2FPGB

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 123
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fpgB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fpgB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgB03
1EUCB 3ETJA 4IWYA 2R7MA 4Y8VB 2PBZA 3GIDA 2XD4A 2GQRA 5LA6F 3TW6A 2NUAB 1M6VA 5J2UF 5I47A 4IZOA 2W6OA 4MA5A 4O2AF 1VBHA 1EHIA 1DV2A 4I55F 1KJ8A 2YZMA 1JLLA 1EUCA 2DZDA 4M9UA 4YBZA 3K5IA 1VKZA 1B6SA 3MWEA 3ORRA 2FP4B 5K2MA 1EZ1A 2YZNA 2V59A 5JVDF 5JH7F 4XYMB 2QK4A 3MWDA 4MV9A 4O7WA 3UFXB 5KKNB 1Z2PX 5JVLA 3KAJA 1OBDA 2VQDA 3ORQA 3VMMA 5JQGF 1Z2NX 4FFNA 5CAEB 2W6NA 3U9TA 4YB8A 4O4IF 4O7SA 4O86A 1GLVA 2OLSA 4O7VA 1KEEA 4TV8F 3LWBA 2W70A 2WYOA 1JKJB 2W6PA 5IYZF 2YS7A 1W96A 1GSOA 5GONF 2IP4A 1IOVA 3QFFA 5J2TF 4YB8B 1CS0A 4ZOLF 2V58A 1W93A 2SCUA 3AX6A 4O7RA 4HNUA 1E4EB 4L1KA 1GGOA 1PX2A 3TINA 2FPGA 5LXTF 4XYLA 5LYJF 2YS6A 4XYMA 2ZDGA 3U54A 1C3OA 4HR7A 3U55A 4YJ2F 3ETHA 1SCUB 2R82A 3MWEB 1BXRA 2Z04A 3VPCA 3R23A 3V4SA 2PVPA 3E5NA 2CQYA 2FPIB 4MV3A 2GPWA 3KAKA 4ZQIA 1DV1A 3TIIA 3PFFA 4FFPA 2Z02A 4TV9F 4XZ3B 2NU7B 4MA0A 2VR1A 1ULZA 2FPIA 4XX0B 2I87A 3WNZA 2R7KA 2YRXA 4HNTA 2NU9A 2YYAA 2NU8A 3TQTA 1WR2A 2W6QA 2X0SA 5HBRB 2HGSA 2DLNA 4NYEA 1AUXA 1CQJA 5C1PA 2YZLA 3HBLA 1KBLA 2I8CA 5C8YF 4ME6A 3JRXA 2R87A 3U9SA 3UFXA 1IOWA 4O2BF 3GLKA 4HQ6A 4O7ZA 2CSUA 3RV3A 4YJ3F 5C1OA 5HBRA 2C00A 2ZDHA 1KJ9A 4EG0A 2SCUB 4YBZB 1EUDA 1EUDB 3KALA 3RV4A 3G8DA 3VA7A 1VBGA 5DMXA 4DIMA 4XZ3A 1CQIB 4E4TA 1I7NA 4FFMA 3K3PA 2XCLA 4FFLA 2W6MA 4HNVA 1AUVA 4I4TF 4YAJA 3WO1A 1JDEA 1CQJB 4TUYF 2I80A 3Q1KA 2YL2A 4O83A 2R85A 3R5FA 2NU8B 4I50F 4O82A 3R5XA 4C5AA 2R6FA 1GSAA 4FGRA 2P0AA 2YW2A 5HV6A 1B6RA 4O4JF 2NU6B 5CA1F 3JZIA 4O4HF 4QSHA 1I7LA 3LP8A 2VPQA 4FE2A 3TIGA 4O7TA 2CNQA 4XX0A 1UC9A 2GLTA 5EZYF 1KJQA 4ZI7F 5BPFA 4O84A 1OBGA 4MV4A 4DLKA 2QF7A 3I12A 4EGQA 3AW8A 2R86A 4C5CA 1JKJA 5JQWA 4WBNF 2YZGA 5D8DA 3JZFA 4MV8A 4IHJF 3JRWA 3RUPA 1KJIA 2YV1A 4O7YA 1EYZA 5CAEA 3HB9A 1M0WA 2DWCA 3N8DA 3N6RA 4O81A 3K5HA 4XYLB 5CA0F 3MJFA 4WD3A 1JDBB 4RZQA 1M0TA 1C30A 3DF7A 1T36A 3V4ZA 2V5AA 4O4LF 4FFRA 5BMVF 2YV2A 4MV7A 2R7NA 5CB4F 4O7LA 2NU7A 3WO0A 3OUZA 1A9XA 2NUAA 1Z2OX 4MV1A 4MAMA 2ZDQA 2CNVA 2PN1A 4C5BA 4O7NA 3VPDA 2FB9A 2DIKA 5BPHA 1A48A 3VOTA 3KREA 1GSHA 3G8CA 2R84A 4YAKA 1UC8A 1KJJA 2CNUA 4FFOA 1OI7A 2W6ZA 1KC7A 4EGJA 5H80A 2FPPB 4YAJB 5FNVF 1KUTA 4IIJF 2FPGB 2GQSA 4ZHQF 3Q2OA 1CQIA 4MV6A 2R7LA 2FP4A 2CZGA 4IWXA 1SCUA 2YRWA 1JLLB 3R9RA 3NUAA 3OUUA 2GPSA 1PK8A 5KX5F 3HO8A 1CE8A 5LOVF 2NU6A 2HJWA 1BNCA 1DIKA 5LP6F 3VPBA 2W71A 3R5HA 3DMYA 3MWDB 1E4EA 4Y8VA 2FPPA 3RFCA 4YAKB 2YWVA 3SE7A 2J9GA 3BG5A 4FU0A 2NU9B
chains in the Genus database with same CATH superfamily
1EUCB 1KK0A 3DOEA 4CCYB 1DBQA 1TQ8A 2DQYA 4Y8VB 5CEEA 1T9AA 2JI6A 2KHZA 2WJIA 1IATA 5I8PA 3ZWOA 1Z5GA 1Z6YA 4OD0A 3OZAA 2E1PA 1DBPA 1UUFA 2EJTA 1VKJA 4REOA 2R4TA 4JJ4A 2PUGA 1GCIA 1PX0A 2JNWA 3CQ9A 1ISIA 4H77A 2FPWA 4CCAA 1DV2A 1BX3A 2DSNA 3A32A 1YK0A 1Z5NA 3KK0A 3CB4A 1GDDA 4KDFA 1TQDA 5AD1A 4BVAA 1Q74A 1GPMA 3ZTTA 4C6RA 3HXMA 4UBMA 1BVUA 4OQFA 1L3BA 3RG2A 1NQUA 5BSMA 1F8GA 1IB0A 4G0XA 3G3EA 3FOFC 2EKBA 1LRLA 4BQOA 3AHCA 3KWJA 3ASUA 4LOJA 1CIPA 4HDOB 3KPJA 4IXWA 2Q0HA 4RK7A 4J1TC 4H0CA 2DCUA 2O7NA 1D09A 5DTQA 2OBBA 5HKLA 3DZJA 5FI3A 1BS1A 4DCPA 1N5RA 1CJMA 1U5CA 4ZJPA 2GCGA 1GEGA 2BWJA 2DHQA 1XA0A 4K9DA 3VM6A 1DRWA 1E1YA 2GEJA 5HHTA 1TF7A 3V2UA 3LHFA 2AKAB 1B93A 1L4GA 4DNOA 4FQ5A 4EEXA 2PFSA 2RH4A 3NHPA 1JHOA 1Q15A 3KOWA 1SVMA 1Z4JA 2WUEA 5CTAA 1CX9B 2X1MA 4ZI7B 5K8TA 3T7EA 2ASJA 2Q3FA 4BIIA 3C3WA 5KVCA 3CF4A 1E62A 1RYBA 5F3WB 3IQFA 4NCXA 2EU8A 4J9OA 1Y1TA 3L0ZA 4W9MC 1OB5A 1XU4A 3QV1A 5CDFA 3RS0A 1AQNA 5GAJA 3WL6A 4U9IS 2OUIA 2C9YA 4ITRC 5CIQA 5AIAA 2WKPA 2RE8A 4N54A 1T2DA 3RGXA 3MINA 5DQHA 2J9ZB 3FUXA 3WKBA 4HBGA 1KEEA 2D2IA 2QENA 5FPHA 1ZK1A 4DUZH 1ONBA 4MEBA 3KCNA 4ZU1X 3BABA 1Z13A 4OOEA 4DWVA 1ZCBA 2PYIA 3H84A 1C1DA 2GAOA 1P7WA 4OEHA 4R1PA 1X7XB 2O48X 4KIGA 3KQVA 3D3WB 4R6WA 1KH3A 1W1IA 2RGNA 3VU3A 1XPRA 2IP4A 3IVMA 5BR1A 3T15A 3L7OA 1YR8A 3KUKA 5DHTA 4EW2A 4KHPH 4YECA 2PH7A 5IFKA 3E81A 1O89A 5AI4A 3CRZA 2QZPA 2IYSA 4RABA 1WQ4A 3N8IA 4L4SA 4ZQFA 2EZ9A 3GCWA 3NTQA 4S0ZA 4XYBA 1DCMA 1X86B 1JTEA 1QYCA 3A1EA 3OC0A 4A6EA 1NDUA 1QE0A 4TXJA 2QX6A 3VYTB 1NC1A 2WKSA 4WKCA 4NPCA 4WNCA 3B20A 1A04A 1KNXA 3S3TA 2V0GA 1NBME 4HLNA 4KKVA 2ZUCA 5BRAA 1PV2A 1X19A 2F3UA 4MQMA 3ES9A 3MD9A 2R79A 3QX7A 2QVZX 4Q4JA 3RJMA 3EH2A 3VSAA 5J4KA 5IDWA 4KXMA 2FGJA 5ERXA 3VHLB 4OHFA 2YWCA 5J4LA 2RDJA 4MKRA 3GFOA 4RUAA 2JA5A 2LIPA 1E58A 4U9HS 1IK6A 3E70C 1NUUA 1PE0A 4HGZA 4WGFA 4A8TA 4BAZA 1ICEA 1IEQA 2DH5A 4KSYA 3P0IA 3PR3A 4OK5A 5EXDA 1KZ4A 3MWEB 2ZSDA 3BWCA 3GNTA 2BGUA 3PHCA 4XCXA 2E6UX 1FFHA 4JOBA 5BWBA 2QLMA 3GRZA 3AYZB 1RJ9B 3GWZA 2XB2A 3EFEA 4XX1A 2FEWB 5TQ0B 1Z6AA 3D6TB 4PYJA 1I14A 1LBIA 2NTNA 2OHHA 4X8LA 3TNJA 1S9HA 1M73E 2GKSA 3BB1A 4FNGA 3GCZA 3JQ7A 4M0KA 1TKCA 2E2WA 3LWNA 1HFJA 2SHKA 3FR7A 4J1TA 4Q47A 4ZU6X 1JHUA 2DHCA 2PRKA 4LZPA 4PNPA 1QG0A 3U5ZB 1C1XB 1JKFA 