2FPGB

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 123
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fpgB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fpgB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgB03
4I50F 2R7LA 3JRXA 4O81A 3KAKA 1CQIA 2DWCA 4MV8A 4ZOLF 1I7NA 3E5NA 1CS0A 2GLTA 2DLNA 4YBZA 2R84A 5C1PA 4HR7A 3U9SA 3G8DA 1C30A 3KALA 1BXRA 2Z04A 4O83A 5JQWA 3HO8A 3AX6A 2V58A 4MV7A 4O86A 4WBNF 3VPBA 2YW2A 1Z2NX 1KJJA 5HV6A 2W6NA 1GSOA 4MAMA 2GPSA 3WO0A 4O7SA 5EZYF 2HGSA 3JZIA 1SCUB 4O4LF 2V59A 4I55F 4DLKA 2VR1A 2XCLA 3Q1KA 4YB8A 2FPPA 2NU7A 2DZDA 1KBLA 3K5HA 4EG0A 1VBGA 1BNCA 2FPPB 2NU7B 2YRXA 4RZQA 3RFCA 4HNTA 3OUUA 4FE2A 5DMXA 1GGOA 1VKZA 4XZ3A 1EZ1A 1SCUA 4MV6A 2Z02A 4IWYA 1IOVA 1OBGA 2OLSA 2YZLA 2ZDQA 5LOVF 4ZQIA 1UC9A 5JQGF 4NYEA 5LYJF 2NUAA 4IIJF 1EYZA 1JKJA 2CQYA 1JDBB 4YBZB 1JLLA 2FP4A 2C00A 4O7RA 3HB9A 2CNQA 2QK4A 3LWBA 2R85A 5LA6F 2FPIA 4O4HF 1CQIB 1M0TA 2HJWA 3K5IA 1KJ8A 1GSHA 4MA0A 2NU6A 3NUAA 4O7WA 1WR2A 2R86A 1I7LA 3BG5A 1T36A 4C5CA 2I87A 2GQSA 2YZGA 2IP4A 2PBZA 4YAKB 1EUDA 2SCUA 1CQJA 4YAJB 3ETJA 4O4JF 1M6VA 2R6FA 1Z2PX 4ZHQF 5LP6F 3PFFA 3HBLA 2NU9A 3R5FA 5LXTF 3DMYA 3WO1A 2R7NA 1EUCB 4O7TA 1JDEA 2YZMA 4ZI7F 3VOTA 2R82A 3TIGA 3UFXB 2ZDGA 2YV2A 1KJIA 1VBHA 1AUXA 4O2AF 1A9XA 2YL2A 3V4SA 1PX2A 4FFMA 5J2TF 3R5HA 1KJQA 1AUVA 4O7ZA 4L1KA 1C3OA 4FFPA 5CAEA 1E4EA 2YS6A 5K2MA 5BPFA 3MWEB 4FFRA 2FPGB 5FNVF 1W96A 4O4IF 4XYMA 5BMVF 2X0SA 1CE8A 2PVPA 5C8YF 3MWDA 1PK8A 2PN1A 3V4ZA 3GLKA 2YZNA 3RV3A 3TINA 1DV1A 4O7YA 2W70A 3TW6A 4M9UA 2R7KA 2YRWA 4O2BF 2DIKA 1UC8A 4IHJF 1M0WA 5HBRA 4XYMB 5D8DA 4HQ6A 2NU8B 2P0AA 2FPGA 4YJ3F 2VPQA 4FFNA 2CNUA 4XYLB 4HNUA 4XX0B 2GPWA 2YWVA 4Y8VA 5BPHA 5HBRB 5CA1F 2YV1A 4WD3A 1DIKA 3VMMA 3KREA 4DIMA 2GQRA 2WYOA 4TUYF 3ORQA 4O7VA 2YYAA 3VPCA 4MV4A 3MWDB 1ULZA 1GLVA 4FU0A 1Z2OX 4Y8VB 3AW8A 5KX5F 1KUTA 5CAEB 2W6QA 5GONF 2NU8A 4YJ2F 4O84A 2V5AA 4O82A 1CQJB 4O7LA 4YAKA 2CSUA 3I12A 2FB9A 1B6RA 5CB4F 3WNZA 1W93A 3U55A 4MV9A 1EHIA 3VA7A 2ZDHA 1DV2A 4I4TF 1KEEA 4E4TA 3GIDA 4XX0A 4MV3A 3MJFA 4XYLA 3MWEA 1E4EB 2NU9B 1GSAA 2VQDA 1IOWA 5I47A 4YAJA 1OI7A 2SCUB 3LP8A 4FGRA 1B6SA 5C1OA 3G8CA 1KJ9A 2W71A 4MV1A 3R23A 5JVDF 2W6MA 4TV9F 3ETHA 2NU6B 3JRWA 3ORRA 4IWXA 3K3PA 5J2UF 2J9GA 3R9RA 3Q2OA 5H80A 2I80A 5CA0F 3DF7A 3KAJA 4XZ3B 2FP4B 3JZFA 3RV4A 2W6ZA 2I8CA 3R5XA 2NUAB 4C5BA 5JH7F 2R87A 4MA5A 3N6RA 4FFOA 3TQTA 5IYZF 4EGQA 3UFXA 4C5AA 2FPIB 3N8DA 3U54A 1KC7A 3QFFA 1EUCA 4TV8F 4HNVA 3SE7A 5KKNB 2W6PA 2YS7A 2XD4A 1JLLB 2CZGA 3U9TA 4ME6A 1JKJB 2R7MA 4QSHA 1EUDB 4IZOA 3RUPA 3VPDA 3TIIA 4EGJA 2QF7A 4YB8B 4FFLA 4O7NA 2CNVA 2W6OA 3OUZA 5JVLA 1OBDA 1A48A
chains in the Genus database with same CATH superfamily
4L2IA 3H04A 3KYDA 1VI5A 3A0RB 2Q9CA 3AHHA 3O73A 4L9WA 4D42A 3GDWA 3GEPA 5JD3A 4KPEC 4G5FA 1Z4NA 2CXNA 2G5CA 2QXTA 4MK4A 1H2EA 2A1HA 1DKOA 1HDZA 1C0LA 2P9FA 1VJCA 4PVDA 1OFGA 1VBMA 1U8EA 3DBLB 4G3IA 4ZA2A 1JF8A 2Z83A 3ED5A 4UASA 4GW3A 3RS7A 2A30A 5LNK6 4RD4A 5HOQA 1XTTA 1S3IA 3E5NA 3AQIA 2Q6LA 4PN3A 1ID1A 5KJ6A 4HPWA 4QREA 3H3JA 1AJEA 2BN4A 5K8VA 1SMKA 2KX7A 4H16A 1NUHA 1B8PA 1SKAA 4A0GA 2CSXA 1VJDA 3IAFA 4A2CA 1CBUA 1F0YA 1B76A 1IAQA 1T2NA 3GLIE 1JR3D 4QFBA 4LTDA 4R7TA 3KTAB 4MR8B 4EWLA 1IWBB 1MABB 1FC0A 1Q1QA 4MGIR 4ITRC 4WJLA 3SLKA 4HGPA 4ZZ1A 3RJTA 1YS1X 2A5LA 2IU0A 1IE3A 3H18A 3AJEA 1BQ3A 2I6TA 2V6GA 4MI3A 5CT6A 5I4CA 1I94H 2JGEA 3OTWA 1CWUA 3VHQA 4BEJA 2VO1A 3RJ9A 5E6SB 1NUSA 5I8ZA 2QAIA 3I9LA 2IU4A 1OBFO 1DKUA 1U3CA 4DSNA 5LU8A 1XWFA 3KYCB 4J7AA 1UMDA 5FUYA 4AYBE 1I6LA 3IVRA 4D0GA 4ARZA 3HEAA 3DLHA 2R7ZG 1E59A 1NR1A 2FFAA 1SYXB 2GCNA 2I3ZA 2QVYX 2C82A 3EPPA 1KJJA 1NQTA 2AS0A 2IRWA 3WE7A 2BF4A 4ZARA 1YZVA 1QS0A 3WKDA 3GPIA 4G65A 4CV2A 3KVYA 3LH5A 3HDYA 4QA9A 4TVOA 4QJ3A 2XAAA 5TMPA 1ONPA 3IESA 1O58A 4NDAA 2I22A 5C7YA 3UZBA 4FKBA 3GQBB 1I3MA 1PFGA 3EBOA 3GA5A 3KC2A 4UTPA 4RE6A 5ARBA 1N36B 4IM7A 4DR1B 3FWPA 1ODJA 3OF3A 1RRCA 1FP2A 4H15A 3PTLA 4TVKA 5KFDA 5L6MB 3CF4G 1KBLA 1RK6A 3NB0A 3L84A 2PKWA 4IUCS 1XZFA 3KZVA 3EQZA 4BJ6A 5BWBA 1Q0TA 2HIAA 1KMHB 4O29A 1IYZA 1ZNYA 5ALLA 3T5DA 2O54A 1ZPDA 2QRGA 1GGHA 4FYVA 3AGPA 5C37A 1HNWB 2JLCA 2YQZA 3MVEA 1FDRA 1I32A 1YE5A 2GHQA 4M7RA 1K89A 2C83A 4B4UA 5I9LA 4UHKA 1QBGA 3ICQB 4BPBA 4NDNE 4RFVA 4BJ1A 2ZZMA 5KFXA 4P9NA 1VGQA 4BGUA 3FGOA 1ULAA 3O4RA 1WRBA 1HE2A 3OKPA 3GUYA 3KT8A 4ZRMA 3UK1A 5EE9A 5DFAA 3OLYA 3OZGA 3OCCA 4J0FA 2GNAA 2PD3A 2RGNC 1X7ZB 2IYWA 3R75A 2ID9A 5LYYA 1QAOA 3NWPA 1HT1E 2ZROA 1C7IA 4D3YA 2PGLA 2QRLA 2QKYA 2IHTA 4RVSA 2WYIA 5DG8A 3QU9A 2CDRA 3PQ7A 3TB4A 3GLGB 2OGZA 5JQGF 3F1KA 4EYKA 1SQ0A 2QD3A 4CXMA 2QRPA 3HR8A 1QRAA 2WM3A 2LNDA 3GROA 4MUGA 4B74A 3HI4A 3Q3EA 1DARA 3IP8A 1CQPA 1XRRA 4L4ZA 3JQ8B 4ZI7A 3FLMA 4QVGA 3ZWNA 4E2ZA 4ZICA 2DLDA 5J4HA 3Q3HA 2ZJTA 2XDAA 4HLUA 4KEAA 1WXGA 2QV7A 4WIAA 4E94A 4ZVRA 3MAJA 4PIPA 5BYJA 2IPAB 1JKJA 1QPGA 5CFLA 4RMIA 3DBIA 2E82A 4YBZB 3BXHA 1LV7A 1AGXA 3CF6R 4P08A 4U9UA 3M6MD 1KETA 5G0VA 2GAOA 3CNOA 4KSYA 1I2LA 4O7RA 5LA6A 2V0GA 4TTRA 3RR5A 2DUNA 5AOBA 1PV1A 