2FPGB

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
393
structure length
393
Chain Sequence
b'MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 123
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fpgB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fpgB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgB03
1B6RA 4ME6A 3U55A 1BXRA 3KREA 2HGSA 4YBZB 3RV3A 1KJ9A 4FFMA 5BPHA 2NU6B 4O4HF 4YAJB 4WD3A 1E4EB 3WO1A 4MV7A 5C1PA 3ETHA 2FB9A 2CNVA 4NYEA 2W6MA 3K5HA 2YL2A 1EUCB 1GSOA 1BNCA 2NU7B 3ETJA 3VOTA 1GSHA 1OI7A 4O2AF 3JZFA 3VPBA 3UFXA 4MV3A 2QK4A 2W70A 3KAKA 1DV2A 2R7MA 2I80A 5JVLA 1GGOA 4FU0A 1GLVA 4O86A 2DLNA 3V4SA 4C5AA 2IP4A 1B6SA 3MJFA 2YZNA 4FFOA 4I50F 3JZIA 1VBGA 2R7KA 1JDBB 5HBRB 1CQIA 5JVDF 1JLLB 5JQGF 2Z04A 2FP4A 3I12A 3SE7A 2NUAB 4FE2A 5CAEB 3G8DA 2R84A 4WBNF 1DV1A 2VQDA 3VPCA 2W6ZA 1I7LA 3V4ZA 1OBGA 2X0SA 2GLTA 2NU9B 2FPGB 2R85A 4IZOA 4I4TF 1EHIA 2GQRA 4I55F 3K5IA 4YB8B 2YRXA 5LP6F 1KUTA 2GPSA 2ZDHA 5H80A 5IYZF 4IWXA 3RFCA 2NU6A 4XYLB 2GPWA 4O7NA 2R87A 4EG0A 3E5NA 3Q1KA 1PK8A 4HR7A 2XCLA 1ULZA 3N8DA 2YV2A 4O81A 2I8CA 1WR2A 2GQSA 4YAKB 1PX2A 1OBDA 2XD4A 1IOVA 2VPQA 1AUXA 3HBLA 3TIGA 4TUYF 3HO8A 4IIJF 1CQJA 4M9UA 2FPPB 5BPFA 1JDEA 1VBHA 4MA0A 3ORRA 4XX0B 1CE8A 4O7VA 4O7SA 2FPIB 1EZ1A 4O4JF 1KJ8A 2NUAA 1IOWA 4TV9F 5CAEA 1DIKA 2PN1A 3NUAA 1Z2NX 1A9XA 2V58A 3MWEB 1KJQA 3GIDA 4O7TA 4O2BF 5CA1F 1VKZA 4O4LF 2NU9A 2J9GA 4XYMA 2YZMA 2NU8A 3N6RA 2FPGA 4XZ3A 2DZDA 2SCUA 1EUDA 4HNUA 1CS0A 5DMXA 5LYJF 1KJJA 3OUUA 4E4TA 4HNVA 3TQTA 5FNVF 2W6OA 2VR1A 2Z02A 2YV1A 3RV4A 4FGRA 3VA7A 5JH7F 1C30A 1SCUA 4O7YA 5CA0F 3UFXB 2CNQA 2C00A 4MV6A 4Y8VA 2OLSA 2YYAA 2ZDQA 2V59A 3U9SA 5GONF 4IHJF 2CQYA 4TV8F 3MWDA 4O83A 1W93A 3U9TA 4ZHQF 1JKJB 3LP8A 2W6QA 4FFRA 4YBZA 4MAMA 5KKNB 3WO0A 4ZQIA 4YAJA 1CQIB 3QFFA 4MA5A 4ZOLF 1E4EA 1KC7A 3U54A 3VMMA 2FP4B 4O82A 2W71A 4C5CA 1EUCA 3AW8A 3JRWA 2NU7A 1UC8A 2R6FA 3ORQA 4EGJA 3OUZA 1KBLA 2YWVA 2ZDGA 3BG5A 1M0TA 4YJ3F 2YRWA 4C5BA 2PBZA 2CZGA 4MV4A 5C1OA 5EZYF 4L1KA 3AX6A 4ZI7F 1M0WA 1KEEA 3R5XA 5HV6A 4O4IF 2PVPA 4O7WA 5D8DA 5HBRA 4O7RA 1JLLA 3Q2OA 5CB4F 2CNUA 4RZQA 3HB9A 3K3PA 2DWCA 2DIKA 4MV1A 3RUPA 2V5AA 3R5FA 4O7ZA 4MV9A 5BMVF 2WYOA 2QF7A 4IWYA 3WNZA 4O84A 4O7LA 3TIIA 2R86A 4DIMA 2W6PA 1T36A 5JQWA 2YS7A 2YS6A 1UC9A 4DLKA 4YB8A 1I7NA 1CQJB 1JKJA 3PFFA 4XYLA 3VPDA 1M6VA 3GLKA 5J2UF 2I87A 4YJ2F 1C3OA 5J2TF 3TINA 1Z2PX 1KJIA 3R9RA 3DF7A 4EGQA 3KAJA 2R82A 3JRXA 5KX5F 2YZLA 5C8YF 2CSUA 3TW6A 3KALA 4YAKA 5LA6F 2R7LA 4MV8A 2R7NA 4XYMB 2NU8B 4XZ3B 5LOVF 3LWBA 5K2MA 2SCUB 1EUDB 4HQ6A 2FPPA 1Z2OX 4HNTA 1AUVA 3G8CA 1EYZA 3R5HA 1GSAA 4XX0A 3DMYA 4FFPA 4FFNA 2YZGA 2FPIA 4QSHA 2HJWA 3R23A 1SCUB 5LXTF 2P0AA 5I47A 1A48A 4Y8VB 4FFLA 3MWEA 2YW2A 2W6NA 1W96A 3MWDB
chains in the Genus database with same CATH superfamily
4MIYA 4R2MA 5I5TA 1KIMA 2R25B 4TXNA 3PC6A 4KR3A 1TWGA 1V96A 5L7WA 1N8KA 3N28A 3U6BA 3O73A 2HCFA 4QYIA 1D2RA 4P4SA 4A3JG 4V3BA 2FWIA 3JZFA 2IZ0A 2OBBA 3CISA 2JLWA 4PO3X 2I80A 3ENWA 1YL7A 5CR5A 5DEIA 3OPYA 3KJFA 5IJWA 3ZUPA 3AP2A 3H0CA 5I5YA 2H9AA 2QRGA 3R77A 3H1PA 4KVZA 2EW1A 1XLUA 1QYDA 3ZDQA 4A4DA 2P27A 4Q82A 1GGJA 1U7WA 4J1NA 3DDWA 2VHCA 1U0NA 4OQXA 5BMVA 3U80A 2X0RA 1GCAA 3JZMA 2OKGA 2X4DA 3WWJA 1X7HA 2AV6A 3IJ5A 5DLGA 1KVRA 5H5JA 4RS3A 5A6VA 2R8JA 3DE1X 1MB0A 1P7WA 3D1JA 1YS9A 5HZKA 2H11A 1A9ZA 2XCLA 4XOIA 4CFZA 5I9BA 3EG5A 5FULA 2JANA 4BY9E 2REQB 1U99A 4J4TA 5ARCA 2EAUA 4MEJA 2AQHA 4YP5A 2VAWA 1OYVA 1VKJA 2RHDA 1H0KA 2MYUA 1CKNB 3DFMA 1NMZA 4Q37A 3TLKA 4KK3A 4LYFA 1U98A 3N42B 1ZWKA 1D0SA 2WWGA 3FOZA 1L5QA 2R1VB 3I6YA 1YRLA 1L8LA 4I6JA 4KQ9A 1Z6PA 4JBHA 5CBKA 1H42A 4LE2A 5LU9A 4JLKA 1MIOA 3B52X 1Z26A 1HFWA 3QX3A 5JISA 1PFVA 1N8SA 1T6YA 1T8RA 1V1MA 1ZXLA 4ENSA 3C6BA 1UMCA 3MPUA 3OQOA 4ZVLA 1JJ7A 4ZDWA 2WSMA 3SZ3A 1K7XB 1NLFA 5IVPA 4J8PA 1X7WA 3VBEA 3ONNA 4KGXA 1G9SA 2QUIA 4LHSA 4DMKA 4MVJI 2PO7A 2JEZA 3INTA 4OLBA 1OLSB 4ZHQF 4KOEC 4CL0A 4NFYA 1FP2A 2DP4E 3KJGA 1E96A 3NANA 1ECGA 2R62A 1U9CA 3T9FA 1ZEMA 4B3JA 1PT8A 2PCJA 3W34A 4RDXA 3V8BA 3OURA 4AJ1A 3QU5A 3KOMA 4EJ0A 4G2NA 2VKQA 3AJ9A 2FSPA 2ZT6A 1NJ5A 3QUQA 5LZ7A 3PJGA 2CZGA 1LV8A 1W4BA 5HF6A 3ZCRA 3DM5A 4KGDA 1AKUA 1YS1X 1C81A 3FHJA 3TAHA 2BGWA 2NP6A 3SZMA 1XJQA 4JQZA 2AZDA 3E22A 1XA3A 5SYMA 4AZ0B 1Y5RA 2Z8XA 2C4MA 1DT3A 3KOWA 3GTKA 1YGPA 3NCHA 1R10A 4PIVA 3NUGA 3KBBA 1DKNA 4HLNA 3DZJA 3SJ7A 5J2TB 4ABTA 1DRJA 3H42B 1BYUA 1XTSA 4LFAH 4YV1A 1JKJA 4AJHA 3WOVA 1R6TA 3H5TA 5EJ4A 4RM2A 2GM9A 2Y77A 4TWRA 5AK4A 4XYLA 2ZI3A 5REQA 1RJDA 2CD7A 1CPYA 2GWHA 2P2LA 5I4CA 2ST1A 5CPBA 1NTRA 1QS0B 3DJFA 4F50A 1BGVA 3OOYA 3HCWA 4ZCIA 5IKEA 5ALQA 5BWRA 4U7TB 1YFZA 3BDVA 5CT9A 2X58A 5KYWA 4CM8A 2AC2A 1UP7A 5DIFA 4A93G 3SC6A 3Q72A 1Q57A 5FOVA 4X8LA 2I65A 1U1FA 2Q5FA 3B1YA 4ISCA 3RUHA 4ZT5A 5CT8A 3HOYG 4OVKA 5DPMA 2YWGA 2Q3MA 5BUQA 4LMPA 3DT9A 1KY4A 2IVZA 5DI3A 3TQCA 3TLJA 2QROA 1B6RA 1AQIA 2ISSD 4NXNH 2W4QA 1XVIA 1H9BA 4CMBA 4CF3A 1Q7GA 2YCHA 5JVDB 2PSFA 2YL2A 1ZUHA 3BXFA 4DQUA 2EEZA 1KS2A 1OROA 2BM0A 3IE1A 1BH2A 4DE5A 2VRCA 