA 4NBUA 4MH0R 3OF3A 1ACLA 3KQHA 2ZS8A 3EIOA 1J2RA 1KETA 4EMTA 2ZXUA 3RB8A 3EIXA 4AF6A 1NM5C 4WZZA 3OMLA 4WJZA 3IDFA 5HTKA 4AG6A 1GZUA 5DTEA 4BXXG 4ZO6A 1YRWA 2J6TA 1R0BA 1JWAB 2Y67A 1S68A 1YTUA 5E2BA 4KBGA 2YMLA 5ITVA 1EWKA 5SY6A 4EWLA 3RRJA 3ZQ4A 1UEXC 1NLFA 4GPAA 4BVHA 4Z4EA 1J33A 4FKMA 2FF5A 2L18A 4C0XA 1AKRA 1SQFA 1WXQA 3ZD9A 3WG9A 5AW7A 1C9YA 1TMYA 1GPYA 2BZ0A 1KDTA 1PNVA 1TMOA 5AHOA 1SXJD 8AT1A 1B4DA 4O2BA 3KL2A 3S8EA 5AJXA 1Q19A 4ZOLB 2G3YA 1N9KA 3GRVA 3SQLA 1P2TA 4HZUB 1PGPA 2ZBVA 4DCCA 3SXUB 5LYJB 2QRHA 1IBMB 1UDBA 2Z2YA 3DJFA 1L5NA 5CLGA 5AJWA 1CB7A 3RUAA 3SF8A 3QVOA 5HCIA 1GFWA 1P9OA 3KYBA 1BVHA 2DP4E 3IA7A 3GCXA 1N2CA 4XB6B 2Q50A 2GAOA 4OHUA 2FQXA 4PX5A 3TCNA 4HR7A 4FNAA 4P4TA 1WKBA 1Z0UA 1XC7A 3HXTA 1YT5A 1MF7A 1WKCA 1YJ8A 2XT9A 2GNAA 5ECWA 1RBMA 3AIOA 2IHTA 4NP6A 2AU0A 4NJMB 2W5UA 4XQ0A 4C4OA 3KJXA 1K1EA 3OFJA 3MK31 2Q0QA 3DM5A 4AYWA 1M2WA 1N8NA 4OO3A 4L6CA 4LV6A 4BMVA 1KI2A 5C4IA 1A8UA 2Y93A 5I4CA 3TFQA 4CF6A 1QHIA 3K9CA 4DUYH 3ZBPA 3TW7A 4BVBA 1T0BA 4NH0A 1SXJE 5BSFA 4OP1A 4LF6H 1J09A 2BC9A 4UHKA 4WRRA 3UXHA 5L3QB 2CHQA 2JGRA 1PU2A 2PZFA 4CLRB 1UPXA 4NC9A 2DECA 4C1BA 5KFDA 2K7FA 3HJGA 3V2HA 1AQIA 1DT5A 3K4QA 3MJFA 3MFYA 4Y2GA 3M33A 5BYBA 3QXXA 3H7IA 5LR6A 2YHIA 5CCBA 1KEEA 4ZKDA 2ODTX 3LCVB 3CTPA 5IDVA 1Y9ZA 4RH3A 2E5LB 4L5YA 3KJHA 2IEBA 1PW7A 1A9OA 3SN6A 1Y6JA 2AH5A 4A15A 1TA9A 3WK8A 4BZQA 3RU7A 3H42B 5JHGB 4QXAA 3NFYA 2E5WA 1WF6A 1C7JA 1PW5A 3U6KA 2B83A 4DEVA 1C8LA 3SI7A 2Y76A 3GJ3A 3M4XA 1DDGA 4MWBA 2NSYA 4BP1A 3WZMA 3JRWA 3VR3A 1SQ0A 4DNOA 4DUGD 2O2ZA 4KXQA 2GN9A 2C82A 2HHAA 4CIDA 4GVLA 5BVGB 5K8CA 3LE8A 3F9RA 2VP2A 1ZFNA 3OZVA 4RJIA 4BKUA 3CR8A 3B2EA 1U0OC 1TRKA 1V3UA 1F0NA 2CZCA 4FGSA 2CXSA 3T3OA 4H0NA 3WR5A 5TC4A 1IC6A 1ODLA 3GEIA 3B8HA 1OPXA 2AZDA 4CCSA 4QGAA 4AY3A 1WM1A 1YK0A 1NQWA 2YFQA 3CBGA 5KQSA 3Q15C 5EXPA 4UQLA 3UMVA 1ONSA 2NT3A 2FPIA 1E2PA 1IIBA 4JSYA 4RB0A 3U26A 1YF3A 2I29A 4F92B 5B7PA 2Q3BA 1R9NA 4HUTA 4G5YA 2BTQA 3M6MD 1X38A 5TQ0B 1YR6A 3FUTA 3KJZA 4U6PA 2ONYA 721PA 5KQLA 2WHXA 2WAOA 1QCZA 2OCDA 4B32A 1AKEA 2PNJA 3ZJ5A 3NOVA 1G8SA 4MZDA 2SECE 1L5MA 1J9EA 4TS1A 3I8XA 4PS1A 3GW8A 4G09A 3FHJA 3UWDA 2FB9A 4RNOA 5KMGA 4Q6WA 5JI2E 3FSRA 2BYTA 5L1IA 1DJNA 4OUKX 4PZLA 2UYQA 5DVZA 4KBFA 4XUDA 1R88A 2OC4A 4F97A 2AG1A 2E89A 2JIZD 4EUEA 5F5NA 4ZQFA 2UAGA 5FOUA 4XD7D 3GLIB 3TCXB 3K1ZA 3H2YA 4RAZA 5EYPB 1JHOA 2WAMA 3CGWA 5DBEX 4IF4A 1KDRA 2CNWA 2FG6C 3GDWA 5HGXA 1WLYA 1Q15A 5G1NA 2AGQA 2JHAA 3TLEA 5AVJA 1V95A 4EPTA 1A1VA 1QP7A 1W30A 3M1LA 4H9GA 3ISJA 4TKUB 4X8LA 3EPIA 2GA8A 3UOGA 5D00A 1F5SA 3GP3A 1W2GA 1LNQA 3ERCA 1DHTA 3OQ6A 3P9QA 5BUZA 2YJNA 3HCNA 2DTEA 4R4JA 5IT9W 1L8AA 3X1DA 3SE7A 3TOZA 3E1SA 1LDNA 4G9GA 4NL4H 3OD1A 3NKVA 3ZU4A 2C00A 1HNZH 2NZJA 4PPYA 3ESBA 4F6RB 1WTAA 2YY7A 4AD8A 1F1JA 4Y2PA 3TW8B 2DIKA 3GVCA 4MUNA 1Q0RA 4IJQA 3IV6A 1WZNA 4NONA 5KTYA 4TZ0A 3GNSA 1GQSA 3B6ZA 3E5HA 3LUBA 2O8DB 1LBTA 3GMSA 4XI9A 4COKA 3QNMA 4Z4CA 1QF6A 2IXBA 3TEJA 1Z34A 3KETA 2RB5A 2AI3A 3CG0A 1BHQ1 4KTTE 1CUFA 2IEAA 3F90A 4M1ZA 1PDVA 2FA9A 4MR7A 4O7ZA 1SPXA 1NW5A 4DR7B 4DV7B 2D5LA 2XKAA 3BB4A 4IFTA 3H7AA 2Y1EA 1TVKB 4C29A 5ICGA 4YR7A 3FF4A 2NO1A 2BP7A 4MR8B 4DSTA 1CQZA 2VNHA 3OEWA 3X44A 3AF0A 3TQHA 2J31A 4DZRA 4YAJB 2W00A 4H4EA 3B1WA 1N2EA 4BBPA 1DG1G 2ERYA 5C18A 5HBGA 1T3SA 4N8EA 1PD1A 3FIJA 2NU9B 3HLTA 4U2EA 5JWOA 3CSWA 2HA4A 3QPBA 2R8XA 3WWCA 1FW8A 2CJYA 2UUBH 3I2YX 2FR1A 2M1XA 3DWFA 4LF7H 2GBGA 4QWEA 3EPGA 1NQAO 2O57A 2V1UA 3C0KA 2ZJBA 5DGHA 2DHQA 5KQMA 3VX3A 1LLDA 1PYOA 2F3UA 1ZK4A 3BWCA 1F6WA 2XITA 4RMJA 1S96A 1ABEA 1Z39A 2VA3A 4O84A 2VA8A 3LPDA 3RRYA 4TTRA 2X0JA 4BYGA 2BBOA 2P2LA 1X77A 3TLAA 1QGZA 3CE9A 2WPNA 3HI6A 4YFVA 4JLAA 4FYXA 4A8JB 4BAUA 3AY0A 5ALNA 4RENA 2RONA 3DE7X 3VYRB 4WN3A 1GEGA 4B79A 4MAMA 2F1KA 2YHUA 1Y4SA 3OEEA 4K03A 2ZSEA 3W1WA 5KSYA 4TZTA 4EFNA 3N87A 3UV6A 5IHXA 4CEIB 1I3NA 1Z6ZA 1C9JA 1PF7E 5IDWA 2ACKA 4QTUB 3F3SA 3GIPA 1UDXA 1Y48E 1HQKA 3JWGA 1G55A 3QWUA 3EZLA 2JEIA 1H1TA 3BXEA 5M29A 1S0MA 1YKGA 1ESZA 1T5SA 1C9DB 1C80A 2HHCA 3S5UA 3E18A 4XWOA 1QYVA 3GZNB 3C8ZA 4Z9YA 3WDLA 2VZEA 4ND8B 1P6UA 4DIKA 3PHCA 1B2LA 4RZQA 4M8SA 4HQNA 1YQ9A 3LOQA 4BTVA 3EK2A 3HKZA 3WO0A 4E07A 2BUBA 3IUMA 4JC5A 5CFMA 3JS5A 1Q17A 5LMUB 2BR3A 1JHYA 3T95A 2WQZA 3OT1B 1N2XA 4LKRA 4NECA 5U4QA 2DTDA 1GZVA 