4BMOB 1PS9A 2IOFK 3V7FA 1XMQB 1EM6A 1JKFA 1FLNA 3CSDA 3I83A 2D13A 4TWIA 3W5AA 3T3DA 4WOPA 4HLQB 1RLJA 1NRJB 1Y4UA 1ZNXA 3DEAA 3DKKA 3E15A 3HEBA 3UYLA 1BVRA 1J56A 1GPLA 1WSCA 3EC7A 1RXCA 4BLPA 1GADO 4UBNA 5L4SA 2XUOA 3ZTWA 4AZVA 5BUZA 1YFJA 5EG5A 5E9AA 2CLIB 3AHDA 4RSRA 1VDZA 4GX0A 4UD6A 2NU6A 2RK4A 4CKBB 1J6UA 4JY7A 2WIBA 5IWAH 5BNIA 2ODTX 1OJ7A 4IMPA 1PZXA 1FNSA 3R3VA 3OJFA 3Q1LA 5D01A 4KE6A 2ON6A 1J5EB 4JP2A 3BORA 1Z7EA 4LJLA 2ZWVA 2HWWA 4TTIA 3PW4A 1JP7A 2LR0A 2TMDA 1KYZA 3AETB 3C6XA 4GD3Q 4JVLA 2X40A 5F73A 1MA3A 4IVQA 4N49A 3TNYA 3E18A 4Z4HA 3A3YA 3ESDA 1MIHA 1H2YA 2C29D 5DQHA 1XHEA 4FYXA 4I81A 2W4QA 5B1HA 3SS9X 1KH2A 4X64B 4ARSA 5LVAA 1FUIA 1S1MA 4QDTA 2QLNA 4OLFA 3EVEA 4YO7A 4E3WA 2ZWMA 5KFOA 4KI7A 1D0SA 3PT5A 4TQAA 1TZ2A 2WVHA 1IZYA 4KQIA 3OLXA 1XUOA 2PUJA 4LZAA 3D6VA 1L5HA 4UBJA 1GP2A 1UPBA 3SJ7A 3H75A 4QFMA 5EIFA 1CUBA 5FOVA 1OIWA 2XVAA 1MC1A 2NO1A 4NWIA 1LZLA 2X13A 4P33A 2J0VA 3L4KA 5HIIA 5JH7B 2PUEA 4NF2A 2BFCA 3T61A 4ADSG 1QFZA 3QU5A 4FS8A 1QMPA 1RYYA 3K32A 4ZCLA 1WLSA 4UOEA 5CD9A 3AM3A 1AUXA 2VJQA 3E1GA 5C3EG 2CW5A 4ILKA 2I1VB 2J41A 1E1LA 2Y1CA 1CUVA 1ZSVA 2V7PA 3MOGA 5E4JA 1SD5A 3MGBA 4ZEXA 5A4AA 3EEIA 4GYWA 3WMXA 2Y1OA 2FSPA 3V2HA 2ZR8A 5CTJA 3E53A 1CQXA 4OI1A 5HIMA 5I5GA 3C7DB 4KBYA 5G0WA 1MT3A 1ZUWA 1GKUB 5THXA 1Z4PX 2HF7A 2WP8J 3I39X 3N40P 5JC1A 4CIVA 4PQEA 3QWHA 3MTAA 3PKIA 2KS6A 3QWUA 1C9EA 5I5XA 4DQDA 2ZTVA 2E4VA 2FSIA 5JAHA 2VHTA 1RPNA 1A5AB 1QJ4A 2X6QA 4FYYA 1DCMA 4CETA 4AJHA 3FKIG 2XVYA 3DEJA 3U2QA 3B3GA 3K6KA 4BKMA 5JMPA 1V4YA 4RB3C 3MWEB 2EU8A 2OHJA 2VRCD 3PK0A 2AJDA 4MIOA 2I4MA 2JI4A 1ZJJA 3UV7A 3HGMA 3IT3A 4FLFA 1WW3A 1P74A 1JDNA 1KY2A 4E5YA 4IPTA 2P9QA 3CKYA 1TI7A 3NHWA 5A06A 4LK2A 3UK0A 5SYMA 621PA 4LF7H 1UBKS 5DHAA 4ZDWA 3RFXA 3A6JA 1NMXA 3V4ZA 2VSFA 3W5JA 3S2FA 2OD9A 3WZ2A 1BEZA 1HLDA 5IMBA 3FPGA 1GYQA 5AK6A 4QDJA 4LOLA 5ALPA 4QIWE 1XTBA 5I7AA 2I1QA 4XGRA 4K05A 2W9CB 3CSSA 1R4ZA 3I76A 5LQKA 5JS1A 2RI0A 4WI1A 2AOTA 3NCTA 3U09A 3ZJTA 4MCHA 2O3RA 2QRZA 1C7QA 1J2RA 3IEXA 4E2XA 4IXDA 3QLVA 4Z0PA 5JO9A 5E2AA 4BNXA 2VT6A 3PYXA 2HA5A 4TGLA 4AJ9A 2DPGA 2PY6A 2OXEA 2H2IA 1EMDA 1XNQH 4Q7KA 5C1BA 2V1UA 4Q9NA 5LM3A 2J07A 5AM5A 2IKSA 3K0BA 1MGPA 3HCFA 4NZOA 1F8FA 2V65A 3W5BA 4A92A 3I6BA 1IYEA 2E4ZA 1R5OA 4L50A 3ZDRA 2I66A 2P67A 4RIGA 2VL7A 4RQTA 1YKFA 5A0VA 2CNUA 1W30A 3ZH2A 4C7MA 3KK0A 5CNIA 3WHIA 2ZJ5A 5LNK1 4HYYA 5LL6P 3FWKA 5DHQA 1WA5A 2DHCA 1YBVA 4HNAB 4NBVA 2BMAA 4MS1B 4XTCS 3ZI4A 3WLAA 4RJJA 4XSGA 5HBRB 1BMTA 1ES9A 3IULA 2V4MA 4PW0A 4B3RH 1M72A 1JZTA 2HK7A 2PT6A 3ESZA 4CM3A 4QT0A 3BN3A 1NVWQ 3ESAA 5ES4B 5IC4A 3PPVA 4U2GA 2V6JA 1UL1X 5I5UA 3RTDA 5AYVA 3ABSB 2QM8A 5L7YA 3O83A 1SUSA 1M2NA 1Z6TA 4RHXA 1IPFA 1MDBA 3EZLA 4UVHA 2ZB3A 1DLIA 3NYQA 3U37A 3TLMA 1SBTA 4J3JA 1Z6QA 4UCRA 1IZ9A 5WRFA 3L8HA 2P5SA 4MRAA 2QORA 2WIDA 1KAHA 1SD2A 5DTJA 4CQMB 2Q5IA 5GOZA 2BFBA 3U3DA 1XTIA 3IOMA 3V9PA 3CLUC 2EATA 1PYDA 5J47A 4OIMA 3KR9A 4KQGA 1Y33E 1T1RA 5A9SB 4DV3H 1FFEA 3HKEB 5TXGA 3RRJA 3M4NA 5HA5A 5K3SA 1JILA 1HT0A 3AR8A 3Q7IA 1M34E 3N0VA 3B9PA 1YZQA 4KGXA 2WJIA 3S0JA 5GADl 2AZ4A 3SF0A 4O3QA 1Y1SA 2J7PD 3AW8A 3TXAA 4U7GA 4DLXA 2AVDA 1KUTA 4K46A 1DZ3A 2A58A 1X80A 4L16A 2O2CA 1NQ5A 2UYOA 2JJQA 1R0XA 2ZU6A 2LE0A 3L8EA 5FUVA 2DBYA 4EELA 2O0HA 2ZVQX 3DTYA 3H40A 3CWCA 2PZGA 1H2FA 4CMEC 3FCCA 4NCNA 2IHUA 3L7LA 4UNIA 4B9AA 2XKBA 3ROFA 121PA 1CQZA 1DLJA 2ODPA 2CT8A 3L6OO 3IP1A 3QIVA 4MW1A 1UFOA 5JW6A 3GRAA 3PFNA 3KDPA 4JLNA 1U7TA 4QZVA 2VJKA 1OVGA 5FPRA 4E07A 3GNQA 4ND4A 4S04A 1WP9A 3GZNA 1B6RA 1KY4A 2P6PA 4OB8A 1OH6A 4Q8EA 1TW2A 1ZD8A 1JS1X 3K92A 4M1EA 3CS3A 3O82A 1ZQ7A 3E5HA 3I4LA 4N48A 2KHZA 2B20A 2VP4A 1YBHA 2M1XA 5B7QA 3EB9A 2PZ8A 2ZJYA 3UANA 2HWYA 1G3MA 3MMNA 1ISMA 4L6IA 4PINA 1ISJA 4K2AA 1VPWA 4KR6A 4C30A 1BU5A 4BKRA 2R8EA 1C7JA 4YCBA 1WL8A 2AH5A 2H11A 1VKNA 1C9MA 3OQHA 5CH5A 3NIGB 4F4DA 5HHTA 3GFOA 2ZU0C 3ADBA 1YR9A 3JWGA 4IH9A 4CC6A 1U3GA 1PIWA 3P9PA 2JEJA 2SKEA 4DRYA 4ZOLB 2UXBB 4J4TA 4J4BA 3WKCA 3D3EA 1A7JA 1E6UA 1RPZA 1NG9A 1U9IA 3ZWMA 2GNOA 2NOAA 1UF9A 3H16A 1P80A 3KVRA 4EPTA 1Q6YA 3QXCA 3QNUA 2C2ZA 4UCTA 1PBTA 3NTVA 2EBFX 1H2ZA 2PS3A 1N32B 1E3WB 3LGXA 2BZSA 3JAMW 4X1IB 1FFGA 1IQPA 4LFBB 1CVRA 1PTKA 1PZHA 1O6CA 1XXLA 2D2IA 3F49S 3R24A 5M2QA 4FMDF 4UU0A 4YX9A 2PX3A 2WC1A 5CP8A 4X6UA 1J9EA 2JGMA 2DP4E 2BSAA 5A2QW 4OAPA 3RRXA 1DOHA 1T3TA 4GZ6A 2IYFA 4O4IA 4UBOA 3JRWA 4DW8A 2X5RA 3MUEA 5EIOA 2BDTA 5ITZA 1W5AA 5IEBA 4GYKA 2EJ0A 2DPJA 2TMGA 2R8YA 2XMRA 2VSYA 3AESA 3AWIA 4M0LA 1QHNA 3VH4A 4BMZA 4AMZA 1QC5B 4PC1A 2QN6A 1TWFA 1PE0A 1IMJA 3MWFA 4XQEA 4F1JA 5JY1A 3DEKA 4KFRA 5L3ZA 4EG5A 3HKZA 1Z47A 5JXIA 2Z43A 4DV4B 1UBRS 2FJZA 2FPSA 4M83A 3GG9A 2X0DA 4D9JA 2Q2WA 1I1NA 1N7JA 2GM5A 3QHPA 3SYNA 4DMCA 1ORRA 3GEIA 4RU1A 2FMFA 2P6MA 3WKAA 2QQ0A 3UGTA 4ZAFA 3KSBC 4RKWA 3KO8A 5DX1A 4A1OA 1EB9A 1MPXA 1I5RA 1RWQA 3PVXA 5FBVB 5EUMA 1V7ZA 5D7NA 3AOGA 4JYCA 3NC4A 3QOWA 4JUCA 5FWXB 2IITA 3ZIUA 2I91A 3AHGA 2WUEA 1TUIA 2HI0A 4TQ9A 2IS4A 3T5PA 1Y89A 4MPPA 4DV6H 1M1YE 4LVCA 1QGUB 2FF7A 2R8KA 5FB3A 