2L69A 2EJTA 3NCTA 3ON5A 2W2LA 2O07A 3K9QO 3DR3A 3RVOA 1Y9EA 1GYFA 1ZQ9A 2PV7A 1HE4A 1TUBA 2X7HA 1NLUA 2WWHA 3NGXA 4NE7A 1IY0A 4H1WA 3U3ZA 2D0OB 5H7XA 4UQLA 3R8FA 1ZIYA 4J2HA 1A9XB 2A0YA 4K03A 5DK4A 2FW7A 6LDHA 2IOFA 1N1EA 2G5PA 2WIJA 4DQVA 5AKKA 2EKBA 1J2TA 4AY4A 1TVKB 4FE3A 2RGAA 2XNHA 2B94A 4Q12A 3H5OA 2PL3A 5TARA 2CBGA 5G1NA 1RWWA 1HE8B 4V0OA 4YCDA 5DGDA 3ZWBA 4K8OA 2X14A 4J75A 1E2IA 5ILGA 5ES3A 4BC0A 5JXJA 4XYEA 1JT9A 1UODA 1DB3A 1MC1A 3G6WA 3ENQA 3DTGA 3QW4B 1U7XA 3T7JA 2VQSA 1JZQA 4B2IA 4UBOA 2YY5A 3DYVA 1U7HA 4IIJF 1XZFA 2EFHB 4RE5A 3U4HA 5TEVA 1WIWA 5FOSA 2C1EA 3DM9B 3TE6A 1SBYA 1B93A 5KQGA 3GEHA 4M38A 2FLKA 1Z7WA 1PVVA 4D82A 3GG2A 5BUSA 4HDSB 1C8LA 2IBKA 4NFHA 1GA4A 3VDNB 1L5ZA 5FL7A 3GNTA 3KJIA 3GXBA 4TROA 1XC7A 3ND7A 3PICA 4OY3A 1Q15A 3ELYA 3PNMA 1DSSG 2B20A 3VA7A 4NZYA 2WNSA 3MAGA 3EXG2 4GPD1 1FFAA 4PG5A 1KI4A 1N7JA 4BGUA 1X0VA 3SX4A 1E18A 2OQVA 1M6YA 5DHSA 1N77A 4YJ3B 3G5LA 2BFFB 4NVRA 2EP7A 3RBZA 4EFDA 2O0JA 2X5RA 1M67A 2FX2A 4L4YA 4AF8A 1KFEB 1FJGB 2IHZA 2VJOA 2DHDA 4C5CA 1Z0IA 1NDHA 3JU3A 2W6ID 4IQ8A 3D3JA 2CV1A 1M1ZA 3OZBA 2RHJA 2XY4A 3PNBA 4GMXA 4ECRA 3R20A 3DEKA 4HYTA 1UWLA 2YJGA 2A7QA 3KLOA 1W5EA 3LBYA 1VB5A 1JA0A 4L1KA 4FT4A 4EY5A 4R0NA 5JBIA 3SMVA 4X1OA 2KSWA 2P0EA 2AVDA 1ONSA 4BC1A 1P3JA 4BVBA 5JS7A 4F4ZA 3G85A 1BDHA 4UNIA 5K0GA 3VNBA 1AVTA 4JYCA 2WFAA 4CTKA 2QLMA 4RB1A 3ROFA 1D1SA 4L7QA 1OF1A 2FLPA 3V8VA 3L4BC 4ZAWA 4L08A 3DZHA 1U81A 3GLGA 3H9QA 4WESB 2WJHA 5BYJA 5I8PA 3JAKB 3FOEC 2VOJA 2QQEA 1ORDA 2I4MA 1SURA 2AKYA 2BTQA 1C8KA 2P11A 3TM4A 3B38A 2BC9A 2P7IA 1J5XA 3CVOA 3OP4A 3QVMA 5ALHA 5FTJA 1PG5A 2IOFK 1IXYA 3RUAA 1EYZA 2JVKA 1UK8A 4X3CA 4ZGGA 5LD2C 1S10A 4IEEA 3HJRA 2IYNA 2O8FA 3V34A 4EPVA 2JEGA 4WVFA 3B48A 4BBAA 3NTUA 2MSNA 1IG3A 1IEVA 1PEDA 4CEJA 2UZ1B 4P34A 3LBAA 3RFXA 2QRJA 3OIDA 5DK6A 3EOBI 3QWUA 3BFVA 1F6BA 4S3MA 2H65A 5D5HA 3DE0X 4N3BA 3MQ4A 2W9XA 3R74A 2FPOA 2RHRA 4TYWA 5LP1A 2VSQA 5ELLA 3QXHA 1WRBA 4RZ2A 4UAJA 4H17A 4LWZA 3QFCA 2WPDD 1TZKA 2GMWA 4BB6A 4DW8A 1ZU5A 1KZGB 5HQJA 4BTLA 3NBFA 2XOEA 5FT9A 3COVA 2XHZA 1M6HA 3EF1A 4OQQA 2PPLA 2B61A 4IXDA 4ALLA 3FPSA 4D9IA 1VKOA 2BAGA 5KVQA 1QFJA 5BW8A 3TSAA 4Q0MA 4QOJA 3KEQA 2YYSA 2BHTA 4EA8A 3EVAA 2A9JA 3MQ2A 4D1YA 4LNAA 1W48A 3GJZA 1HY3A 6GPBA 4G0YA 3HB7A 1D2GA 3SKVA 1X86B 2C22A 3L1VA 4UTZA 2JI9A 1W1IA 4B32A 4TMZA 1LPAB 3EWAA 3TCNA 1PZXA 2QPTA 4WADA 2QE7A 2J6UA 5KNCD 2W2OA 3JQ9A 2D7CA 3RBEA 2UUOA 3OI7A 1QK4A 1WPGA 4UU8A 5AFSA 3SC2A 2R96A 3H9UA 4LK3A 3UATA 5CG1A 5HS4A 3YASA 3BYZA 2BFDB 1SXIA 1G0OA 1Z5ZA 5EJ7A 2EYQA 4FGUA 4AP6A 3CZ9A 4ZQGA 5KNLA 4MVJF 1TWHA 2BFMA 3DWIA 1A4RA 4MZDA 2XQVA 2X5KO 2VTBB 3DNFA 4WNCA 1U3UA 1DEXA 4A16A 5KFHA 3MWEB 2QENA 3F49S 4QT4A 1YGYA 3NOQA 3A0RB 3RVLA 4REMA 3N6RA 3CN7A 3KPUA 3T7CA 4JP8A 2XKBA 5DM4A 5C80A 3WJ2A 3AMVA 4WK0B 3FCOA 2VDNB 1D5CA 1G3QA 2ZIGA 7GPBA 3L41A 4J0FA 4JVMA 5JSZB 3IV7A 1SCUA 3QTTA 5FOWA 5A3RA 3DLHA 1QO9A 3WB0A 4C4XA 3L0DA 3HOZG 1SC4A 4NENB 1N25A 2H8KA 5LLTA 1N56A 2VRWA 5AXAA 2VT7A 3SIWA 3KYJB 4C7BA 1BRMA 1W4AA 1UBRS 3UHJA 3VOAA 5AW3A 3S7ZA 3O95A 5K4GA 1WSWA 4QVKA 4Q01A 4WBSA 2X77A 4FKBA 3CGWA 2TECE 2F8TA 4BVHA 5KVCA 2H7XA 2NO6A 4FVTA 2ECFA 3WL4A 1MRZA 4FLFA 3JV7A 3PPXA 1TIKA 2H5LA 4D8UA 1KGSA 2V8BA 3A2LA 4OX9H 3SYRA 4G0MA 3GYBA 1XA0A 4UDOA 4QJFA 4PLTA 2I2FA 3WYEA 4WFJA 4J1TA 3GLUA 3NZEA 5GV8A 1K3TA 1O0SA 1O97C 1KEZA 1I0ZA 5DSXA 4YR0A 5FR1A 1XDGA 3DTVD 3A6ZA 3QOFA 1YT5A 5BSFA 2V1UA 2JGDA 1KOJA 3TLEA 1ZMRA 1E2UA 5FHRA 1WX1A 1VPWA 3TLYA 1J8QA 4WQMA 3KU1A 3H7IA 1N5KA 1T3TA 1EUQA 1UK6A 4ZZ3A 4YCLA 5CXQA 1F9AA 3JS5A 3DF7A 2KS6A 3NGDA 4YECA 1XSEA 3JQ9C 2W93A 1T13A 4EQ6B 2V4MA 4TXJA 4GI7A 3LYAA 1T8YA 1QIFA 2D74A 3T5JA 5L7TA 1QZXA 3ZWAA 3BFXA 1TKRA 2HHFA 2JGLA 3Q3EA 4DUZB 4MPPA 4BMZA 4R9VA 4BQRA 4JI5B 2C95A 1NX9A 4NE9A 2PMWB 2D6FA 5A2QW 4LMYA 1HLPA 2WB1A 4NU8X 1CNMA 2QN6A 1X1BA 3L7LA 5HIKA 4HAXA 3MINB 3KE8A 2P6UA 1F0NA 4QAQA 3BQ9A 4RY0A 2DM6A 1K6JA 3K70C 4RMNA 5KT5A 4CI0B 3PPIA 1C4WA 1NWCA 3NKVA 3BRSA 4R8KA 1ONBA 3QU4A 3AHHA 3JQAB 4PGMA 2HJHA 3A6JA 2XWSA 3QEKA 1AT1A 4W63A 1O6CA 3CUVA 4FHEA 1K0FA 3RT7A 3T3IA 2XWJI 3I5MA 1RPJA 2HJRA 5BW6B 2CZCA 3K9BA 2C2WA 1QP7A 2O6LA 4MTCA 2IXDA 1SUSA 4BZQA 4HEA6 4ZV9A 4BVEA 4PS0A 3OCVA 1A4UA 2FE1A 3SZRA 3GJSA 4F7WA 2DPLA 1WXFA 4MDEA 4E14A 3IB3A 2BGJA 4N8DA 3EEFA 4TL7A 4J9RA 4G1VA 3T7AA 1SUPA 1L7VC 5EINA 4UUQA 2A78A 1N5OX 1JIVA 4JMPA 3A3KA 2J45A 2NO9A 3JQ7A 2HF8A 3TPFA 4AKHA 3R2JA 1M33A 3IEXA 3KKKA 3RCBA 5EKUA 4J1TC 2WFZA 1FL9A 4RO0A 4DHWA 2QX6A 2ZXUA 1XZQA 4Z4GA 5ESRA 2BKVA 4FCVA 4ZQCB 5B57C 4Q7JB 2VDKB 2HD4A 1PWHA 4NCKA 4B79A 1H65A 3T7KA 2I2AA 1DHRA 4MKFA 4DQKA 1XEWX 5LL6b 5DXAA 4AQ7A 4KWHA 1CVLA 3UCXA 1U0SY 3L4EA 3UTCA 4KAAA 4QC2A 3GLIA 1NQTA 3B2QA 2DCUA 3GGCA 3IT0A 5BQPA 1SVMA 2YQ5A 2XLBA 2FSVA 2UUBB 5A0VA 1H0SA 4P53A 2YWJA 4MGKR 2UUPA 3STYA 4L74A 5CDHA 4Q03A 5BWNA 1JMVA 4TWZA 3T7DA 2GM3A 4FYKA 1I50A 3DKRA 4UBIA 4FXOA 3W5DA 1CNEA 1HYHA 2QY9A 3KYBA 4X7BA 5AVVA 5JNTA 4I9FA 4JI7B 1Q16A 2Z5GA 2XXAA 3VZSA 4BJ1A 3N8IA 4KQWA 4O4IB 4CQJA 3WXMA 1T2DA 4QQ8A 