4DBLC 5HKLA 3NIWA 2OP0A 1VS0A 2EKPA 2FY8A 3AY6A 4X54A 3CH5A 4HL6A 5DWVA 1N0VC 3Q3IA 3O3MB 1DELA 3NM6B 3PXEA 2FZEA 3VC7A 5BMVA 2BFDB 1BWQA 4NEQA 3ZCXA 1V8FA 1QFJA 2C31A 1EFRD 3D6MA 1NW9B 1LCIA 3G7UA 3G0BA 3OF2A 3WP1B 4URXR 1X2EA 2O8CB 3N2YA 2ZRPA 1TZMA 2O9JA 4BO2A 2GZ1A 4P2GA 3J80A 3QEAZ 2OGUA 1BXRB 4NOMA 3IIEA 4D5EA 3W2IA 5DM2A 3ZCTA 2XCRB 1L5FA 1D6MA 4A3BG 2R25B 5FBZA 2FZKA 4TXMA 3DGFC 3K0KA 3KR0A 4DIMA 2J4FA 1N2OA 1ZPDA 4DQDA 4OHXA 4Y8VB 1O2DA 1I1QB 4B8WA 3VR5H 3H9GA 4BFTA 4B3BA 3RSQA 3ZY5A 3N2NA 5AOBA 4R1LA 1FFAA 2OXEA 4D26A 4TLEA 3EOZA 2P90A 2PZGA 4QBGB 1XEXA 3HYNA 4UTNA 1FC0A 4H6PA 5IUNC 1CZHA 4OX9Y 2WF8A 1O97C 3HJNA 4KQ1A 2IP4A 4NS4A 2CE2X 2D6FA 3M1IA 3OQJA 3HRIA 3SD7A 5IC6A 4NY1A 2FWMX 2BEUA 3FVWA 3TTUA 1ND6A 2WFLA 4E6NA 5IP5A 2H48A 1NPDA 3TRIA 1R8QA 2OVFA 1VE9A 2UXBB 5D3ZA 1B14A 1U7TA 2H4ZA 4W99A 3JVVA 2XOKA 3H11B 4MYCA 4A10A 3ZCSA 2NZYA 2HRZA 5LZ2A 3TOXA 4IR7A 3A6PC 1DGQA 1WVIA 2IYEA 1SXPA 4BTEA 2R6CA 4GP6A 2QE7D 4GEGA 4UCUA 2O2GA 2P11A 4GGMX 1U6JA 2WIJA 1P3JA 4UUQA 5JS6A 1SVSA 5JD5A 5TT1A 3IERA 4JCCA 3VZQA 4CR8A 1XTKA 4RTQA 4MQ5A 3THXA 3PFCA 3V1TC 1ADJA 5BMVF 2J33A 4DOMA 1T5BA 2YMMA 3HMKA 1MA3A 3VMMA 1KJ9A 1F2UB 1QYIA 4AJJA 4JI5H 3IP1A 1Y7PA 3K0CA 3NEAA 5GP1A 2CXTA 5J23A 4HQ0A 4DUPA 4YJGB 5LZ5A 1DQPA 4QU0A 2X0IA 4FZ5A 4W1SA 3KUXA 4K0RA 4C0LA 2P9FA 5FYDA 3CE6A 1YKSA 1VRCA 4BGVA 4C3UA 4PX2A 4OU5A 1APBA 1S4MA 2GQ0A 4ES6A 3LO5A 3QMWA 3PUJA 3GEMA 3UV3A 4MW9A 1LC0A 1MX5A 3KKEA 1PJ8A 3ED5A 2ZPUA 3N6XA 2IEIA 1U2DA 4WHXA 1J20A 1J22A 1J8DA 4NENB 2EJWA 3AR5A 4LSZA 3TRFA 3AG5A 5BSHA 1Z25A 2QJRA 3UW1A 2E2WA 1VPEA 3LQ4A 4Z3DA 2EJUA 3C3EA 1ZO8A 4YRLA 3CVJA 1RSZA 3VTKA 3Q9UA 5FOWA 2NZUG 5KFPA 4REQB 4QEZA 4WI1A 3SEFA 1ZCFA 3FMVA 3U37A 3PC2A 2YZMA 1YHYA 2IWRA 2XR1A 1OWPA 4QVIA 1XQ1A 3QBDA 4ZCPA 2RH9B 3ANNA 2F43B 3E9QA 5K6TA 2V7GA 5AWFC 5CB0A 4EBCA 4O1HA 2G7ZA 3ABOB 1ACMA 1MMFB 3A25A 3PDCA 5TMDA 1W73A 4XEHA 2B78A 3PYXA 2F00A 1X7YA 1SK8A 3H8JA 3HGMA 3VA7A 4NXMB 4AP5A 4QQRA 1CDDA 4IP0A 1HEIA 2B0CA 3VHQA 5DHQA 3UZUA 4YH1A 1KC3A 5SY9A 3DOCA 4RB3C 2CV1A 1CJUC 3I8SA 4HVAA 4P36A 2JFYA 3A9RA 3WIDA 1U9CA 2O0JA 2QLMA 1SIOA 4I5GA 5EWJA 4DMUB 3O84A 1BRMA 3AHHA 4D74A 1FFXB 4QNRA 5DE3A 1ZONA 4CKBB 2R11A 1H0RA 3CNBA 5DM0A 4MTEA 4EL0A 4A3GG 5HMLA 4CGZA 1E7QA 4GC7A 2UVRA 5H4HA 3QU5A 5FFMA 3X1ZA 3BXXA 2IYWA 1LW7A 2W6CX 1D6NA 4Y0NA 3T7RA 3AY7A 2UZ0A 4DB4A 5HWSA 2I33A 4I3HA 1RCFA 4I2VA 3TTWA 4OSOA 1ORDA 4M3NA 1XZHA 2E18A 3OBIA 2IIBA 3RNLA 4LGCA 1T2VA 5I7EA 1Y1QA 4XWYA 1E7WA 2L17A 2WJPA 4YYZA 3K0FA 4ECRA 4B7XA 4LE0A 1PUJA 5DHPA 1AUOA 3P94A 5JZ9A 2P40A 3DNMA 4AMUA 1FNCA 3ELBA 3K6RA 1DADA 3D2AA 1SUAA 2O8NA 3NEJA 4ZWNA 5L45A 2JLYA 2WDPA 4BE9A 3I4LA 4QFCA 5C46F 2VEOA 3AXSA 4AG5A 4TKVA 3UQZA 3LPCA 2IXEA 1KAMA 5BQXA 3KD3A 2Q4DA 1RZUA 1K68A 1H8ED 4LRQA 2JG3A 3DDCA 1QFYA 1DO2A 4N5IX 1JQKA 1CQJA 1GQQA 1JPVA 3KUCA 1M2OA 1HBJA 2F9FA 1UBFA 2WWXA 3N58A 5B64A 1UK7A 2B1GA 2W8BA 5CBPB 3C7AA 4PQRA 2YUIA 2RBKA 3ZG6A 4DUZH 2QMQA 1E7SA 4MXDA 2AWOA 4BB5A 4DE5A 1PK9A 5BSEA 1DBIA 5BWLA 1TA8A 4U0JA 4UNPA 3RRXA 2E4UA 3I64A 2I3AA 1IPFA 4LX8A 2HQBA 4HTFA 1ISSA 4FHCA 4TVOA 4QYIB 5MHTA 1DQZA 1L4HA 2EZTA 3QPDA 4E70A 4DV5B 4UTOA 3H84A 4DIEA 2P35A 3PTZA 2R6ZA 3AM3A 2WY2D 1PLLA 4JH0A 3ZK7A 1I6LA 4BMXA 5EKTA 2RHMA 1FMTA 2BIFA 4MUMA 1GT91 3MMPA 1Z4OA 4N03A 4J0CA 4MRSA 4LQDA 1Z17A 5EP1A 1T9ZA 1DQYA 3U4DA 1W4RA 2OWDA 3F49S 3WLAA 3FD8A 2YFHA 3B5IA 4DV1B 1L4EA 3MFQA 2PX3A 1PWZA 3ONEA 4AJHA 2MCFA 3TK1A 1W8DA 1NYQA 1S8AA 3BWDD 4JEIA 2CJFA 3DC2A 5AJUA 3JYHA 4R69A 3TDMA 1I4EB 3SY8A 1JI3A 4EJ2A 3K0SA 1PWXA 4OGKA 2BDEA 4P7BA 5TJ9A 4TS3A 2EZUA 1PR6A 4IBOA 2BR0A 3OP1A 4UXIA 2RGVA 2XBUA 1JPNA 4OQLA 2CLDX 3BGIA 4NMWA 5TF4A 4YJ2B 1MX9A 5CT5A 3WADA 5I5YA 2C7VA 1PFGA 4HWOA 4UU8A 5A1TA 3GJ6A 2HMTA 4LDJA 1PR9A 4LMAA 4ZCMA 1OXTA 1L7OA 1RJWA 5DTQA 1R8XA 5K3EA 1JUDA 1PQPA 1FDSA 4P4SB 4CE6A 1H5NA 3AR9A 2RIPA 2V6JA 3I9V1 5LNK6 3WWYA 3TQOA 2ZYDA 3EXHC 7YASA 3ZZ0A 2O03A 4MS4A 3OZEA 5BSWA 1U8FO 5J3JA 4PLWA 2NW6A 3Q6IA 4RTOA 4JSTA 1JB1A 3B85A 3DWGA 1TAEA 3BGSA 2VYNA 1PS9A 4FT2A 1CLEA 3R09A 2A0YA 3DFUA 3ETNA 3CX6A 1I4TD 2C9DA 2QDKA 2EKQA 4ZI7B 2DPJA 5EIFA 3WHKA 1QU2A 5JMPA 4KMMA 2YYZA 3VYWA 4J8PA 5HXAA 3ZZUA 1NMZA 4Y6QA 1TE2A 1XZAA 4FSDA 2PPVA 2I1LA 2ZVJA 2CMHA 3E3OA 1ZOPA 4ECTA 2EP7A 3D8RA 