3GL9A 2R93A 4JYAB 3FI9A 2AJTA 4JENA 3FVRA 3T34A 2FLKA 4C21A 1TMOA 2PTGA 3T52A 3UXEA 3RRBA 3DS8A 3EGXB 5CTAA 3CN7A 3WJ2A 2YHIB 2LVBA 3E70C 4B8WA 2GFIA 2P9ZA 4RWEA 2J3JA 2OT3B 2QNBA 2NN3C 1VRCA 1EXMA 2ZRPA 3AUXA 1VS0A 1XZMA 1S97A 4O3OA 1QGED 5BUCA 2FE4A 3AF6A 1J5XA 1J70A 2BM9A 2ZUCA 4WOJA 5CB0A 3ROMA 2Q3EA 1W0KA 2IVFA 3NDPA 3Q3GE 2WAQA 4JL8A 4ZANA 2R8GA 4EP1A 4X62B 1RJDA 5IX8A 2TS1A 4TMFA 4FJ1A 3KB8A 421PA 4C4XA 3BQ0A 4RHUA 4AG3A 3RK0A 4UVDA 4TKLA 2NVUA 2V7GA 2RB4A 2HQOA 1FFWA 1GL9B 1OASA 5B2ZA 4LRQA 5EIEA 2LD4A 1G41A 3BDIA 4LUCA 5FLXA 3N76A 4H3KB 5TE9A 1IZ0A 3H9GA 1N33H 2IY9A 4JYMA 4X54A 4EGJA 2CDNA 2TMYA 2QF7A 1VE3A 1XFDA 4KN8A 4OQYA 1KPHA 1A5SB 2G0TA 1DJOA 4NAHA 1GT6A 4ECRA 2ONZA 2PMWB 3D3WA 3DONA 1R27A 3FZEA 4BEWA 2IS1A 3OUZA 2AJBA 3C5HA 3M34A 2GI4A 2JB9A 2Y99A 2IPMA 1HZZC 2CUTA 1LSOA 3FF4A 4JCOA 3LKZA 4N3NA 4B73A 4QOHA 4AQYB 1XDBA 3D4PA 4OH1A 5ALUA 5HCNA 2OCKA 4BMCA 3K0FA 4GKAA 1BFKA 2O9JA 4HAYA 4MQ6A 2ZGIA 4X1KB 4HRAA 5E1MA 2H4YA 4MWEA 3P71T 4DVJA 2I2BA 3E84A 3EXHB 1MENA 1QF7A 4FFWA 3FUXA 2VYND 4DV2H 2QTAA 3A1CA 2Y66A 5T8KA 4MUNA 2PCLA 2ONJA 2QW8A 4JODA 2WY2D 2L2QA 4IIEA 5ER9A 1TQ6A 3A1NA 4WK2B 1YGYA 4IEFB 1K3FA 3LPDA 2Y76A 4EJFA 2W43A 4I6EA 4W8HA 3UYYA 1ZK1A 4JV5H 2AFHA 2JIZD 4J0JA 4Y1GA 5EWLA 2IXAA 4FYIA 4HFRA 1ZIPA 4AQYH 3TSYA 2J5RA 1ADFA 3U31A 1Q3KA 1U0EA 4D4JA 1KKLA 4OQ4A 2JW5A 1FLDA 4U3JA 2PH3A 5CT4A 4C9BA 1ATZA 3IYLW 3NPMA 4Q3BA 5JRZA 5IAJA 2ZWAA 4KFSA 5G4KA 3TTXA 4CT4B 3ST7A 4TV9B 3PNVA 5CCBA 3NWEA 2Q3FA 4KBFA 4YR3A 2E6UX 2QUAA 3TRKA 4AL4A 4CV3A 1N33B 4KQJA 2HBQA 3QJYA 3QOFA 4WPGA 1OYWA 4ZT5A 1AG9A 3TTYA 3LCVB 2JHAA 3UC5A 1JL3A 3ZUPA 4WT7A 1K6JA 1U0OC 2Q9BA 2QROA 4YJGB 2PZJA 1ABBA 1JJBA 2B21A 4DV1B 5T67A 2AYZA 1QKIA 4U6PA 2QVGA 4NCXA 7YASA 3FAKA 1BMQA 1P1JA 5HQ3B 2YH2A 1MZBA 1ZGAA 3AB8A 3PQ3A 1EGAA 4QNRA 5ALIA 3ROEA 3TY5A 5LP6B 1LX6A 3VYVA 3QMWA 5FWDA 5H4HA 2OQIA 1BJTA 3DKPA 1PZEA 2NTNA 2IH2A 1AN7A 1KO1A 2PS9A 4Z99A 3R41A 3GAMA 1KZ4A 1O4VA 1S0UA 5ALKA 2G88A 4H77A 3ODGA 3VHLB 3ZDQA 5IT5A 4PHTA 2CHUA 1IN8A 2OM2A 3G13A 4URUR 2WTMA 3MBOA 4D3SA 1U8YA 2GD2A 2GK7A 3TR5A 1AO0A 4O4LF 1Y34E 4YYZA 2RK6A 2FP3A 2DT5A 2GD0A 1GG8A 4HPJB 4IDFA 3UFBA 1FTYA 2P2ZA 5BQPA 2XCLA 3ZBQA 4BFSA 4IUBS 1G9TA 3GU3A 5JLAA 1QO7A 4ECYA 4YNBA 1L7OA 4KFCA 3I4MG 3K94A 1U81A 2R2GA 1V9CA 2XNCA 4AICA 2XC9A 4J7XA 3QITA 2VAPA 4M0EA 4E51A 1GV1A 1X7XA 1EIZA 3EGOA 3BQMB 3Q3VA 4DV6B 1EXVA 5JJIA 3WK4A 1CJSA 2HA2A 3NRJA 1EE1A 1FVFA 3HACA 4FHZA 4MR7A 5KNDA 1N2ZA 1KJYA 4ZK2A 4RCZA 4IV0A 3NNNA 1EDBA 2RH5A 3VMFA 3LXUX 4I4IA 3WL3A 3DCIA 1AQNA 2AIRA 4TM7A 3J81k 3AIOA 2O0KA 4RH0A 2IUUA 4B6EA 1RXSA 2QPLA 4LMBA 4ZGGA 2VJOA 3N8HA 4UDXX 5I5YA 1JPUA 1P0MA 1ZD1A 2I3GA 2W2NA 3A11A 4RIHA 3VZRA 4FUTA 4EATA 3L9XA 4JJZA 1NZFA 1SVKA 3GDGA 4XEHA 4CMHA 1N5JA 4BBAA 1PJZA 1P0CA 3SEQA 1IOVA 1WBBA 1FNBA 3FKSA 3TK1A 1JXLA 1EA5A 3NIDB 5FNVB 4BGEA 1PD0A 4D9GA 1MF7A 2BMJA 1QQAA 3DAFA 1P73A 2O05A 1S4QA 5E2IA 1L1FA 4FX5A 1MAUA 1OF1A 1T0JB 4CI0B 1GT91 3P9KA 2OV6A 3R0XA 2RDJA 2POQX 5DO9A 3I5UA 3IBCA 4QXQA 3HJHA 2JFZA 4QPZA 4A3GG 1SUCA 2VA2A 5FWYA 1E2UA 1JQAA 3DC2A 4YGYA 1MW8X 2P3SA 3PHCA 4PGAA 1GPDG 4P3OA 3UQZA 4F2PA 1K7CA 2IYPA 5CYOA 5JJBA 4CF4A 1MCZA 2Q5QA 3TNLA 4A0QA 2KBEA 1A9TA 4DQ0A 4R9VA 4G36A 3ESQA 3A1FA 3V4LA 4G5XA 5J4VA 2MSWA 1Y8ZA 3G79A 5DTEA 5EXTA 3ABIA 1O3YA 4JH0A 2CNQA 4DNFA 5EQJB 2VBCA 3B51X 1KEEB 4DN6A 2EQBA 2WTBA 3QZ7A 1G66A 4UHHA 4QUJA 2V96A 3ZGZA 4I14A 5AKLA 3GIQA 2V1XA 3WRWA 3LLUA 1FMFA 2W00A 3I2FA 2A5FA 3O9MA 2QUKA 2P90A 3AY3A 3BHMA 3BHIA 3I72A 4P54A 4ZAZA 1U31A 4BTEA 5IRCD 4IV5A 1WKBA 2HB6A 2ZJ1A 3H84A 4RZHA 4OJNA 5BMVA 1QKJA 3BCRA 2D6FA 1BROA 3ZQUA 3J80A 3QUTA 1DRWA 1AGPA 1LLQA 2UXDH 2JAXA 3EMBA 1R8JA 3KV1A 2KJQA 2DX7A 3I9MA 2R96A 5LQRA 1T36A 2QMZA 1W7AA 4EFLA 3X44A 4MWTA 2YMMA 4FFDA 4F6CA 6REQB 4DL7A 1SUAA 1RHKA 1WSWA 3TGWA 5IAAA 2IP4A 1MJGA 2CXUA 2HGZA 4JYBA 2GN4A 3SM9A 4YXWD 1X7HA 4R8VA 2R6JA 3V2UA 5I4IA 4P5PA 5ANRB 2VNKA 1A9SA 2J5KA 4LOIA 1W0KD 2HA3A 1VMEA 4ZAWA 1I2KA 5CVDA 1E20A 5T8KC 1WJGA 1BRMA 1EXWA 3DZIA 5L40A 1YBMA 4IIHA 2HIGA 2QMHA 2WDZA 2YDYA 1K1EA 3TVYA 3ZHRA 2MYPA 1BSVA 3LLSA 3GLFA 4BUJA 1IJKA 1T29A 1UT6A 4QFDA 2YZMA 4EKEA 1JHXA 2F59A 1R6UA 1NLUA 2FEPA 3IR5A 4P3YA 4AJEA 3BFXA 1V11B 1BTOA 2Q0SA 1A82A 1K3TA 2XBUA 3R8CA 5KFRA 4BJ3A 1M9NA 4PZEA 1V9PA 4KMSA 3MTIA 5KC9A 2YR0A 1W36C 3BE4A 2XCTB 4M1KA 3EASA 3H9UA 1UBGA 4GECA 1NBMD 1M1UA 3R0JA 2RIPA 4LNUA 1IYDA 3PXXA 1AXRA 3GGSA 4HFNA 1JV2B 1ZNWA 3UWKA 3Q85A 2BCEA 3LY8A 3NXKA 3X0DA 4F46A 4ZCRA 2B7BA 3D6UA 5ARDA 4YRQA 2HX1A 2A1TR 3LT5A 3OPYI 4DLSA 1THGA 3KLOA 3T3NA 3LUGA 1U28C 3L8FA 3S5JA 1HT3A 1OWTA 4EIWA 1RJ9A 3HYTA 4P5EA 3MD9A 1AUVA 2OZLA 4FI3F 2FX3A 3X1KA 1G2WA 2JGLA 3OG9A 4F4JA 4LJ4A 4MJ7A 1A04A 5D3QA 6LDHA 2RG1A 3OOEA 3O75A 2P9HA 4BNUA 4KSCA 4PYLA 2P2GA 5FP0A 3U0BA 1D1PA 4I9UA 5FLEX 3KQYA 3BQ1A 4KTVE 3U4GA 4M9SA 3EQ2A 1BXGB 2ZLBA 3MGAA 5FNVF 4KXQA 2ZBPA 4LMRA 4P8RA 1IL0A 1E1QA 2J0EA 2GPAA 5D1NA 1IONA 1J2TA 4PQYA 3HYLA 3VPGA 5A6SA 1L3IA 4DSZA 1FQWA 2OHGA 3P7MA 2OHVA 4Z86A 