1GZSA 3PYXA 4DV1B 5HCIA 1GV1A 1U0OC 1HZZC 1XDSA 2HY7A 4QRHA 4UNNA 4F4IA 2HWWA 5JASA 2GVNA 1L4FA 1OLUA 3OG9A 2H17A 1A5AB 4XRRA 1HTTA 5IX8A 2OESA 1CW2B 4MVJE 5DTJA 3T38A 4IWNA 2KYRA 3M7IA 2RGUA 1EGVB 2B4KA 2UVDA 3GFBA 3H9JA 3F73A 2BGTA 1KGSA 4W6ZA 3K71B 3KCQA 2WMYA 2C4NA 3IILA 3HJGA 4DSZA 1Q77A 4QT4A 1TA8A 4Y2XA 5F51A 3FPGA 1EHCA 3IKMB 2PWAA 4L5JA 2CLEB 2LIVA 4RHCA 2B78A 5DI3B 4NZNA 4CIXA 4DYVA 2BUAA 2B9VA 1T5OA 2IGBA 2H1RA 1S0OA 3LYUA 2DE0X 4GGOA 4OREX 4P98A 2IYTA 5K0GA 3L0OA 2Z2ZA 3WRVA 2EX0A 4KPFC 3INGA 1QU3A 1ZVQA 2I7CA 2W8BA 4YJKA 3GVHA 3BULA 3NDPA 3ANTA 4YRDA 3BGIA 4RUCA 4I1UA 4RZSA 3I1FA 2CW7A 5E9AA 3T7KA 3ZW9A 3RREA 5JAZA 3A3PA 4LFAB 1XEFA 2OV3A 2IBSA 3C2QA 3WDMA 4IYJA 2IYEA 1YRWA 4Q9AA 1XOIA 4WLNA 2AEJA 3NHKA 4YR0A 5IAOA 1ODLA 3PW0A 2YR0A 3LRXA 3OJFA 3TCKA 3A1CA 1KWGA 3PEVA 3TFOA 3GA0A 2AG0A 2MSCB 4F9GA 1ESDA 2WYHA 1Y6RA 1ZOIA 2VVTA 3IXQA 2HNBA 3HS3A 3OEEA 4PSVA 4TTRA 1W4AA 2QJOA 2WTFA 1NZJA 1SPXA 2VDOB 3LHDA 1KRHA 4YGYA 4IIEA 3TLZA 2BUBA 3J81A 5FUVA 4DBLE 1ID1A 2GGSA 4DDKA 2YXNA 4U7PB 4P31A 5K6RA 3U4AA 2J0SA 3EEBA 4TQAA 2ST1A 2WWXA 4MWBA 4IMRA 1X7XA 1JIJA 3ITKA 4OI4A 4Q0MA 3SF8B 4ALJA 4D3XA 3DWEX 5JRJA 3HXOA 1IY0A 1IHXA 2OBYA 2REBA 3HGTA 5CB0A 5JTUA 4WGGA 4CN8A 5I5YA 3ZCXA 1VIAA 1YAHA 2O52A 2BFEB 1ZJ6A 1L7MA 2WIDA 1RM0A 3BDVA 4Y2PA 1R4ZA 2RIPA 1V3UA 2C2ZA 2GYYA 3C4QA 3KSUA 4H7IA 2ZI9A 4I99A 3C5VA 4ZQBA 4DL3A 1G21A 1K7SN 1PRYA 5AKZA 4ECUA 5AESA 1RQGA 5EL0A 1E2LA 1CQJB 3ADCA 4DV3H 2QSJA 4QOFA 5K6TA 1Z0UA 3QWIA 2NP7A 1DCKA 1MC8A 1FMCA 1U0SY 1ZIDA 4LC1A 3E7DA 4LZZA 2EC5A 4PO3X 2VSNA 1N2IA 1AGNA 3LK6A 3L7BA 1IPFA 2ZAOA 5EG5A 1YI1A 4QIWA 1Z8NA 2NU8B 1T9KA 1XLTC 3OKAA 1F20A 1NV9A 2QX7A 3KWLA 1Z2DA 3PQEA 4RLSA 4TTPA 5JCOA 3V6MA 2J30A 6REQA 6ABPA 2ADFA 2B3DA 3RBEA 3MTJA 1TCAA 1BAPA 3KLNA 2R6FA 1F2UA 4EB6A 5JNSA 2ZM6H 1P1HA 2NSJA 3DYVA 2DPHA 3HMKA 3SI7A 1LDGA 2DP4E 4L0DA 4AZTA 5IVKA 5KFXA 2EYUA 2OHIA 1Y8AA 4R2LA 4KQGA 1YBMA 2VXYA 4G1BA 2GN0A 2HU2A 1NONA 3D9QX 2K2QB 4X93A 2JCBA 5IAEA 4ZU3A 4FOLA 3UANA 4LVUA 3RADC 2UXCH 1PQ4A 3ZVRA 2EHDA 3C0KA 4WJZA 3RYFB 1UOOA 2QQFA 3NEJA 1YDFA 4QSHA 1M1UA 3U39A 1NKSA 1YU6A 5IYCG 1XCMA 2GA9A 5F9NA 4WRRA 4YJ2B 4ZARA 3FLEA 3RRFA 4U8GA 3UHAA 1UFRA 4G0MA 4IQ8A 3DE2X 3NHUA 2D4HA 4RH1A 5D51S 4R0VA 4S3MA 4IRCA 2CNQA 1Z16A 1Z7WA 2R66A 4R01A 1QR2A 4QJFA 2FR8C 4PX9A 3GQBA 3SXJA 3GH1A 4TVSA 2O8NA 4QUJA 1PS8A 3VSDA 5BPFA 2AVNA 1Z0JA 4J1NA 3IV9A 3PGLA 5C81A 2BMDA 3RIZA 3HFSA 4EVRA 1CTQA 1WMFA 2IH4A 1IBRA 1KZ9A 1EDBA 2IZ7A 4ILEA 5F33A 3GRYA 4LF8B 3QPCA 1E59A 1G4AE 1PW7A 2PMFA 2Q2NA 2C95A 3PQ2A 1PJAA 1SG9A 3U4DA 4CV2A 2CFCA 5FDFA 3EXFA 1N6LA 4ZOEA 4Z7NB 4UU7A 1QB8A 4V0OA 3GPCA 4A2CA 1JKJA 2HPVA 2WPNA 3SYRA 3TI7A 3UJDA 1BVRA 2IODA 3V32A 1L5WA 3T5DA 4C4TA 4LS3A 4O2LA 2CYCA 1JKMA 1H0RA 3HG7A 1JF8A 1ST2A 4IJWA 2CUNA 4EB6B 3IT1A 3B6ZA 3VU9A 5EIXA 1XXHB 3NFYA 2ZE5A 1I1MA 4FMPA 1JG4A 2NXEA 5JAPA 3TL3A 2FX3A 2IXGA 3HFGA 3IAFA 3BCHA 1U2DA 3SJCA 4UTVA 4QEZA 2OM6A 3A9WA 2C98A 2GNOA 5I5SA 1DIGA 3C85A 3L8DA 3JCZA 4FMDF 3O2JA 3P4YA 4IV8A 1SQ5A 2HRQA 3QVTA 3PPVA 4KACA 4PWYA 4XUEA 2CHUA 5AH0A 1E6MA 2PVCA 4DMLA 5K4HA 2A59A 4CW7A 1N9GA 3OZFA 4EFLA 4QBFA 3FCXA 3DZBA 4KUEA 4QUIA 4CI0B 4RV4A 4QODA 4JR0A 4PTYA 1QB7A 3PQ4A 2YXBA 2JGNA 4D2IA 5AVUA 1GQOA 1VC2A 1WBBA 3HZHA 2ODBA 3KKLA 1L8XA 3C7DB 2R93G 1I2CA 5IM4A 3JRNA 1VL0A 2P4UA 4CIAA 1JYSA 1XZHA 4R2IA 4NDNE 4B3XA 1OFUA 4FLEA 5AT1A 2GR9A 5REQA 4CKWA 5LQSA 2X40A 2FR8A 4X1KB 1W36B 4ED9A 2I65A 3VR5A 4B8YA 1UCFA 3EVNA 1USVA 1Q1EA 2BMEA 4BLQA 1YQDA 2BJWA 3CO0S 1V8PA 5AW6A 1R18A 4PLTA 1DOAA 4RGVA 3ESQA 2WUGA 3T5CA 1QP7A 2CBXA 3SX0A 3TNLA 3V4LA 2E5LB 2GKOA 2JC3A 1TCCA 2HK9A 3F5MA 2WJAA 1P8LA 3GJ6A 2ZI7A 2OBXA 3BYZA 2WZDA 5DGTA 2YWJA 5HUJA 5FWXA 4C07A 3PFWO 3JQGA 2NNWB 3RAXA 4WACA 4Q4AA 4YFVA 3SHTA 1KR2A 1I24A 2LD4A 1DJPA 2JLBA 2VAVA 2XHZA 4V0SA 3UB2A 5A4DA 5ITZA 3AVOA 5C4GB 4RD3A 3GJ3A 4HZUB 4PRZA 4HGNA 2H07A 3R3HA 4B48A 4H9GA 2ARKA 2I7TA 3U4MA 4YRRA 4IZIA 5FLYA 2ZXEA 1CUAA 3Q9SA 1ZUD1 2YV5A 3R9XA 3SC2A 1J09A 1TZMA 3DMNA 4O4HB 1XRMA 2GLUA 3E22A 4QPCA 3D1LA 3FRHA 4ZD6A 1SKMA 1GSHA 3O47A 1L5KA 2CMKA 5SY4A 1O95A 2AMJA 1H2FA 1QGDA 3GFRA 3K8QA 4AY4A 2KSQA 5CVTA 3HOWG 4B84A 5DNDA 4Q9DA 5KFVA 1IWPB 1YZFA 3ZHXA 1AMOA 2QLNA 3L82B 5AMXA 2GM4A 1JFVA 1YZGA 4FS2A 5FA8A 1Y1WA 1FC0A 3PDIA 1Z29A 1D3AA 5D7NA 1FW8A 2MJLA 3DAHA 3YASA 4YXFA 2WJ6A 4FPXA 1E5VA 4Z9FA 4PGAA 4C06A 4HVCA 4P58A 4WY2A 3R3WA 4O5OA 1BYUA 9LDTA 3CHYA 4TSRA 2WSSA 3ZR4B 3ZPXA 3AHGA 2XMZA 1ZCFA 3QTTA 1CUUA 4GM4A 5JQGB 4DV0H 4F72A 2HRCA 1KK2A 1XWIA 3WC4A 1T2UA 1ZVKA 2WNSA 1P0IA 4PX3A 5BYKA 1R0RE 3FVTA 4OSOA 3ABOB 4ZI5A 2QSYA 5DAAA 1A98A 5JI2E 4CJXA 5DXJA 5C3MA 1U2PA 4AUKA 1T2FA 1M6HA 1QH0A 2IEZA 2XUDA 2F8SA 1E6CA 2N9UA 1EFHA 3V6KA 2R1TA 3CKKA 4Z0HO 5BVHA 1UKVY 5KFQA 1TOAA 7GPBA 2O5VA 2Z8YM 1RLMA 2OK8A 2VN8A 2YOHA 2CF5A 3JARB 1A5TA 4O29A 3LU1A 4QEKA 4XVUA 3HT5A 1KI6A 1NOJA 1KI9A 3H9BA 2FDCA 1KDTA 3ICOA 2P8JA 1ZH8A 3IR5A 4EJ6A 4FQ8A 5T8KC 4OQEA 4CM5A 3P2YA 3I9MA 1WRBA 1DIKA 4V0ME 4H6PA 2WF6A 3V55A 