4D25A 1VG9B 4J9KA 4JLMA 4DZRA 3JRWA 3M6LA 3BEDA 3WE7A 2GD6A 3H84A 1WBJB 1R4AA 1AS3A 3ETDA 1XLTC 3IP5A 3WFZA 1EFRD 3F5SA 5D5PA 4XR4A 4UXHA 4RA6A 4GSKA 2HMUA 1RAAA 4FOSA 2XDYA 2J3MA 3ANTA 1HBJA 5HV6A 4BHTA 3HG7A 2JFQA 2DH5A 4DWWA 3L7KA 1GKYA 3CX4A 4UEOA 3KLPX 1ZJ5A 2HIGA 5T5QA 5EHZA 4TS4A 5IJ0B 3AKYA 4WY8A 3FYCA 4MQBA 421PA 1A9QA 3K05A 5DNEA 2ZWAA 3DHWC 2R86A 2A1HA 4XPZA 1J0XO 2FXVA 2F1KA 4QJIA 1AO0A 5M34A 1ZCFA 1T5LA 3B6EA 3UGKA 4CU5A 5F9MA 1S3IA 1ESMA 2V7PA 1N7IA 4MW6A 4QEZA 2OUIA 2F1HA 5KPJA 4DLUA 4RAQA 4QBHA 4GEGA 4EMSA 3KQHA 4EKYA 3GQCA 1E6LA 3BRWA 2Z4RA 3AEUB 1VCHA 5BV2P 1Z6TA 1PJZA 5G0SA 1Z2OX 2EEPA 3EN0A 2RE8A 3LO5A 2AEJA 1SBIA 1PR5A 2CCKA 4LXYA 1UDCA 1GTZA 4DLSA 1FP1D 4XIJA 1NJ8A 3LY5A 2WIDA 4DGSA 2WILA 3U0VA 1NOJA 4BV2A 2I4RA 4HVTA 1E2EA 3HEAA 4YJ2A 4QGBA 3FOCA 3CVXA 4JXZA 1BXRA 1YTLA 2WUDA 1LF5A 4CCSA 5DAAA 2FSVC 5BPHA 3WWCA 3QMWA 2WDTA 3VNUA 4L8GA 1XZLA 1NZFA 3H9JA 2V7UA 2HTEA 4NYJQ 1O95A 1QGDA 5LLDA 1PT7A 2XIQA 1LSOA 1CB7A 5JJCA 1B3BA 1GZ7A 2BTOA 2WOJA 1KVTA 4OQEA 3EBLA 3D3EA 1A7JA 2V5UA 5TPWA 5F9NA 1VLVA 5FWNA 1F8FA 1TK2A 4IDOA 4QFCA 4BNFA 1PJTA 5DTQA 3SVTA 1XNQB 3SHQA 3KB2A 3HA5A 4XIYA 1H94A 3BBPA 5EMHA 4JU9A 2BKXA 3W9BA 3MFIA 5CCXA 1U3FA 2RDMA 4EG1A 3I83A 3QX7A 1SYXB 3SE7A 3ELUA 3EASA 1N0VC 5LMNH 1GYPA 3O4FA 5FTKA 4AURA 3HGQA 1BCSA 1AU9A 4FEEA 5EJ6A 2V97A 3FUUA 2AMJA 1N6PA 1A5AB 1J4AA 1GTJ1 3QELA 2YWEA 4AN1A 3KX2A 3SU8A 1MJ5A 2IHBA 4RX1A 4OHYA 1QFMA 3GFTA 4IXMA 4AMUA 2VKTA 4PHFA 3D8UA 1VGVA 4C05A 1USKA 4BXOB 2WWWA 3C6MA 4ARUA 3E70C 2UZ3A 4ETIA 2O1XA 3I6ZA 3VJKA 1V1RB 1VXRA 1I1NA 4MO9A 1DIGA 5JLJA 5KYXB 4RADA 1C3XA 1V3VA 2XWBF 4DV5H 1TA8A 2IYUA 3K1AA 4D8VA 1QXSA 2R8GA 3O8RA 2YZMA 1I8TA 2FPGA 1UKCA 2K4MA 4ROTA 1FX0A 4LMRA 1CY1A 3GJYA 4HJRA 1SG0A 3EGOA 4Y0NA 4H6PA 1M5UA 4JT4A 5F33A 5NLLA 3T15A 2HW8A 2YQ4A 1KKUA 4N82A 3UH1A 2Q5LA 4B81A 4BX3A 3WDLA 2FSFA 4O83A 4YK7A 1I3CA 3QUCA 3ABOB 3KPJA 5FUYA 1SG6A 1PJCA 2EV9A 4S12A 3K2QA 4E46A 5HXAA 3L0YA 4FYYA 3WAJA 1DBPA 3DO8A 1DE0A 2RJOA 1PD0A 1GARA 3IOYA 5KHLB 4RUCA 2UVDA 1O95C 3HZZA 3UWMA 2QRVA 2EW8A 3OFSA 4RV9A 1YC2A 2J7PA 3WGIA 1W5AA 5FCDA 5LZ5A 3WRYA 4POOA 3C7KA 4JUIA 1JXOA 5HZGA 4IRCA 4E33A 1ADCA 2YC2C 3JD1A 4FS8A 4RKYA 3B70A 5LKRA 2FMFA 1WUIS 2PZBA 3WB9A 1UZUA 1ZC3A 1L4MA 3TJRA 1PU2A 4DIOA 2AC4A 5ALRA 2W6JD 3HPRA 1QV6A 4WLNA 3LM8A 2HB6A 2YYYA 1SHKA 4Q3LA 4AKIA 3TSWA 1YRQA 2WZCA 2ZS7A 4HS9A 3G7NA 3RJ0A 1DQNA 4N47A 2VA8A 3KP1A 4QWAA 3CKYA 4JP1A 1BW9A 2AQKA 4GQBA 3O9ZA 2P5TB 3TOVA 2HJSA 1ZHHA 1QHXA 2DTDA 4NBKA 2RARA 5FPQA 1WDMA 3D5QA 1WXIA 4LRXA 3GN1A 4IFBA 4KNYA 3QRWA 2JD2A 1M9NA 3OLCX 1HURA 2WEKA 4IDEA 2G1PA 1U11A 1G9XA 1C4KA 3GLQA 1OCEA 3WMXA 1ZN9A 2JLSA 3KZKA 5IM4F 1WULS 2FP3A 2MOKA 1UK7A 5B1HA 4JLWA 3TAUA 3IVXA 1CCWA 4HV4A 4TKMA 4ASUD 4DDUA 1Y3AA 5BOVA 3I9NA 4KO3S 3KTMA 2OXCA 3PGA1 2B34A 9ABPA 2FF5A 2QQ5A 4DOMA 4ABYA 3RSGA 3KZVA 3TVDA 4JUBA 1F6DA 3QUTA 4RFVA 1RVV1 2PKQP 1CC1S 4IGEA 2IDKA 4DPKA 2W2XA 1HZZA 4QHTA 3R6LA 3TXXA 4D56A 2ENWA 3DVSX 2Y68A 1V2HE 2W8BA 5KTKA 1YZLA 1VLQA 3OQJA 4I4TB 2R7KA 2Q9CA 1KK3A 1D7AA 1CP3A 1TAUA 4YRLA 5CLLA 2VA3A 4HXEB 4ZP1A 4I66A 3GPLA 3A2KA 2G6TA 2IS4A 4NBVA 1NNUA 5K3SA 1UQRA 2CHUA 3QMMA 3BDIA 2Q6OA 5EP1A 4EVRA 1I6LA 2Q5IA 2I1WA 5KYGA 4B3FX 4OI4A 4WE3A 5ALDA 5DYTA 4S24A 3VU0A 1AKNA 4KFTA 1G5TA 5BSRA 1JNYA 3DE2X 1ZD5A 2D2FA 3TB6A 1JQBA 3OUTA 3KQOA 2PSDA 3DDZX 1QHFA 3OZIA 5IM5A 2X9VA 5JD5A 1S03G 1UBTS 3AF0A 4YT4A 3TW8A 3MIIA 4RDCA 2JEOA 2REXB 1LI4A 3ZX4A 3PXUA 4EG4A 4BO9A 3C6XA 4U2FA 4I4LA 4M1TA 4WJLA 3FNEA 2RF4A 1FNMA 3I2HA 3GTPA 1JIJA 1ICIA 4LJ6A 1U9JA 1LDYA 3H5WA 2JFYA 5E4FA 1NQOA 4LDPA 2ZBQA 1KKLA 4QUKA 4AYTA 3BH0A 4J3FA 3NBZC 4IICA 1P61B 4FOPA 2HHHH 4DRZA 1IY8A 2P9FA 4V2IA 4XVQA 1MA0A 3CNQS 1OZFA 4IIVA 4QOHA 5P21A 1ZOPA 2GUWA 5BUCA 1UOOA 1C8BA 1GCIA 1YZKA 4K46A 3LCRA 1X9NA 2ZRDA 3IVMA 4YMVA 3C8HA 3IMCA 1U8EA 1MTZA 5HIIA 4Z4CA 1DJOA 4K6NA 4KIJA 3GTMA 4ND6A 3O8LA 2KLHA 1GCGA 1VJCA 5L9XA 2Q1TA 1C3OB 1OZGA 3EZLA 3PGXA 4BO1A 1T0BA 4RXTA 4C89A 1T5TA 4QBFA 3RRJA 3EB9A 2ZGVA 4J03A 2XT0A 3KOYA 3LJKA 3KJXA 2ZDGA 3TLZA 2ANCA 5FTMA 4DCTA 3OH8A 3LBNA 1VJGA 2PS1A 2ZVPX 3ROKA 5F1KA 1XEFA 2OY0A 2AQ4A 5CNKA 1FB5A 1TEXA 2BR3A 4PPYA 5HSGA 3CEJA 1CLEA 2VQ6A 4ZOQI 1C0EA 2XB4A 3F90A 4ERXA 4I14A 4TL8A 4B7XA 4F4WA 1Q83A 1JEAA 4PHTA 2DY0A 3FWZA 1R0YA 1II8B 4L4RA 4LYEA 1VPLA 3CRNA 1VAJA 3AG5A 3G2QA 4YAFA 4J2OA 3H3JA 1TRHA 1FYVA 3NDRA 3IEKA 3JASA 2YJ3A 5FIUA 3K16A 1Y6JA 1MEEA 4UFNA 4EI2A 4L9AA 1R1DA 1W4CA 4YJDA 4QO7A 5SY4A 3TQOA 2QRHA 3OC6A 3H4TA 4P0TA 3GFPA 3PGJA 1NNI1 3DDHA 3RW9A 3I01A 1QF7A 3EZXA 2IY8A 1M7JA 1NLZA 2J41A 2AFIB 3DMYA 3AI3A 2AJBA 1GKKA 3AY0A 3EXIA 2E6UX 2DJ5A 2A84A 5ICCA 3NOOA 1IAQA 5H1YA 3BJMA 4RLQA 2P9ZA 5C8XA 2KHZA 3GGPA 1ECFA 1YD7A 2J3IA 4NDZA 5DNVA 1NA5A 2GN8A 4YMHA 3D5EA 3DC7A 5FV7A 2FLNA 3FNQA 4J90A 4RELA 3C1OA 1ZXBA 1QFSA 3ZI0A 5CU7A 3K6SB 1GKUB 4LHXA 4LY3A 5F76A 1L5HA 4BTEA 2AXPA 1Y80A 4R8MA 3K9GA 2PT7A 4WASA 5FPPA 3T1QA 2GLXA 2QXTA 3LA6A 3U40A 5C32A 2J6SA 2PEZA 2QTAA 4MLCA 1XVVA 4LCEA 2IUFA 5AI9A 1IBMH 