4QIWA 1ZVKA 2PD6A 1WZIA 3ABRB 3KYIB 2NT3A 5A9RA 4X65B 5DXJA 1T94A 4B3SB 1DJLA 5FA6A 1O8BA 2YWRA 1EFAA 2WYUA 3JQ9C 4PTLA 5J5CA 1FNNA 3ZDAA 3EC2A 1T3NA 3D6JA 1YVPA 1DV1A 3EAFA 1AM4D 4EYIB 3OZDA 4OBEA 4XJVA 2P5YA 4E5DA 3ZE2B 3G7UA 3WSTA 1VJRA 2VJAA 2G40A 5IU6A 3P2YA 4L9SA 1QDUA 3PV0A 4HDNA 2FOIA 3AMVA 3EDCA 2IIVA 2DAAA 3K1AB 3MNFA 3O8QB 4R7ZA 1JDBC 3DCYA 5DASA 3BWEA 9ATCA 2JVKA 3DQQA 1QSGA 1J24A 1ND6A 1CIPA 1SN7A 1O95A 4G5OA 1FTNA 2OLJA 1U90A 3W6PA 2DQKA 4C7OB 1JFSA 2QAGC 3CLRC 4RGYA 4WWHA 2VPQA 4EUFA 4HZUA 1L7AA 5LMUH 3KJHA 2VLIA 4D4LA 3LLMA 2Z9BA 1M1ZA 1JEDA 2PL3A 2OPBA 4IKEA 2PT5A 2VDNB 4TLEA 4BBZA 4TVSA 2NSJA 2CF6A 3I2HA 3L43A 4S05A 1C3OB 1Y9DA 2QL5A 5LYJA 1RBMA 1FPQA 1AZSC 3JD4A 3BAZA 2C3MA 1W4LA 3MR5A 4I8IA 2K2QB 1JG3A 4Y2YA 1NR5A 4ARCA 2VTKA 1L2ZA 1UJCA 2CC2A 2O48X 3L3BA 4RS4A 3UJ3X 3DE5X 1DIKA 1U8XX 3EN0A 3G0IA 3HB7A 3JQDA 4K0KH 5AKIA 3GIJA 1SIWA 4UAUA 4YXFA 2ZR7A 5JPDA 3TGPA 3THXA 2ZYUX 3ZS8A 4BY7G 2PA0A 1OE0A 1DFIA 3PP8A 5JAZA 5C1IA 4L28A 4MGKR 1VXOA 1YU6A 4B76A 1AN9A 2QT1A 4V03A 3TLAA 1NTRA 4MVJE 4I55B 4RSHA 2EWWA 1BKDR 2GQ0A 3E05A 3LC0A 4GP6A 1THMA 2PMEA 3DF9A 3FMAA 1KI4A 2AW5A 3BJRA 2CB0A 3EYWA 2HF2A 3DQZA 2DTEA 1F8GA 1QG2A 2PJDA 2OH2A 5A6SB 2EFCB 2CL7X 5SV2A 4F3CA 3AR9A 3P0JA 4WLOA 4QJFA 5ELLA 4RTJA 3FFBA 1G2QA 2EJTA 3ZHSA 3F8NA 5C18A 2Q62A 2AX4A 4CQNA 4WL0A 1XNGA 2R00C 3IRVA 4PCUA 3OEHA 3PW0A 4JN6B 5CEJA 3FVTA 4WEQA 2QLMA 2D1YA 4OPMA 1SQFA 3ICOA 3MT8A 2NU8A 4EZIA 4KE7A 4I8XA 4O82A 1DIHA 2ZSAA 3GJ0A 2D00A 4YAKA 4N3GA 3IUBA 1I51A 2NPFA 2VOBA 3H6HA 4Y7CA 4F12A 4I1OA 4XSVA 1RWOA 3L7DA 3NP9A 4FGUA 4F4ZA 5T6MA 3FN4A 1PV2A 4H17A 4R81A 1P7CA 1WXDA 4JB3A 4L8YA 1TLLA 4TMZA 4G5HA 4GMKA 3M6LA 3BA8A 2Y1KA 2H9YA 3CH6A 1YB5A 3S70A 4O59O 2J5BA 4KBGA 2YCLA 2JA6A 4CMEA 1WLYA 3WNZA 5KNCA 4PO8A 2P9GA 3ISVA 4MW9A 4C6RA 3OWHA 2AZMA 3SEFA 2WU8A 5D84A 3PUYA 4DBVO 1SBNE 1TC2A 1T5TA 4BO6A 3HC7A 4MVCA 1ITZA 1VHTA 3L77A 1Y1VG 3DT6A 4MV9A 1A9ZA 3H5WA 4XWGA 4AQDA 4BO2A 1NI4B 2O8DB 2EIYA 1PL8A 5HSGA 1G0NA 1PR9A 3W2TA 5L95A 4V1CA 1UDBA 1WXXA 1Y9JA 2FYTA 2Z4RA 4B6OA 3GLFB 3SVZA 4F4WA 5TQ0B 5B58T 1EH5A 2CNWD 5EA2A 5HE8A 3EXHC 5ESRA 4YAGA 4G86A 2E4WA 1H42A 5JEEA 1SXQA 2NU9B 3GDFA 3OWOA 2JFQA 1IAVA 5KBYA 1Q20A 2R1UA 4Y2GA 4U2BA 5K0BA 2WUFA 4K1LA 1C7FA 2R0QC 4BO9A 3OHSX 1I33A 2BFMA 2VYQA 3PGA1 2H5EA 5TJHA 3U3RA 4DQNA 1HUQA 4J9OA 2OCLA 3D6TB 5LQMA 5MGNA 1WNFA 4PC2A 4D8XA 1DWPA 5ALDA 2VP6A 3I8XA 5A3JA 1IPHA 1GFSA 1XPJA 2W71A 1NZJA 3LNTA 4H7KA 4IIYA 3D5EA 3ET4A 4I3GA 1YS7A 1N6LA 1SUWA 2J8ZA 4P6VF 1NBMA 1U9ZA 2C9ZA 2D0IA 4C0LA 1GTRA 2BEJA 1GV0A 5FPQA 3OC0A 4M0UA 2IZ0A 4MLZA 1PJRA 1OXVA 4KYIB 2GWHA 3GZJA 3UATA 2Q2UA 3I6ZA 3PXDA 2AN5A 4J1NA 2BHTA 2J9FA 3OEED 1MJ5A 5FLMG 3HVIA 4FDLA 1NTOA 2W90A 2O03A 3HOVG 4PC7A 2R8JA 2QVCA 1MHPA 2YJ6A 3UKOA 3W2FA 4DLNA 2YWXA 4BKOA 4RHCA 1CF2O 1J1ZA 5LL6b 1E8MA 4NZ9A 4CR8A 1T5IA 1K08A 3D8HA 2IXTA 3X1ZA 3CVOA 1DEHA 5HM8A 5FO0A 1Z7GA 2OV2A 4L27A 2ZRMA 3FR8A 1DAGA 2ZYIA 1PGPA 3QVKA 3WYGA 2ZYSA 5F64A 3HCAA 3CTMA 3E2IA 2IXDA 3FPFA 5CT5A 1YR6A 3VZPA 2ZBGA 2I8LA 4LQCA 3OI7A 1ECFA 1UBTS 4BC0A 1H94A 3GNTA 1MG0A 4AMBA 4QWEA 3RE1A 3CZRA 3KXYT 3NGDA 3DXYA 4AC9A 4ER3A 3B7PA 3CBQA 1KE1A 2H29A 2C96A 5E6RA 1IPEA 2GAAA 1EFHA 3ON5A 5JAMA 4MW2A 1LBIA 1YDWA 3CUKA 4HH1A 3GTLA 1D4AA 1Y1KE 2ACKA 3LYUA 4G24A 1R66A 4MUXA 4PCVA 2HCTA 2NUPB 4A0SA 3TL3A 4B71A 2FDXA 4CPDA 5F9FA 1U5BB 3OBIA 4ZAYA 4B6SA 4C0AC 4OFWA 2W2KB 5FNVA 4AY4A 4Z2YA 2X0JA 2WIKA 2QAGB 3FUVA 1XLTA 3R7BA 2IEBA 2YDXA 2AF4C 1JA1A 4OHOA 1YZUA 4LSAA 2A9JA 2DWQA 2OV3A 2ZPUA 3HBJA 2PS0A 2YVAA 3HXKA 4X61A 1BJKA 1ZS9A 4NBLA 4R2LA 4YJ3A 3TPFA 4KR2A 1KZ6A 1CRQA 1P77A 5CXXA 2P2CA 3KEGA 3LW7A 3IQFA 3CO0S 1Y4DE 4HEA1 1XCLA 5EE3A 1EVEA 1L9KA 4CBVA 1JFLA 5I8WA 3W8FA 2X58A 2XYPA 1JR3A 4BC1A 3NUQA 3B9BA 2W6PA 2XD4A 1E77A 2I6FA 1UBLS 4FMCF 4DUYH 1PYGA 4M88A 3RNOA 3SHVA 4JJFA 2IHKA 2VF5X 3EZYA 4ZVQA 1F8YA 2X22A 1S9DA 3NTOA 1E58A 5ALXA 3W5VA 5LJIA 2C94A 3HT5A 4QG3A 2B3TA 1IHDA 2JZOA 3MHTA 4IZOA 1OI4A 1JNXX 4LAFA 3JAKA 1ZLYA 1HE1C 2XIQA 3CH5A 3A6FA 2IP2A 4YQYA 2FZEA 2IYSA 2PS1A 3QSGA 3S3TA 4D1YA 4QFCA 4U6QA 3KT6A 5CT9A 2BKVA 3WLIA 2XZDA 3OM8A 4F8EA 1VHLA 4YAOA 3BE8A 1Z6PA 3L0DA 1I4LD 3FMOB 4HK4A 4L9RA 4XOIA 1E2GA 1P7ZA 2O1SA 4I50F 4UU7A 3ZBPA 3TQ1A 3AEQA 5IJ0A 4C0XA 1UIMA 4B6PA 1ZZEA 4FR5A 3EFOA 4H3HB 3T9FA 1JQDA 1KK2A 4MPTA 4JQYA 4N5HX 5HZHA 1B41A 1NG1A 2PYZA 4F2DA 5CFOA 3FWZA 4OYLA 1Y1PA 2QMYA 2UZ0A 2QL9A 3AERB 1XN1A 5A3SA 3S1AB 3NC0B 3RABA 5ALEA 2C54A 3UMBA 2BQRA 2BONA 1C41A 4WEOA 4EGCB 3IKMB 3WICA 5JZMA 3FHTA 1YUMA 5IJ9B 2R84A 1OA0A 1BW9A 1HZJA 1KBQA 3OX2A 2ZPTX 4R69A 2DFVA 3R9KA 2A4MA 1PVVA 3M33A 1ISSA 4LDQA 4KO8A 3B9QA 5DU2A 5EUQB 2B92A 4YMTA 1H9AA 1BXRA 2CKZB 3JAKB 1XALA 4R7RA 4Q6BA 4BX8A 5EVCA 5C5IA 2YXNA 2IOQA 2WSYB 4CF7A 4O08A 1XMXA 2GS9A 3JWJA 5CJJA 2Z3VA 4BIMA 4RZIA 2WVGA 2GLUA 1HDXA 4UDOA 4I8DA 4UUPA 1WZNA 3BJEA 3JWHA 2Z57A 4FLEA 1Z07A 3RHSA 5SYNA 4L7QA 2FK2A 4OIFA 2B99A 3AFGA 1Z3CA 3UJAA 1DJNA 4ZTZB 4ZC8A 3UKJA 2AQ4A 1M66A 4O3NA 3M9NB 1IXKA 1R12A 