5A5DA 5KHOC 4BBAA 5K8JB 4INOA 1XZ8A 3G0BA 4WWHA 2D2VA 3WLLA 4GZMA 1E4GT 3KYJB 4AULA 3QPDA 4Y9DA 3D7NA 2NYUA 4BO5A 4IIGA 3NUQA 1U9IA 2J6IA 1D8AA 1XQ6A 1N7HA 2VJKA 3HC7A 2E5WA 1I0IA 3SU8A 4AUMA 1JDSA 3WR5A 5LZ5A 2ESRA 2WKRA 4TL6A 1KJYA 4K7JA 2WG0A 3I9FA 5T64A 1E64A 3E3NA 1WMBA 1JWBB 3H9QA 4DJDC 2ODQA 5K3FB 1O08A 1LPAB 4YREA 3KSDO 4TMFA 4NECA 3ILXA 3ZBTA 1SVOA 1D7AA 5B4UA 3D2BA 1XAHA 3GT4A 1ODJA 3VNRA 1YVPA 5I4IA 2C04A 4G5HA 1WW2A 2FW6A 2ZETA 2G70A 4FR5A 2QZZA 3C70A 3OLVA 4R1QA 1FYWA 3PPYA 4AT1A 4YCJA 3HZZA 1ZM9A 5LA6F 1KYYA 2X0RA 1WAMA 2P27A 1Q0TA 2CNLA 2JCSA 1ZNWA 4JZKA 1V8ZA 5DTEA 5E6UB 5BQPA 1VGVA 3FMOB 4RZ2A 4WT7A 1F0YA 2YCBA 3C8MA 4NYIR 3W4IA 5CYGA 3E0XA 3REOA 1W94A 4LXXA 4KR6A 1PT8A 4LKOA 5IC5A 2EFGA 2JJ8A 4QT0A 421PA 2FEMA 2FH5B 2VUSA 3UAXA 4RFLA 2YVQA 1EE1A 5SY9A 2YMQA 3AU8A 3FX2A 1JLLA 4MIEA 3WMFA 1IJBA 2MYTA 2OZLB 2IX3A 1N2CA 4G63A 3PDWA 4Y30A 1RJ9A 2R8JA 1NN1A 3ZNOA 4A3LG 5AK4A 1QTQA 3R5TA 4BNXA 4V1CI 3FTEA 2QMOA 1FL9A 4D8UA 3L1UA 1LEHA 1CUZA 2DQ4A 3K4HA 4WLUA 3OX4A 2Y0EA 1O1YA 1QHIA 2HT6A 4P7KA 5KNDD 2VDVE 4YJ2A 1S4MA 2IUTA 4ZA2A 3N0WA 5BOSB 3LK7A 2HO5A 4U7DA 3UK2A 3OCXA 1O8CA 2F3TA 5KYNA 2X3YA 1YFJA 3UK0A 2WLSA 2CJXA 3RIYA 1BG6A 3GUUA 4B9AA 4DCOA 1Y4DE 2HMAA 3M4IA 2A5JA 1J20A 2PV0A 3MOGA 1RJWA 4O3SA 3GK3A 4NEQA 3NBQA 2H18A 2HEIA 3RYHB 2JDIA 4BDTA 4WLFA 1AUOA 3FBGA 4JEUA 1WB6A 3B36A 1GL7A 4Q1AA 2AQKA 4I8XA 4BFZA 5JU6A 1DSSG 1SXGA 2Y2VA 1FJGB 2FQ1A 1J7JA 1LZKA 3G68A 3PYMA 1Q14A 4BO1A 2O5CA 1N3LA 3CZ5A 2B2XA 2JEZA 2NV0A 4L5CA 3G5MA 5DMHA 1GFSA 5KAMA 2YQ4A 2FV8A 2BCGY 4JBIA 4ZCSA 5LC1A 2AB0A 3HI6A 4OM8A 2ZROA 5H7XA 5CAEB 3U7GA 4R2JA 1M33A 2BTQA 4JIGA 4KQEA 3STWA 2HREA 4BX2A 1EDEA 3OESA 2RDIA 4NMLA 4C3VA 4DNPA 3GOQA 3O4RA 4V0LA 5LMUH 2OCDA 4A73A 2C31A 4L8WB 5KI6A 4YIKA 2PQ0A 1DJNA 1TYAE 3UJ3X 3FUVA 5H70A 3FH0A 3EXG1 3NIFB 1QMGA 4KGDA 4I55A 3LIPA 4NDAA 1Z73A 2XBLA 1RHMA 2Z5FA 4U7GA 5AJWA 4GKJB 3NXKA 4QGBA 5D5HA 4WCVA 3ZWKA 2YFYA 3SGIA 1FYEA 1R64A 1S96A 3PL1A 4HH3C 3T0FA 1RYSA 4RA9A 2VUTA 4WXRA 5GONF 4QUHA 1L5FA 2RHCA 5H59A 1VHWA 3SG0A 5LA6A 1WDWB 2XKAA 3E2IA 4NCNA 1KO7A 3U31A 5IWAB 5C7IO 3SS9X 1XQWA 2ANBA 3AGPA 3GV0A 5HQTA 2JLVA 2P9HA 4H08A 4JJEA 4HX5A 4F1KA 3A1FA 4TLMB 3QE9Y 4A1FA 1TEHA 4OAQA 3SNHA 3ENWA 3JQ9C 4R8RA 4FM9A 2FPLA 2JASA 4QUGA 2IS1A 2ZRQA 3AB3A 5IXYA 3JYNA 1E0DA 2D1RA 1FNNA 1K7FB 1ZU5A 3OFNA 1DKQA 1SUBA 1KZGB 1J0BA 1CNEA 2ZBQA 1RZUA 1RACA 2OGSA 2PSHA 2YWHA 4FE4A 3G89A 3WFJA 4HXEB 1HEIA 3LDAA 1T6NA 4KXXA 4LNUA 2A9JA 4RHXA 5ICFA 1IBLH 3THSA 3UGQA 1L7VC 1OBVA 4E5UA 1TPYA 1ZKDA 1OI2A 2HUPA 2OXEA 2XUKA 4A8PA 4JT2A 5B55A 1NKTA 3QPAA 3L0BA 2FXVA 1GFWA 1JP7A 1R27A 1AURA 4GKKB 1PKXA 1V4YA 1MAAA 2DLDA 1I1QB 2F1IA 2J48A 1Y6GA 2WAOA 2Q3MA 1GVHA 3VNBA 3LKVA 1SBYA 4IMIB 4FZ5A 5ALTA 3TE6A 4Q1DA 2QVYX 4UHFA 1X1TA 2QRKA 5KFPA 3F1KA 3BDIA 3OEWA 5D84A 3GTPA 3CIOA 3I62A 1G6KA 2PD4A 3DW1X 1TVKA 2PAAA 4MR7A 4W4TA 3CGWA 4J0FA 3TFQA 4ARAA 4F3KA 4DEXA 1EFDN 4KV9A 5IT4A 1ADYA 2WICA 2GN6A 2XLBA 3E35A 5AJHA 4KAAA 2O19A 2AOVA 2GFHA 1VPVA 2ZBEA 5CVVA 4EPXA 1I2LA 3UXMA 4BO8A 3F6EX 3AM1A 2PT5A 3CLKA 2HHAA 1SXJB 1D4OA 3NV7A 4HN4B 3CVWA 3O8DA 1WXXA 4WZAE 1DAMA 1KOLA 1JDBC 4MCHA 2ZB8A 5MHTA 1R4MB 2OA0A 4MA0A 2HBRA 3Q0IA 4LFBB 2JCVA 1VS0A 1O4VA 3P71T 1MJGA 3CEMA 5KWVA 3HVKA 1JLKA 2C4WA 4Z3DA 2K6GA 4XYEA 1MPTA 2WHEA 1Q1QA 3Q1LA 1SBNE 1MBZA 2XGQA 4GI1A 4B82A 4HNAB 2DXIA 1LV8A 4HNTA 3QHQA 4XTCS 2PKRA 4WOCA 1FRFS 4GBGA 4K46A 3QZ7A 1QHSA 4IH4A 3BE6A 2E87A 2GNPA 2GMWA 1BN7A 1D6MA 3DEKA 4F4FA 3RASA 1UWKA 3DMHA 5LP6A 1H3FA 2PGJA 10MHA 1JECA 1U2SA 2EP5A 4BLWA 5FL7D 3F2IA 1YHNA 3AONB 1IPHA 1MR3F 1Z28A 1H69A 3PJDA 4MZXA 3UG7A 1K5GA 1Z5WA 2R87A 1UMKA 3PNMA 2F00A 1N6HA 1ZM7A 2PPLA 2W4MA 4X66H 3U9SA 5HE8A 4JU8A 1UPAA 2W2KA 3L4SO 4FGWA 4UQLA 4TL9A 3HYRA 3KNZA 3TDNA 1G8GA 1H8HA 4U2DA 1T0JB 1Y8QA 3ZV3A 1R16A 5K8LA 4RLFA 2ZT7A 1J90A 3S7ZA 1T9HA 1X9GA 3AUSA 5SY6A 1T10A 4P3PA 4MYUA 3UFBA 4QGGA 3QWAA 3M9NB 1EWRA 4IUYA 3OZCA 4IL5A 3G2KA 2ISSD 3OD1A 4FW8A 4XIJA 4CMEA 4E2FA 1AU9A 1P2UA 4B0OA 4XIGS 1WY5A 1LDNA 1EUDA 4NH0A 2WF5A 4IGAA 4JYMA 4BFVA 1CJSA 2JZNA 1FP6A 4AQDA 4Z1OA 1GTMA 3RS8A 5AVWA 3PW5A 1U8EA 4JX8A 3DBVO 5CFRA 3ILSA 1MGOA 3VVLA 1JAHA 1TM2A 2GEKA 3IIMA 1A95A 3WLHA 1QP0A 3G1TA 3VH1A 2P9YA 1UC5B 3D54D 3ZI4A 1H9CA 3AM3A 4IAJA 3HCDA 3PDUA 4JSTA 4A15A 4YXWA 3ZY5A 2IMWP 1FTWA 4FFMA 1SO8A 2WIFA 2RHGB 3GDWA 3V4PB 2H4XA 4UHDA 1C1XA 1EB8A 4D44A 4F6CA 3W5OA 5A6SA 5JAUA 3EVAA 3JQ7B 4BKQA 3WAGA 1EUYA 2EJ3A 5HF8A 5C4MA 4W5RA 3MWLA 4ZVQA 4EMSA 5KSZA 1L2TA 1YKFA 1BOFA 4LSMA 1VSVA 4HLUC 1D04A 2W7TA 1PCXA 3FCOA 1BVYF 4N7JA 5K8CA 1PJSA 1Y4SA 3MUFA 3K9BA 4QRDA 4XVCA 5B6PA 4QASA 5I01A 4HNQA 1PTJC 3NOQA 4BNLA 3ZWNA 1VMAA 2QX9A 1IVYA 2BFPA 2VK4A 4XE5A 3SQLA 5BR4A 1ZGAA 3C39A 3TRKA 3AU9A 5T4HA 4ZTZB 3UMVA 1I1KA 1RC8A 3QYPA 1CKMA 3L0YA 4O3RA 2W58A 2P9CA 4DV6H 1N56A 1UKCA 3CXUA 1RPZA 1H2EA 1ZHQA 2Q9CA 3IP3A 1TT7A 2HIAA 4O4JF 4BMXA 4ZQEA 3HDVA 2Y1CA 4G41A 4WFKA 3KDPA 5ALGA 5A5EA 4RPLA 4DYDA 3ISTA 4TMZA 2HADA 4RJ2A 3MCUA 1O3YA 4CCSA 5J4YA 4M1KA 