4EI8A 4QUBA 4I3HA 3DUFA 1FDWA 3O82A 1AGPA 2J0VA 2OVBA 2ZAIA 3FDXA 1C1XB 4M21A 3CLUD 2ZRMA 1QH1A 2H1WA 1P0CA 5E0OA 2GJ4A 2VQDA 3N43B 1W1UA 1BHJA 4YRBA 3H2KA 3AWIA 3ROZA 3BS4A 1K3FA 1EX6A 3WNBA 1EDOA 2K7FA 1TVEA 3AQIA 2GF2A 2WD7B 3L46A 1OAOA 1M6VB 3JQAD 4FZJA 2ODAA 3OY7A 2E49A 4MR8A 2AMVA 3W3AA 4PTZA 4FGZA 1XZMA 2FZEA 5KWSA 2FOIA 4OL9A 1FQWA 3C5VA 1N2CE 3PPWA 1W94A 1WUKS 3SK0A 5JECA 4EX7A 3GMIA 2G70A 1WD7A 4AO8A 5CA1B 5DIZA 3LYLA 3WGKA 1LZKA 2XE8A 2OFPA 3LKDA 3IBYA 4PN7A 2VTEA 2YXPX 1N34H 5KTMA 3RF6A 2ZIUB 4MGEA 5KOJB 3RAQA 4U7WA 1DS6A 121PA 1JKFA 1Z6QA 3MGGA 4BQNA 3LTNC 2FUCA 4CCWA 1T9GS 5CFQA 2NGRA 3U7QA 3WHIA 3L7BA 7MDHA 2JA5G 4DSOA 2DPIA 1X7XA 1GXSA 1KZ6A 5JTTA 3PSAA 5GZ1A 2DFTA 1S9HA 2CFCA 1NXXA 3ZWKA 1T9HA 4UUBA 3EQZA 1NMXA 1T5SA 3G5MA 3N2IA 2FZWA 5K3CA 2W6OA 3KT0A 2K87A 1B8UA 4D6YA 4L5AA 2WYVA 4MW5A 4HYQA 2NYAA 4RKRA 3EXEA 1EWVA 2GO1A 5BWBA 1H6CA 3RSHA 4DCPA 1O9HA 4C21A 3RFUA 2WKQA 1E79D 1W93A 3RYTC 5BR8H 3CO0S 1JJIA 4RY8A 1R9TA 2AB0A 2WF6A 5JFOA 3H2SA 1LH0A 2XBLA 4RABA 1OREA 4Q4AB 2PQMA 2QA5A 2WC1A 2JGKA 1JSRA 1SXJA 4I81A 3ETLA 3H0EA 3LPDA 1NHGA 1WF6A 1AN7A 4XKJA 4L75A 1KDOA 2EJ0A 3GDOA 4BP8A 2XKKA 5GM1A 4ZVKA 5DGAA 4O7RA 1Y1TA 1D4FA 2NWQA 5TJ9A 1THGA 3FVWA 1X1EA 2GXAA 3NNNA 2ZJ5A 4JJEA 3IBTA 4O3QA 3WX0A 2HU7A 1KMIY 5D01A 3I32A 5DJ5A 3QFTA 1KAMA 3QEOA 4YUXA 1MO6A 4D4JA 3N6VA 2C5EA 4WZAB 2OESA 1NBMA 1THMA 4JJ8A 3S28A 4JOQA 3IN5A 3GMSA 1SM4A 3MOSA 5K2OA 2YASA 2ZANA 1XMQB 2NVUA 1EM8B 4M1YA 4R1SA 1IBKH 3ZD9A 1RKXA 3KNZA 3FGPA 3P94A 1DO2A 2R7LA 1TYCA 3JWEA 1UBHS 4L8VA 3ZNPA 2GXSA 1FFXA 3ZW8A 5FBRB 4MSUA 2RHLA 3UPUA 4O4HB 3FMIA 2RSLA 1EEXB 1SPBS 4E5MA 1YIDA 2G3YA 3GLFB 1A27A 1ZOSA 4JYMA 4Z4EA 3BCUA 2H07A 3VR6H 1Y7TA 3V2UA 5CNIA 5JMOA 3L7IA 5C53B 2XCAA 1POWA 4LW8A 3AVYA 3GK3A 3KE9A 1F4LA 4HDMA 4UXJA 5C8ZA 2HMWA 1J8VA 3Q3HA 4OJQA 3KT6A 2VG8A 5KFKA 4LE1A 1L7XA 5AI0A 2YWDA 2HH9A 4J2TA 3H05A 2RH9B 2XNDD 1BXZA 5JSQA 3RYCB 1GPJA 2OCDA 2XGPA 1RW4A 4X3OA 1B2RA 3SYTA 4MB6A 4JVSB 4C06A 4MUBA 4R7RA 3GJRA 2XTZA 1GAWA 4XGKA 3NHUA 4E94A 2DERA 3PS9A 4P4TA 1JLMA 2FWRA 3ML1A 4BKQA 3FKQA 3IP8A 4PYOA 5J1SB 3TSZA 3OETA 5HYVA 4WBNF 5IC6A 3SX2A 1IQRA 4IR1A 3FTCA 2GTIA 3LOPA 3QVKA 1SXJC 3M5PA 3H4IA 1MZVA 3OAAD 2CGEA 1UPTA 2IW3A 1U0LA 3EPRA 2DBZA 4R54A 2FK8A 3KSUA 2G83A 4N40A 3OF3A 2ZDHA 1JE0A 3TLAA 1FTQA 4JJ7A 4QIWE 4DMRA 1NDUA 3DW3X 3D7RA 2P4QA 4FDMA 4Q45A 1Z07A 4NV0A 1SVNA 4YP6A 4F9TA 1ZQ7A 5EWJB 3HV2A 4IVQA 4C0JA 5J4LA 2Q2OA 4JLBA 2CVPA 5AYVA 3HHPA 4Z49A 4EG6A 3OESA 5AVRA 2Q21A 3ANYB 1JGTA 2WJ3A 5FX2A 3DP9A 1PV1A 3T3EA 3LX8A 3IEIA 1LLFA 1KNQA 1FLDA 4I1OA 2AE1A 1NPYA 2R97A 3DYBA 4YDHB 4YQEA 3WHLA 2C4NA 4WLFA 1WP9A 4RNCA 1RJWA 1BFUA 4BMNA 2ESRA 4YJKA 3OU7A 2QJWA 5DX8A 5HQ3A 3OLWA 1FW6A 1W6UA 3IPYA 5BSWA 2UVWA 3Q7QA 4HXGA 1F7VA 4RVUA 1VP9A 3U4IA 4R2JA 4IDGA 3E61A 2I54A 3VYSB 3TLGA 4E3ZA 3F4BA 1YR6A 2FZGA 1U8AA 3SAJA 1M2EA 2AI1A 2HA0A 2O2GA 4TKVA 3TQTA 5C1BA 1BZYA 4J76A 3ZZ1A 2ZIVB 2L2QA 2RHMA 4Q4DA 5FI5A 5CA0F 3MAJA 1FPMA 2X0FA 2VL7A 2C5SA 1S1MA 3AUYA 2Z98A 4ER5A 2EJUA 4IHJF 3IT3A 1DRKA 1P17A 4XASA 3CEBA 3SY8A 2BKEA 4RNOA 2WM3A 1ZM9A 5T4FA 4JI1H 4KAFA 3ZNOA 2VA2A 4B46A 2WD8A 3SMQA 4D7AA 5JDCA 2ONZA 2CYAA 3OPNA 4R16A 3W5OA 3G0OA 3C8MA 2OCPA 3V1UA 4E6NA 2AG8A 3ZXXA 4KMMA 3MEQA 4LSXA 5AKIA 3DKIA 3R76A 4EUKA 2RGYA 3C4JA 3CH5A 3GD5A 2XVAA 5ELMA 1IPEA 4O8CA 3PZBA 5ETJA 1QPZA 3FPGA 1WHSB 4ARIA 2RMKA 1SQSA 5GONA 4CQMA 3RYIB 4H31A 1E59A 3VR3D 2J5BA 3HU1A 4FZRA 3A1VA 3B53X 2ZTUA 2K6GA 2ZWVA 3J80W 2BGRA 5J2UB 3IIIA 1GPMA 4OIFA 2PLRA 1K8YB 1NGSA 3T3GA 2H1RA 3OZDA 3ZHQA 3RAPR 3MLBA 3B6IA 3T0FA 4LIPD 3A4NA 1T4CB 3S81A 2WYUA 3C3BA 3SYKA 1QR6A 4CTMA 1MO2A 3HKBB 1G1MA 1RZVA 4LSGA 4Z0HO 1DKOA 2GCEA 4NS4A 5AUNB 1Z18A 5C5IA 5AVUA 1PYOA 4Q3NA 4RCZA 1E3IA 4IGAA 2PMBA 2WAOA 5C8YF 4Q4JB 4RTLA 3KALA 4IKOA 4ID3A 3W6OA 4LAFA 4DL4A 4L9RA 1ETUA 4ND4A 3RIZA 2VH2A 3F47A 3OT1A 3NYRA 3E81A 3HDQA 3LU1A 4WZ6A 4XGIA 5EC8A 4L3OA 2HEGA 4O63O 4MYCA 2P4UA 1T9ZA 5FWDA 2COJA 1QDEA 1F3OA 1Q7BA 3FIUA 2FFHA 2UVQA 4QXPA 1CUAA 4RNMA 2PTGA 4CMFA 1YA4A 4YACA 2XC9A 4M83A 4UE2A 5K8UA 4U7GA 1KJ9A 3KR1A 4BUCA 2AZMA 5FA5A 4K6GA 1AQUA 1PGQA 3KLMX 2KE5A 2YOGA 4XVRA 3RUDA 4EL0A 4BKPA 2BHNA 2A3RA 3OCJA 2ODEA 1P1JA 3UAOA 1ZKDA 1YQGA 3VNAA 2IEIA 2MSLA 3CNOA 3E03A 4P1ZA 4A6EA 4Q34A 4Q66C 2PSHA 2VA9A 1Q5PA 3OM0A 5EP2A 2NVWA 4N5DA 5ECDA 1HNXH 1VCNA 1OR8A 2ORYA 4Y6RA 5FWXB 1RABA 3R3JA 5KSOA 5DI9A 1EXVA 3OWXA 3W5UA 4JEHA 3P9XA 5I5VA 4DFDA 4N6OA 2I6FA 5JDCC 2RJNA 2D8MA 1N9GB 4MVJM 1DIAA 4H4EA 3PFIA 3S0JA 3UBTA 5LIPA 3N76A 5FOUA 3K53A 2H4XA 1JTEA 3BXEA 3ZCSA 4DA8A 3V8EA 3C8ZA 5LP6F 3D8SA 4UBNA 2Q07A 4QTUB 2XB2A 2JD0A 5HIJA 4LRSB 3THRA 2YVKA 4G4JA 4I50A 2WINI 5IAGA 5AMXA 1BMFD 3LDAA 4FIZA 4B85A 5AQ1A 2OWEA 1ZJWA 4MI1A 1HFEL 4UCQA 1U9IA 3B6MA 3U6KA 4CZ2A 5BSMA 5IT9A 4B3HA 3LS2A 1KZ1A 1H1DA 1GAEO 5B64A 1N3YA 5CIQA 3RSFA 1OLXB 4F9FA 4V1CB 1A97A 2B2CA 3CF0A 3U39A 1P2GA 4C0KA 1F4PA 1FTSA 2B36A 2DH6A 3IFSA 3V3TA 2QI9F 2QZJA 4MCJA 5H3HA 3BL6A 1HL7A 2J33A 3IVGA 2F4NA 2XVYA 4Q7LA 1OW3B 5H8WA 