2FCAA 2WJJA 1Y7PA 2WV9A 2HWXA 2NZ8A 3AHIA 4F45A 3TSCA 4G5QA 3DDWA 4NI5A 5JIBA 2IPOA 2IQIA 1O95D 4MVJD 5IZCC 1P39A 5GV7A 2WKWA 5DM4A 1ZISA 3CC8A 1T2CA 3N6XA 4F56A 2VNHA 1N9GA 4L5IA 1VLHA 1SCUB 3Q0TA 4XIJA 1JXOA 2I71A 4GVPA 1SVIA 2NUPA 3LSTA 1I30A 1QHYA 2OD7A 2P65A 5HP4A 2OC4A 1RWMA 3KOXA 1L4MA 1NW8A 1QHEA 2FG7C 3CX7A 5E6RB 3GIIA 4FUQA 4FIZA 4I1UA 3KFVA 5L1KA 2KPOA 3RKSA 2OKGA 3FOAA 2ATIA 4ESEA 5G02A 2WM9B 2YJTD 1WIWA 2OBFA 1VBGA 1D09A 1QV9A 3A1DA 3SBXA 2RDMA 4JWTA 1UK8A 4JVOA 4F96A 3G02A 1TCUA 2XZTA 4DA9A 2VSQA 5EJIA 4MUBA 1AUOA 1K8ZB 4YGXB 3IQGX 2RI1A 4KGZA 5DGHA 2H2GA 3DOCA 2AFHE 4M1QA 5CDFA 5T3UA 3ZS9A 3Q3CA 1SURA 4OK6A 3PUWA 3DHVA 4LFAH 4K88A 1PF7E 3VR6H 2XYVA 1QQ5A 4FHFA 1A69A 1CHNA 4IBOA 3WTBA 2XGSA 4IICA 3W78A 2J6UA 4EYOA 5JNUA 1PG0A 2WQ7A 1ZI6A 2WZDA 3ZTTA 2GOYA 2DTXA 3TW8B 4F6LA 2CNNA 3EIFA 4QOEA 5JS2A 4ESOA 4RL4A 1M6NA 3EGXA 4AWXA 3IELA 2IUYA 3B6ZA 1NE2A 4TTAA 4WN9A 3WWYA 2WQ6A 2IYRA 4GVLA 5EERA 3TMAA 5AFSA 1M6EX 1IEWA 1QGUA 1X1DA 2VKTA 2UKDA 3A7DA 3OQMA 3ORSA 3FSEA 1DCKA 3UJ7A 4Z7QB 2H5JA 2C0PA 2CXXA 2FW6A 4OD0A 4PBSA 4DR7H 3VPSA 2XMPA 3W6UA 1QANA 5I5EA 4DCUA 2GF2A 4MRPA 4Q9LA 1ZUHA 3ITDA 1QFYA 3KVVA 1IXSB 3VV3A 4ZHQA 2ZSKA 4KL8S 4YCNA 4UUBA 3PFCA 4C4AA 4XOUA 1F7VA 1L8LA 3CB4A 3ME5A 4KIWA 5JSQA 3X2FA 1QP4A 1D2MA 5FPKA 3CQZA 1HL7A 4YRCA 3G0BA 4LTNA 4ZK6A 4D8VA 3NEYA 1SQ6A 1MRZA 1XZEA 4RPHA 3ZOZA 4N5IX 5L7WA 4YCJA 1JEEA 4U7DA 3KPYA 1UAYA 3BXZA 2R25B 1I3KA 3NG1A 3ZTYA 4JI2B 4FR0A 3LA6A 2W6ID 5K20A 1FUKA 1V3QE 3KSMA 3MJEA 1VFPA 3AESB 1MEJA 4KDEA 3DWFA 4Z9AA 4ZREA 1KEPA 4LRYA 4BZPA 4Y6LA 4W5RA 3TFQA 5JV5A 5KFUA 3R5SA 2HHAA 3UJHA 5SY4A 1YDHA 3WRYA 3O4HA 3HXMA 4EM6A 3CW8X 5IJWA 1XKQA 1DAAA 2J6TA 2XOXA 3EODA 4IO0A 3TKLA 3B36A 1LNZA 2NZYA 1XC7A 3F46A 4EF4A 3C70A 1D2NA 1CF9A 1SIOA 1FS5A 2QQ5A 3O3NB 3PR2B 4JEMA 4A26A 1GRQA 1E3WA 3JALB 3ONDA 4ZJZA 4F86A 1NW6A 4YAKB 4CM5A 1HNXH 3S1SA 4B6FA 3N2GA 4O1HA 1O1YA 3G2KA 3IMEA 1PR1A 5FOXA 4ZHQF 4CE5A 2QDKA 1ZKDA 3OHPA 4IJ5A 1W2GA 3I8OA 4LMAA 2A9QA 3OE7A 4J0DA 4PRLA 4PICA 4FYKA 4CWAA 3BCHA 1NI5A 4R4JA 5AM4A 3UK6A 3QOXA 1JIQA 2OORA 4CDGA 1RPAA 3OFNA 5E4FA 5JCOC 2Q1YA 2AD1A 1E2MA 2WF7A 1BHSA 4O7TA 3G5MA 2YIDA 3KM0A 3H8VA 3W7BA 1JHMA 2VJLA 3OIYA 3NC1C 3S8MA 1NAHA 2CUNA 4OX9Y 1DC5A 3DLPX 5LOVA 2CXSA 1GL7A 1NVXQ 2C61A 2RCNA 4RD0A 4G4JA 2M6SA 2R47A 3K6RA 3OJLA 4ZI3A 1KI9A 4ROTA 2ERCA 1JHQA 1HYEA 3F5SA 4FCTA 4QJIA 2VPPA 3M9OB 1B0UA 3EMDA 3V4SA 5MN4A 1G21A 1A9OA 2MWMA 1I1QB 3PE6A 4M9XA 5JAOA 4H6XA 1DTWA 221PA 3CLHA 4DYVA 1L5SA 4E12A 1E98A 3KPJA 4DR2B 1LB1B 1WSBA 3THXB 1T9KA 4HLNA 4I1IA 1LPMA 4H7IA 1JLHA 1GL6A 5TB5A 1W4CA 2R2AA 2WWRA 4EEQA 1YRLA 3UH0A 3IT2A 4RVFA 4ZYZA 2ALZA 1XDDA 3GFPA 2EJCA 1C3OA 4CT0A 3GJZA 1JEYB 1FPMA 4BVKA 5HTOA 5AW2A 1E4EA 4HB4A 4DJTA 2FLNA 3JQAB 13PKA 4OSPA 2ZJ0A 4YECA 2VHCA 2Q7DA 3OEHD 4ZU6X 1PFKA 1FDOA 4HZUB 3HJUA 1QHIA 2P8JA 1YRQA 1DKMA 2GWRA 2VT2A 4WECA 3TSOA 4BO8A 4C0SA 1RLUA 5IDYA 1XJQA 3R5TA 3UAYA 1V6AA 2PUBA 4PE5B 4O1MA 2YASA 2IUEA 1IBLH 3HKEA 3SC6A 4PQRA 3OT1A 1FQOA 3WJAA 1T0BA 2WVJA 5IM4F 1EAMA 1RWPA 2AT1A 1BRTA 4DIBA 2WIAA 2XEXA 4RVGA 3N1UA 1C1DA 2D3TA 2C5GA 2WNIA 4HDNB 4O33A 4PXYA 4UZSA 5IT0A 3QUCA 4EVSA 3EQ8A 2CLMB 2XECA 3GI1A 1OU4A 2IW3A 2XA2A 4RVHA 4J7CA 1F5NA 3EDYA 3GB9A 2ACEA 2V7QA 1VRVA 3ILHA 1VPTA 4E13A 2JLVA 3RNLA 2LDBA 3L49A 2A5GA 2YN4A 1I3LA 3T5JA 4AJNA 2XDQB 1A2OA 2C7PA 1HDIA 5AUQA 2PNFA 1XD2A 3FOBA 1OAAA 3PSHA 5FJJA 2GCPA 2RAFA 5TRTA 4YT8A 4MS1A 3QVXA 4Y9DA 3SWWA 4HNAA 4TTJA 2XIJA 3O31A 4R54A 5IH3A 3ZH9B 3HA7A 2MINB 3N8IA 3Q2IA 1C0KA 3DHWC 3OP4A 3OIFA 3FYCA 3RIGA 3M1YA 4IS3A 3VNBA 2BMEA 4BB0A 3O95A 5JMTA 1U9CA 1GGJA 3LVFO 2B78A 3FZNA 3VO8A 2FX5A 4OJTA 2GSDA 3SX2A 2AD5A 1DUVG 3HVJA 4RADA 5JDCC 4YRIA 1E2LA 3DFIA 3LMKA 4RESA 3WBBA 3D2CA 3VU3A 2FUNB 4B83A 4Y0AA 1CFZA 2EG5A 2VYVA 2SECE 4FD3A 5AXCA 3E9NA 1NQVA 2XMSA 3RSHA 3ZXYA 1JFFB 3TBHA 2ENUA 2NQTA 4QYIA 1TF2A 1NNI1 1UQUA 1ESEA 1KDVA 1KQOA 1L5OA 2J9XB 1II0A 3VGPA 5CITA 4FOSA 2W48A 2OPHA 3RVQA 4KLNA 2A9OA 2AOTB 3M4YA 2HL6A 4CMIB 4HWRA 2BJVA 2XMQA 1IUNA 3ADCA 3ORYA 5KFQA 4R1TA 3U1TA 3URMA 1UKAA 2DRIA 1E9EA 4AT1A 2LIPA 2ZYWX 3ENZA 1FDIA 4XW2A 3WQHA 1H8HA 1EM8B 5BURA 1DVRA 2YMQA 4G4GA 5AJVB 2X0IA 3II6X 2O3UA 3HBNA 4YEDA 4R51A 4XLTA 5IYZB 2TRSB 3HU5A 4YASA 4LZJA 1UXKA 2GBIA 2IEDA 1JDJA 1J33A 1IBMB 5BR4A 3K6JA 2JDID 1I4DD 1VMIA 2H4JA 5L3VA 1V39A 4WMLA 4BQQA 2JLXA 1XDUA 3GUZA 4S1OA 1VCOA 5GONF 5K9ZA 1S5PA 3H3FA 3KR1A 1FW8A 5HS4A 1ZIYA 1LI7A 4LRWA 5HIJA 1Z0ZA 3EXIA 2EGGA 2N46A 3JPYA 4GMHA 2GEDA 4A03A 2QSZA 4HSEA 1FFSA 4ALKA 2ICAA 4R5MA 1BMFD 2C7VA 2HF9A 3NVMB 4S3MA 1M1XB 1JT2A 4TXMA 5DT2A 3BMCB 3UJBA 3V8BA 3U17A 1XFAA 2ZJ8A 1WCIB 2RONA 4CMIA 3T9BA 1SKQA 4IRKA 3VNNA 3UQ8A 1QR6A 1XJ5A 3KLMX 3PIDA 3PPIA 3GJQA 2QNRA 4G56A 4K9NA 1GCIA 1QGAA 2R68A 1X39A 2VK8A 3AIIA 4D8WA 5G1PA 3BTOA 3LD9A 5L3QB 2G1PA 3A9CA 5IVIA 2BSQA 3PFBA 1SG0A 1ZOLA 3PJEA 2G36A 3MLBA 2HK9A 3ZWWA 4B35A 2FMIA 3M2TA 5EHNA 1D8TA 3HCNA 4NFLA 2ZT6A 3J81A 3W5DA 1TE2A 3ECCA 2DQYA 3FUTA 4TL9A 3QE9Y 3F2VA 1K92A 