1EVYA 4Q66C 5EZYA 2NO6A 4ETIA 3HXKA 4MZXA 2J8ZA 3TB4A 2QYZA 4J16A 5DG9A 1U1DA 4OFWA 5B5SA 2HBZA 1Q92A 3BHNA 3EBPA 1SHUX 4HFJA 4KREA 3HN2A 3TLKA 4HUQB 3GVIA 4OJMX 4C7XA 1E3EA 2EEPA 2H57A 4B17A 4QBFA 5T64A 4CM4A 4FDUA 5E6RA 3TZBA 4M9XA 2DH5A 3T4UA 2D2IA 3V4ZA 5JH7A 4XB2A 4CMCA 2OFXA 3G85A 4N39A 2G9RA 1Z74A 4BBSG 4U7CA 4URZR 4PHHA 1N2GA 1JJBA 3KDAA 1EUCA 2OMEA 4N5HX 3ABRB 4CKWB 1F8YA 3HJCA 2VP3A 1N3LA 4MYTA 3L8YA 3P0IA 2EQAA 1J6UA 4HDRB 1OD6A 4ARBA 4TMXA 1V1JA 2OPBA 2I2DA 2WWYA 4KGXA 4WT7A 1IULA 4M8LA 3WMFA 4KHZA 4B3XA 5AW9A 4MR9A 4WINA 3KYIB 2YOGA 2EHDA 3EOBI 3QEMB 3ILYA 5BR4A 3R6LA 4XXHA 2FKAA 2IY7A 2X5KO 2DXIA 4BCBA 3AFOA 1P9LA 1H9AA 1Q0HA 2XE8A 3A9VA 1P0PA 2HFJA 4OXYA 1QH9A 1ID1A 4C5CA 1PHPA 3U80A 4BNDB 1CC1S 3SYMA 2J32A 4LYHA 1AQUA 4KV9A 5KT7A 3ZGLA 4IIFA 5FWNA 3EW7A 5ALVA 5IWCA 1LK7A 1P2VA 2A9VA 4E15A 4MRAA 2YINC 5BW8A 1QOZA 1GKUB 3AHIA 2AQHA 3KT6A 2B3TA 4QG3A 4C14A 2H2GA 4X3OA 2WYVA 1EPUA 3GRPA 4XFKA 5CA1B 2FPPB 2JFGA 4YXWA 4CU5A 3HU1A 1CR2A 3TBHA 3D7RA 1B8UA 3H1GA 2DHRA 5DGIA 2D00A 3O3NB 5HHTA 5ICCA 3HB7A 3WRYC 4HH1A 4B47A 1UT8A 1Z63A 5C3UA 2JGEA 3AVPA 1UMKA 1VA5A 4G1CA 1E2EA 5IXSA 4FJ2A 4RPHA 2RAUA 4NWIA 2HIGA 3ZNOA 3QZ8A 4UOQA 4C6SA 3PGMA 4XOUA 3PQDA 1XI2A 1PZXA 4LSAA 1I4OA 1WCMG 4DCMA 4S1PA 1S1CA 1CRZA 3NETA 1D2CA 1E2IA 1E6UA 2Q28A 1Q7CA 4LFBH 2RGRA 4DG9A 3U31A 2FG7C 4WK6A 3I9MA 5LQAA 3FDSA 4EKEA 2ILTA 2JASA 1ZU5A 5KFJA 3HC7A 2IHKA 3UANA 5AM3A 1Q1BA 2H11A 4CQNA 4TYNA 1TUIA 1VBNA 1A2BA 1JHDA 1SKUA 4GXTA 4AP6A 3L4BC 3CNLA 3TF5A 3RSZA 1FRZA 3K35A 1U0HC 4M0MA 4HK4A 1PJAA 3ER9A 3IVAA 3AVXA 2AUTA 3FW1A 3PRKE 2YJ3A 2P6NA 4BV2A 4JU9A 2JCXA 4JI1H 2ZT8A 2KB0A 5AW6A 2B1RA 3NT2A 4ABTA 3VAAA 5KFRA 3E2MA 5EHQA 2V7XA 1NWCA 3OIVA 3OE7A 3G6XA 3UPDA 1PNTA 4ND1A 2WV7A 3GLHB 3ZVKA 3FOBA 3HHEA 5C9ZA 4CUKA 3BFKA 1I4WA 1KJQA 4IR1A 3Q3VA 2PYDA 1PQYA 5A7FA 4O81A 1PR3A 4ILEA 1V7ZA 3ESQA 16PKA 1B93A 2IH4A 3CVVA 5I45A 1EIWA 3MAAC 5F64A 3PE3A 4TSFA 4JBIA 1XRLA 3ZU2A 4PXSA 1M7BA 4IDHA 5DQGA 1YA8A 4JEMA 3CXRA 2V4MA 2PRIA 4XDYA 1NOIA 4YREA 4C3OB 2VOBA 2GBIA 3E7DA 2PJZA 3EVTA 1MLDA 4J6EA 3I2HA 1R1DA 1DFGA 3BQNB 5JCPA 4X6XA 3FWNA 2R3SA 4DPKA 4XE5A 3EJ6A 3KWJA 4Q16A 1EE2A 4PTZA 3C39A 4I4LA 3PXCX 4ZRNA 1Z73A 3MCAA 1TM5E 2J0VA 2RIRA 3ZHZA 5JVLA 1UBSB 1QB8A 3O8LA 1QOQB 1L8LA 4L73A 3NM5A 2O54A 4HBGA 2C29D 3MB5A 1KMHB 5LQMA 5A04A 1XROA 3GP5A 1E1KA 5DULA 3F3YA 4H4CA 5B58T 2HSGA 1MRSA 2COIA 3C5CA 1M0EA 3PKZA 4ZVKA 2FLVA 1LQUA 5CVUA 2H65A 3VKFA 3AZQA 1OH5A 3D1VA 4DLAA 4Q9JA 4NYIQ 3LO8A 2FOXA 1XLTA 3U3ZA 5KTKA 4A36A 5J1TB 3VH4A 4UEWA 1MGOA 5DU2A 2G9QA 3HL4A 1ZP6A 3GRKA 2AFHB 1QHGA 4TROA 4RHCA 3VDRA 2NVUA 4C0BA 2QT9A 2HSDA 4ZAWA 4HX5A 4EEKA 1OSNA 3W9UA 2FSIA 1M2GA 3JQAD 3P96A 3BJRA 4HNAB 3VO2A 3SNOA 2DPMA 2LE0A 5COQA 2CCKA 2YV3A 2D1TA 2R79A 5DWQA 4CKCB 1OASA 3WGOA 1OAOA 1P19A 1RE1A 3ED1A 4HN2A 1V39A 3SZOA 1G41A 4NCJA 3RF2A 2V4UA 1QFMA 1OBDA 4JXUA 1QJCA 3VKVA 2YWFA 4JP5A 1S3SA 3CUTA 1C1YA 1VL2A 3QG1A 1KSFX 1PZFA 3B1ZA 4LE1A 1EVIA 2VDPB 1E77A 1TTPB 2KBFA 5EIBC 2OLSA 4TMKA 6Q21A 1V5GA 1OF1A 4JLWA 3SBDA 3AM4A 2UV8A 2N9UA 1RWBA 4F11A 5K8JB 3HBAA 3V55A 1W93A 4F9GA 2W7PA 2ENUA 3LYLA 3OAAD 4PYRA 1CY8A 2IU0A 2GCEA 3F8NA 4UZSA 1N8KA 1SBIA 3I5YA 2JPDA 2ZRJA 4B3SH 4YLGA 4XWWA 1STOA 5HQ3B 4QARA 3WLSA 4FYJA 1ECFA 2ZB8A 1P9RA 4UFZA 3LHDA 4OLAA 2ZM6B 4UNIA 4W82A 4FBUA 4X91A 3ZR4B 3IAM6 2RH4A 2YKGA 1SK9A 2XRFA 1DAFA 4ZANA 3TFOA 3GJYA 4EMBA 4QD3A 5CH5A 2YC4C 1TXGA 4ZYZA 3JQBC 4MKRA 3L04A 5D5QA 1TCAA 1X7ZB 1U0TA 2ZIVB 6REQB 1YHNA 4ID9A 2JI7A 5AI5A 4Y1FA 4NCBA 1ESNA 3ZQ6A 1RFLA 5MN6A 1CW2B 2R6JA 4ZEXA 1U7XA 1B6TA 2WWVD 5TXGA 5KS2A 2G71A 3RTDA 5TQJA 3ZX4A 1ODFA 3FTCA 4JBLA 3WK9A 1B76A 3FDZA 3AL0C 4RGVA 1NP3A 2H1CA 1FCJA 2OMKA 5B7QA 1NTOA 4NG4A 5K9ZA 3OIFA 4ROSA 2DKNA 3N41B 4W9NA 3ADCA 2O7NA 4DWVA 3REGA 2GEUA 4LY9A 2P65A 3PGXA 3HQ4O 3BL6A 4AN4A 1CP2A 2Q21A 3EC7A 1XRPA 2WUDA 4BX0A 4D3ZA 4V39A 3MJDA 1UR5A 5FUVA 3QA3E 5L3SB 3IKMB 1DO0A 4HD8A 2DCUA 2IYXA 4HDQB 3D6JA 3BE4A 3ELWA 4NBRA 4XIFA 3NALA 3USZA 1E4OA 4RXMA 4KGVA 3KLOA 2DR2A 5B1IA 3ONNA 3FDFA 2R8RA 3OCCA 3ITNA 5CIYA 4DQKA 2CNBA 2H17A 2C94A 4LJ6A 4HMPA 2GCOA 1K5DA 4BPRA 2X9LA 3VNNA 4TYYA 4FN5A 2IE0A 5NULA 2H31A 5E4FA 1PFYA 2D54A 3QHAA 1WCMA 3DWEX 4D8TA 3C7KA 3PI7A 4APMA 5L3ZA 3HB9A 4HN9A 3K73O 4IJUA 2QRVB 3Q4GA 