2IOFK 4UNQA 4TXMA 4KX5A 3DEAA 4PG5A 1HT0A 4DYHA 5A9TA 2BFOA 1YMVA 1RM3A 4FHZA 1X1SA 3RVRA 2W00A 2MINA 1WD7A 2DWOA 1EAMA 2PZEA 3ZVLA 4YAOA 3OHMA 1V9LA 4AROA 1R00A 3OE4A 5ILGA 1CUGA 2QRPA 3IPXA 4HRYA 5CB6A 5FNZA 2EGGA 3IUJA 2QMYA 1Q2UA 1L4UA 2PZFA 2VDMB 3L8FA 4LCEA 5JWHA 4X60A 3RKUA 4BC0A 3W04A 3P9IA 4H0NA 4ZVPA 4I5FA 1S7CA 3H0EA 3ZNNA 5ESXA 4RHFA 2L42A 5IJZA 1SA0A 1W88B 1E0KA 3B38A 4FBMA 3EG9B 1USGA 5DLDA 3ROPA 3SXUA 3ZHRA 1WOYA 3QLUC 3KQMA 2WIJA 2YV3A 4DLKA 3BRWD 1GKIA 3W1GA 4Q3NA 1M2JA 1A50B 4EGQA 3CJQA 5JSUA 1SR8A 4FI3F 3QK7A 4AS3A 3LYHA 3VVCA 3D0OA 1IUOA 5COBA 2PMZE 3J7AK 2O1WA 2OO3A 2Q4RA 3KXLA 4IH9A 4ND8B 5J1TB 1NPDA 1K9SA 4Q1EA 2ODAA 2MYNA 2P4EA 4H16A 5U1PA 1HDOA 4GEKA 3W3AA 3A1SA 2CLMB 4H6XA 5E4JA 4WBNF 5BSFA 2HJVA 4OIFA 4QREA 3JRWA 3N40P 1LFDB 1VG0B 2LDXA 3BQ2A 3H86A 4ZRDA 3VU0A 5TQ2B 1E7YA 1NJ1A 2O8VA 2CDRA 2G9ZA 1JKIA 1DJOA 3WRWA 4BV8A 2EJCA 3LY5A 4FDMA 4HDMA 3CKYA 5H16A 4HH0A 4DV2B 2VTBA 4LKRA 4ZGWA 3CLSD 5AVSA 1G4UR 2Y05A 2FZEA 1SK8A 4BTLA 2RC6A 2JGRA 1SKYE 2VYCA 2J6HA 4FE7A 5B12A 4IV0A 2CHFA 4TYWA 1KFEB 5I5EA 1I4WA 2FSIA 4I4LA 4I46A 2X15A 1CERA 4INZA 4JP2A 1PZGA 3HN2A 3V46A 4B6OA 4DCJA 1YS1X 4JT4A 4RF5A 2FLPA 1G8AA 1A5SB 1QC5B 3K1JA 5CFQA 2CT8A 1XF9A 1UAYA 3E8SA 5ECWA 1M2OA 2UU9H 4PIMA 4LWOA 2PZMA 4BB6A 1BHJA 3ZYZA 1VP3A 4FZ3A 4JMLA 2C2DA 3HNPA 4Q18A 3RW9A 2O8EB 3P0RA 2QUJA 1R6TA 4EPWA 2VRBA 3ISJA 1AKVA 1I6UA 1KBQA 2C2MA 1BJTA 1BJRE 3DYBA 3U3KA 3ZGVA 2P0EA 2ZYIA 3AHEA 4DHWA 3AKEA 4O4LF 1Y6QA 5KOIA 3RYIA 1DS6A 4D92A 4LQCA 4L4XA 4DS3A 3DW3X 4XUCA 3AZOA 3NWOA 4Y7CA 3FUCA 5H68A 3NOOA 3ZWCA 5MFPA 1XNRB 4KWIA 4IDFA 1L1RA 3PRJA 4FNAA 5CH5A 1XP5A 1BW9B 3QKRA 3WMGA 1VMIA 1IWOA 2A1UA 4HPXB 1B14A 2HVSA 3IV7A 4CEJB 4WBNB 1OA0A 1A9XA 1WL8A 4PC7A 5JBNA 2F4NA 1J1IA 2CLKB 2XYHA 3I3OA 5DK4A 3O7WA 1UJBA 4HJRA 2QVLA 4OH7A 2B1JA 1V5IA 4WNYA 4JWKA 4L6IA 1SHLA 4QVKA 5KC9A 1A69A 4JKOA 2DBQA 4E08A 1AM4D 1B0ZA 3CX8A 5CB4B 3PDCA 4PCLA 3TVTA 4YDHB 1K8YB 2LXNA 3VOTA 3L7IA 1K66A 3FHCB 4KQIA 3SEAA 3DEJA 3UMRA 3P2JA 4L74A 4O1IA 1OYYA 4GPTA 4R7GA 1LI5A 2OHGA 4MDHA 3VR4A 4BWFB 1F4VA 1BCRB 2BGRA 3EYWA 4YAJB 3E5MA 4Y1GA 1AK9A 4NK4A 4F56A 5CM8B 1A8QA 2R1UA 3JQPA 4B1FA 3L5KA 3RPEA 3V7UA 1PN3A 2W93A 4YUWA 3BK2A 2C4TA 4TRJA 4ZV9A 3RNLA 4YR7A 4J7CA 4JI5B 4GR4A 4Z99A 2YMPA 4N3CA 4M9QA 2VT2A 3VO2A 1USIA 4ZYLA 2WT8A 3HDTA 1KHTA 4F50A 2WTNA 1UBSB 2N75A 2JEFA 1R0XA 4HHEA 3GUVA 3O1IC 1C50A 4PYRA 2VXCA 4QRIA 3Q8MA 4N6GA 4DR4H 3G85A 3CX4A 4MR8B 3FWZA 5EJGA 3D2CA 1P0FA 4IKOA 1MJFA 2GN4A 4Q39A 3C3KA 5L4NA 5B1DA 4IJMA 2X8WA 4G1FA 3C3MA 3JU3A 1GPLA 2H85A 5FB3A 3RAGA 4K9KA 2BC9A 3UMJA 3FKIG 3COJA 2G4LA 4PY2A 2IDZA 1SQFA 2C4MA 2GPYA 5DHAA 4HATA 3WQQA 1RZRA 3Q3CA 3OUUA 2GTHA 2ERYA 4NFSA 5GGXA 1XNRH 2FMTA 3TEJA 5ENDA 3ROZA 1V6SA 3UQ8A 2V4ZA 3IVRA 3R5SA 1OZFA 2BMAA 2D13A 2ZJ5A 1OT3A 1V1MA 3ODPA 1E2DA 2WPDA 4ZQCB 5B1YA 2ZJ3A 4D80A 3KJZA 6PFKA 3ZD6A 4R81A 2EWVA 1ADGA 2DPJA 2HUNA 2GJ9A 4JJZA 2O8FA 1QPZA 2XZTA 2LBPA 4R1LA 2X6QA 4JBWA 3CT4A 2OCYC 1I36A 3GT0A 3GZJA 5LJLA 1PEDA 1GTL1 2H5LA 2IHYA 1A9YA 1FFXA 2XIQA 3HRHA 3WNVA 5K01A 1XPUA 2OBMA 1DHRA 4URHA 3W7AA 4FONA 4DL9A 1QH1A 3IJ5A 5AVVA 3RFCA 4IDNA 4D5GA 4Z9XA 3QX8A 3EWNA 5I7WA 2AWOA 3KTOA 2VDKB 1NI4A 2YFHA 4R5MA 1R37A 3SJAA 3KL4A 3M3HA 5EJFA 2NV2B 2J8ZA 4YUVA 1ORVA 1Z35A 2C2EA 5IJXA 4DR1B 5FUWA 3TQCA 2ZTSA 2XE7A 2IV3A 4US1R 1W8IA 3FNRA 4X00A 1G8JA 3R9XB 2R7MA 4XARA 1R5OA 4ID3A 4ZHQB 3G1UA 5E7IA 2UZIR 3PCTA 2Z8ZA 4MUJA 3UMGA 1JQBA 4MIYA 1MORA 4GMGA 3TW6A 1BU8A 2I1WA 2ZSUA 4NABA 1Q11A 4F04A 3ZDDA 2WWFA 1UKAA 5HFAA 4M8KA 1H4QA 1KR5A 5FBZA 3BF7A 4HBZA 1ZCZA 4K6FA 4LJ4A 4GQBA 3T41A 2ASEA 4MS1A 3K0FB 3VZCA 5JSHA 1QUEA 3LX6A 4RGQA 4ALLA 1SNYA 1K8XB 2OOKA 3DTTA 4RV5A 5EY5B 1RWQA 2W9XA 4KBGA 2NO0A 4RGBA 1U1DA 5ES3A 2UYCA 4BXOB 4F4YA 4YDRA 4QNNA 2A9OA 4U2BA 3BF8A 4ZT5A 2DPGA 4YP9A 5JS1A 1NVFA 1ZM2A 2QRMA 4S1PA 1CS0B 2ZM5A 4US2R 3PNPA 1T91A 4UCWA 2NM0A 1L5LA 5H3LA 4OHBA 3DB1A 3URMA 4X84A 3H20A 5JAHA 3UVEA 3MWEA 4PSKA 3JXEA 2QTMA 1KP3A 5EIAA 4Q45A 2JFYA 2GEBA 4B83A 4B6PA 3AHHA 3EQ2A 4BE4A 1TM1E 5GJCA 4GG1A 4ZOLA 4YUYA 1O97D 2H2FA 2LKDA 1EK5A 2V59A 5GWXA 2PMKA 3ZK7A 5F9FA 2ES4A 3KQUA 3B1JA 3QZUA 1DDIA 5AW8A 1GRNA 3NBYB 4GRAA 5DI9A 2CD7A 4R3UC 1C9YA 1LBSA 1YKSA 3C6ZA 4OKSA 1Y81A 2QYZA 2WU3A 4OJQA 3HI4A 3I8OA 3I6YA 1Y1VA 2JLRA 3QMMA 4M60A 1C7RA 5P8WA 1HG1A 3O21A 4IYRA 4PFKA 3X0DA 1SEPA 4IHAA 5B2EA 1EX9A 4ZVLA 5K0LA 4PTLA 3O73A 1KIMA 2QUBA 2AF3C 4HFNA 4HUQA 4RZ3A 2I67A 5HXAA 1QIMA 3PXCX 4PLFA 3CWZA 4FR0A 4BWVA 1CF4A 2UYQA 5BQFA 4TT3A 4Q3BA 3WMXA 1R5BA 1L4EA 3DEFA 2Q6LA 4BZWA 1HSOA 2GQ0A 3F4LA 2CXNA 1OX6A 2PU7A 4KRGA 4MYRA 1ZRNA 3AVWA 2ZRJA 1T4BA 3MLAA 4DFDA 3UC9A 3ZK8A 3UV7A 1Z4OA 2ZATA 3KQTA 4NFHA 2PWPA 4UJ5A 3DXFA 3M70A 4O7SA 3D6AA 2AK2A 3F1LA 3O9ZA 1TXGA 1JFRA 2E4ZA 3EXAA 2IS4A 1D2RA 2P5SA 3HVHA 3U62A 2CJYA 1H94A 2YOFA 5BN3A 2R97A 3I04M 3SSOA 1GT6A 4REMA 4AY5A 3MD0A 1V3TA 3AO0B 3SC4A 4EHAA 4DR3B 2W70A 1QIFA 1X80B 2JI4A 3BMOB 3GEPA 4AUNA 4DEYA 5CT5A 2IYLD 4DPKA 1S2NA 2OK7A 2JGJA 4M9SA 3AHJA 