3WSVA 5C5EA 2IA5A 1V4VA 4R9SA 1P0FA 3KX2A 1PHRA 3AYHB 1R0CA 2OBNA 2ZIVB 3FX2A 3ZHCA 5K8IA 3DDUA 1BC5A 1LFAA 2JVJA 2N1BA 1CUJA 3IAHA 4MXDA 4EA8A 2H2DA 5DP1A 4QTYA 4ZYTA 3IKTA 3CT4A 1WDMA 2NP6A 2W8KA 1OD6A 4MVJH 2OD2A 1JG7A 4HDRA 4BU0A 3ZGOA 4F4UA 1HYGA 4EFMA 3OQNA 1V3UA 2FRVA 1U7XA 1DJPA 1LRLA 4X3PA 3T5GA 4URWR 2C88A 3RWOA 2BJHA 4AZ0A 3EXEA 4CDMA 4EF5A 1H1DA 4QJ4A 1U2GC 4YFYA 3N8GA 5FWYB 3HVRA 4O2LA 2ZBEA 1PGNA 1TAUA 7ADHA 1ZJ6A 3ANMA 3OECA 8ATCA 1A8QA 2M6LA 3P32A 5EKXA 1QYIA 5HF9A 1GG9A 1ZI8A 3WWCA 2G9QA 3WK7A 2BE9A 2HMAA 4YJKA 4H35A 5C8XA 5JCJA 3IOEA 4ZYYA 4OLBA 1C1DB 3WLJA 1GU7A 4IXTA 2HHFA 1DL5A 1E2JA 2VBIA 5AJUA 1U7WA 2G70A 3M1AA 4QTZA 1QCCA 1EDEA 4MKFA 4MHSA 4F9FA 1RI3A 1RTKA 3FUWA 3UYKA 4DADA 3M5WA 5A2GA 3BILA 4JI3B 3HZZA 4H0NA 4IDPA 1G2PA 1KH3A 5FQNA 4LDRA 4RB2C 4JJ6A 2A5DA 3ZE9A 2ZXUA 2KE5A 5B64A 1JBKA 4JYAH 3RANA 1A4IA 4UNQA 3UXHA 1HT2E 1JU4A 2WJ4A 3IPCA 3QLJA 5KOIA 1RXYA 1O89A 4QUKA 3JWEA 5IC5A 1SOUA 1DDGA 3GVCA 2W6ZA 3IBSA 2Q41A 1RAGA 4WKOA 5EXSA 3QLUA 2HKIA 1VSQA 1HI9A 1JI3A 3RM3A 4YUVA 4YRZA 4FBTA 3CX4A 5F98A 3PIIA 1N75A 3JS5A 4KN9S 5FPHA 3TTUA 1LGYA 4GZLA 5JBNA 3N6RA 2G09A 5HOEA 3U7EB 1FFBA 4I5DA 4CIAA 5IYZF 3NEJA 4BYGA 4RUCA 3PJGA 3R9XA 2V7BA 4JX9A 4XAQA 3VKWA 1CZKA 1U0SY 1JHYA 4ZQFA 4NCAA 1Q0RA 1I24A 5TDHA 2FPIB 3H3VH 4GWLA 1LJUA 4DHWA 2HAEA 1MN6A 3RF2A 1JR3E 1RJWA 3TR0A 3ICEA 3D7SA 3Q98A 3SR3A 1RQNA 2ABJA 3A58B 2XAUA 2JIOA 4I2VA 2F3SA 5TVKA 2X8BA 3U3ZA 1BDJA 4D2IA 4G9BA 4RF5A 3KSAC 1WD7A 3X2EA 2QN7A 2VDOB 2IPNA 3JVDA 2R7MA 4LFBH 4BLRA 1UFQA 1WXHA 4YCLA 4JI0B 2ETXA 2NYVA 2QD2A 3BVPA 2DFDA 3WLMA 3ZLTA 4MZDA 1FXWF 2Q8QA 4YR2A 3HOZG 5KKAA 1CEEA 4RMGA 4QOJA 1RLIA 2GZAA 1BIFA 4UFPA 3VNVA 3FPAA 5U9CA 4FFLA 3EG9A 1CDOA 2UXBH 1J42A 1KFEB 3FGZA 3GFFA 3O4FA 2BBSA 1FP6A 3P52A 4GPTA 2W6OA 4OP1A 5ALTA 3SNHA 4YR7A 3N6VA 4BV3A 2P1RA 2VQFH 2H3HA 4OLAA 5ECWA 3KZOA 4ASUD 3F3YA 4Y0NA 2A9VA 2GEBA 1TIKA 4URYR 4WCDA 4Y2HA 1N4AA 4MQUA 1VE7A 3VO1A 3WX0A 3AI3A 1Q7CA 2PRYA 2HHHH 1H4SA 3KPVA 1G8SA 1NRIA 1UDRA 2UYYA 2VH2A 3EVDA 3LECA 2FSGA 5IN4A 4PXAA 3TDNA 2VYCA 1Y8QB 4AN0A 2ASVA 3J7AC 1PWYE 3DZKA 2BFWA 3E9YA 4U8GA 4AJKA 3OAAA 4IHQA 2R7ZA 1R0RE 2RAVA 4F5EA 4JWKA 4HR7A 2JEYA 3KTFA 3HR4A 3E0QA 4D92A 1U4SA 2A0WA 3TIVA 4DJDC 4F2HA 5JHHB 3U3MA 1RYDA 5KG3A 1KO7A 3JVIA 1MABA 4OM7A 2BW0A 5FA5A 3ZYZA 4DL2A 2IF2A 4FN4A 1QUFA 4IG4A 4Z0HO 2GYWA 3CZ5A 4N8SA 4EB0A 4P4TA 3WBFA 1Z6YA 2ONKA 2PH7A 4UFZA 3PVZA 3GAZA 4O86A 2R92A 3Q6NA 4DIEA 3HFRA 2X86A 1QU2A 4BVHA 4PLZA 3WP0A 4QG7A 1Z0JA 2YW2A 5KSOA 1CY1A 2XCUA 4OK3A 2Y77A 3JQ6A 4A91A 3FDZB 1NY6A 1PZMA 1EG7A 4ECTA 1TA4A 4RM2A 5GONA 3W2IA 3ZDFA 1EKPA 2R00A 5DP2A 1E1RD 2ZREA 3CZPA 3VO2A 1N0UA 1BU8A 3G0OA 4DZRA 2JRCA 4R2IA 4L5BA 1TJ4A 3PYMA 2YHIA 2YV3A 5AO9A 5BSTA 2GPSA 3AUFA 2NVOA 3CLSC 4G0XA 3UQYS 4OXYA 1T8WA 5EZYF 2QIOA 3JZIA 3VC2A 3NHYA 1L8OA 5IK2A 2Y1FA 3I4NG 4JELA 2IL1A 3EEFA 2VPWA 3R6TA 2CNBA 4HBZA 4TMWA 5E1DA 3UICA 4BWSC 1UZMA 2J3MA 4YB8A 1X0VA 2PGAA 5EMNA 3HUEA 4GI5A 1R0SA 3MK31 2V7VA 2EIXA 3N2KA 1R9TA 4A8JC 3L0YA 2V0NA 5ALYA 5CCDA 3IMGA 1T9AA 1C30B 1YNOA 1BNCA 6ADHA 1LNQA 3V6HA 1PI3A 5C44G 2PO7A 2BH9A 2Y1XA 2Y4OA 3HBMA 3OBBA 2Z2ZA 4M1YA 4OFZA 5EIHA 5CDGA 2IIQA 4M7EA 4CTMA 3CPEA 5JMOA 1T6NA 1URPA 2ZBVA 3DOEA 2D0OB 3T95A 3R6GA 4BWVA 1E1RA 3KFLA 3NJ8A 1Q14A 4JKYA 4XZ3A 3QVLA 4FSXA 1N9GB 2P9YA 4KDRA 3BMQB 4DMKA 3R0QA 1S1CA 3ZLBA 5EJ7A 1E2BA 5DB4A 2JKZA 2AE1A 3KYJB 4ER6A 3MD0A 1F4VA 2JFYA 1VG0B 2EL9A 3IKJA 2O2XA 2PZBA 3JD1A 4V0ME 4WOCA 3ZDYB 4BP3A 5KINB 4TTSA 1E9BA 3QVVA 1FE8A 1XNQB 4OGKA 4CU2A 5GGXA 2BFOA 1SK9A 5FTNA 5IUKC 1NIPA 2UVPA 3V97A 4B3HA 1QF6A 2OBMA 1KIMA 2ODWA 4JJGA 4UE2A 4XWWA 4A3IG 3DE4X 4PAOA 1ABFA 4A0RA 4CC5A 3AF4A 1ZOPA 1Z37A 5TMEA 2RARA 1TA8A 3LVQE 4IG9A 3SVTA 4INAA 4X1IA 1BAPA 2XA1A 4GUAA 2BEVA 2HR1A 5J58A 4IRCA 3ZHXA 4BKPA 2FH5B 4NEHB 3AM4A 3QW4B 1TM2A 1B26A 1BX1A 1UBOS 4V0OA 5BYKA 2TECE 4MVJG 1AV7A 1X1TA 3Q10A 5IJ9A 4DM3A 2LCIA 1CETA 3U49A 1ZXXA 4ETMA 3CCCA 3K30A 3OPXA 3PC3A 3GIMA 4CMBA 1X3SA 3U44A 3RRYA 1DIAA 3QKRA 3DGEC 3JQAD 3LWBA 1V3TA 3HKCA 3P96A 4A3JG 5K3AA 4R68A 4N4AA 1JHVA 2WJPA 2A6PA 3KPUA 3EFOB 4M9ZA 2EKBA 1ZETA 2VRNA 1DRJA 1O9HA 2V4UA 4FWBA 1YVEI 3QUSA 4HN9A 2YMLA 5AR1A 1XROA 4GLOA 3SU8A 2XUFA 3AEQB 1XIVA 1TQ8A 4QX6A 4OL9A 3OZIA 4XM1A 5BR8H 1P9LA 2XE4A 2ES4A 2XNKA 3CNLA 1BCRB 1V2GA 2BELA 3G9QA 1GU0A 3N74A 4M89A 2FRDA 3JSXA 2ZI5A 3K5PA 3FVVA 5F51A 1W76A 3ZHUA 1RXIA 4DLUA 5JT1A 4CODB 2H1HA 4ZVMA 3EK2A 3L2OB 1KSJA 2WWFA 4PLTA 5AT1A 2DR3A 2WJVA 2QVBA 3GPBA 2P1ZA 1J09A 3HXOA 5BWUA 2UVRA 1W4RA 3QY0A 1E0AA 2DEUA 3CUUA 4TUYB 2PXAA 3J81W 1G60A 4FOPA 3FHLA 2UUBB 4D4IA 2WU0A 1QXSA 3VH1A 5CFZA 1IEXA 3R7DA 1Z0UA 1H8HD 2EYUA 1P2VA 2YUTA 5A04A 5DG7A 1TYAE 2J3IA 5H83A 1SUEA 4II7A 1WMAA 4J0EA 4BLSA 5AJXA 1AMOA 1TF7A 4WRRA 3I30X 5EMMA 1QYDA 1BGWA 5EE0A 1NNLA 3SSMA 4S24A 3CNEA 2QLFA 3NFYA 4DUZB 2EZUA 3WRXC 3KQPA 3T3PB 1YK1A 3IV7A 5L51A 3I4CA 2HV9A 1OZGA 5E4TA 1DX6A 1S4MA 1VI2A 3OT4A 4X64H 1S01A 1XRQA 2PSHA 2GGSA 4IYRA 2QAGA 4O2AF 5C32A 3G2QA 2JASA 2CJWB 