3NATA 2L42A 2C9OA 5AM1A 3SVZA 1C30A 3HKCA 1ODLA 4Y2RA 4YPOA 4XCXA 1NRIA 3Q88A 4IYJA 3RG8A 1Y8QB 3K92A 4KXUA 5TMEA 2ZB8A 2I8AA 3LIIA 3X1MA 1HNZH 1JVNA 2GLUA 3I4CA 4X3PA 4Z0TA 3WR5A 3LQRA 3ONEA 1UWVA 1AH2A 3DVAB 4AO7A 2X76A 3GZTB 1J2JA 5C3MA 5GIOE 1N32B 2QIPA 3ZNQA 3ANSA 1OBVA 5JQGA 4RANA 4YY3B 2VP9A 3KYCA 3O8OB 5GIPE 4DDTA 2KMLA 4PZDA 5BN4B 2XA2A 4J0IA 3U31A 4JZKA 4M9XA 1N6RA 1VYUA 1PNOA 5HS6A 3UMFA 2C35B 1XD2B 1CJTC 5EZYF 2XAAA 5AI6A 4ZREA 2QL5A 1DXQA 5BSKA 2WE8A 2FN7A 1SU6A 1XAHA 1Z7GA 4LZAA 1WU8A 3UXHA 4OGWA 1RAIA 1IJFA 4S0XA 4PSCA 3PJFA 5L3SB 4RTMA 5E1OA 2XGMA 2JBHA 3CX3A 1ZGJA 3M81A 3PDWA 2FKNA 1JPJA 4DQLA 2YWBA 1D8TA 3OZXA 4QRDA 2XTJA 10MHA 4DIMA 5F12A 3LX4A 4I2NA 3WAKA 1EE2A 1UC9A 1H8HD 3A2MA 2DULA 5DASA 1QYWA 4CN9A 4KWIA 1A4XA 5A7GA 2FJUA 5D6NA 4RCNA 4V0KA 4HADA 1WZIA 4FK8A 3QMPA 4B31A 1H5QA 4RPKA 2YZLA 2WD9A 2JHCA 1GRRA 4H4CA 4KIFA 4KN5A 1LPNA 1TQHA 1R5JA 4P08A 1NYTA 4PR3A 3JQ6A 4GUAA 3BA9A 2ZUVA 2WABA 2PXHA 1U9IC 3KTDA 1G19A 2DHQA 4DR7B 1L5YA 3GTLA 1Q7EA 4DKJA 1QYIA 3I2JA 2PXCA 4RORA 4UNSA 1Z62A 1O96B 4XXHA 1DHTA 1F3LA 4PPNA 4Q4HB 1ZICA 4TWJA 1KSGA 3BD9A 3D2LA 1AQ6A 1UOPA 1WCMG 2I7DA 1E4YA 2ZITA 2CVFA 3HI4A 3GUCA 4MTDA 3GJTA 2M05A 2COUA 4ZQFA 1YUNA 2GF0A 8ADHA 2AXQA 2FEAA 4DMUB 3OQIB 1R50A 3WI7A 2JGMA 4YMLA 1AURA 1SHUX 5FDFA 4TMVA 4M22A 3L77A 1QNFA 1YTUA 1E3JA 3CCFA 3SXUB 1RWVA 5C51B 2XYVA 1EWRA 4RGBA 1JL3A 3IDOA 3FCXA 2BONA 3DE6X 1G3UA 5DGCA 3T61A 1BVYF 2WP8J 5C9ZA 3UXYA 3F7TA 1TOAA 4E2YA 4WZZA 3DAPA 3PFGA 5IYZB 1LJ8A 3VJLA 2G5GX 5I5SA 3RDPA 1ZYUA 4EGFA 1I4WA 2QTTA 3WY9A 1DDIA 3NBYB 5BN5B 4XJTA 3CVJA 2D2XA 4ZRDA 2V98A 3ZBQA 1L7OA 1D1QA 1TYAE 3ZDXB 4LDZA 2WF5A 4M6WA 1OWTA 2PSEA 1H93A 4PC2A 4YMSA 1P9NA 4KW7A 3NASA 3NC0B 3JARB 3AL2A 2QP3A 4JLPA 2C7GA 3VX4A 3KSBC 2WU8A 3MCVA 4JI0H 1VLMA 3KEGA 4DR2B 2H18A 1HDGO 1SR8A 4KUHA 5KOHA 2QVGA 4TUYF 4D43A 3DWEX 1Y8AA 2ZJ8A 2DF8A 4J9LA 3PFBA 1MMFB 3PNLA 2WWFA 3H20A 4R31A 3CSWA 2M2IA 2XUDA 2EL7A 4BO7A 3LT4A 1P1KA 2JATA 1Z2NX 1RACA 1HPLA 3ER6A 1YBAA 4IW3B 1KDPA 2F67A 4FFBB 4BFZA 3OFND 1VIYA 5FP0A 3KHHA 1T8PA 2HSWA 4QOFA 3NTXA 1Z0UA 4HMPA 1IYEA 2W2MA 5ALZA 1YCFA 3CZAA 2Y0CA 3UJDA 2DG2A 4YJHA 3AL3A 2POCA 1FMLA 4XI9A 4U02A 1VL2A 4R1LA 1J20A 3UW1A 4CLXA 1J07A 1RXIA 2ZI6A 5HKKD 1PSZA 1UBCA 4ENVA 4JHLA 2JGAA 3WK4A 5JCOA 4RHUA 2YN2A 5K6RA 3I37X 3M2PA 4E5VA 1U6IA 3EW7A 4YGXB 4YCCA 4OATA 4EK9A 3B3FA 3F8TA 2W5UA 3IDAA 5KG6A 1JEOA 3CY6A 1KOFA 1S2LA 4DBLC 3OBBA 4M8KA 2ZBPA 2O8VA 2W48A 3I42A 4YQYA 1GNTA 1GZSA 4X24A 1H1TA 1HRKA 4I46A 4HZGA 3QHPA 1C9YA 3RVRA 1OI2A 2ZUDA 1X80B 1RRKA 1ZIPA 3H2YA 1QCZA 2AMLA 1Q1GA 2PZ8A 5ALMA 2FEWB 3S2FA 4UM8B 4EJ6A 1XMSA 5CDTA 2PRIA 2VJAA 4D8XA 3ZOZA 1PEKE 4XTCS 1RMTA 1PJRA 1M3SA 3RJ9A 4GQIA 5FB3A 1OXKB 2EQAA 5CBPA 1NBHA 3HCCA 1VPTA 1WUYA 3AXSA 2CDBA 3R0VA 5J5VA 1FOEB 3U26A 2VF2A 3HJGA 4JV1A 2PX0A 3M34A 2WFLB 1U2RA 4WT7A 5CFLA 2OP0A 4C4TA 1T5BA 1AG9A 5CEJA 4H3SA 2PAFA 2OLEA 3DZCA 1M1YA 2IDJA 2MU1A 4MW1A 3HU2A 3F46A 5A4KA 2W9AA 5E25A 1GO3E 4MITA 1MU0A 4JV2A 4X41A 1QVWA 2R6CA 1YHYA 1NP7A 2GHRA 1CR6A 3ZHXA 4UNQA 2PBFA 3WRVA 1YACA 1E1MA 3AVQA 2EFDB 2WAQE 1VP3A 1ZJYA 2A8YA 4YRIA 4HJXA 4TRMA 4ZO8A 4P84A 2WUWE 4EFMA 1K7YA 1XD8A 3MWDB 2N9UA 5E7QA 4IFEA 3E2PA 5BWTA 2GZRA 2O2DA 3VDRA 1RNLA 2C4WA 1KU6A 3GHYA 1BMTA 1RYYA 3BL8A 2CC2A 4DZTA 1I3NA 4ZOLA 1TU3A 5JJBA 1TJ4A 1RIIA 3P9SA 5GJWC 1OKKD 3AFGA 1XAGA 3IC5A 2EKPA 2E48A 4MJLA 3FPKA 3H3XA 3UM9A 5CYGA 2JJ1A 3RYFA 4U0KA 1QGUA 1F1JA 4QJ5A 3N3AC 3RHZA 2XQIA 2HDNB 1ODIA 3OJ0A 3EZGA 5JCOC 4P4NA 1CQWA 4KZPA 2WZDA 1NP6A 2X8BA 3AVUA 1DV1A 1XVLA 4B1FA 1ULAA 4PV7A 1XTPA 2X0SA 2LKDA 2R6JA 2A0KA 1MGOA 2XMQA 3MGKA 2JK0A 1WRVA 1QIJA 3HUFA 5JWHA 4LF7B 2YNMD 3LT1A 1IB6A 2MHCA 1F0KA 4RGVA 3ZWWA 3GP8A 2GPYA 1E0AA 1K2VN 1RBQA 5DCYA 2A0FA 4FP9A 1NFFA 2HZ7A 4DVGA 4A26A 4B2PA 2YHUA 3TUZC 1K4KA 1TD9A 4P83A 2WU4A 1HM5A 2M32A 4KI7A 2GNPA 1EWTA 2D4HA 1NY6A 3VVCA 1GGVA 2PS3A 3IHWA 4UAVA 1YB6A 1YDEA 1UQUA 4JLVA 3WZLA 3M9NB 2PLAA 2FRVA 1Z4LA 2CVZA 1ZD8A 1QO0A 2ZYHA 3COPA 5JJKA 2DQYA 3WA7A 4RU1A 2PGOA 1ORWA 1MR3F 2OP1A 3HY4A 2IF2A 4PBRA 3ZD7A 5CM2Z 3F96A 1G2WA 1QWOA 3RBXA 4Y9RA 5JI3E 1Z36A 3CLSC 3IUMA 3ZWQA 4MH0R 2JCXA 1SXQA 3ROMA 3DNMA 1XP5A 2HA2A 4MR9B 3PUVA 3S3TA 3I6IA 3MFYA 2XNJA 3WWYA 3G1WA 4YUWA 4JZYA 1GPAA 5J23A 1ZGZA 3ZQJA 1I94B 3RVQA 5G4LA 4GGMX 3QKUA 2F59A 1QQBA 4B3CA 2YV3A 2ZJ3A 3T95A 1Z82A 1P75A 5GV7A 4G07A 1NVKA 2ZUBA 1XRMA 2HT6A 3L49A 4EPRA 1KH2A 3CQ9A 3EDOA 1WB6A 1XEAA 4G01B 1NF3A 1K06A 1DEOA 4HH0A 3HE3A 1YDWA 4FDUA 4LI0A 1Q1EA 1M2VB 4WN9A 4X20B 2NPIA 4EHHA 3K3PA 1H2WA 2GWRA 3RUPA 1A9PA 1W87A 4G0QA 4QGHA 4I3FA 3VAZA 2VAXA 4PIPA 1NE2A 3Q8MA 3KUCA 4BO3A 5JC1A 4UATA 4QELA 5G53C 4KZKA 3IBFA 3TXYA 6REQB 3ZH9B 4EGSA 2RCYA 2XE7A 1RLMA 4V0MA 5ECWA 2W4IA 2H1IA 2FW6A 4FBUA 4BGEA 3FMPB 4U4AA 1G41A 3SVLA 2GN2A 5DQGA 4R83A 2BEKA 1XDDA 3EXHA 2ZJAA 3NIBA 1WXXA 2J4DA 3A9TA 2AUTA 3ZKAA 3G13A 5B7QA 1J8YF 2JJ2A 2RGNA 2C2YA 2NVYA 3R3SA 2QUZA 4EA9A 3T52A 2JGEA 2ZTLA 1QG6A 1LBEA 2QD3A 3G7SA 2CB0A 2JCVA 4G0XA 4O3PA 1Z7BA 4AS1A 1FYFA 3ILYA 