4G89A 5AJZA 2JLWA 1ZD1A 1BVRA 2C98A 5DT9A 1MABA 4QG7A 3HDHA 1UDCA 3OLYA 2OFFA 4OD0A 4M7RA 2QAJA 4O59O 3W05A 3RAFC 1I01A 1Y98A 1XQ9A 2R84A 1KO1A 2G8LA 3EVGA 5FBRB 1OX6A 4Z0HO 2ZTMA 4CBVA 1E4EB 5AKXA 5CDUA 1OJLA 2PXXA 3E1KA 1OTHA 1Z4IA 2C2ZA 4AJEA 5B57C 4WJLA 1MZBA 3WIEA 3NHFA 5C8DA 3OZXA 1GOTA 4AF7A 5M7EA 4X3PA 4DLXA 1Y7HA 1QDUA 4EZIA 2OUIA 3ZDYB 3G1UA 3NHZA 3JV7A 3JATB 1OH6A 5JDCA 2QX9A 3KVRA 2KSWA 1CVIA 4FDVA 4IKEA 1IHXA 3INYA 4Q3DA 4WOKA 5CGQB 4QASA 3OU6A 4BLUA 3ZE2B 3CPJB 3RABA 1WXWA 3VTZA 4J2HA 2YCLA 1T9DA 3TSCA 4WH0A 1H2YA 2QN9A 5FPOA 1S9DA 4B1FA 4G67A 3HABA 2FKLA 5CVDA 5JALA 4QIWE 1M6VA 2JGFA 4IVRA 4BY1G 5B1YA 4BNFA 4O86A 3VNUA 4EB6B 4J7UA 3OZGA 3P9SA 1GL7A 1ES9A 4J94A 4LK3A 4U1RA 2GKOA 4L3VA 2GUWA 4EGSA 2WPDA 1QHXA 3MXTA 1USUA 1GRNA 4ZPJA 4GW3A 3UMBA 4JJ6A 4OQXA 1NP6A 1SB9A 3E03A 2JCBA 1FXUA 3RIEA 4LVUA 3HPRA 2H4HA 3BM5A 4BO8A 3OIGA 2HK9A 2ZRBA 2WMOB 4AVYA 2W2LD 3P9KA 3F3KA 4OQEA 4GO1A 3R7NA 3WTCA 5HEKA 1BCRA 5IZ4A 4ML3A 2Q5HA 5K3WA 4PZ0A 2I9KA 3TPZA 4MEAA 4ENQA 3VYVA 2Q07A 1GGVA 1KSJA 1S3GA 1NN5A 1JFLA 1K8ZB 1XMOH 1O95D 1R4AA 2V7QD 2AWNA 3LNTA 1UBMS 3V8MA 2QT0A 4CN8A 1Y89A 3DWIA 4UPDA 2VNIA 4FOTA 2C0PA 3UXEA 1GGFA 1EZZA 2CXUA 1JJIA 4J0MA 4Y2HA 5EVCA 1JAXA 4JUCA 1U99A 2J5QA 1BDJA 3AM1A 3LC7O 3GIIA 1Z6YA 1VL5A 3G8AA 1RYYA 4NMMA 4DA9A 1PGNA 1PJZA 4KHPH 2Q4BA 2HSZA 3WLQA 1BDMA 4RABA 5CK4A 4IQ8A 1KMMA 2P9GA 1JXMA 4YJ3B 3C4JA 2GX6A 2W4IA 2CWDA 4U7PB 5A2GA 2HFKA 4AY5A 2W7TA 3C1UA 3DFZA 2CT8A 2JFNA 3LYUA 3ZBQA 2XUQA 2OCBA 4C3ZA 2Q0XA 3K92A 1E2BA 1RKXA 2Y1OA 4F38A 1UL1X 4IWNA 2WTAA 4B3FX 4O2BF 4B3RB 3ONFA 4HNSA 3OTOB 1N4DA 1MD9A 1MVNA 1OXVA 2AN4A 4DQLA 3K1AB 4TZKA 4WN9B 4DRFA 4BFXA 3SC3A 3MS4A 2X8LA 3G23A 3LY5A 1F8FA 4OL9A 4HNQA 1Q77A 1LLFA 2FQ1A 2Q5OA 5IYZA 2I0FA 1I7PA 1XTUA 1A5ZA 2KE5A 3PFWO 3AUUA 5DLGA 1ODCA 3ZS9A 4KN5A 3BB1A 3OQ1A 1P81A 3A6JA 4JS0A 1KL7A 3C4VA 1CJCA 3RKUA 4AUNA 1WPQA 2A1UA 2GPJA 3EZ6A 4XFDA 5HFJA 2XUAA 3WFZA 4U7HA 2HHLA 4QQNA 5ALXA 5A62A 5IUKC 3STVA 4P3PA 2J3DA 5FPKA 4BP3A 2UYGA 3W5HA 1D1TA 5A4DA 1QDEA 1NURA 1H0HA 1WCV1 5JFOA 5HJ5A 2OYRA 3AUFA 2LKDA 5JROA 2NO5A 1QHNA 1KRHA 3JSNA 4HC4A 4DCSA 2G80A 2W71A 5CM8B 4DT1B 1DCKA 4MV4A 4DQVA 3RRBA 5K0BA 5FJIA 3LXXA 2B69A 4HVCA 4TKZA 3GDHA 5EWLB 2JLZA 3K09C 1I2ZA 1KZ9A 3I4CA 5JRDS 1PDOA 1GV1A 4DV6B 2PIAA 2K7ZA 1DIBA 1D1SA 1XIVA 5TY0A 1B6RA 1QIIA 1E1LA 4XOIA 3I9NA 1K7XB 2ID9A 5JFGA 1XDNA 3T5KA 1RI2A 4P54A 4E6EA 3R9WA 3L8GA 2G70A 4O4HA 1A7UA 3DMPA 3PUWA 5GZ6A 3O73A 3HA5A 1N1GA 4IJKA 4DDHA 5LKRA 3RTXA 5G0SA 4DQXA 1M8FA 5B12A 3PDWA 4JUFA 1SBZA 3PF8A 1S0OA 3RJ5A 3S68A 3W2HA 4GPTA 1X7WB 3JQFC 3SJCA 3L02A 2C3MA 2RHRA 2VKQA 4P3OA 1VPDA 3PC3A 3SHWA 1WRBA 5AK3A 4PCVA 3QLVC 2P0EA 1NQUA 3TZQA 5JI3E 3BRQA 5CLHA 3RBAA 4OBXA 1JMVA 1SC4A 1LRLA 3ZYCA 1XZDA 4JBYA 3IAM1 3EISA 2JGAA 1E18A 4H2DA 4LI3X 2FF7A 2XKBA 2R7NA 1TD1A 1RXIA 4ZZ0A 5IYZF 1PFWA 2W6JA 1CUVA 2D0IA 3VOAA 2QM7A 1IK4A 1G8FA 4EQ6A 1ZOOA 1RACA 4FFLA 3ZVLA 2R2AA 4JI7B 5E38A 3L7DA 3VO1A 2BH9A 4RSGA 3HXQA 1GRQA 3GA5A 4DMFA 2XA9A 3LUAA 3RADC 3PVSA 1X1DA 1G7SA 2HB6A 1BOOA 3Q8WA 1QQ7A 3BMCA 6AT1A 5C8YB 4Q3CA 1ZK1A 3VH2A 1Y82A 4J0HA 1UOOA 3DLCA 2N75A 4CTNA 5K3AA 2B4TO 4J3FA 4U8HA 1NW7A 5MFPA 2FE3A 4RUKA 1WZ2A 2I4RA 3O8OB 4UBIA 3WS7A 3QBEA 4WCVA 2PO5A 3PBKA 3FVVA 3NBYC 3AF5A 5D85A 4WZAA 4KYIB 4G5RA 1W0CA 4J4BA 2BRUC 3DW3X 1EE9A 4B73A 4LXTA 3CPHA 5FIUA 5AVYA 1ZKMA 1OX4A 4PZYA 5IWAB 1R8SA 2FHSA 1FTYA 4O4HF 3HJBA 1TO1E 3DA8A 2WAQA 2MINB 4L28A 5ITWA 4LJLA 1AV6A 3GRCA 4YFYA 4KQXA 1PTJC 3ABZA 4IS3A 1WIWA 4BO4A 1ZW1A 5M3BA 3KREA 2JFWA 3A9SA 4ZI3A 3FNHA 4DIFA 4COOA 1UP4A 2O05A 2H18A 4EKYA 3VNAA 3MLEA 4DL4A 1FFCA 1G8PA 1SC3A 5C5EA 4WESA 3L0ZA 2VHZA 3GJ7A 4P3YA 5L1JA 4JT8A 5FOXA 3S2ZA 1OWTA 4EVIA 2H52A 1C1XB 5CITA 5M34A 4B2IA 3JU3A 4ZCRA 2YL2A 1E61A 3B1VA 3H05A 4YV2A 1UJNA 4TMVA 2CXPA 1UXHA 2FJUA 1H0KA 3A1EA 2AJLI 4MV6A 2FCAA 2PSFA 1RQRA 2GDZA 4OQQA 2J0QA 2FMUA 1O94D 5EIHA 5KJ6A 3JQQA 3WGUA 2O1WA 3RHSA 4RDCA 3BA1A 5KG6A 5EVJA 4RL4A 5HX7A 4XM1A 4BKPA 3PG5A 3LOPA 3ZBUA 2W2MA 3W5VA 3HGQA 4E03A 3HFSA 4QQFA 3BMNB 3H86A 1X1QA 3NYQA 5WRFA 4ITUA 3SM9A 4BMNA 1EX6A 4C43A 4BASA 1M0TA 1D3AA 4JT4A 4OKSA 3DF7A 1E62A 3NV9A 5AI8A 1UBCA 5T4BA 4LKOA 4IJ6A 4PXAA 3WLRA 4BNLA 3RO7A 4HMQA 5FWAA 2QUIA 3N8GA 3IP5A 3QU9A 1QVWA 4N6GA 1MB3A 3JQDA 