5CK4A 2ZYSA 1SYXB 3F6CA 1DKOA 1HNZB 1S7GA 1IEXA 4JI4H 2O3JA 4MUAA 3GY0A 5JBIA 1G6Q1 1T1JA 1YK1A 3NCHA 1R8SA 2HX1A 4QDJA 2DAAA 2KMLA 5A06A 2HXGA 3VPXA 2G77B 2BYTA 3UAGA 1S8OA 1T9CA 4I5GA 4UBLA 2V4UA 4N03A 2B7LA 2VG8A 3JQQA 1I01A 2XCUA 1BCSB 1TIBA 1JVNA 4JOCA 5AW5A 1GTRA 2O8FB 4WX2B 2O2JA 4GZ3A 1M1YB 1O2DA 1UIRA 2GX6A 4EO4A 3AK4A 2ZS9A 2VKQA 1MJNA 3FRIA 3DJFA 4UBNA 3WLIA 4JB0A 4UARA 4HNUA 5JUMA 3EHDA 2WD7A 1ML3A 3QH4A 4OQMA 2RHDA 4WZBB 5GZ1A 2BEWB 5GV8A 2J9FB 3WSWA 1E4EB 1V11A 3P9XA 1Z18A 2R68A 5JH7A 2P1DA 3KYHC 4Y9RA 3K0CC 1LDBA 2VDLB 2YHIA 5EKSA 1J24A 1KFJB 1QV7A 3KSZO 4P1ZA 4FIDA 4TN5A 5DXFA 4B5KA 1QF7A 3ZGZA 1NATA 2GBPA 5AJYA 3ORYA 2DB3A 2O3SA 3F9IA 4ZGGA 4K8RB 2B6NA 1Z47A 2NMVA 1NTRA 3N1UA 1TAGA 2HPAA 3E9NA 3FZGA 2ISCA 3BACA 4MWEA 1W5EA 4X90A 4YJ2F 2XIJA 3DP7A 1DFHA 1S3FA 1KS2A 2O3QA 3JYPA 4U5XA 5EE5B 3A6JA 3FPLA 1UXJA 1RS0A 4AUEA 4F45A 4Q1FA 2PVPA 1Q0QA 5JPDA 3E5RA 4BYMA 4PO8A 4YJGB 3TRFA 5CT9A 1V9SA 3WBFA 1DEOA 1PFWA 3W2GA 4TWBA 3BJZA 1CR6A 2GN2A 3LT2A 1P7PA 4QJIA 5YASA 4GPBA 3O3NB 4DPLA 4MVJP 4ZTUB 1J22A 4OBXA 2Q1XA 3MXOA 4C0QC 5IHPA 3K8ZA 3KEOA 5KJEA 4E5DA 5HW0A 1DAIA 2LTAA 1P72A 1QIIA 2VF4X 3GPDG 2OZVA 3A6DA 1XHFA 5A9RA 1IH8A 3ADPA 3OEYA 5A71A 2V1UA 4DT1A 3V42A 1H6CA 3O4FA 3OZTA 1PFKA 4OBWA 3PG5A 2H1SA 3WLQA 1OH5A 5DYNA 3SM3A 1BKSB 4PR0A 5EOVA 5A4AA 2XIGA 2ALJA 3LULA 3ZYCA 1Z37A 1C2TA 2DSTA 5JANA 1WW3A 3SVZA 1JHRA 2VA8A 1C8LA 1Y4UA 2V7UA 3NV9A 5D3QA 1EGMB 4AMGA 1Q1NA 3FOEC 5ALMA 3M6WA 4JLVA 4KDRA 3TM5A 3HBLA 1TKAA 2PH1A 1KBLA 4W7HA 2PNJA 3TQRA 3KUCA 2QXTA 2D5BA 3JRXA 1QIDA 3PUZA 4BWSC 4ER0A 2XNJA 2QTLA 3M6LA 4JEMA 4LJ9A 4W8HA 3FIJA 5KB3A 3RSLA 1USKA 1H2ZA 3ABRB 5GOZA 1BQ3A 2WVHA 4NULA 4XPZA 1JEEA 2E1RA 3TDKA 4RLQA 3AR9A 2CVFA 3R5KA 2H4YA 1EBUA 4WASA 1KWKA 1Q0RA 5CCXA 1IBLB 2NWQA 2F48A 2Q5CA 2ZUBA 3BAZA 3ZU5A 4UZEA 3I73A 4HDMB 4M7WA 4QUKA 1I10A 4CDNA 3JALB 4LVOA 5K6AA 3G2QA 4PZZA 2HOQA 4EG0A 2OVFA 3O2NA 5C7YA 4KR7A 1AB6A 4HK4A 1OLSA 2Z6AA 3H4IA 5EMMA 3RBDA 1WCIA 1QNLA 2P69A 1EUDB 5DASA 2Q5EA 5MGNA 1OXXK 1QH8B 1CUWA 3B5JA 4E13A 2OPBA 1GSIA 5FA5A 3RV4A 5K4AA 4Y3UA 1E7MA 5CFZA 1N7JA 4V24A 1MJ5A 5AI9A 4B6SA 2GBIA 1XHLA 4MRRA 1ZNQO 4RPIA 2VHZA 4J0DA 3E03A 4IQFA 2WA2A 3CVOA 1R8XA 3WLPA 2EP7A 1KVSA 2ENUA 1LSSA 3BXXA 4KQFA 4ZVRA 4G65A 4CLHA 1B0PA 1KTIA 4RNMA 4BO7A 3ESXA 4CQLB 1RKBA 2XPCA 2BGIA 3EQ6A 3AV3A 4HNVA 2G4CA 2KE5A 1UP4A 5KFBA 1P9NA 3DG9A 2DQZA 3RK0A 4C05A 4DMGA 4Q03A 2VWHA 3WBBA 4BVLA 2AHRA 5HFNA 2QT9A 3DZCA 3PHHA 5F52A 4NV0A 1LI4A 1ZG3A 1YUBA 4X62B 1CR4A 1N36B 4MUEA 1R66A 1AO0A 3H3VH 1SUEA 3P9RA 2WTUA 3LBHA 2HMTA 3NANA 1CB7A 1THTA 1VJRA 1U1GA 5CW1A 4CUKA 3FE2A 4LF9H 1RXYA 4A6XA 1KZ1A 2BGMA 1ZC3A 3M4YA 4RMNA 4IRXA 4UXIA 2FZLA 3WNBA 5LDGA 1NQVA 4QJ3A 1CIVA 3OEED 4GMKA 1CQPA 5KIAA 3F3MA 1X1BA 3G6WA 5JEEA 4K9OA 4GP6A 4X8OA 2H59A 1DB3A 1Q0SA 1L8OA 3A1TA 2X0FA 4LC9A 4BKMA 3FY4A 4D9MA 4MQUA 3PUJA 4J7AA 4MVJM 2NPFA 4DSAA 1WA5A 2ZJYA 3PHGA 4UTXA 2F55A 2GPBA 1F2VA 5EZ5A 2W2LD 2ONYA 1S68A 1YZYA 1Y63A 3MQFA 3ZH2A 1U0LA 2G25A 5EFOA 2DX7A 4HNSA 4QUDA 4BQNA 4BTVA 3I9NA 3ACCA 1DC7A 1KDPA 1AKRA 2AWNA 2GK3A 2H1IA 3LQSA 3EWIA 3FYHA 4MA4A 4NPHA 4PQYA 4D45A 3EAFA 1GYRA 2H1HA 3SDZA 1N0HA 1F7UA 5HMMA 2GM3A 3QMVA 1E79D 1YZKA 3BCSA 3TW7A 4ANFA 3MMSA 3IS3A 1DWQA 3ZK9A 2NTJA 3BRSA 1D2MA 1A8UA 4AFNA 4MQ6A 4R2KA 5CLFA 5EWGA 1MJGM 3E9QA 3LNTA 4ZFNA 2PZLA 1KL7A 3ZXSA 5KUTA 1QJ4A 4BKOA 1E18A 2IZ5A 1JL3A 1RZ3A 4MV4A 1RPJA 2CF6A 2WM2A 2JIRA 1TECE 3NJ4A 4H0FA 4NCKA 4ADSG 2G36A 3QBTA 2XWJI 3CRQA 1SKAA 4G0OA 4MROA 1G0NA 1ILWA 2A9PA 5AK3A 2JEIA 2FZGA 3QUTA 3ROFA 4MWGA 3ZIAA 4O6VA 1EZZA 1T8WA 5GM2A 2EV9A 2Z2KA 3SX4A 3UWPA 4N4AA 1K9VF 2FGKA 4K0RA 3RJZA 2HT1A 5I5WA 1SCJA 3B85A 4N7RA 5T41A 3OLYA 1WCYA 3GP3A 4RWZA 3F74A 1G20A 2BOVA 2V8BA 3BFPA 1S8NA 1KDVA 1BDHA 3A4LA 3KLBA 3DFZA 3O8NA 1CNFA 1XWWA 4D56A 2JLYA 1GU7A 2MSKA 3CR8A 4X7BA 1R3UA 3NKLA 4PLGA 5A5VA 3A6PC 4OY3A 2DHEA 5H9VA 4TRMA 4Z9BA 1X9IA 5T3YA 2ZR7A 3WWCA 4BRSA 4EMBA 2GVDC 5JNRA 3S6JA 1PR9A 3NTXA 3DLPX 3AL3A 5H0IA 4NHOA 3PR5B 3C87A 3L4BC 3LFUA 4BLSA 4ZAYA 4ZT2A 4TUYA 1XMOB 1DRJA 2I2XB 4UMDA 2G5PA 3T5HA 2HAEA 2JH3A 3EZXA 2HSJA 2BE9A 3DNMA 4EUFA 1V6AA 3NBYC 5BXYA 4CQNA 3WGZA 4ARZA 4XIIA 1EXMA 3WL4A 2J41A 3HY6A 2VS1A 3AY3A 3INTA 4X8MA 2QJRA 5JSZB 5LKRA 2GEUA 2OWDA 2HLDD 3UAWA 1OH8A 4MRMA 4OI2A 2B9EA 3AEZA 3ZHSA 3Q3GE 1G63A 1T4CA 3BJIC 1JN0A 1FRNA 1TCVA 3OCJA 4NU6A 5CJPA 4ECRA 4URZR 1CLUA 1P4SA 5U4XA 1M8PA 4KN6A 1Y14B 1QYIA 1RQLA 3LAWA 4TGLA 4EELA 2W83A 4CLRB 4RQBA 5JMOA 1DQYA 2NTEA 3QE2A 2HU5A 3M83A 3RF2A 2PXXA 3ZE2B 1JQLB 2AFHE 2PKEA 3V00A 1AH2A 2VUUA 4I66A 5AI8A 4ZXFA 3RODA 3VC7A 2OCIA 4RVUA 3OUZA 3H11A 2JIDA 3GFVA 3O2QB 1IZ0A 1ETHA 1YR1A 3L0IB 2X42A 2FSSA 2CY0A 3OA0A 2HV9A 2XV1A 2Y2UA 1WDKA 3JYHA 2I2AA 2BT4A 4F1JA 5U4QA 4TMKA 4A0SA 2YWEA 4F9FA 3VPDA 2H4HA 4TL8A 2DT8A 4R68A 4G9BA 2P1RA 1MVNA 2HBQA 4J9LA 1BA3A 3HXKA 2PUBA 1DELA 3SI8A 3FBTA 5EIWA 2LUOA 4EJ2A 5T14A 3MFYA 2OCXA 5IDQA 2ZRKA 3G8CA 2AE1A 3GMDA 1BGVA 4Z0NA 5GONA 4EHBA 3FMAA 1RCUA 2VQ3A 2PX5A 3H9GA 