2QAIA 2GA8A 1TVCA 3W2TA 4RPHA 5D3MB 4N76A 3PX2A 4X6YA 3OMWA 2AZXA 2LCQA 3NOVA 2DBRA 1GTSA 1ST3A 2FGKA 3Q1LA 4GOLD 3DR5A 3E84A 3LULA 3HI6A 1WV0A 4RW0A 4C7MA 4OHZA 4PGGA 2W43A 3VHXB 3WGMA 1LQTA 4CR7A 2B1QA 1KY3A 3LVRE 2AN1A 5LBIA 2ZS8A 5KREA 3FWNA 1UBEA 1GGFA 4Q93A 1GQSA 1AOXA 1XZKA 4PNHA 5IT0A 1GPLA 2Z09A 4E7OA 2IXTA 3HLTA 1KH3A 1N36H 3DZKA 1VRWA 3K8YA 2HWKA 3IQEA 5JS8A 1RWPA 3GARA 1GG2A 1XQ6A 1VMDA 4R9NA 3SHOA 1FE8A 3WLOA 4HLDA 3DO5A 1W2WB 2VF5X 1T5IA 1XZJA 2VF7A 3GFQA 4KODA 4YRPA 3AERA 2XNSA 4KL8S 1RXCA 4LRYA 4CNQA 4RMGA 3PF9A 1W25A 4GNRA 3D8HA 1QTIA 1L4UA 1NLYA 1CYDA 2XMSA 1UQTA 3W3AH 4ZVTA 4UTNA 1VOTA 2JCSA 3ZLVA 3VR5A 2C5BA 3BJRA 3PCRB 2FZ5A 2NVOA 2EW2A 4ECXA 1DPGA 1FVHA 3U4QA 3EXFB 3B7WA 1ZUWA 4TPKA 2D5IA 4YI3A 1CZUA 2ATLA 4OHUA 3W6NA 1QGZA 2H1FA 3TRKA 3HBLA 2Y6UA 1GTG1 4RPCA 3DL4A 1J2EA 1S2OA 4BLRA 4BJHB 3W1GA 1QE0A 4KNWA 2W83A 4AZ3B 3I39X 1MEJA 4BLQA 4KVAA 4ECZA 5JNWA 3IULA 1GYRA 4TSFA 1SHLA 4Y6PA 2QM7A 4G09A 5K8LA 1E60A 3EXHC 4BV8A 1VKZA 3OX2A 2RGNC 3JAWA 3CLTC 1BA2A 4OGFA 1J33A 2G7ZA 4ZVNA 2JI4A 3DBOB 1ZJJA 3ASUA 2LWIA 2ZJ6A 5FPYA 5TPZD 5JH7F 4KR0A 2DFLA 4BU1A 5HK9A 4F4IA 4IIXA 2OLSA 1YDHA 1OFGA 1Y8CA 1ZVKA 3SR0A 1R0LA 2MSKA 3HS3A 2SHKA 1P0FA 2XUOA 5FPKA 3EVDA 4EMTA 4ZOCA 1AQYA 5IK2D 5I8ZA 1X1TA 1BVUA 4RD6A 4ZO4A 4Q9JA 4XCVA 2HA5A 2N47A 3ZY3A 1RXWA 3VAAA 5ALGA 3KQMA 1E4VA 1S4MA 3ZS8A 1DXOA 1NVVQ 5ALXA 3NR2A 1ADGA 1YFKA 3HVIA 1DTWB 4HDAA 3MTEA 2D4AA 4W99A 1CQXA 3X2EA 3KV3O 4N39A 2CNUA 2X0EA 4N3GA 4DDWA 1XDSA 4B9EA 3P2MA 1IZ8A 3DULA 4HQKA 4TTVA 1RR6A 1UT8A 1DKMA 3CM0A 4LF6B 3B51X 3QWHA 4X84A 1AV6A 2E55A 3NUZA 2VXBA 4IGIA 4LWQA 3QSGA 3GDWA 1B1CA 1YKFA 1TXGA 2YS7A 2P91A 1JZSA 4LF5H 4GI2A 4MUAA 1N3BA 1C29B 4MRMA 3HKEA 4CMCA 5L3RA 3QKWA 2PQ2A 3RVBA 3T06B 4GLXA 1DO0A 2X5OA 1XROA 3IELA 1GG8A 2YW9A 2XADA 4DR5H 1KAHA 5KYUB 1KSFX 1R6XA 1JHZA 2GCIA 2G28A 1G7CA 3ZGYA 5BNWA 3ZWNA 3EC2A 3HDVA 1J0DA 3HOXG 1XHLA 4OKIA 2QDXA 2Q2WA 3ILSA 3KHGA 1OWLA 3RTGA 1UFRA 2O50A 2EZ4A 4TRRA 5JYBA 2FG6C 4PFSA 4FFPA 1KQ3A 3VPFA 3WRYC 4GRDA 1VG0B 2P8JA 4E3WA 2COEA 3EVEA 3FRIA 1P4AA 4A2BA 1ORTA 1UMDA 3BQMB 5ER6A 1SC3A 2FPUA 4LMBA 2DFNA 4F97A 4ZKDA 2RBKA 4J0MA 5F2NA 4YAJB 1T8TA 2Q5QA 4R6WA 2RHCA 2C9MA 3TTYA 3DPIA 3CX6A 3IP9A 4X1IB 1T6XA 5DYIA 1RI1A 4LXTA 4QWBA 3P5BA 1UPBA 4ZD6A 4Z0PA 4IJVA 3C0FB 1JI3A 2RIRA 3ULKA 4IP0A 5ESDA 1ESNA 2HF9A 2BMVA 1N92A 4KE9A 1VBMA 1WR8A 2ZBRA 5K3BA 3C3YA 4INJA 2GZAA 3O94A 1PEYA 1RBMA 4BN4A 1FUYB 4OQLA 4H0FA 2XR1A 4YCJA 3HK2A 3JY6A 3AGQA 2W6ZA 1ZO8A 4YMUA 2JS7A 3UUWA 2QTFA 4D99A 4WOPA 3KD3A 4IQ0A 4D02A 4WA8A 5A05A 1IHOA 2JA7A 3THYA 4P3KA 4QNNA 1ZINA 4JENA 2NO1A 4FMPA 1ES9A 5FD8A 3H2IA 3CSDA 3PR2B 5FTLA 1ETHA 4TV9B 5DM0A 2Y76A 1QH8A 3UBMA 1GZUA 4QX6A 3DHEA 3F1LA 1HZZC 4L5JA 3H2ZA 3E23A 3EFOB 2WKPA 4DLXA 5LOVA 5JS2A 5KS8A 3BA8A 4H16A 1JQLB 1YR9A 2FPIB 4O4JF 1HT2E 3QE4A 1JQAA 4FHZA 4CDRA 1ISIA 3GGSA 5K7SA 3GRYA 2D1SA 1TQ8A 3ER8A 2X8JB 4MYUA 2HMVA 5JV5A 2QJRA 1ORRA 3DBRA 3LFTA 1T4GA 1UXKA 2Q8QA 2VNSA 4X90A 2BMDA 2F3SA 4KIGA 5EIEA 1GG5A 5AM2A 4YDRA 3KEOA 4DBVO 4YO7A 1HDCA 3A25A 2JCYA 3P9NA 4KH1A 4JQOA 5KKAA 1UBGA 3JQGA 2ZIXB 3GH3A 4F0JA 4CMGA 2GCOB 2EKQA 4WHXA 4BEVA 1H5UA 4YJFA 1IU9A 2YXBA 4M7OA 3QGMA 1IG0A 3GDFA 3RRFA 5A9SB 3DAHA 4BO8A 3LBHA 1WLSA 4UKDA 1KO4A 4QXAA 1OUMA 1HE5A 4FHFA 2G4LA 4A0QA 2RHWA 2CDAA 1ZLXA 1P1HA 2I55A 3OPQA 1YZQA 5CFNA 4YPFA 5KG2A 1EGQA 1RHJA 4DRXA 3I1YA 4OBEA 2XJ9A 4JBXA 3G1TA 1EQ2A 2OBXA 2WBLC 3QQPA 3L1UA 1TI7A 2WYOA 4XB2A 2QF7A 5LMCA 1IXRC 1VIMA 2WZQA 3GEIA 2A30A 3BF7A 3GRCA 1QMGA 1S9FA 2YHSA 4C7OB 3EG9B 4C01A 1ZNQO 3Q11A 3K0AB 4GNKA 1N6IA 3QPBA 3F6PA 4TSKA 4ED2A 2HDWA 4PLYA 1V9PA 1KY5A 5EL0A 1NM5A 2OLKA 3SGIA 1JIKA 5CDFA 4RM3A 3T3HA 4LRWA 3EIUA 3GG9A 2XV1A 4H2DA 3PCXA 1ZHFA 4LKRA 1I30A 1XRPA 3H87A 1HSZA 4YRZA 1RHQA 4LKOA 4QASA 3GTQA 3W5BA 5KFNA 1NF9A 1LC3A 4PWZA 4EBBA 1ZD4A 1AB5A 2HJWA 3HR8A 4TSRA 2YHAA 4O2AB 2W6IA 4F11A 2WMDA 1QCCA 3AFOA 3EF3A 3L6CA 3D1VA 3ZCTA 3KLBA 1TCUA 3PIDA 4NF2A 2C8JA 3KREA 5B58C 1QYXA 4BZXA 4BNDA 4DTIA 4LK2A 2AWNA 4H3VA 1U2GA 1SZJG 1EUCB 5JMTA 1YUMA 4GSLA 3Q9SA 4TMXA 1G2IA 5LQJA 3ESCA 2COKA 3IKJA 4O86A 2W9CB 1DNPA 1CZHA 1KQOA 3JZAA 1KAGA 3NWEA 1ID8A 1Q20A 3KFLA 4BPRA 1XDZA 4U7CA 1P45A 3OECA 3U37A 4PZ8A 1JVSA 3IG0A 4HAYA 3MWMA 1AD2A 3RR5A 4D4IA 3EA5A 3TY9A 5M5BA 4MS3A 5C5JA 3ZY4A 1S7CA 1BTOA 2CNWD 4W8GA 2G07A 1IBLB 2PMKA 1OX6A 1SC9A 3D4IA 1NAIA 4ZWNA 2AN5A 3NC1C 4U6QA 2G36A 3WV4A 3O9MA 4FONA 3KCQA 1FRNA 2QNIA 4A9AA 2XGJA 2IU4A 3TD2A 2Q4OA 3BWDD 2Y2UA 4UDYX 4AN0A 1DINA 1C7FA 1TUGA 4AJJA 4OP1A 1E0SA 1VBHA 4GOOD 3PHJA 3W6PA 4Q15A 3BOSA 2EJBA 4GKKH 2Q5JA 3MFQA 5FNVB 3MJRA 4R5HA 1CZOA 3THXB 1E9RA 2VEDA 2YZ2A 1WY5A 2CNBA 1XRSB 5ERGB 3NBKA 1N33H 1O54A 5DGIA 3FIJA 5EZ5A 3B9PA 1UP6A 2AFHB 2QLJA 2WPDA 2PJRA 2CYCA 1YFLA 2JARA 1KMMA 1C1DA 1EK1A 2Z4TA 1PFWA 3I8XA 3O91A 4B7UA 3QFHA 2PUCA 3LMLA 5TXGA 2CEKA 4KAXA 3WWPA 4EFLA 2JFFA 2PFGA 4BNGA 1OAOC 1M2OA 5CFOA 4PNEA 2IYQA 1YRAA 3U9TA 1ARZA 3WGZA 3NP7A 4YALA 1QMPA 2EGGA 2IZZA 2PL1A 4TQ9A 3PC4A 3CSSA 3V6LA 1K1QA 