1M1XB 5GONB 1RI1A 4ALIA 1E2MA 4BUJA 2GXAA 2QI9F 3B3GA 1DFIA 1ESCA 2GTHA 3GTLA 2ZIAA 1NSYA 3C6MA 1IVNA 3EZGA 1FVOA 2P7HA 4NAHA 3RK1A 4RHTA 3CF6R 4P7FA 1HF3A 3PW0A 1FBNA 3FWHA 1E3IA 4GMDA 1IY1A 2XXAA 2QA5A 4D9HA 3EA5A 1SELA 5F9NA 3K2IA 4B2LA 4DAEA 4I8XA 4NXNH 4O82A 1DBRA 3IUSA 1KS9A 4R98A 1VFPA 4LSGA 2UKDA 3D4BA 4QYWA 2EFGA 5ENZA 1NHWA 2PMEA 4YV7A 1W9HA 4MUIA 3U0VA 1NU6A 3NUQA 2JFBA 3W1GA 3QPUA 4JLUA 1LKZA 4FB5A 5DNCA 2B37A 2EKDA 4NH4A 2LGJA 2Z3ZA 3QZUA 4QELA 4IDCA 3KIPA 5KFNA 2QN6A 1GFSA 4CL3A 2ID7A 4TN1A 3MG9A 2FJPA 2GK7A 4UDXX 4G2TA 5KTPA 3TLGA 4EJSC 1XOIA 3LQKA 3D8SA 2HKIA 2EGUA 4CCYA 1JDTA 3I9KA 4C2BA 1YJXA 3BJZA 5K7SA 2AZXA 3RBZA 1LUAA 1J21A 5F3DA 4LF4B 2XYGA 4EQZA 3RSHA 4ZTUB 2X4DA 3TR0A 1XTJA 1NC3A 3WHIA 3H9EO 1IJBA 1EWTA 3ZOZA 2H4FA 3OTWA 3NOQA 3LECA 4TTAA 1E20A 4L08A 3WRXA 3UEOA 1PJBA 3NJ4A 1XE3A 2Z8YA 1P16A 3I05A 4N76A 1ZA1A 4KXUA 1GDHA 5KFAA 5BR7A 1QKIA 3L43A 2VRCD 3QYJA 1MGPA 3TTSA 5CHYA 4M9CA 2Y0SE 2XTJA 2JGKA 2ZREA 3HFGA 3SFTA 4QM6A 2JHCA 3GLGA 1FBTA 2YHSA 3E9MA 4UHCA 5KOHB 3FE2A 3GPBA 4BJ1A 3VSEA 1YFZA 1P7WA 2XMZA 2WFMA 1AXEA 3JQ7B 4AYBE 5TX7A 1Y3CE 3FRIA 4AJLA 3F1KA 2PKRA 4WCFA 3DZHA 1RNLA 2X9NA 1CRWG 4XJTA 3GFSA 3QITA 5G4KA 2ZJAA 1CXZA 2C4HA 3BQMB 2A6PA 1ZQ7A 4JV2A 3N2KB 3CKYA 2IKQA 3VR4D 3V5NA 4JD5A 1RPAA 1Z75A 4PGAA 2W2KA 1RDFA 2ZRNA 3GUYA 3JQ9A 4NBLA 3PJRA 4M60A 1EP3B 4FS2A 4ZCIA 2ZBRA 3JW8A 1IATA 3X2FA 4ZI2A 2FGKA 4BRWA 1T1RA 4GMFA 3QKUA 1NXOA 1GL3A 1UC5B 2ILVA 4AWXA 4B34A 3L40A 4EHLA 4XX1A 2F8LA 3WL6A 4M0EA 5BSMA 3SYRA 4F46A 1CY4A 2Y66A 3G13A 3GILA 1NM5A 3ZD6A 5I7HA 4LOLA 1FLVA 3VDQA 1DX9A 3MS2A 3KO8A 1LDYA 1JYEA 2ZAOA 1C3EA 5K3OA 1WCIA 2LBPA 2R2GA 2VYQA 1J5PA 5JTTA 1IBKB 3PQFA 4R16A 4RKRA 1MOZA 3KSRA 2F3SA 121PA 7REQA 3EEBA 5DNYB 2YZGA 3JRNA 3HLKA 1SEVA 3TR5A 4BP8A 4NOJA 4R54A 1PBTA 1CV2A 2XIGA 2GNPA 1GZHB 3TW0A 2K2QB 3U7FB 2CNDA 1Q3HA 9LDTA 3SIRA 4EYHB 3Q1KA 3IUBA 3AVWA 3DXXA 4MQMA 4RY8A 4UREA 5ES3A 5JFTA 4F8YA 1XXHB 2J5XA 1N32B 3RC7A 2LRHA 1ODTC 3IQHX 3L49A 4RFSA 3ZVMA 1MH1A 3MMZA 4GBJA 3PSAA 3R5JA 4MITA 3SFZA 1DXOA 4RPIA 1QLJA 1J2UA 2GOYA 3BTVA 3KLBA 2AFRA 1E6CA 1YE5A 3AJAA 1I5EA 2FLPA 4HDMA 3UMJA 2QRJA 1RK6A 5BN5B 3QOXA 4U00A 1T1JA 3I9LA 4F4IA 3SLGA 2ZUVA 1MAWA 3EARA 3QXHA 4MRRA 2P6PA 3NTOA 1MPXA 4TQRA 2M05A 5FUWA 4WXHA 4D4MA 2PD3A 3WGNA 5KOJA 1E8DA 4GKBA 3D02A 5I8ZA 3AUSA 3W8EA 1IHYA 3FTQA 2ROQA 2DU8A 3GK3A 1SU8A 2Q7DA 2GTPA 2QXUA 4NBKA 3PLAE 4MHSA 2NNWB 2ADFA 3BFJA 4QBHA 1O6FA 4EBDA 3WY9A 2ETXA 1P2DA 2UDPA 1Y1TA 4YUXA 3OC0A 4QSMA 5JXJA 3WGLA 4RNDB 3TY5A 5GIPE 1JTVA 4KVGA 4Y98A 1O57A 3MS7A 2WHYA 4KQ6A 1FQJA 4FHGA 3D1JA 1O5OA 3PRYA 1X86B 3AR6A 2DH6A 2QPTA 4R1TA 5C5IA 3GT4A 1X0XA 4ER0A 1HUQA 3GVXA 3CH7A 2TECE 3OLQA 1C0LA 3LZDA 3W5UA 5LQSA 1W87A 3KSBC 4CQMB 1DOZA 2Z8YM 4U7JA 2CVQA 2P5UA 4OHOA 4QPJC 4IDQA 1O03A 1W1UA 4WCDA 2HHFB 1OLOA 3RAXA 1LSSA 4O1IA 1B42A 1SEIA 4MVJD 2OZKA 2VCYA 4CHGA 1PK7A 1WMDA 2CDRA 5K4HA 1TAQA 2F9MA 1P7ZA 2FPLA 1WHTA 4ETSA 1SUEA 1CHDA 3EUAA 4UKDA 3EVDA 3M9WA 3EZNA 1Q21A 2VHQA 1P77A 2R6DA 5JSYA 3GG9A 4BBAA 4WY2A 5JXWA 2XSZD 1JHUA 1ZD2P 3T1YB 3H2ZA 1V6AA 1AD2A 3EXG1 1GCOA 1ETHA 1O54A 1I0LA 1NNEA 1LLQA 1QHHA 3WP0A 5IJ0A 5FJ8G 2BD0A 1GUZA 9LDBA 2QQ5A 4AICA 3UCXA 5CAEB 2VJQA 2PIDA 3JYQA 5BWNA 2BJHA 1DUVG 2XUHA 2QBYA 5DSZA 4EO7A 4MW7A 4URHA 1UP7A 6NULA 5EJEA 4PGMA 4UJ3A 4PRZA 1P1BA 5KYGA 4JK3A 5TQ2B 1ODJA 1SOUA 2OCAA 4D7AA 4EJ0A 5KTNA 3IP7A 4EVSA 3BAZA 1N6RA 3PC7A 1FVFA 4P33A 3UJ8A 1XRRA 4IICA 3KQQA 1GDDA 2Q7OE 1Z38A 4BNYA 4AQYH 1XDBA 3VAYA 2IF0A 4WXRA 2ZIEA 1A7AA 4B9AA 5KPDA 4MVJE 1QS0B 2ZTHA 4OCZA 1LY1A 4RHUA 1T3LA 3A70A 4DDTA 2EFDB 2VH1A 5AM2A 2FDRA 2VH2A 2HA5A 4PNEA 1PL7A 4JASB 3B13B 4CT5A 2O8FB 3DTTA 2XE7A 2ZUTA 4Z3KA 3GT0A 2FPUA 4RPGA 4K26A 2FV8A 4AL4A 1KI6B 5FA5A 3VQTA 3UQYS 2V0GA 2YVKA 2BV3A 2VUSA 1J5EH 2OQ2A 3BKWA 5KTMA 1FYEA 3B52X 4EPYA 4CM6A 5C1BA 5IC5A 3RSGA 4U0KA 4E09A 2NN3C 4D98A 3AB3A 4KN9S 5HILA 4H17A 4L5AA 4KZPA 1BX0A 5D3KA 1ZINA 1H3NA 2EBWA 2PFGA 2O2IA 1SGWA 1VZ2A 2W2QA 3I9OA 3CEHA 2CEAA 2X77A 1M6HA 2FEWB 4I4TB 3PI6A 4YAKA 5HE8A 3CLRD 3PICA 4L74A 4EKIA 1CS4C 1RHUA 4BMOB 4BNZA 1HE5A 4ZTZB 3ASVA 3ER8A 3V6KA 3MJHA 1H42A 3ZE1B 2O23A 2COUA 1V7QA 3CURA 3GGDA 4II3A 2XX3A 3VPGA 1T5LA 2GRAA 2J3KA 2UXCH 2HJSA 4Y6LA 1NUQA 4WX2B 4JBHA 1EWRA 1R6TA 2ZYHA 3BWBA 