4KJZA 1NI5A 5C80A 1ULTA 4EGJA 1PBTA 2ERCA 3N53A 3MMZA 2GERA 4BTEA 5DULA 2GN9A 2XF8A 4JY7A 1JDPA 1JR4A 1FOEB 4DCCA 1H1TA 1RI1A 4P38A 1XDUA 3GEHA 3UMFA 3ORSA 4HWOA 2FPGB 4EB3A 2QMHA 3GG9A 3JQFC 1VRCA 4LF4H 3G0IA 3H16A 3IMGA 3LX8A 4YACA 4RBNA 3PUYA 4BECA 4LF7B 3EZ9A 5BOVA 3IVAA 2XQKA 4E7PA 4OQDA 1G16A 1FVIA 4U5QA 5IAKA 2G3YA 4G0ZA 2GNAA 3G6YA 4PGGA 4HMQA 1GITA 2Y0DA 3LSYA 1JIVA 4FS3A 1U7OA 4EY5A 2X9LA 3HU5A 3TD2A 1E3IA 1R0WA 2R93A 2JIZD 3M1AA 4FYIA 1SOAA 3LD9A 4PBRA 5CPBA 4B81A 2X7JA 1HNXB 5THXA 4MDEA 1Q44A 1SCKA 1HX7A 5LZ8A 5TMBA 2BH2A 4RVSA 3OIGA 3I6ZA 2JFHA 1Y5IA 2ZJ7A 4O59O 1RE0A 1QZUA 1XVVA 4PPGA 3TAXA 2WYIA 1YVDA 3DWFA 3KWMA 1RPNA 1P75A 3HJAA 5DJ5A 5IH7A 4CV0A 3E53A 3PPIA 3B2QA 1OUMA 1Z6GA 2W98A 3PIIA 4QPZA 5CJJA 1B1CA 1PNTA 2MTBA 3U0BA 1YHZA 2Y9MB 1Z45A 3J81W 4LSZA 4EKYA 1Y7IA 4WKBA 2NQ8A 4BVEA 1C0EA 1RD4A 1U31A 2RCYA 3LP5A 4P3XA 4OHWA 4I5IA 5EZYB 1PR0A 1SBQA 3S7TA 4NCJA 3KD2A 1Z5PA 1BNCA 2VF7A 3DO8A 5GM1A 3ZE7A 4BY7G 4JX9A 1WSDA 5L3QA 4IDOA 2F9LA 1IBKH 4GWGA 4KEAA 4Q9NA 2Z6VA 3ESCA 4S1TA 1N9KA 3JWEA 3R5HA 1V8OA 3JVEA 3LUCA 3NT2A 1DIRA 4FYMA 3CGGA 4JKYA 5DGCA 3O7MA 5JZVA 4UCRA 1GPAA 4G1VA 3PVXA 4II2A 5TMPA 4P33A 2CVOA 2V9CA 4IF6A 2OG1A 2HCBA 4NJOA 1TZKA 4OHOA 2EDAA 1GG9A 4N9WA 4P36A 1P4RA 4B6QA 4DLPA 4JXKA 1TQ2A 2XGOA 4JEIA 5J5CA 2Q4EA 3AJEA 4FU0A 3R3YA 3PUIA 1IMOA 3EK2A 3KQWA 2H1CA 2I4TA 2P68A 3QEJA 4QTUB 4W8OA 2IF0A 4AJLA 4OTZA 2W42A 4F4HA 2M2IA 4ZEWA 4UNSA 3E1KA 3N6XA 3FPEA 3IO3A 4RE6A 4C6HA 3PHBE 1CUJA 1MHPA 1E7WA 3H2BA 4M0LA 1U3FA 2OXRA 4PAGA 3GB8B 1R8YA 4BN4A 1O4WA 3QSGA 1PR2A 3TLYA 1PNQA 4IZOA 1K1EA 4UUNA 1CKEA 5KX5A 3B6IA 1T1GA 2BBSA 3AGQA 3U3XA 1K8ZB 3QMWA 1X92A 4ICIA 3MBIA 1AGPA 1JEYB 4WOPA 3DFFA 3F6RA 1VBHA 1EHIA 3M6AA 4LQDA 1DHTA 5FWDA 1E5QA 3OKCA 3WI7A 4A0HA 3L4JA 1TJ4A 3SFZA 1QFSA 1LPNA 4YO7A 3VYUB 1JR3E 4II7A 3HKDA 4HDKA 1WKBA 2C0QA 1E3QA 2D54A 2OKCA 3AFIA 1X7WA 1FE8A 1CR1A 3QE3A 1VM6A 3QLJA 4ZAXA 5DVZA 3K5IA 5JMPA 4UUGA 2LW7A 2QN6A 3O8LA 3W34A 3WA7A 1C7QA 1ZPDA 4O4HA 4Z0PA 1KC1A 3TRHA 2GPAA 3B1WA 3QFCA 4ZCLA 3LBIA 5KNLA 1GGMA 2FETA 5LNK1 4QDZA 1QQ6A 3GJ0A 2VJMA 4O3MA 1FK8A 3VR0A 5KFYA 2PFKA 4YASA 4A0GA 4E07A 2D1YA 5DOZA 4EZBA 1N6OA 1GUYA 1PD1A 2EARA 2HTEA 4MIOA 1Y1LA 1SQ0A 4HGPA 4MYDA 2H06A 3PL5A 5AUPB 4L8YA 4R5HA 1AV7A 4RCNA 4YPVA 1WZ2A 2WE6A 2NZUG 3IMFA 1YNOA 2GAAA 1M10A 2HCFA 1XKLA 3GZNA 1J1ZA 2GA8A 1ZJJA 2YWGA 1JPNA 3DEZA 4FDVA 2CW8A 2Z8XA 4BDSA 3VNNA 3JQRA 4C4SA 3HU3A 5SICE 2F90A 4MRVA 3RJTA 1P33A 2XQJA 1YO6A 5CFOA 4WL0A 2WV7A 2E4UA 2EX1A 2ZS8A 5TRTA 5KAPA 2I62A 5BWXA 1DEXA 1UDXA 4FD3A 3MRTA 3EISA 3KR1A 1VPEA 4IDCA 4M1TA 2J5RA 3GTOA 1FXSA 3MQ4A 2NVXA 4HGYA 3EG5A 2FEKA 2PXHA 2B1GA 2R3SA 1QWOA 4R2MA 3FHJA 4KXQA 4UATA 3NKVA 2CBZA 1P2FA 4ETWA 3OOHA 5DV9A 3W5IA 5DF1A 3P32A 3WLSA 4WIAA 2VJOA 3CWCA 3R20A 2Q28A 3KUXA 4HQKA 4YLGA 4JXXA 4Q6BA 4YAFA 4P83A 4Y1RA 4IDPA 1R0KA 4JR2A 4MI1A 3U44A 2VCEA 4EEYA 1A9ZA 5JCPA 3LFTA 4LZWA 4Q9IA 5C35A 4RPKA 1UBGA 4RHYA 3DA8A 4BBPA 3WWZA 4E5MA 1RMTA 1QG2A 4HQLA 4IJ6A 3STYA 3U0GA 3NLLA 3VR6H 4NOJA 1EK6A 1GKYA 3PUVA 2F64A 1CS0A 4JI8B 3GVCA 4W5QA 1RC1A 1UJ6A 4HZIA 5C46F 2QAGC 2BZ0A 4OQXA 2QVGA 2Z4SA 4EY7A 1MAWA 1GGKA 3Q7QA 7YASA 3M9LA 4GRIA 2KX7A 4MRMB 1KAHA 4MUGA 3AETB 4WZBE 3RRBA 3WJ7A 1JHXA 3WBJA 4IZHA 1QVAA 1D7OA 2JJYA 1H2WA 3L04A 3LHKA 2ZUFA 1HURA 5EJEA 2QUZA 4O8ZA 2AFVA 4MPPA 3OU7A 3WKCA 1KEVA 2W2KB 3WRXC 1AXEA 3CF2A 5CBKA 1N2XA 2H0AA 3PZBA 4PSAA 3E9YA 1ZH4A 2G07A 2K4MA 3A2MA 3KVOA 2IHKA 2ZDGA 4UBIA 4HRAA 1AKMA 3FB4A 4RY2A 1HH4A 3G0DA 4KOAA 4FHFA 1JZQA 3WWDA 4KMSA 2NZ8A 2XDWA 4IP0A 2HK7A 2EATA 2GZMA 3REQB 2BRUC 3PQ3A 4Y6QA 3RVDA 4GR5A 5G1OA 5KJCA 4LYJA 2HH9A 2XBMA 3OQ1A 3OUTA 5ALDA 3TXYA 4MV3A 3RYCB 4RA6B 4IDAA 4UHEA 3KYDA 2JJ2A 3C15C 3TR0A 3VAZA 4ZTBA 3GTMA 5DX1A 2C1EA 4ZV7A 3K73O 3CNHA 3H1BA 3IAS1 3UK7A 2Y4RA 3X1KA 2YDYA 1LV7A 1RQ7A 4DLVA 3SYMA 1B16A 1IYDA 4FFPA 1KSHA 2UVWA 5CK5A 1XPOA 3BIJA 3S0JA 1NBHA 1J0AA 3UJ9A 4YV2A 2J45A 1QCYA 4GL4A 1VOTA 1U0BB 1U3UA 1KVTA 3ENZA 1VCOA 4XOUA 3AUKA 2K7FA 1Y7HA 1Q1GA 2WAAA 4LE0A 2ZUWA 1F2UB 4Q0YA 3AL2A 4AG5A 1ZKMA 3UCFA 4ZVOA 3M6IA 3U7IA 1CULC 2EQAA 5IMSA 1JQEA 4GOND 1TU3A 2P77A 3Q8XB 4JK3A 3RWMB 5DHFA 3TSWA 1T2NA 3PTLA 4N5IX 2NU8A 2GD6A 4A23A 3QXGA 2RBEA 2QNIA 1I9CA 4N0QA 5FOVA 4BN0A 4A2BA 3GIMA 3D3EA 3KKPA 3NUGA 3L9XA 4U2EA 3SIWA 3A1DA 4E70A 1UMCB 2C29D 1F2TB 2SECE 5ARBA 4IILA 1WV1A 4CT5A 4CMJA 1GDTA 5IKXA 4E12A 1NG1A 1YIDA 3RYTC 4M0CA 1MC1A 3N8HA 3FOZA 4FGZA 2OOSA 2VPXA 1I8TA 2ONCA 4MP3A 3N0TA 3TAUA 4ON9A 3RE1A 3D5QA 1TGVA 5JJ5A 3D4LA 1T4MA 2DUUA 3WIVA 3QQPA 4CG2A 3TG8A 1VE7A 1J2YA 1ZVMA 1CXZA 1OVGA 1UDBA 5D5QA 3OCWA 5DBOA 2BFCB 2PANA 4CBVA 3LQFA 3RV3A 2RI0A 1Q6ZA 2R8XA 2XADA 3ET5A 4C1BA 4ECWA 1YJCA 1G18A 2B8EA 1V16A 1LBHA 3L7MA 3USCS 1KC3A 4TKVA 2FCAA 2FKNA 4MCAA 3ROXA 3RSCA 5T7BA 2AJBA 4IHJA 1ISRA 4S1NA 5AKHA 3QG5A 1HF3A 1WXQA 5EUBA 4F12A 4TXLA 1DUVG 3A1UA 2P41A 3MWFA 4O4LB 2QTHA 5J63A 4DLXA 2C2HA 1BFUA 3ZGNA 1EWVA 5CGZA 3B78A 1NRIA 2I3AA 2WWIA 1Y1QA 1W36D 2HLHA 3F2VA 1G3IA 1SB8A 2FK3A 3FDFA 