4P4GA 3BSYA 4UBLA 2YJZA 2Z1NA 1XTUA 5FO0A 1KH1A 4RVHA 1QQAA 2J85A 1QC5A 1C2YA 1MRNA 5KNCA 1FYWA 2A2ZA 3LQ2A 3TXAA 4UVIA 5T4EA 1KEEA 3EDRA 3GLGE 2FUKA 1YNSA 3K7EA 2C5GA 2OBNA 5C2JB 1I2MA 5PGMA 3LD9A 4F8YA 3TQHA 3B3AA 4BGDA 2BM1A 5I9SA 3EMKA 3N5CA 4MV9A 2AHOA 1L5GB 1DZ3A 3NQ41 3VO8A 3ADDA 5AXCA 4PYKA 1JSZA 1T36A 1B16A 4QU9A 2IK8A 1VE6A 4B0PA 3DB2A 1P4HA 4JT2A 2XA1A 4DV6H 1NT4A 1HK7A 3DOJA 1V4VA 4AJNA 2C84A 2GYUA 2BKUA 2QMZA 4P0QB 1IN7A 1WJGA 4BN5A 1OOEA 2RGDA 1IXZA 3E7DA 1T2AA 1U65A 2HJ9A 3W2GA 3CURA 3HJHA 4HTAA 3ZVRA 4UQOA 4ITVA 1M1NB 2UUAH 2O2IA 3UJBA 5AW4A 1NZJA 4Q47A 1D2HA 2JLRA 1G5QA 1DGQA 4HGYA 2NZYA 4JLOA 1Y7PA 3D1LA 2QPOA 3S2YA 2G0AA 3F4KA 2AH5A 4GZ5A 4ZJZA 2VDJA 4CFSA 3VU9B 3TIVA 3HDTA 1T25A 3QZUA 3T5KA 4OF4A 2LNDA 3B5EA 3U5ZB 1IPHA 1PIWA 3DT6A 2TSYB 1X7ZA 3HNRA 1EP1B 1MXHA 1LSJA 1RE0A 4WNAA 3D43A 1GT91 4OHMA 3O83A 3UAZA 2QX4A 2AXNA 6NULA 2R0QC 1AJEA 1MW8X 3L2OB 4NYMQ 1V35A 3NB0A 4ZAFA 3AY7A 2E5LH 1I3MA 4G25A 3FYUB 3DTVA 1IN6A 1UAYA 3PYMA 1NF8A 2ODTX 2YDYA 4FYVA 3RODA 3SWWA 4C07A 2PSSA 5LQKA 2W0SA 2O3SA 1YDGA 2CN1A 1PNQA 1GTRA 3K1TA 5DHAA 1SOMA 2O7RA 2EVWX 1JEQA 3RM3A 4JI6B 4UW9A 1S97A 5TV2A 3TL6A 3JSNA 4Y18A 4H6WA 3T3PB 2PKWA 3E1GA 4RZSA 1A72A 1KKMA 2GEUA 5H80A 3LT5A 2H2AA 2O2ZA 1JRLA 2R87A 4TLEA 1L4KA 1PJAA 3M6WA 3UHPA 2WF9A 3CG4A 1PVOA 2OZKA 1GIAA 1JPUA 4BFTA 2I8CA 4X62B 1WR2A 4CJXA 2GD1O 4RIIA 2P1DA 2AIRA 2LBPA 3TIGA 4XAQA 1TMOA 3DHNA 1OU4A 1J8MF 2CCGA 3OMLA 3ORRA 3GHHA 1CF2O 2BHRA 3R44A 5C4GB 2JFUA 1RPTA 1TKCA 1QRUA 5MN4A 2E2WA 1I7SB 5CXSA 4EITA 2C1ZA 5IG2A 3OX3A 3BHNA 2CFMA 2OGZA 3PBKA 5ICMA 1ESDA 4J0CA 3GIDA 1FLAA 3RE1A 3AFMA 2J07A 5A6SB 4ZHQB 4CGZA 3DT8A 1V3TA 4BIMA 4PSUA 1ZBDA 4ZIRB 3QA9A 4JYBA 2RDIA 5AHWA 3K73O 3C3KA 2WE7A 2VWGA 1WSAA 3M6MD 2WJGA 3VR0A 1C7IA 5IASA 2BCJQ 4RMHA 2RKBA 3QG1A 5L9AA 5A0TA 4D9KA 4WK4B 3FN4A 3WRWA 1CY2A 3ICVA 1Z29A 4GVPA 5HFNA 3KTAB 1PW5A 3G2OA 3EAFA 5DTIA 1V26A 4EI9A 1NUUA 1WVIA 4MCHA 1KZ7B 1JG4A 1LKZA 3PP8A 3GIMA 4H7IA 3QQMA 1CLUA 3HB9A 2PKEA 4UTXA 4LTNA 3VTAA 3RK1A 2RG1A 3N41B 2JZOA 3EIHA 3B3JA 3TKLA 2J6IA 4GYKA 3RAEC 2EWMA 3WNZA 3K1ZA 4TTQA 1A82A 3T3DA 1DG3A 4MVJP 3FH0A 4A3FG 4P92A 3UWSA 2GN1A 3DJYA 5DLEA 3K8OE 4DEVA 5BN1A 4P54A 4LJ8A 4AVYA 3U1BA 3E8XA 2ZYRA 1HT0A 6YASA 3EVBA 3EYWA 5E3JA 3VH2A 2DUWA 5K3EA 2YTZA 4ND8B 2REQA 5B53A 4CKWA 3NU1A 3EARA 1JBKA 4AQYB 3UXEA 1LI5A 1L4BA 1KQPA 3KQNA 1X7GA 3K72B 1E0DA 2MR6A 3A1UA 3ABQB 5KYNA 4M0FA 5DG7A 4R0MA 2R1VA 1JR3D 4FFLA 1VJ1A 1SN7A 3URKA 3CFYA 4HVAA 3O8NA 3OQBA 2G4VA 2K5UA 2C2RA 2Y0EA 5F64A 2YWXA 1EFRA 4O3OA 2HF7A 4EPWA 4FFMA 2JD1A 2QD4A 3V7FA 1YDFA 1PT9A 3VH4A 4FDAA 4LVUA 2PS9A 1WXEA 1CQPA 3U7IA 4OBBA 2WKRA 4CUKA 1DBVO 4E03A 1X8KA 1QHHA 1P81A 2M6KA 5C8YB 4QNMA 2PL5A 1CRZA 2B63G 3U62A 3FX2A 2GHIA 3N8HA 3CCCA 3ZR4B 4F8JA 1OLSA 3PIIA 3WIBA 5JD4A 4X97A 1GKLA 1V5FA 4HMOA 2R8KA 3JATB 2IH5A 5ALFA 4UUAA 1PKEA 3T34A 2BF4A 3IEUA 4J9PA 1O58A 4BWGA 3A6LA 1E5QA 4N7JA 3UQYS 4BIIA 3BWXA 3HXQA 5DGBA 4ZJUA 3S68A 4ARVA 3CPHA 4IVNA 2Z57A 2VBIA 3ESAA 4LF8B 1JMKC 1J7JA 3MGCA 4IIJB 3GLIE 4EKNB 1Q0HA 4AYBA 4OQNA 4Q7EA 1BN7A 3A70A 1FXWF 4AZ0A 1VIAA 1RK6A 4HUQB 3NI2A 4MHOA 5DHQA 1BSVA 1W8IA 1DRWA 1W4ZA 4CIVA 2IY7A 5J2TA 4X65H 2WSSD 1KNXA 3JWIA 2W2KA 2IPMA 3G0CA 2ID9A 1SG9A 2Q2TA 1IZ7A 4B3SH 4LTMA 1CERA 5K8IA 1XNRH 3IAS1 4MJ7A 4B6PA 2ZWPA 5KTRA 3EIFA 4ZODA 2I34A 1GDHA 2AN9A 1M6EX 2YR0A 4HWKA 3OZUA 3FNIA 3K2IA 5GY7A 2RHGB 1Y1WG 4PW0A 1U2PA 1O1YA 1DIKA 5A62A 1QS0A 4P33A 5L4NA 8MHTA 4M0JA 4XIGS 4QE3A 4TS1A 1KK1A 2X6QA 4F5YA 2ZCUA 4M87A 1VC2A 2ZPAA 5D2CA 3U16A 1NU8A 4XM2A 4OJNA 4V02A 4N3NA 1RM4A 3JSLA 1S9DA 4ZT7A 2HQSA 3K15A 4QJ3A 4YQWA 2BR5A 2NZWA 4H7EA 4PYIA 2D5LA 3NWJA 4HRVA 4H7FA 3UWOA 1KVSA 2A9OA 2GX6A 2PZAA 3DQPA 1PFKA 1NMYA 1P16A 3E7FA 5KKNB 2I6UA 4PPQA 2BKAA 3D0RA 2ASDA 5JVDA 1JH9A 1YE8A 3ZE6A 3RC9A 3Q3GE 2JIDA 3B9BA 5G02A 3NWBA 2IW1A 4EP1A 3BH7A 3DTTA 3F5FA 4D9BA 1DAAA 5F1OA 1E99A 5KHOC 3TY5A 2P9TA 1I01A 2VWPA 1JLHA 4FXPA 2P65A 5HCNA 1REQB 3EIWA 5IP5A 5CB4F 3H4VA 5DMHA 1LW6E 4OJYA 4YEDA 1TMYA 1ZOIA 1QP4A 4WAUA 3FLBA 1G3RA 3Q10A 1ZWLA 1CKOA 4KCGA 3IUBA 4YASA 1HEIA 1EA7A 4DV4H 1OIWA 3I9V1 2HTFA 4B40A 2JFZA 1JVBA 3I34X 1E1CB 1MFPA 2D1RA 3CCBA 2LUOA 2BQUA 3PD7A 4NBWA 1JG1A 5B6JA 1ZK3A 1XN4A 1TVKA 1XU4A 1PJ2A 2ZUUA 2H85A 2ECQA 1L4FA 1X0XA 3C0KA 3WWOA 4DJTA 4JASB 2C07A 2LPMA 4LOKA 1IPFA 3SIXA 4NDAA 1WB4A 5EA2A 4B3RH 4R7ZA 3NEPX 4ENQA 4A3KG 4JXJA 4BXXG 3T5LA 3RAGA 4XZ3B 3DFKA 2SCUB 1EUDB 1JJAA 4QDKA 2CLSA 2EL9A 3FYDA 1ZHSA 2ASLA 3OQ6A 4P5EA 3O4GA 4WLVA 4X60A 1KZYC 2G80A 5AVXA 3HNOA 2NZ8A 3FXAA 1DC6A 4ARBA 1V9LA 3L0PA 4HDSA 1IQ0A 2I71A 4BRSA 5KBYA 1SU8A 4GL4A 2CV0A 5GQSA 3WOHA 1E61A 4ZGBA 3T41A 4RESA 4IS2A 3G2JA 5JNVA 5MGBA 1R0KA 3BIWA 2PXXA 3K5PA 1TO1E 4OHOA 1N3LA 3CKLA 1YZHA 1FMTA 2O23A 2QTMA 1XX6A 5JS1A 4F60A 4BFVA 1ZMBA 5LNK6 3KDAA 2NVBA 4X85A 4A7PA 4K2AA 4YJ3A 4OHCA 4BFYA 4KI0A 1YVPA 5DM60 1YBVA 2HI0A 3NXKA 4Z51A 4WXYB 4OKSA 5BV1A 1W30A 4OU5A 4F3NA 2WV7A 1CXZA 3PQFA 4FUTA 2VPSA 1MAWA 1OFUA 3OCXA 4MUNA 3ZJTA 4YQFA 3LUGA 4YP0A 