4R05A 2YXPX 3E27A 2JBHA 4QUAA 2GQSA 1NYTA 4HZGA 4GLLA 4P22A 3KAJA 1FSGA 2IPMA 3IGFA 3W78A 4ENTA 4O4JB 4GL2A 2NU6A 5CVEA 1DRKA 4QYMA 5K0JA 4RA9A 2HI0A 3A58B 1FXWA 3HJFA 1XEWY 2R7ZG 1XP8A 4CM5A 4HMOA 5I3ZA 2CVHA 1ORTA 2QKYA 5JAQA 1IYEA 4LWQA 4TZ6A 3ASYA 5D2CA 2O7RA 1FMCA 1F8GA 4ALMA 3QTTA 1RQNA 3SKXA 1XNRH 1TVEA 1HYQA 4HFMA 1W36C 3X1JA 3AR8A 2BTOA 1P7YA 1LX7A 4B4VA 3CX3A 4IL5A 1X19A 3OPYI 4P80A 1EP2B 3UFXB 2HJGA 3QG5A 2HQSA 4WSOA 4RZHA 2RGNC 1S2OA 2ODAA 1AK2A 2WU3A 1RTTA 3L0CA 3NNSA 1RJDA 2Q3JA 2W8KA 1UM8A 2F1RA 2G4LA 3DXZA 4MWEA 1Y8RA 1RADA 1RQXA 1TU4A 3U1TA 1JHQA 3U81A 3UJNA 1FTGA 1R64A 3OCWA 5B7GA 4R1NA 1TZJA 3W8NA 1RD4A 1U2PA 1KS2A 1MJGA 5CXUA 3GPLA 4US0R 1AS0A 3VU1A 4OXNA 3G17A 5LD2B 4NCXA 1U8EA 5KT3A 1R0XA 4ENRA 1VJCA 2AQ4A 3UUEA 2BELA 3EG5A 3MFIA 3KZKA 1BMFD 5FTNA 1ZOSA 1VI5A 1Z8HA 1VG9B 5KHLB 4KXNA 3NZEA 3QIAA 2CGEA 3W5OA 4GX2A 3B53X 3DTVA 2C4TA 4PR3A 4GVPA 4JFAA 3N39C 3IKTA 4TOIA 1JSCA 3B9PA 3TCKA 3SLKA 4B0OA 4B35A 4V1CB 4H7JA 4CF7A 9MHTA 3A31A 1PDWA 3WQRA 4Q4AB 4ZRMA 2IV2X 3S1AA 3QU4A 2Q9CA 3M9LA 3B9QA 1JKJA 4EEYA 1JDJA 4ALLA 2ZUUA 3TFWA 4QJFA 2GN6A 3MOSA 1MXFA 3M83A 1VLVA 3DBHB 1SXJC 4EFEA 1YS7A 1GTG1 2RHWA 1J9ZA 3VOTA 2YH2A 3BYZA 4ZU6X 4JI0H 2UYCA 1C3OA 1GXSB 3DVLA 2WJWA 4GLWA 4JYAB 3QF4B 5KVQA 3COSA 1W0JA 2NYRA 2I4NA 1KQFA 1G19A 2V5UA 1KK0A 2HLDD 4RETA 2XGQA 3ZV7A 2BEJA 5HUJA 1FXWF 1QIJA 3UJAA 3GZTB 2E4XA 2QPAA 3IPLA 3RANA 4K9OA 4G4GA 3DMFA 4BFUA 3LF1A 4JLPA 3TJRA 4MGHA 4Z4IA 5FOSA 2CL5A 5GJCA 2PX6A 1USKA 1OFUX 3E9ZA 2POQX 1CJMA 2DLCX 2Z98A 5BQOA 1R0SA 4KQ9A 3PYLA 1JN0A 3UPUA 1E6EA 4YQYA 4CR6A 2Q46A 1LLCA 4W9RA 5FLKA 3IILA 4RLFA 4EA6A 1FNSA 5DYNA 3IAFA 2BZ1A 2QY6A 3AUYA 5FWXA 3QKRB 4L7QA 3UW3A 5F1YA 3QU7A 4LECA 3E3NA 2AVDA 3K0AA 5KT6A 1PGOA 4JHLA 4LOAA 3LQ2A 2FWIA 3PQ7A 4ESEA 5EXSA 4PPFA 2GGSA 4IUBS 3VGPA 2VP5A 5EZYF 1H4VB 1UMDA 4L15A 5REQA 1TECE 4W5NA 1FFDA 3DDUA 3MB8A 4EMUA 1W88B 2RB4A 3Q0TA 4PX9A 3UGQA 3G2OA 4TMWA 1KJJA 1FY2A 2GN4A 5FJJA 2AFIE 4YCCA 1EX9A 1JX6A 1ZMRA 4KAJA 1MX1A 4C01A 1Q1EA 5CYOA 3I0MA 5DCYA 4PO3X 2VDVE 4Y2VA 3QVJA 4M86A 3THWB 3V4PB 2ZQYA 2H1SA 1O0CA 4REMA 1BKYA 5JH7F 1I13A 1ENYA 5H3LA 4G0WA 4DV0H 5EOVA 1GTMA 2QM8A 4U7FA 1U2ZA 4BCDA 1RCTE 1M1ZA 4DR6B 2ZUBA 5EUBA 1U63A 1WDKA 2I3BA 1VECA 2WSBA 4CTMA 5TPZA 2P6UA 4IHJB 4J9LA 4BATA 3C6QA 1K3UB 1T3TA 1G7TA 2HO4A 3O95A 3HDQA 4BX3A 1TWHA 3HSSA 3ES9A 5UKDA 1UKVY 3W9BA 1U7ZA 1JQAA 4MVYA 4C0SA 4H7DA 4ARCA 1W48A 3ZKWA 1JKFA 5CH3A 2NNLD 5ICMA 1Y5NA 3HN7A 3C15C 2O0MA 3FKJA 4DRXB 4CMIB 2BFCB 4PZEA 1J1IA 2I1VB 4GKJH 2F8TA 2OFPA 1W5TA 3OHSX 2VHXA 4TWBA 3T7IA 4ZDIA 4RF4A 2FOLA 2EFHB 2MU1A 4EMSA 2H4JA 4L76A 3CV3A 1A9YA 2C9BA 1JR3D 3FSEA 4LPKA 5F3RA 5K0TA 3RUHA 2ID4A 2QV7A 3H5TA 2FK8A 1MJGM 2VPXA 1AGYA 3RVDA 1BHSA 1FX1A 2ECQA 1TWAA 1E9BA 3QU2A 2IHUA 2R1UA 1EX1A 1V43A 1AF4A 1RJRA 5KIAA 3ZGYA 2NZWA 1WOYA 5DIZA 4YT5A 4ZCSA 1NUAA 5E7JA 3LC0A 3DVAA 2YIVX 3LHFA 3WGIA 2G17A 2IPXA 2Q9AA 3RPEA 2QRNA 1TT5B 1Q1AA 4UM9D 3EC2A 4AIIA 2CVFA 4TUYA 1XA4A 4NZYA 2OK7A 2MR6A 3VUFA 3OEYA 2ZBUA 1A8HA 1Q14A 5H80A 3M4IA 4MRNA 1PR2A 3G6WA 2JFVA 3KU1A 1YCFA 4JP3A 4AJOA 1A77A 3W6PA 3URMA 1YASA 1Z4PX 1HQDA 3GARA 1OXUA 2WB1E 4LWPA 3FIUA 3KE8A 4DUYB 2IY8A 2ABJA 1QPGA 4P31A 5C37A 2FW9A 4LF6B 2R7ZA 4O7VA 3RWBA 3UCEA 2XQJA 3DUFB 1QSGA 1FYFA 4Q3NA 2WT8A 5DYGA 2G06A 3WB1A 1G7RA 1U0JA 2JIOA 5IKPA 2YBDA 3PT9A 3U16A 4S1VA 3PPVA 5F9MA 1OLSB 1MVOA 4P58A 5JCOC 3RGZA 2HMYB 1CE8A 4D80A 4CW7A 3NWJA 5IBQA 5K6AC 4QUJA 2J7PD 4ZOCA 1QP8A 1U4OA 3IDSA 4WOCA 1N6OA 2X58A 3A4NA 3AILA 4OJKA 1N6HA 1W2WB 4KZKA 1FQWA 1VYTA 4O4IA 4OM8A 4F5EA 3LJKA 4DBVO 2PGJA 2NVYA 2PQMA 3ZI0A 1SU6A 5E6UB 2V6MA 3KJNA 1ATIA 1X7XB 1ZNXA 1ADGA 3QA9A 2QTVB 2Z43A 3DAOA 3QH4A 3FVTA 1JTEA 2HK7A 2Z3VA 4MDYA 1HKHA 2QW0X 1NAHA 4NHEA 1GQFA 4MHTA 4KL8S 4RHFA 3ICEA 5KNBD 4GDFA 1SVLA 1K4MA 3GEDA 5A4MS 3ADOA 1E0JA 1YBMA 1O6ZA 3TVDA 2QR5A 4R2MA 5DSXA 3UNXA 5JV5A 3A1UA 2IH5A 2B0JA 2C88A 3EQ8A 3INGA 4BX9A 1V1RA 3KSAC 3AKDA 1WEKA 5CVCA 4QAQA 2M6SA 1KYYA 1OHHA 1MKYA 1J70A 3T12A 1L2TA 3BN3A 1Z7YA 4TUYF 1XAGA 3S6JA 1OXSC 1HMYA 3H3VH 3NVMB 4ERNA 4YI5A 4J0JA 3FFXA 2V6FA 5LNK1 3BJMA 2NU7A 3T9DA 3AI3A 2QVCA 3TKYA 5AVXA 3WYNA 4HQLA 1I32A 4C4XA 3IDAA 4GPZA 3ID6C 8ADHA 4HVLA 3S7ZA 2I54A 5ALQA 2PXCA 1LX6A 1XLWA 1ZW6A 3ZDAA 1FRFS 1V1MB 2XDWA 4FBGA 