2C59A 3NT5A 1OR8A 2F3PA 2PMBA 4O3FA 2GK4A 3BAFA 4WLEA 2WFLB 3GIKA 1VLLA 4LF9B 1SQGA 4LVNA 1SBTA 2REOA 1U63A 3G2NA 2EIHA 5AUOB 2PR2A 5B7QA 2JA2A 4J6EA 4G5SA 4LECA 2TMGA 4LF5H 2ABJA 2ZIAA 3L40A 1B0AA 4GKBA 4GE3A 1D0IA 1WSAA 1UEJA 2CXSA 3K6KA 4LX0A 5KWJA 3DE5X 1ICIA 1ZW1A 3C48A 2OFPA 3O4IA 1Q12A 4YJHB 5I8ZA 4BB0A 3HBNA 3WNCA 1ETUA 2OC4A 2B4TO 2RGBA 4YUXA 4HWKA 3CY6A 3KXKA 1IULA 4MK4A 5DNYB 1XTRA 1YFLA 4URYR 4N8SA 4O83A 1ZD1A 4PZAA 1G66A 4TYQA 1JXLA 3E3LA 3TUIC 4KRFA 2UV8A 5BN1A 1KKUA 1Z6PA 1JIXA 1MUUA 1XMXA 1AMNA 5JISA 4LY6A 1KAGA 1UOQA 2W7OA 3A4VA 1A2KC 1ISFA 1XCPA 2JAXA 4TS4A 4DR2B 1WTAA 1E96A 4C0LA 4XRGA 5BMVA 5C8DA 1Y9AA 4KWEA 3T9FA 5KFLA 2J3KA 2FRDC 4MWSA 4KDCA 3HLYA 3ER8A 2VHQA 4ILKA 3ZV5A 1I3NA 5LB4A 2J7PA 1EK2A 1VJTA 2VP2A 3L6BA 1PVVA 4YJ3A 3TLGB 1RJFA 3CMCO 3A6FA 1VBNA 3EJ6A 4I4NA 3C3BA 4A3JG 4WCDA 4FCWA 4BWYA 4CIDA 4BJ3A 4M1WA 2EF1A 1HE4A 2F8LA 2XA2A 2DTEA 5CVUA 1R6UA 1R50A 2WP0A 2QTTA 1XZPA 3BBPA 1GFIA 1T8RA 3PNKA 1VCHA 1F3LA 1V8DA 3TLCA 2XNHA 5DLYA 3VTFA 1VZ3A 3W1WA 3ZIAD 4O7TA 2JKVA 4JYBA 4YLEA 4D8TA 1VG8A 1RWNA 2WFMA 5IVDA 5TC4A 3RKRA 3BB4A 2P5YA 4E2YA 3K0SA 4OLHA 1VIVA 2B98A 1FFDA 4BGUA 2FRXA 1T36B 2W2LA 3BMNA 2R25B 3TBFA 3QRWA 3JQFA 1TU0A 3WICA 3KOXA 5TT0A 1NF2A 1OBGA 3IV6A 2QI9F 2QRUA 4EECA 3B6JA 3L7NA 5GZ6A 2HWKA 2GB4A 3THXA 3DT8A 4OSPA 1CRWG 4EMTA 2PD6A 3BJRA 3D1JA 5D3ZA 3THWA 3CT6A 5EYPB 1E1CB 5KFOA 2Z1MA 2DR3A 2ZULA 5ULLA 3F5SA 4FOOA 1Z2EA 5F78A 2VC2B 2ECQA 4CL2A 2VAPA 4P3NA 3ZE0B 2JVJA 2ODEA 4US0R 1SA0B 1W88A 4MVWA 3NBFA 3F3YA 5DM4A 4TV8A 1YQXA 5CVEA 3VKVA 4M0MA 2XMDA 1MB4A 3DKVA 1CKNB 4UBOA 1YZHA 3ZDYB 2RBKA 1KH1A 1PTJA 1XSEA 2H5IA 1ZMRA 2VDWA 3NTUA 3NOXA 3D4BA 1T5IA 4Y98A 1EYZA 5JWOA 1FXUA 5EUQB 1OZHA 1JJAA 1FNSA 5A5FA 4NJEB 5ER9A 2EIYA 4REQB 4EVSA 4MNTA 1N8TA 1EJ6A 4ER7A 2QQ0A 1JYFA 3LXXA 4CDRA 1YA4A 1ULUA 2QMEA 4CIYA 3WISA 2QS9A 2ZFUA 3IOYA 3K0KA 4DF3A 4GI2A 4WADA 4HXYA 5AJXA 2R8BA 2C28A 1P31A 2Y1FA 2C61A 5JPCA 1L8LA 4IJUA 2H4JA 3KR0A 4U7TB 4DEVA 1H6DA 5FA6A 5LJIA 5I5UA 2QMZA 1M2VB 5FFMA 2JFBA 4AL4A 1ZJWA 3DF7A 3JARA 2ORIA 1L7OA 3V8QA 4EG5A 5GADl 3ACDA 5LZ4A 2IU4A 1G1AA 1HR0B 1Q7CA 1DFGA 5ADVA 3DDCA 1XMVA 4RO0A 1PYDA 2AOUA 2JAWA 1X70A 4E6NA 4NCBA 1GN9A 3LUBA 3DBLA 3RRYA 2HIVA 1GGFA 3HOXG 1LQUA 2W2XA 5HZHA 2HNAA 1WPRA 2QVBA 1S3IA 4Q48A 5LMZA 3UXYA 1GVNB 4G5YA 1MEOA 1O9GA 3LECA 4O7LA 3SHWA 5ECYA 3DPSA 4RZXA 4GX5A 2CHQA 4QYWA 3B1XA 4DR6H 4DR2H 1BGWA 1G7SA 3HMQA 2JJQA 4YRZA 2M6LA 4NBNA 3JSLA 4IY1A 3WNQA 4AVYA 4L9AA 1NNLA 4ZZ2A 1G3MA 3EGDA 3M5CA 4LZJA 2ADOA 2WUWE 3MJ4A 2OAEA 5CCEA 4DQDA 4BO3A 4EM6A 1D8TA 1CUXA 1E60A 2INGX 3N5CA 4TLEA 3DVLA 4CC6A 4Q12A 3A4NA 3TTWA 1W44A 3I04A 1SWWA 3DTYA 1O95D 3FOCA 4IQGA 3DCNA 1V8BA 3GPLA 1IC6A 3A4MA 1U7HA 1RM5A 2BLLA 4MRPA 1QS0A 3RF7A 3WGYA 3IQHX 4MYSA 5A05A 4K88A 4BMZA 4C22A 1A96A 3Q7IA 4QSMA 1OWPA 3OM9A 3QLVC 3JAWB 3IUBA 1A2BA 5DT9A 3FDJA 5BW8A 1LLQA 1UK6A 4IICA 2CNUA 3ANLA 4A7PA 1QLJA 1YCGA 4TROA 1CKOA 1Q20A 1UMBB 3IEIA 2YCHA 2RAFA 3MN1A 1YQGA 3DGEC 2HBZA 3I53A 4F4CA 4D8YA 4JI2B 1PVOA 2VHXA 1G6HA 1S0MA 2GPNA 3IDSA 4F2GA 2J31A 3DFUA 3DL7A 3HGQA 1I3QA 1ZK3A 3GLQA 3STVA 3I28A 4AMZA 5F98A 2FE3A 1OGYA 2QMQA 2R8KA 1EIWA 5KREA 3WGKA 2WJJA 1EKPA 3KVRA 2ZAMA 2B99A 4N82A 1CQIA 4EDHA 4LC0A 2PL3A 2NOAA 4N0DA 3H8WA 2NP6A 4O4JB 3WK6A 3CINA 3A11A 5F1YA 1REQB 1Y33E 4E09A 1FIUA 4BAUA 3UHFA 4TS3A 2HJHA 1KMNA 2P9ZA 3NRBA 1O9HA 4YYZA 3EY9A 3MF4A 1SOMA 2BTOA 5FPYA 4F6RB 2LKCA 4PCVA 4ZI2A 3Q72A 5KQGA 3SVTA 2ZTMA 4NYMR 5A2QW 4WQMA 2H5EA 1C3LA 2O57A 2PJDA 1L7RA 2OMKA 2Q4DA 3G2JA 4I1IA 2OYRA 3W1EA 3VTKA 5LWQA 1E89A 2QROA 1K7EB 1QG6A 1PK8A 4AS2A 3Q9NA 2DABA 4KXLA 2H4WA 3PHIA 2AGVA 1GXSA 1X9HA 1IY8A 3EXHC 3IA2A 3ZGYA 2IPMA 3HDQA 4IDEA 3PKJA 4RVOA 3OHPA 1ZH0A 5E3IA 2HJWA 4NCHA 3INNA 3WWPA 4RDIA 5EDWA 4MI9A 2FMFA 2VA2A 3OQ6A 2KS6A 2FMHA 3OTGA 3OSNA 3JVVA 1UDWA 4CNQA 3GLIA 2PL9A 4CR8A 2BHSA 2QSZA 4GX1A 1TVKB 3R3UA 1P0PA 2OO5C 3AR5A 4NL4H 5K51A 1Q16A 1BRTA 4Y8VA 2P40A 1V7QA 3J7AC 3HCPA 1H5NA 4A5SA 4IW3B 4EBFA 4YR3A 2MSDB 2DBZA 3G8BA 3GGPA 5EZ6B 1HC7A 1F2TA 4P5DA 3DTVA 5FORA 3MZ0A 2XXBA 4FCTA 4BO0A 4DJJA 1YB7A 2PZAA 3E22B 1XNHA 1EVKA 1OWMA 4BHTA 3T3OA 5E2IA 1BMDA 2IHUA 2X0DA 3JASA 3OBBA 4G0WA 4D5EA 5CURA 2X8BA 1AUPA 4FMDB 3EGXA 3BK7A 4PSDA 4PU0A 1FZTA 3M9MB 2OAP1 3FMVA 3FUTA 2AEEA 3NNDA 4RETA 4RVGA 1RWOA 1J2TA 4FX5A 1CVIA 3ZBUA 3K1AA 4TS1A 1Z75A 4BEVA 1XGKA 1UZUA 2P9GA 1XAIA 2VPYA 4XD7A 1KI3A 1EP1B 1WB4A 1P62B 3ECCA 4FFSA 1XK7A 3ODGA 4PC2A 3ZD7A 2EBUA 3QWFA 3GEBA 1G3QA 3C3AA 3CA8A 3GLUA 1GG2A 1RBQA 3NBUA 3ROEA 1FTYA 3RUCA 4CTOA 4QYTA 4Y0AA 5KWEA 4KBFA 1W87A 3OIYA 3R0ZA 1X1DA 3O75A 4QFMA 1V26A 3FPAA 3QMPA 1DJMA 3PR1A 3PC7A 2IY7A 5ALXA 5A04A 2ZRDA 3PEWA 4EJFA 2YJNA 1PV4A 1XZBA 2HHFB 4ZHSA 4BX8A 5JALA 1YD7A 2W4IA 2LCQA 1OMOA 2WMDA 4DRXA 4DCMA 4DABA 5E4TA 2V4MA 3DKPA 3VZPA 1FDUA 3LCVB 5BSWA 2FP4B 3F96A 1MTOA 5TNXA 2IP2A 5IAJA 1KZ6A 3NHLA 4XM1A 2CFTA 3PC2A 1J70A 4P80A 5DW0A 4IR7A 5HJEA 4J0HA 1T9BA 1RRPA 2EKLA 4XB1A 1T0BA 3WLRA 4YMTA 1JIHA 5HRAA 4EAAA 3TRIA 4FWIB 