5AM3A 2EFYA 3M9OB 4ESEA 4G5YA 3W5VA 1M6NA 3VR5H 3E9EA 1ZR4A 1TFRA 4RQUA 3GPCA 2HNBA 3MPOA 4Z9YA 3VYVA 1NNSA 1TWAA 3S2ZA 2GAAA 2PYZA 1E62A 1XTRA 2DBYA 1KI8A 4XQ0A 3AUJB 2O9JA 1MORA 3I04M 1X9IA 1Z63A 4CC6A 2ZSJA 3WZMA 1WSBA 1TEVA 3RC8A 4Z86A 4H7JA 1ZUNB 5H70A 5CHEA 2DPYA 4ECEA 1TADA 2W2TA 2VHXA 3I76A 4NECA 2HFJA 3FPHA 1NKVA 3LYHA 3JAKA 3RTBA 2O14A 1LB1B 3AVXA 4EEZA 5K8CA 3AP1A 2I2XB 1JDSA 2EJCA 3BTUA 2D0DA 4DKXA 3SKXA 4E13A 3D7KA 1EFAA 2FY8A 5CH8A 2IC5A 1R6VA 3WIDA 1EVLA 2FMTA 4W1QA 2PH1A 3VU3A 2XRZA 4G1UC 1D4OA 2ZK7A 2DFVA 4GZ6A 4U6NA 1EBFA 1P33A 5DNWA 2JKZA 2B8EA 2UZ1A 4RE6A 4H27A 4AYWA 1NYRA 4MVJG 5B1DA 4KJXA 3TFWA 1OXSC 4RK5A 2VVTA 5AICA 2ZZMA 3F2VA 4JVNA 2YUTA 3KKQA 1JKXA 3CTMA 3PL1A 2BGKA 2ID4A 3PC2A 4IEFB 2V9ZA 1SQGA 4V03A 1W6RA 3VRHA 3L0ZA 1ZGHA 4YHHH 5ALOA 3GUZA 2HRBA 3NRCA 3VI3B 3AYXB 2PS0A 3PUYA 5CM9C 5EMMA 3H7AA 5DNUA 3OSNA 1QDLB 1TJPB 2IYAA 1ZGBA 4RK6A 4GX5A 3H0GG 4IVRA 2QTZA 2ZSAA 4EF4A 4Q1EA 1Y3HA 3OZFA 3JYQA 1M2KA 2REBA 2BHSA 1CUCA 4ND2A 1M2WA 3LCVB 1UPUA 1Z0FA 1PKXA 1HQYE 5DXJA 3TJZA 1EX7A 3EWIA 2QKYA 2QN8A 4XUDA 3PFWO 2AMFA 2F3RA 5E7MA 5I5EA 4R41A 1SCDA 4HN4B 4F84A 4MV8A 1NATA 4HRAA 2BFDA 2I1VB 4WY2A 3TL2A 1B1AA 3BB1A 4AMGA 4JR2A 1G6Q1 4QVGA 3R9XB 1GSAA 2C2XA 1UPXA 5ED4A 2C5HA 4TTIA 3ZLBA 1PG0A 2NZ2A 2TYSB 2VTBA 4EW6A 3MWEA 2CFIA 4WKPA 2NXEA 3A3YA 1VKNA 5JUMA 1OAKA 2HGSA 3GBPA 3WZ2A 2YHIB 1WETA 1FRVA 2HBZA 4GM1A 2FB9A 3KQLA 4R8VA 4MJ3A 5JSZA 5F7ZA 5LQRA 1LBSA 4J9MA 3HP4A 3FLAA 1DAOA 5B4TA 2PWPA 4HWSA 3HDYA 3OG9A 3KKLA 1DCKA 3HWX1 2E87A 3TI9A 4MMXB 2P75A 3TTVA 4KK4A 5DV9A 3P9KA 1DBSA 5KFJA 1JI0A 3AHEA 3NWPA 5AVZA 3QEJA 1A04A 2CMDA 2IU3A 3WHKA 2OD2A 2P90A 3L6EA 4L3VA 1J21A 3N07A 4HSGA 5DP2A 1TB4A 2CF5A 2D2VA 3OJWA 4CMEA 4YB8B 1Y3DE 3I09A 5C8DA 2EJ3A 2IYFA 1KWKA 4KQKA 1FEZA 4E21A 1XU7A 1IB0A 3L7YA 3IIMA 4HAUA 1F60A 3UHAA 2DUUA 2O48X 2X15A 1KQNA 3MT0A 3BWCA 4OFWA 3W2IA 2HXGA 2WMYA 3S40A 3F71A 1JX4A 1EVQA 3H8WA 1DGSA 3FOAA 1IN4A 2J5QA 3OZ7A 1L7DA 4M88A 2XITA 3E15A 4WW0A 4LJLA 4PX9A 1TZMA 3VSEA 4GMHA 4RQAA 3BQ1A 1DTSA 4WN3A 3KCNA 4LGVA 2R92G 1V39A 2HQOA 5BNTA 4EQ6A 4HWTA 2YN0A 4PZ9A 1A8UA 3OVMA 5C1DA 1AHIA 1SUWA 3MB8A 1DLJA 2GEVA 1CD5A 4JS0A 5F23A 1COZA 2NX2A 4MW9A 3V42A 4LSAA 1PYDA 1XTJA 2GJ9A 1G18A 3PQEA 4GKJB 3WG9A 1DARA 4KRGA 2YYAA 3HP7A 3I62A 3MINA 4NOKA 3LP8A 3CZMA 4HZIA 4LS3A 5DCWA 1RYFA 4OYYA 5BRAA 3W4KA 3EGVA 5FLYA 1RP7A 5CH5A 4GD3Q 3U54A 2OAQ1 5EZ6B 2BZ1A 4DYHA 2ET6A 3ODGA 3DKKA 1O94D 5U4XA 4AP5A 3JQAA 3ICOA 3A4LA 1W75A 1XNGA 2FR8A 1DIOB 3AJEA 2PX8A 4A0HA 2D06A 2ZROA 4ZRMA 3M8KA 2CK3A 2R4UA 4ETSA 1E2GA 2ZBGA 3LTEA 2IWRA 4TV8A 3T94A 3IKLA 2Y71A 4LHZA 4K88A 2JDID 5KQRA 2OCLA 3T54A 4EGAA 3W5SA 4N3CA 3CW9A 1QHNA 3R5TA 1VJTA 1GPBA 3N0XA 1YFJA 1TFUA 4EHAA 4J6FA 2JNWA 2NACA 5IN4A 2P6PA 5DTRA 1YVEI 3GEBA 5DQIA 3PO2G 4M46A 2ORWA 3VBCA 5SYNA 4G5FA 4KO2S 3ORHA 3ZLUA 2FTKE 4CMEC 4RY2A 3D6FA 3NWOA 1MAHA 3EZYA 3WLRA 3MM4A 1QHIA 2QB5A 5DLPA 1KHHA 4US2R 1PWXA 1L1RA 3E58A 4DCNA 3EPIA 1ZW1A 3SX0A 2YU9A 4Q48A 3ECAA 3ZD6A 1MENA 4QLAA 2O8NA 4FM9A 1E79A 4QULA 5DX0A 1HZJA 2V6JA 3WDSA 5AXDA 3GIIA 1D6NA 5L3QB 4LGMA 5HMLA 1Z4PX 5C46F 2BFNA 3BT7A 3DMGA 3IPCA 2QZ9A 3EIOA 4XW2A 1DCTA 2PCLA 3A6HA 3PRYA 1P8AA 2CXXA 3THOA 3S2GA 2E82A 1CJCA 3TQ1A 3ABZA 2WVHA 4F4YA 1ZMOA 1S0MA 2VNIA 3BPSA 1E1NA 1UBOS 1GSHA 3L40A 3JALA 5JATA 2NSDA 3OTQA 2ATEA 2FW8A 3IA2A 4XFJA 4BAZA 1N2JA 3M5WA 3INRA 2I62A 3WLSA 2WWTA 3CLUC 3ROXA 4RV4A 4OG2A 3ETGA 1GNRA 3I53A 1V11B 4HK4A 2Y4NA 4MWSA 1ADFA 4ER3A 2QZSA 2PMZA 3C7AA 2XRFA 4L8FA 4TVKA 3HSSA 3GLHB 3JQBA 4OGLA 3ZLJA 3BA6A 3OP1A 1Z6GA 4XLZA 2M6LA 9LDBA 2FR8C 2Y6VA 1DAEA 1T2FA 1LX6A 5C35A 3WSVA 5IT9W 2C31A 2I0FA 3H9BA 3BQ0A 4DMHA 3D4OA 1C7EA 1P1IA 3DKVA 1UDAA 4IMIB 2O0MA 4EHLA 2HIAA 4EG0A 5IJ0A 4KPYA 2H1OA 3VYTB 4P58A 3RRMA 1LTQA 1MB3A 3FKSD 3VO9A 4KTTE 2CBXA 2DX7A 4P35A 4JCOA 1NVGA 5AW6A 3TZCA 1V7CA 2JHGA 4NNPA 1NFQA 4BX8A 1V8PA 3ZK9A 5ADVA 1Z2AA 2OZVA 2VUMG 3PUWA 4XX0B 3G02A 1DVRA 4ZO7A 1WMDA 3T9AA 3DONA 3OE4A 1XYGA 3HOWG 4OAQA 1MJGA 4NABA 5U9CA 2P2SA 2GKSA 5I7RA 1TAHA 4Y1EA 1DQYA 1R8SA 1EIZA 2IYWA 3T1YB 2DEUA 4N01A 1AF4A 5KWJA 3MIZA 2J3EA 1TCCA 4GX1A 1X1QA 4PZYA 1Y48E 3LOQA 4WKGA 1MCZA 3AEUA 4ZPXA 4M7PA 4FDTA 2VDWB 4JV5B 2IEAA 4QU5A 1SXJE 4ZMRA 2P79A 4YIKA 1EGAA 1AXEA 4RKFA 4G81A 2JLAA 5IUKC 3E9CA 3IUNA 5K09A 3MUFA 2RAUA 1DEAA 1RYEA 2H00A 4H1UA 4UD6A 1T1GA 3UB2A 2CV2A 3M6XA 4JI3B 3R75A 2WLSA 5KFEA 4B6GA 1BFKA 1FY2A 1BJTA 3TZ6A 3L92A 2HA7A 3P27A 3UJ7A 1V3QE 5FQNA 3GJ6A 2QRKA 4RJTA 4RDIA 3OAAA 3G2KA 1NW3A 4AJ2A 5BQFA 3L4JA 1NBME 5B3LA 1ZL2A 2R93G 5AK5A 4X8OA 3SBDA 4GFDA 3M2TA 4D79A 3D3WB 3OD5A 2QV7A 3W8NA 4DXAA 4BQOA 2DQSA 2ZRCA 4RJLA 2DWUA 1UMKA 5ENZA 3MBOA 3GRRA 1O77A 2X23A 3THWB 1L1EA 3I05A 4RD2A 4ED1A 1XUOA 3R5FA 4B73A 3HDGA 5CB0A 4AJKA 2AYXA 3JQPA 3JQBC 2ACWA 2Q46A 1O75A 1NRJB 4MHTA 1PTKA 3GJ3A 4OSOA 4JNKA 2BH9A 1WWKA 1SY7A 5TNXA 1JJVA 4R5MA 4DIBA 3TSCA 4ZKEA 4B4VA 5I5WA 5KYKA 1L5WA 5FA6A 2VUTA 4JSTA 4K6MA 1NBWB 2GAOA 4Q02A 3NT2A 4BXOA 4BJ5A 5HKLA 5KFAA 1UOEA 5TS2A 3JTEA 2HA4A 4AN4A