2JH3A 4X62H 3OSZA 2JI9A 2GPYA 4Z0NA 1K7FB 4YCNA 4P92A 1QMPA 1WQ1R 2G8NA 1EYZA 5IVPA 1FP1D 4WNAB 3RYFB 1K3FA 4KOAA 2C7PA 3K2EA 4L1KA 4RJJA 5IASA 3I2IA 3H9UA 1YQWA 4M0JA 5FBWB 1XP5A 1M1UA 3W5DA 5TGDA 3OLVA 3BQ1A 4BPBA 1P4AA 3UJ7A 4DBZA 4M76B 1E3TA 3JAWA 3L7NA 4AURA 2D1QA 5ABPA 1HPLA 4UUGA 1JHPA 1E2QA 1CY1A 4O4IF 2NUPB 4FGZA 2QJFA 2EP5A 5E2AA 1QIMA 4JV1A 3SZUA 1X1RA 2NUAA 3TNJA 1DZ3A 3F7MA 3OEHA 3FKSD 1AHIA 3ITDA 2B8NA 2W9BA 1KOJA 3T0FA 5EQJB 4P83A 4XGNA 4DA0A 2VUGA 2FTKE 1TT7A 5KYNA 1L5GB 4EYSA 1RWWA 4FS3A 3IN5A 1G8YA 5DNWA 4DMGA 4BAZA 5KFCA 1E1DA 4KKVA 1N1MA 3BQ2A 4RTKA 1HNZB 1R0KA 5JNTA 3WOVA 4KLRA 4CL0A 1L5HA 3H18A 4L57A 3ZWDA 3SR4A 3J7TA 2GQRA 2CL0X 3TXXA 5DCUA 5T4FA 3GH1A 4IVNA 3L01A 1NL3A 2FP4A 4I50A 3UIEA 2B82A 3RS9A 3VTAA 1JLLA 3PQ4A 3NRCA 2YWDA 4BQNA 2EG5A 4TTPA 4HX9A 3P2YA 1ZUNB 3EGXB 2ICAA 5HOQA 3QE0A 3UCFA 1TO6A 1LQTA 1EVEA 3F6BX 2HR1A 1YR7A 2WG2A 5C8ZA 1MDFA 3E22A 1RXYA 2PO7A 2DETA 1GPJA 4FFOA 3U13A 3GFTA 3ZGVA 3CCCA 3JQRA 2A35A 5F4ZA 3QM1A 1SCAA 3O8DA 4A2QA 3EGDB 1V45E 1HNXH 2JJ2A 2GYVA 4LBWA 2C77A 2QLLA 4M8KA 4NRDA 2B1QA 1G0NA 1OFTA 3VOBA 4AP9A 4YTEA 4ED9A 1PV2A 1RRKA 1NE7A 1QPZA 1EESA 4LH7A 5EP3A 3E7WA 1UF9A 2QUJA 3SSNA 3RJMA 3IP3A 3OTHA 2JA7G 2UUBB 3A9CA 4U3JB 1Y8QA 3EY9A 2WIDA 1L5LA 1KJWA 4LF7B 3RREA 1JWBB 4J29A 3K71B 1QIEA 2WJZB 3TLJA 2BFEB 3U7JA 4E2WA 4EFDA 4HH0A 2X3YA 5BYJA 4PWQA 2B21A 2EX1A 2IEDA 4KXMA 1CJVC 4MGZR 2CCGA 3QPAA 2G1AA 2EL9A 4FS1A 4TV9B 5I9IA 1E3MA 3GJ8A 1IAVA 4Q5IA 3DZCA 3PNLA 3IOEA 3ZHSA 4OQMA 4HDSA 1TJ5A 1KRWA 1AUQA 2QN7A 2Z58A 3K9HA 2FUCA 3GN1A 3QSGA 4TYPA 1SC1A 3LVRE 1JEYB 4L72A 2C9MA 1BX1A 1FFHA 3TECE 1ZXXA 2Q9UA 2OSVA 4ENPA 2ZT5A 3EXIB 4JJ7A 4ZV9A 4NE2A 2GZRA 3EXHA 5KOYA 1VM6A 4JQZA 1OIXA 4E32A 2DY0A 1XMIA 3THYA 4I50F 1VIMA 2N42A 5G3YA 1V8OA 3O4JA 5BUSA 1JNYA 4H7HA 3TGLA 2GLXA 3JASB 4EEXA 2FHPA 1K7EB 1PG5A 4YQZA 2QXTA 3M49A 4GECA 1UEIA 4EFLA 2AGPA 3P2KA 4FMPA 5A9RA 4BVLA 3PRHA 3Q2KA 4MQEA 3ROXA 3AF6A 4DJEC 3L6UA 1KDYA 1XRSB 1GT6A 3HYRA 1XDGA 1UOEA 2BMEA 1EVQA 4A1FA 2PLNA 3Q88A 3KTDA 5CM0A 4OXKA 3CUSA 1BX3A 4KE8A 4Y6RA 4R2HA 1WD7A 4R68A 1F06A 3GEGA 3TZHA 1N9GA 1RXUA 3K70D 1A2OA 2OWOA 2FGJA 4CCWA 3STTA 1OAAA 5GOZA 2SCUA 3NDPA 4TRJA 3P9NA 1R4MA 3MPOA 2YXDA 2RGDA 5ILOA 2Q1YA 1G6KA 2PWYA 1LRJA 3HB1A 4Y2SA 1P2SA 4O2AA 4J9OA 1FUEA 1G4UR 3NAMA 5B6PA 2BSQA 4YWJA 2ALJA 5KFFA 3IBYA 1NZFA 3VX4A 2HSJA 3VH1A 3MRVA 1KI1A 5JJIA 2BEWB 3DLIA 1XMPA 2XNCA 2XVZA 1YDWA 3T3NA 3GO4A 1GILA 3INNA 4R1PA 3O8QA 1Z0FA 1K63A 3KSZO 4E51A 3TRHA 2P75A 4AX8A 3U0GA 3QHQA 3DHNA 2CK3A 2WUEA 1UKCA 4LBVA 5AD1A 1P5JA 1JSRA 4N5LA 4YI3A 4EEZA 4ITRC 5IBCA 2ZTVA 3NCHA 3I9FA 2E37A 1OYVA 1Y5MA 1Q22A 4PGHA 3WFJA 2ZUSA 5EE0A 1WMBA 4P0TA 2CDBA 2AHOA 3UKDA 2BLNA 2PRJA 3ICQB 4YP6A 3IE0A 4YP0A 5IAEA 3PNKA 3RU3A 1T4MA 1ZUHA 1LSUA 3FWKA 5CU7A 3A6GA 2QORA 4R31A 1SQ6A 3WYBA 4P4GA 2WSSD 3ZE8A 4BLWA 1T15A 4P35A 3SKVA 4E5KA 2MYPA 5HJ2A 2VSQA 4S12A 1VDZA 5DISC 3UJ9A 3GZJA 2C5HA 5LOVB 5TPWA 1S0UA 3KQPA 3CU5A 4NCHA 1U02A 4K9NA 4L8YA 3GV0A 1OU0A 2PUDA 1D8AA 4Z4GA 3DZDA 1YA6A 1EFUA 1L5VA 1GZ5A 4OXXA 3S2YA 1OZGA 3T7EA 2XDYA 4R2IA 3QP9A 2HN9A 2PJUA 4RY9A 3AUJB 4LMRA 4F06A 2QSYA 2VHVA 1UKEA 1USWA 4CTOA 1U9YA 3EFOB 5L1LA 1IOWA 5BV0A 1MC8A 2FPSA 3WRYA 3TTTA 3SK0A 1GGHA 1QCCA 2BM1A 4M8IA 3FNFA 3AC0A 1KXZA 5ERXA 2GAJA 1LZLA 2FN7A 4Q3BA 5H7XA 1EVJA 2JAOA 3KG2A 1PFKA 4XQCA 2RARA 3WLLA 2XH8A 3L79A 4MQLA 3HCOA 1PD0A 2IA6A 4F3TA 4RU9A 9GPBA 3A6HA 4EABA 1NI4B 4JI5B 3S1LA 3NIBA 2WTFA 3QBVA 4I4IA 1H23A 3PHGA 3H1FA 1II0A 5CW1A 1Z0AA 1F2VA 4D9KA 4RCYA 3F3MA 2GBLA 2LXNA 4V3BA 2G5GX 4YJFA 5HIMA 1T4DA 4JVSB 1ISFA 4TQGA 4PIPA 4D44A 4F4FA 1KHTA 5E3IA 4ZVMA 2PMBA 2PQ2A 3L4BA 1JF8A 2EJVA 2ZYIA 2J9ZB 1MIOA 2Q3MA 2X6QA 1K0FA 4M0PA 4EL5A 1HZJA 5ULLA 2P4UA 5HP4A 4E1BA 4A8HA 4I7HA 2GKSA 2XYHA 4AZ0A 2ZJ1A 2GFIA 3TYXA 4C4SA 4F6LA 1W59A 4K3UA 2GZMA 1ECCA 5G40A 3BOSA 3SMQA 3OSNA 4Q8FA 5BWCA 1QO9A 3A7EA 2HG8A 1IRXA 1E1MA 2KS6A 3MWJA 5HNEA 3SF0A 1L7VC 3IXMA 2XEDA 3B6MA 2R62A 5E8RA 2H08A 5MGNA 1HR0H 4S0XA 3FPAA 1MBZA 2NZVG 2QTCA 4CEJB 3ZHYA 4MKFA 4FX5A 4ZOBA 4QOEA 1EJ2A 3OJ0A 2P4SA 3V8NA 2X42A 1TJ4A 1MVLA 1VJTA 1ZUIA 4GPD1 1YIOA 1KOFA 5B7NA 3LF2A 2JA7A 3BL5A 2FH5B 2V6IA 1P1FA 5GVRA 1CUAA 4ZHQA 1FPQA 2Y4NA 4AKEA 4C06A 3AHFA 3IQWA 3PEFA 5CURA 5JHHB 5JCXA 3BXPA 4LZJA 