2G8LA 3CKLA 3W4IA 1YI0A 3JR3A 2QM3A 4GHWA 1CERA 1I0IA 2OMEA 3FTDA 5FAXA 1TAEA 2XLBA 2BGNA 1AZWA 2XUAA 4AUEA 1Y7LA 4JP8A 3PPWA 1ZGCA 3AOEC 4M54A 3N2ZB 3MERA 1GHTA 3PGXA 2X9VA 1TA0A 5TF0A 4B2LA 3RB3A 1Q2XA 1HF3A 2ZAMA 2YICA 3PHBE 4N5NA 4QSMA 4WUTA 1KI6A 1E7QA 1PW7A 2Z9DA 1MC8A 1UPXA 1TOAA 3OEYA 4IUDS 2E37A 5KCMA 4DMRA 3DZFA 1NUPA 4KO4S 4NARA 1BVUA 1L5LA 3AINA 2ZCJA 4P0TA 3H8WA 4X8MA 4GM0A 4MUAA 3I2GA 4D9FA 2XQKA 3GLUA 4O2AA 1Z06A 3T1HH 3P26A 5EHGA 3UAVA 4KXYA 3I73A 1ZRNA 4GRDA 4GC9A 3VAAA 3NKVA 4ODIA 4G0PA 3UB3A 1OV4A 4KMMA 1NBME 4GZ3A 4O3FA 3V8NA 2D7CA 2G9UA 2IYNA 5HPYB 1CE8A 2W7OA 5EIAA 3OIGA 4LHYA 3MWGA 1O97D 4PLYA 4V0QA 2IBTA 5DG9A 3NEPX 3GLKA 1U1EA 1A4RA 1JDPA 4QHTA 3LQQA 1NC1A 4S1VA 2P7HA 3LPCA 1PJSA 3KELA 4AI6A 4EDFA 2A1UB 3D4NA 4CT5A 4DLVA 2ZSBA 3T1TA 3MUFA 4HJXA 4ZRDA 4ZMSA 2I6XA 2QE7A 2RHTA 3OCZA 2GVDC 4A3LG 1U28A 3LMLA 3DFFA 5L53A 4GC7A 3RBEA 3U6KA 4ND2A 4K26A 1NWHA 4RX1A 4CQLB 4UJ3A 2VEOA 3LT0A 1ZHOA 5SZKB 2FPOA 1IBSA 2FKLA 3CLTC 3DKVA 4REOA 4XGKA 3NVDA 1SIBE 3LY5A 3O94A 1TX4B 1QTRA 2PBLA 1XNJA 3BJMA 4MRMB 5DCLA 5J1TB 4Y2QA 4E14A 5C8VA 4CHGA 3HGQA 1YRWA 1DBWA 4CLOB 2PANA 1P1HA 5LB2A 1OSNA 1E1KA 4FJ2A 1Q12A 2G6TA 2NXCA 4N5MA 5TQ0A 3GEEA 2ZR0A 4PRKA 3NYWA 4AY5A 5BSGA 3Q8KA 3FDFA 5KYXA 3U7FB 2O5CA 2HFKA 4K81B 3DBHA 3PJDA 3T7IA 5HDBB 3AHFA 4MPDA 2E4AA 4IGEA 3UXMA 3ZV5A 2DUUA 2VTBB 5AI5A 4UDYX 2ID8A 4UTNA 1UXOA 2DCUA 3IQIX 2ZXFA 1Y7TA 4MW6A 4L76A 1MQ8B 4LSZA 4DIMA 2JNWA 2EGUA 2ZUWA 4LC9A 1S8OA 3N3AC 4WKNA 4FDAA 2P2SA 3BULA 5DXFA 1M2GA 1Q19A 3ROKA 3L40A 3D8TA 3RREA 3S2YA 5DM60 4DKXA 3H1BA 1PDVA 2YYAA 5JZOA 2FW8A 4YRLA 2P5UA 3LX5A 1C4WA 4GM1A 1C9KA 1V7PC 2XQJA 1ENPA 2BFAA 1ISIA 4HZGA 1GCOA 1L8QA 2PPLA 5DULA 5DM2A 2XNJA 2BR0A 2OCIA 2PAAA 3T5MA 1GLVA 3A3PA 4BFYA 2FMAA 2WNHA 4MS4A 3REQA 4QGSA 1NHWA 3M3DA 5A4FS 1NLFA 5HJEA 1CEQA 1WBDA 1OH7A 3MJDA 4JI6B 1JSRA 2QENA 4ZT2A 4HUQB 3INYA 1L5HB 3OH8A 4DUPA 3CN9A 2BZ1A 2NTYC 2PWBA 3I2JA 3QLEA 4JK3A 4MOWA 1E2QA 1H66A 2BBTA 4JBXA 3IE1A 5E7MA 4HVCA 1MB4A 4KAJA 4MQ4A 4DA7A 4RF4A 1B73A 2PO5A 3D2BA 4RB1A 2GT1A 3JR7A 4YJ2F 2XITA 4CCAA 3NTQA 4LXGA 1OX4B 1FQJA 1WXWA 5EJGA 1G5RA 3R6WA 3JTMA 3LXXA 2A2ZA 2EC5A 2QPTA 2ZE8A 1BGVA 2CJYA 2FB9A 3QPWA 2RCYA 3OZBA 4M0DA 4MI1A 4QVKA 4LFCB 5CD1A 4FDTA 4Y6PA 1GWNA 4QW9A 1D6MA 1I4WA 1NLMA 3HLKA 4IILA 4BLOA 4CEIA 2D1SA 3M9LA 5IH7A 5BV8A 4FTWA 2VTEA 2RC6A 2EJBA 4Z9BA 3K8QA 1OB2A 5ALQA 1A9XB 1YDMA 2GZ2A 1NULA 4Q7QA 3LPLA 1ZN2A 2YU9A 5JAQA 1ORIA 1TYEB 2F8LA 2L0XA 2Y0SE 3H4DA 3RFUA 2IE8A 3TBFA 4ACAA 1SCKA 3RHFA 2ZDHA 1ZWLA 1P9OA 3FHOA 2P2LA 2LGJA 3IO3A 5L3RA 1CB0A 1TFRA 4CV1A 5CRIA 6Q21A 2AI3A 3U39A 1XCGB 1NSTA 5LYJB 3LC7O 3BGSA 1GNTA 3BICA 5AVWA 3ZU3A 2GN1A 4XYLA 3KZ1E 3TYXA 3NHZA 4K2HA 3U80A 4DIKA 1NPDA 4AG5A 1DT3A 1R8QA 4TL7A 4F7DA 1R6VA 2YQ4A 4G25A 1T2AA 4MSUA 4U7TB 1ENZA 2NADA 4V2IA 4WFJA 3HU2A 1RXUA 2QGZA 4C7OA 4NPHA 3T1VA 4N3AA 3DE7X 2RHCA 4BNIA 4EDHA 4RTKA 4F4IA 4CZ2A 2H1OA 5CVVA 1B04A 3B20A 3O8QA 1UZUA 4NS1A 5T7BA 2X1LA 4MQEA 3ZZUA 1G38A 4ARUA 1DDIA 4ON9A 3TWOA 1ZY2A 5K51A 1T4MA 3EDQA 1ESNA 3EXFA 3R0ZA 5KG1A 2WHXA 1NA5A 5TMDA 3F6BX 1O6BA 4NIMA 1GYFA 5C1DA 2COEA 4KE8A 3NVAA 5CBPB 1WG8A 4M87A 3SX0A 5KQRA 4EPVA 3VYRB 4YY3H 1X14A 2NZUG 1X7ZA 2Z3ZA 3IP6A 1GPH1 2W0MA 3RT1A 2C8KA 2Q49A 5CNJA 4XFDA 3ZCPA 2FKNA 1FMCA 5H80A 2QX7A 3AIMA 3N2IA 4PTYA 2ZAIA 3GF4A 4L22A 5E8JA 3PLRA 4QO7A 2OXTA 2WT9A 2RGUA 4LWQA 3V1LA 5EWMB 2ZSIA 1KDYA 1KFCB 4E22A 4FOTA 2GBGA 4KTTE 4C7BA 2FP4B 1E5TA 1FTSA 1U1FA 3M8KA 5DNEA 1DTEA 3R3XA 1ADYA 2CUKA 4M36A 2IYOA 1KTVA 1X94A 2GERA 4F8JA 4D4KA 1NV9A 1KMHA 4BQOA 2C99A 4DYHA 3JATA 1W5SA 1DKPA 3E3OA 3FWHA 3IJPA 2FNAA 4E46A 4BMYA 3K9GA 5JH7F 4B9EA 1KAQA 1PWZA 3GLTA 2RK3A 4LI3X 2VWQA 2B94A 2X5JO 5KFHA 3HJAA 3VDRA 2ZK7A 2PNJA 4KCGA 5JYBA 1J25A 1DXHA 1BX3A 1RYEA 5KYWA 1LC0A 3LT1A 5IM4A 4D56A 3TQTA 5ICMA 4R9RA 5HJ2A 1MA0A 3DDOA 4FX2A 2Q21A 3BMOB 4YMIA 3TOSA 3ZWPA 4UJ5A 4ZJUA 4IR9A 2CV0A 5FJ8G 3CVXA 1Z5PA 5HIAA 4HAVA 3T38A 4EGQA 3HBAA 2HEGA 1HDOA 1PGOA 3LTEA 5JRJA 5IF9A 4BB9A 5KFMA 2DFPA 1Y5LA 1TKRA 4JUFA 4MVJM 4EVIA 3DOHA 2Z30A 4LZPA 4ZIRA 1O0CA 4AN4A 2Q2OA 5JCXA 3ENNA 3DV0A 1A0GA 1OLOA 4QWCA 2CVOA 4ZT6A 4ARZB 1KC7A 4EEYA 4CTKA 1EUCA 4NOJA 1OLUA 1GAEO 1Z75A 3CX8A 3P4UA 1SA0A 3VBCA 5KKNB 2YS7A 1ULHA 2J7PA 2IU6A 5E6SA 5JALA 3COPA 3DUFA 3TGLA 2XCSB 2VP5A 1AKTA 1HZZA 4OMDA 1KVSA 3E9EA 2FN8A 4AF6A 4Q7MB 2Y93A 4AO7A 1HNZB 4M9QA 4EABA 1U2QA 2PQMA 2P69A 1L4FA 4FYJA 3NBXX 3VU0A 3WIUA 2DPIA 1GCGA 3TH5A 2VXYA 3NONA 3EUWA 4G63A 5IPFA 3H4BA 2BRUA 3CIOA 2EHJA 1T36B 4Z7NB 1P0PA 2Q46A 1TADA 3MSCA 4G01B 3SJAA 3ZK8A 3AKEA 3V8VA 3ZNOA 1LZKA 2QLJA 3HMQA 1OX5A 1Y9EA 4B3JA 1MO6A 5AP9A 4DQLA 4PHCA 3PW7A 3GBPA 1V1MB 1PD1A 4G8CA 2WHQA 4QO8A 4TTTS 1QO9A 4YDHB 1XDNA 4TWBA 1WDWB 4YO8A 1D2EA 1GN9A 2ILTA 3WYAA 1SC4A 4MLDA 5CFRA 4TZ0A 3KTDA 1LVUA 4P2GA 1PUXA 1UOOA 2H7YA 3D4BA 1OFUA 3OUTA 5G1NA 8ABPA 4JI8B 4NMXB 1V16B 1ICIA 3P4YA 4F5DA 4BBRG 1RMYA 4REQA 4H9GA 4D0RA 1MX3A 3Q0EA 4JMPA 3TB6A 1UBNA 4DR6B 5IAKA 1WM1A 4DPMA 3M6UA 2YOFA 4NNOA 