2FOXA 2EQBA 2R6ZA 1KORA 5KKNB 3DEHA 4L5IA 3PO2G 4RVDA 4B6FA 4RTJA 3OMWA 1EX6A 1DWPA 1O9BA 5DEOA 2IQIA 4A10A 5A9SB 1XRPA 5KBYA 3KOUA 1JEQB 2H7CA 3FN4A 3EVGA 2BEWA 1DAPA 2VQDA 3NYRA 3DAFA 1SM4A 1J2RA 3IUQA 2MIIA 3ORQA 2RGEA 3GGJA 3K2QA 4YJDA 1AXRA 5GP1A 3U80A 3MT0A 1M5RA 2BQRA 5HBGA 1TYBE 5TPZD 1C9NA 5BWOA 1MQAA 4RK5A 4Z5XA 2VUMG 4DIKA 5IJ0B 3C5HA 2QI9C 3G7SA 3F49S 4EGAA 1AK1A 3BJMA 1DAAA 4FFNA 1CZKA 1CY0A 2ZB4A 4I50A 5CTJA 2W6NA 2C5EA 5MGBA 3CONA 2AGPA 3ZDBA 3QXSA 2E82A 1XA4A 3OCYA 1G21E 3QKIA 5IKPA 1ZMOA 3ESAA 4I1SA 4UUBA 4DA6A 1U7UA 2WB1A 4OGKA 1XRLA 4O86A 1UT5A 3ADKA 1HDYA 2FSVA 4RY0A 2IVFA 5AUNB 3RTBA 5L4SA 5LLTA 3HOYG 1F8XA 3DFIA 3TXXA 1BZYA 1P9OA 3S81A 1UDRA 2XTJA 2IYPA 3GXBA 4G9EA 2VK1A 2B82A 1NSYA 2YASA 3H11B 4W5NA 3CZQA 3I2HA 4ONEA 2GZDA 2IIQA 3TLXA 3JTMA 2A1TR 4BQSA 1K6IA 5TIIA 4ND5A 2Z6UA 1J8DA 2AUTA 2CVZA 2HK8A 2IBMA 4D4GA 1ZJZA 2RG1A 3IAHA 2JGLA 1AQ6A 3L49A 4ZVKA 4J7UA 5FWYA 1WB9A 3HJHA 1USUA 2WJWA 4U00A 2POQX 5DM1A 3CNNA 3I83A 4KQCA 2BM0A 4J7XA 2ZU0C 4MS4B 3RHSA 4BP8A 5BV0A 4QIHA 1FLVA 1PTKA 5KSPA 3SKVA 3V7FA 1JG7A 5AKKA 3T1NA 4KI0A 4RFSB 2CCKA 1U3DA 4GHWA 1A1SA 1Z0IA 2PIAA 1WJGA 1HQDA 2I6FA 1DKRA 4XA8A 4UDYX 1Z5ZA 2RB5A 1GQ2A 3NP7A 4J9UE 4KQ1A 4DQUA 1C1HA 2EFDB 4K40A 3EASA 4TSFA 4C2BA 3CG4A 4CN9A 2L19A 1RR6A 1D2NA 5D1NA 3SD7A 5M29A 4AKIA 2N3ZA 3TINA 1WB5A 1NE2A 1CUCA 3GEIA 5EMNA 1Y82A 2FPGA 4GYKA 3UXEA 5LYJF 3GFTA 2Y6UA 3VV3A 3UT6A 1UKZA 4DDWA 4XYLA 4PIVA 3ND8A 3OU6A 4BQPA 3ORFA 3EUFA 3GL9A 4O2AA 2R00A 2A5LA 2P11A 3JASB 3K32A 2UU9B 1EQUA 1R9JA 4TM8A 3J81k 1NIJA 1XL0A 3DBRB 3B89A 3BICA 4LSWA 2FF5A 1T3TA 2RKWA 5LL6P 3T9BA 4Y1EA 4GD3Q 4EB8A 4I2VA 4TLLB 1TRHA 1WQ1R 3LVFO 3RC7A 4E11A 2AQIA 3F8WA 5GTDA 3PJFA 2NQTA 3D3KA 2Z3VA 4P35A 4W99A 3BWXA 2ZEJA 3LJKA 3F6PA 5ALJA 2KW5A 3DOOA 4NNPA 1GUDA 4XVRA 4JI3H 1VYHA 5B1SA 2FX5A 1YBAA 2F9FA 3QUBA 2VQFH 1F0NA 2EIXA 3U3JA 1HDIA 3OY7A 1MG5A 3LBYA 2ZT5A 4AMVA 1G41A 4AM8A 3UWSA 2HQOA 1ZUWA 5TPWB 3ZWDA 2HZBA 2V45A 3QI7A 5LM3A 1I32A 3SR3A 1M6NA 1K0UA 3G2IA 1KQPA 4OXQA 2HM7A 2RGXA 3PQ8A 4CI9A 3NEYA 3HBAA 3OLWA 4D9NA 2Q2QA 3EPLA 1YQUA 2ZVPX 3OOWA 4XQ0A 1QR6A 1XDWA 2PKWA 1J25A 2CCJA 1ZN7A 3H3JA 1NTOA 4UUAA 3PC4A 5JO9A 1OZ0A 1PWHA 4LV6A 5CNJA 3WLEA 1IN5A 3ZXIA 2E3JA 4AG6A 5JWRA 2LP4Y 2R96A 4Y2YA 3GLGA 3R4CA 1P3DA 1R6BX 3KZOA 3K35A 2A5GA 2GWRA 2HGSA 4MUYA 2MR6A 3GCXA 2ZVJA 3I0NA 4NBKA 4CTJA 4DG5A 2P6NA 4UHJA 2OC9A 4YV0A 1HQYE 2YNMD 3HM9A 1SUIA 3BSWA 3FDSA 3KB2A 2ZJZA 4Q5IA 2I8CA 1F4PA 3P19A 2UUAB 2H2HA 4PZ8A 2OYSA 2BE7A 3AR2A 3L7LA 2BR5A 2CBGA 3CEHA 4X24A 1SG0A 4MVJI 1FDVA 4G0QA 3S28A 3C5CA 3DNPA 2FPUA 2HB6A 1W9MA 3AQ4A 3UZOA 3HLKA 1IOWA 2YV4A 3IB3A 2FOIA 4MB6A 2JFVA 3VHXB 2W22A 1ZZEA 2XAUA 4ZAZA 3PDIB 4BBSG 3BTUA 4Z7JA 1HNXH 1S4QA 2WHYA 4UTNA 2GZAA 1IZ9A 4AYXA 2WK1A 4DJ5X 4U2CA 1KZYC 2GRAA 4UFOA 1X7WB 5K3AA 3F8TA 4GOKA 3EEQA 4R40A 1OD6A 3RU3A 4A8HA 2YNMA 2GRJA 4DGQA 1JXQA 4GM0A 2V74B 4O1HA 1RW4A 3LUAA 5BQXA 3TWOA 1J49A 2PUVA 4ZEOA 1NVEA 5ICGA 3R2JA 5CLIA 3QKSA 4OM7A 1VBGA 3SOPA 5I8WA 4L72A 4DIMA 5CG1A 1E2IA 1S9DA 2HHHB 4RMIA 1STOA 4I3FA 3RYFA 3HJRA 3CIFA 3V2HA 3AYHB 4RF3A 5CFNA 4Q4HB 5EKTA 2B4YA 3R3XA 2FW1A 4RB3C 2C9CA 1L5VA 5H8WA 1TMGE 1U2TA 1XKQA 2IS2A 3VR6D 4JYAB 4HEHA 1NSFA 2I9PA 3BSSA 3MINB 4FCVA 1L5SA 3EGXB 2C3PA 4QJBA 4RHEA 4YAJA 1SD5A 1EK0A 1NZDA 1W85B 2AK3A 5FF9A 4W5OA 4Y2JA 3U4HA 3T5GA 1DX6A 1T2AA 4A2WA 1JG1A 1SHKA 4DR7B 1XJWA 3H1GA 1U3VA 5KFUA 4D43A 4OXRA 2CCGA 5DGHA 1F06A 4ED0A 2VNIA 3PD1A 5TSDA 2X8AA 4AP6A 3KQHA 3E9RA 3VNUA 1SUWA 2JA5G 2FRVA 4MUBA 4XR4A 5AKXA 2H57A 4KU4A 5TEWA 2R1VA 4JXZA 3OFJA 2IF2A 2JD1A 4Z9AA 1ECLA 2RF4A 3PC3A 1E5DA 2L0XA 3PEUA 3FWHA 4BFYA 1OA1A 2C4VA 4AF7A 4JQYA 1F1BA 3B8HA 4PPFA 5IN4A 3UGJA 1A82A 2GBGA 3B13B 1ELOA 2PT7A 3DHWC 4HL6A 1DO8A 2Y1KA 2I66A 4QXRA 3A9VA 5JYCA 4RB2C 1SOWA 4KQ6A 2FFRA 4ZVVA 3U3ZA 4EOGA 1N6NA 1WH2A 3JZIA 2VAWA 3OQIB 4X3PA 3ZDZB 1NM5A 2W6JA 4O4HF 3LKDA 1TQHA 2Q27A 1JG2A 4G1MB 1U2EA 3SQNA 2IV2X 1JX4A 1E9VA 1AE1A 3BC1A 1Q0HA 3EZ6A 4NHEA 3VVMA 4J0IA 4UUOA 1SZDA 1NXWA 5DH9A 3RIGA 4BFLA 9ABPA 5H82A 2VT7A 4GI3A 3V8VA 1SEIA 1UADA 4RTOA 2FSUA 3IE1A 2JLXA 4ID9A 3UUGA 3PVZA 3OHSX 4D9EA 1TFUA 3SR4A 1DAEA 2Q9UA 5LIPA 1JALA 1WDLA 4ABYA 1Z5OA 3KJXA 4GBJA 3KQLA 1KJQA 4N5MA 4M99A 1FQOA 2JA6G 2MINB 2O0MA 3GRRA 1I2AA 1WCWA 1EBBA 4CF3A 4IEFB 2W8ZA 4EA7A 1A8IA 4ECXA 1O57A 1ND6A 1XQXA 4I4TB 1Y5NA 4QOGA 3ZXXA 2HLPA 4UOQA 5E6SB 3I12A 3WLKX 2UXDH 4CF5A 5DT2A 1E6WA 3AW8A 2ZBPA 1DXQA 1E1NA 2P6RA 2YN0A 3OWHA 4B3TB 1AKYA 2D0OB 2WZQA 2Q2TA 2JK1A 4AMUA 3UC5A 1JDTA 1B73A 4UQOA 4E2ZA 2J4DA 3QKRB 4LXYA 3M33A 4ZO7A 4K03A 2Q45A 3WYGA 3I3SR 4AJKA 4DTCA 4MR7B 3H5LA 2DPIA 3A8TA 4N01A 5EXTA 3VFDA 4L9RA 4U3JB 1BD3A 5FYDA 5BSGA 4XSHA 3UPUA 3JZFA 1TAQA 4KQKA 4OMCA 3PZPA 1C1YA 1TMOA 3K96A 2AQ8A 4MW9A 5EN4A 2IZ1A 4W1QA 3UJBA 4KBYA 1G1MA 3OICA 4KYTA 3RARA 1B42A 4JLPA 5CAEA 5G4LA 4HDSA 1XWFA 1ZUNA 3FMFA 1W5FA 5ELMA 1XTKA 5ALUA 5EJMA 4MPRA 5JBQA 1U7TA 1LDEA 1PWYE 2JIQA 3QE0A 4A2QA 2DWCA 4C0SA 1TL7C 1ZBDA 5KG4A 1WXHA 3GTKA 2QZSA 3I9V6 3P9NA