1ZETA 4ARUA 3T1NA 4D97A 2WAYA 2W6ID 1WV0A 5MN5A 1E96A 4KCGA 1EDOA 3AHDA 2WF9A 3AEKA 3K8ZA 1KP3A 2G09A 4LOHA 2XB6A 3WK5A 1XYGA 1IZZA 3AX6A 2QE6A 5FO1A 4NBTA 5J59A 4ZQGA 4UXJA 2P0AA 3UTCA 1VE1A 4LFAH 3HK2A 2J46A 1YBFA 1JHVA 5HDBB 1I7LA 1WS6A 5LQRA 1VKOA 2ZUCA 1F51E 3MRSA 1NXWA 4KXWA 4C2AA 2A9JA 2GPNA 1ODKA 4FS8A 1I2DA 3WA6A 3K3PA 3DLPX 2ZWMA 3HKEA 3KOZA 1WSWA 5FPQA 3F98A 3G5LA 3ORFA 1NY5A 1AKUA 5AFSA 4R51A 1GV0A 1MX3A 3TXAA 2X2EA 1SHJA 5BT8A 1WHSB 4Y9TA 3P2OA 4F0JA 3DHEA 2NX2A 3SS8A 4AQ7A 2FZWA 3H04A 5FBHA 2AIRA 2I6UA 4ZZ3A 2RAFA 3MCTA 3CUVA 3SF8B 5SZKB 3IIIA 3FB4A 4EVQA 1RBQA 4KIGA 2E49A 1XPUA 4E12A 2GJKA 3Q2IA 3ZWWA 2D0OB 4EKNB 3R6GA 3FPBA 3ZGOA 1QGAA 3CEJA 1ZSVA 2JAPA 3ZJUA 3BXFA 4RS3A 4KWEA 5I01A 2FEKA 4XSHA 1TKAA 4GG1A 4ZFNA 2OA0A 1ZGAA 1Z5GA 1TTQB 2QRMA 1RZRA 1L4NA 1HTWA 4A0GA 4KB5A 3HV2A 4C2TA 3I52A 2NSJA 2ZYRA 1PFQA 3GCGA 3CSSA 4BO7A 1TYCA 4CI9A 3NB0A 4ZHQF 3WLIA 4CLXA 5JZSA 1JFSA 3SLRA 3GG2A 3QPVA 2VJMA 5AVSA 3AL2A 1QYCA 3T1OA 3UYLA 4TRNA 3BQ0A 3KZNA 4Z0TA 4IG4A 1PT9A 4DUZB 5COBA 4OB8A 2YHIB 1H5UA 4BNVA 1JW9B 4A82A 1RRVA 2K6GA 2VCEA 3WKBA 1BHO1 1OX5A 1B8NA 1Y8AA 2BKXA 1E1RD 3KJIA 4RZSA 3OTQA 3LTNC 4QBIA 4LYEA 2R6GA 1PR5A 5D1OA 4MWCA 5I8PA 3IAAA 1OIVA 1PUXA 4BKQA 3H2IA 2EU8A 2CF5A 2QX6A 2AX4A 3KHRA 3RJTA 3FCEA 4M0LA 4NJEB 1FFWA 5K3DA 1UBHS 1ZN7A 3ZK8A 3BACA 3IC5A 3PR1A 1QBKC 3GQVA 2LW7A 1OFIA 2DQ4A 1LQ2A 3DP7A 2GB4A 4LJ9A 5DGBA 1W49A 4M0KA 4Y7CA 4G65A 2MSWA 2CL6X 3M70A 2Y4RA 4PDBA 1XAHA 1ONBA 4JYMA 2V8BA 4RADA 1IQRA 3THSA 3HDTA 4LGVA 4IZ6A 1BS9A 5JASA 3H8VA 2OLEA 3BMXA 2MIIA 4OHVA 1U9JA 4YK7A 1VE5A 1KPIA 3A6FA 4G24A 1N77A 4GBGA 5C7YA 3K8QA 3D3KA 4KQMA 5DHAA 2FFAA 1X1EA 5K3FA 2KQUA 4MQFA 4YR9A 4CPDA 4C6HA 3LH5A 1ZVMA 1VYHA 1RWVA 3E82A 4NZ9A 1Y9DA 3UGKA 1GSIA 5EUQB 4WA8A 1YZHA 1ECJA 4I5EA 4BMYA 1ZAKA 3JYNA 3M81A 4YX9A 3V4LA 2QZJA 2FPIB 2IZOA 4DL2A 3IQDB 4C7VA 3E61A 2ARKA 4A1OA 3NHAA 3LCRA 2UZ1A 5BWUA 4D25A 1GAEO 4DVJA 4R1QA 4O7WA 3GELA 1DKLA 1E4VA 2VBIA 2QWXA 1NRXA 3N0RA 2PT6A 2DPYA 5ES4B 3LKZA 1JA0A 1UAGA 4RSMA 2YY6A 3S27A 2WP0A 4LJ4A 1I0ZA 4F50A 5KMGB 4V0MA 2Z9CA 4IIJA 1RR6A 4L7VA 4CDMA 4D45A 4MV0A 2ZT7A 1XD2A 2Y0DA 3DBVO 2AA3A 4GP9A 4CUJA 2FDXA 5HQJA 2AHRA 1TWGA 2Z6UA 1NUUA 4RVSA 4I5IA 1O6CA 2OP1A 5BWXA 3D3WA 5B1SA 3I09A 1OILA 5FUBA 3KT8A 1GLGA 4EGQA 4A91A 3KSDO 2AW5A 1Z6TA 5ALMA 1NP7A 1HRKA 1RKBA 4HYKA 2EVWX 4XUCA 3URKA 2HQ1A 1JV2B 3E58A 2LTAA 1PKXA 3IODA 1C7RA 5C7OO 1FU7A 4QO7A 2H4XA 1D1PA 3MTEA 3GQBA 2WUVA 3NGLA 1CUYA 3B1KA 4E6PA 2YOHA 4RQTA 3IOMA 4R7GA 3VSBA 5KWEA 4RE5A 2ZCUA 3ISTA 2OBXA 3PB3A 3L7YA 4C0JA 5DAAA 2C2WA 3I34X 3A4LA 4MW2A 4MJLA 4FGLA 4RIEA 4KDCA 1Z82A 5FD5A 2IIPA 2ZBGA 4K1LA 1ZLYA 2ZE7A 1FP4B 3R0IA 2Z4RA 4PBCA 5DM60 4XTRA 3LWNA 3JVUA 2YJ4A 5GGXA 1H3EA 3FUCA 5JCJA 2OD9A 4MR7B 3U4MA 3CH4B 3F9IA 2V0NA 2GEBA 5MN4A 5FF9A 2CN1A 2QRUA 3NG1A 5L3RA 2P41A 3BWEA 1TZBA 2PKEA 2QTAA 1P62B 3GRUA 3IT2A 3AP2A 1YO6A 2BP7B 2WF5A 1N2BA 4MUFA 4MGYR 1TJ3A 5IJAA 5JY1A 5GPBA 1Z4NA 5M04A 2ZULA 4IIJF 1UZLA 3LW8A 1FYWA 3ACCA 2ZBQA 3MJTA 5AXBA 4D6XA 2Q0HA 5BSVA 2HT6A 3SHFA 2EGGA 2JBAA 1YGYA 1K88A 4O8CA 4LOJA 5KX5A 2C20A 3MOIA 3WX0A 4P7GA 3ANYB 3CQZA 3SCZA 5DIFA 4QPCA 1CQIA 4CF3A 1NJ8A 2CVOA 1X87A 3RBVA 1JXAA 3A6KA 3IPYA 2R00C 2YR0A 3ZHXA 4F6CA 3PNSA 5IT5A 2VI5A 4PXYA 3EX7C 1ISJA 1PWYE 4Z8YA 2V65A 3ANSA 3HRHA 3WSTA 4JROA 2XT6A 3JARB 2FW8A 3I28A 3CVYA 1F20A 4LYYA 1NR1A 1WUYA 1YDGA 3BH0A 4TTIA 3HEAA 1ZJYA 4OJYA 3EFHA 1VFNA 3F8WA 2CJWA 4JKIA 4FE7A 3O74A 1JG7A 2XXBA 3E3MA 3O1HB 3TRKA 4YGXB 1U7DA 5FDFA 1B8OA 2AOUB 3T41A 1SURA 4KBYA 4B3JA 3PJEA 3SQMA 5EIEA 4LFBB 4OB6A 4UC0A 1TYBE 1SOMA 3CEBA 4WFKA 4PM4A 3ECAA 4D0RA 5IVKA 4PGFA 4KXXA 4QEKA 1NMYA 5THQA 2LPMA 2R1TA 1KORA 2EGHA 1XZLA 3VNSA 3ITKA 4U39A 1SYXB 5IJ9A 3ZV5A 1XFDA 3NPMA 1XTBA 3PK0A 1YI0A 3OJXA 5A02A 3CNOA 1G5IA 1ZVJA 5FADA 4YRIA 5JDIC 3VKGA 4NV3A 3EEQA 5HDQA 4D0SA 1T8PA 2V7PA 4PO9A 1U0BB 3MINA 3CY6A 1JJ7A 1QVRA 1TEXA 4QXRA 5FRDA 4FEEA 2GF0A 4HYEA 4MPRA 4JI1B 3DVSX 3HUEA 3LX6A 3FY4A 2R7LA 2X4IA 2IYRA 1CLUA 1UODA 4GR9A 1US8A 3TEFA 3P97A 4B87A 5JARA 2QIPA 3SJBA 3SU8A 4Z4FA 3ODPA 5KAMA 4OBBA 4RLSA 1GYQA 5KFYA 1T36A 3M6FA 3HVJA 2ANBA 1L5WA 3G2IA 4MYSA 5ED4A 5BXYA 1T34A 1EWQA 2UUPA 2GPSA 3T0GA 4M8NE 3OLCX 5BMVB 3PFGA 4Q18A 1F17A 3K09A 5TB5A 2F4VH 1YFKA 4RVCA 2ZAIA