2HSEA 4KRFA 1M2HA 1M34B 4WK0B 4FT2A 4ESHA 3K09A 1EUZA 3BEOA 1GNPA 1G5TA 1E3DA 4BV8A 1O54A 1IVYA 1VLJA 3GV0A 5FI0B 4CM6A 2QG6A 4XIFA 3K2QA 4KLRA 3MRVA 1GEEA 1OUMA 4YQFA 3OZ7A 4Y6RA 3ZWXA 3BH6A 2ZEJA 3ND6A 4XPZA 4D6XA 1S8AA 4AD8A 2ZVDA 3DUFB 2PR2A 3IMCA 4OA8A 1OA1A 3NOXA 4GWGA 4ANFA 5EJ8A 2RFLA 1PSDA 1BHJA 1PCXA 3DTVB 3SEAA 2OCYC 1PR3A 4MDHA 2IYQA 1TWGA 1OLUB 3A2KA 3D7NA 1Z2NX 2EZ4A 3ANNA 1F48A 3N07A 4Q93A 2FR8A 5DI3B 5D85A 4OOFA 1YF3A 2LWIA 3O8OB 4NFSA 3R0IA 4POAA 2GJ9A 1BCSB 3TM5A 1YCDA 2W6NA 1L7RA 5BNZA 5K45A 5I7UA 2I7VA 4I5EA 3EFHA 5KYUB 4BFWA 1EWQA 4RTRA 3TLGA 1CQWA 4CG2A 5J4KA 3AVUA 2JFFA 3DDZX 3CURA 3AVWA 4GPEA 1ZR2A 1ZEJA 2BGUA 2XBMA 4R1LA 1P18A 2QYZA 3CPJB 1UT8A 3F4LA 4IQ4A 4M2LA 1Z56C 4DLPA 4BBSG 4EY8A 5DTMA 4D26A 2E2IA 1YE8A 2WD8A 3Q7SA 1IRIA 4EYHB 5ALSA 3PC8A 4RZ3A 3IQDB 2P6NA 4EO7A 2QQFA 4M76B 3B82A 5DPMA 4R8UA 3U4QA 3WV5A 1U0BB 3V1KA 1RYRA 1CT9A 1NW4A 4BJHB 5A4IS 1V41E 3GRZA 2WF5A 1NN1A 2QTTA 3I6IA 3ONWA 4PWYA 4AKEA 3DV2A 4BMDA 3TUIC 3FG9A 3IL2A 3SZUA 3V7WA 1P6UA 2Q5FA 3DL7A 1RXWA 2QYOA 2O7SA 5DCWA 1I13A 1FRNA 3W5CA 4FS1A 1Z6AA 2W58A 3T7EA 5M34A 1HORA 4MV6A 1PJBA 3DBRA 1X2BA 4G26A 1YE3A 3S99A 1NGSA 1Z5NA 3BF8A 3KCQA 2FWPA 2WIJA 4Q4AB 3SZOA 7ABPA 4DZTA 4EI7A 4H0CA 5IBCA 3A6ZA 2FE1A 1PQPA 4UDNA 2AWOA 5KFVA 1MD9A 3R6DA 1UUFA 3G8YA 3R77A 4X95A 4ZKEA 3MJSA 1EFTA 1CLUA 3ZEIA 3I05A 3PT9A 4AYWA 4BGIA 5KAPA 3U40A 4W82A 1V5GA 2JLRA 3MRXA 3FY4A 4EYQA 2QP4A 2JARA 4KKVA 4R2WA 1Y5IA 3PNLA 3K70C 1XSEA 4P58A 2BUBA 3PKJA 3JVEA 3KL4A 1VIYA 5KG0A 3ASYA 4A3CG 3FLAA 3KKEA 3B2EA 4N7JA 3SR4A 3SHQA 2HDWA 3BL8A 4P35A 3E9RA 3NYRA 5G4KB 5CPFA 2A9FA 1Q6ZA 5C3UA 2YNMD 3UMYA 3BL5A 2OBXA 1ST3A 1RQGA 4IIJF 3B2NA 1AO3A 1AUPA 2WJHA 4U3JB 2IW1A 1ZOSA 1KH1A 3W6NA 4J1SA 2JS7A 2OR3A 3AUJB 2ZI9A 5DHPA 4UTXA 1B8VA 1E3SA 4ZPJA 5U4XA 1XLUA 3WAKA 1KA9H 2D54A 4HTAA 5GZ6A 4YALA 3QBJA 4WGGA 3SDBA 3HB9A 4BJ5A 1IOZA 1BKSB 1XAJA 1M7BA 3UW1A 1MOQA 4GZ5A 4LXTA 1UZLA 3VPXA 4JYZA 3HV0A 1BN7A 2QK4A 5DDIP 3RU9A 4DM7A 1Y5NA 1ND5A 3GWZA 4IQ8A 4Y67A 4KH0A 1I2CA 1NOKA 1XNHA 4WZZA 4QRHA 4RPLA 3T7DA 3P0HA 4HLDA 5HZGA 4AJPA 5JBQA 2AFRA 5JSHA 1QK3A 3DD5A 1PLLA 2C59A 2HRZA 3H5IA 4J9MA 3Q4GA 1U3VA 3NUAA 1FNCA 2RHDA 1WR2A 1OHHD 3V1TC 1O96A 1R1DA 3NHLA 3ESXA 3PL1A 1OBVA 1ZD5A 4L5CA 2QSJA 4P92A 1FYDA 4B7XA 1FYFA 4OEHA 2C5LA 2ZBQA 5B4TA 2PV0A 3R3JA 5NLLA 1WZ2A 2ZE6A 3IUNA 5ERGB 3DDCA 2DVMA 2PRIA 3VV2A 2B69A 5C46F 2YZGA 2BISA 1KAEA 3UA3A 3IA2A 2WG0A 3H9BA 4M8IA 3LZCA 3PGMA 1NE7A 3K6SB 3EPKA 1JGTA 5TX7A 3W3ZB 1F20A 3WWZA 1KTIA 4I9GA 2HDHA 3EVNA 2P4EA 4LVUA 1Q3TA 2YZ2A 3HL0A 4X90A 1K6MA 4B3CA 4CIYA 3WGTA 3LBIA 2H7VA 2PQ2A 4YP5A 4E7PA 5C5CA 1JYEA 1WO8A 1J90A 2C31A 3H19A 4HMPA 2OYRA 1HMYA 1XP8A 2XIGA 3D3KA 3VTFA 3W7AA 1HOXA 3VKGA 2GYYA 4WBXC 1XZ8A 5A9TA 4S35A 2MSDB 1NL3A 2HU7A 2CJXA 2YV2A 3GUVA 4YWJA 1TRKA 3OPYA 1Y6RA 4NXMH 4IFTA 4FEAA 2GH1A 4ZV4A 2I33A 4YJ2B 2I29A 4WXMA 3ZE7A 4ZCTA 1L1EA 1SXJC 1EVYA 4QWDA 1I80A 3PC8C 5AJTA 4D0LB 4KZKA 4FFMA 1ZHFA 3THRA 3NGXA 4R0MA 2LRHA 3W77A 4GSLA 1T4BA 1GQYA 4YJFA 2JGFA 2XWBF 4ICIA 3PGJA 4GO1A 4US1R 3M9WA 3RVRA 3V6MA 1QOQB 2FXIA 2VTBA 4TM5A 2FMUA 4IZHA 2H5LA 2AMVA 2PMFA 3L6EA 4RLQA 5JS8A 3L5KA 1N2JA 4J75A 3DBHB 1C1XB 3OX4A 2P2YA 4MW7A 3M5CA 3TPCA 3LDUA 4FMCB 1ZBDA 1RE0A 2D7JA 1EXNA 2XTJA 2D5LA 1NXOA 3AQ4A 1NQOA 3DPSA 4GKVA 4KVZA 2WWVD 4ETWA 2VAVA 3GRFA 1IB0A 3O92A 2X5XA 3LX8A 5D5PA 5HCIA 1BS9A 3CE9A 4NMWA 3ZK7A 1TPYA 2JI7A 1E0DA 3RW9A 4EBDA 1STOA 1NP7A 3P5BA 4PGMA 3L04A 4Z4GA 1DS6A 5K03A 5BMVF 2PL1A 4U02A 3U3XA 4DXDA 3SBOA 1LF5A 5ITZB 2FSHA 3GTOA 3R1IA 2I3DA 721PA 4HRVA 2Q3DA 3VOBA 4J9QA 3ZHVA 4EEXA 3HA2A 3S28A 2NO4A 4HLUC 2EX0A 3WLPA 4REMA 4OHWA 1MO4A 2J30A 1DQPA 5H82A 1T2UA 1XF9A 3GLVA 4OBXA 3ITKA 3RLIA 4CEJA 4GC6A 4C0JA 2JGNA 4RWZA 4JVNA 3WS7A 4FT4A 3AI2A 2COUA 2VZLA 1SBZA 5IAEA 1UC8A 1ONOA 5DNDA 3C6BA 1JSLA 3HHPA 1TMGE 4H6PA 4BFUA 1Q74A 4S1TA 3FTCA 5HCUA 2RGXA 2CLLB 3VQTA 4HQ6A 3OLQA 2AGVA 1JDUA 1L6IA 1W5TA 5CB8A 2CK3D 1JR2A 2Z5FA 4KHZA 2GZDA 3GY0A 5K8CA 4P4UA 3WGJA 2XWSA 5AK4A 5HE9A 2O6LA 4QECA 3L0IB 5DIFA 1CRWG 1NXXA 2R8OA 4CIBA 2WSSD 5KJ1A 5BPHA 3RS3A 4QQ8A 4U2KA 1J21A 3GFBA 3K1TA 3C3JA 1OVMA 3K70B 4DGSA 1F14A 4Z8YA 3HO6A 2DR0A 2OP1A 1KI6B 3TI7A 4C7JA 2B9EA 2C2HA 2Y1GA 3JQ7A 4X8HA 2J6BA 1FX1A 1R6AA 3AC0A 2V4ZA 2HJ9A 3KRTA 4I7EA 3PGVA 3F96A 4GKKB 3LHSA 3VKHA 3IAAA 4MB6A 4MIKA 4O7VA 3VPCA 1IN7A 1WHSB 3QVGA 4O4LB 1H2RS 2C4VA 4R1MA 1QYWA 1Z83A 2H4FA 5DVZA 3A4LA 1IG3A 1ZH4A 2ZYTX 3BDAA 3GELA 3ZPXA 2OUIA 1T24A 2FEKA 2GXQA 4RJTA 4YUZA 1EGVB 3MQ4A 4G0NA 1ZM3A 4IVRA 2P30A 3T94A 4C4YA 4F1WA 1E6EA 3DC7A 4I3HA 2REQA 1NFQA 1QZ3A 2JAQA 5LJLA 1Z2OX 3EJ6A 4JKOA 3GLIB 4CF5A 4NBWA 1PK9A 4LJ7A 4LWOA 5KNBH 5AVOA 1KPGA 2B98A 2QN3A 3DTVD 1QRTA 3T3MB 4RNMA 3ETGA 2O23A 4GPIB 1CR1A 2QVXX 3WMRA 4MYHA 1KMNA 2OAP1 3CTPA 5C7IO 1AC5A 3ROGA 3GLIA 2WUGA 3PIRA 2PKXA 2PX8A 1NF3A 2FSVA 3KHGA 5EZ6B 2AMYA 1R8YA 4BVEA 1EX7A 4NE2A 1N6PA 1NQWA 2J1LA 4EG6A 3M7IA 2GYVA 4EW3A 2QP3A 2BFBB 2JEZA 2ZT7A 1JG2A 1Q7TA 2FSUA 3GNSA 1YULA 2IJGX 3FIUA 4PNPA