2FPGB

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 123
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fpgB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fpgB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgB03
2R86A 4TV9F 4DIMA 2W70A 3U9SA 3R5XA 3KAJA 1GSOA 5C8YF 4ME6A 5FNVF 2YWVA 2YZNA 1PK8A 4XYMA 4XZ3B 1EUCA 1M6VA 5HBRA 3VPCA 4YAJA 2R6FA 3K5IA 1EHIA 5JVDF 3WO1A 4YBZB 4MV6A 2CNQA 5LOVF 2DIKA 1KJ9A 4NYEA 1KC7A 5CB4F 2W71A 3R5FA 5JQGF 2V5AA 1KJQA 2Z02A 3K3PA 4ZQIA 3KALA 5C1OA 3RUPA 4O7ZA 4XX0B 5H80A 4O81A 4WD3A 3TIIA 1W96A 1C3OA 4O7RA 3V4SA 1CQIB 2YL2A 4IIJF 1BNCA 2SCUB 5LYJF 1JKJB 2YW2A 4IWXA 2CNVA 4O84A 5D8DA 1A48A 4C5BA 4MV3A 4O4HF 2W6QA 4O7TA 1VBHA 5C1PA 2WYOA 2YRWA 1SCUB 2R7MA 2W6NA 2GPWA 5LXTF 3KAKA 3MJFA 2YRXA 2IP4A 2V59A 3N6RA 1E4EB 4YAKA 4YB8B 1UC8A 4C5CA 3K5HA 4MV9A 1BXRA 4O7WA 4O83A 4YJ3F 2PVPA 1KJJA 1Z2NX 1WR2A 4XYLA 3VA7A 3N8DA 2GQSA 4FFPA 3U54A 4TUYF 2CZGA 4O4JF 1I7NA 2NU6B 5CA1F 4O7LA 2NU8A 1JDBB 2HJWA 2ZDGA 1IOWA 1GLVA 2GLTA 3NUAA 3OUZA 2FPPA 3MWEB 1DV2A 4O86A 2QF7A 2YYAA 3Q2OA 4HNUA 2R85A 2XD4A 2GQRA 1B6RA 5J2UF 1W93A 2R87A 3Q1KA 1AUXA 4O4LF 2I8CA 2W6OA 2YS7A 4MA0A 3DMYA 2NUAB 2YZLA 3MWDB 1CE8A 3JZFA 3OUUA 3HB9A 2FPGB 2W6PA 4XZ3A 2Z04A 4O7VA 4RZQA 1A9XA 2C00A 3SE7A 4O4IF 2FPIB 4O7YA 5KKNB 1M0TA 1OI7A 3AW8A 4YBZA 3ORRA 3RV3A 5JVLA 3HO8A 2R7NA 3JRWA 4MV1A 4FFRA 4Y8VB 3MWDA 3WO0A 1OBDA 5BPFA 3VPBA 3LWBA 2FP4B 1T36A 5J2TF 1GSAA 2R7KA 4YJ2F 5LA6F 4I50F 1KUTA 1OBGA 1DIKA 2I87A 4IZOA 4WBNF 3VMMA 2V58A 2OLSA 5CA0F 4XX0A 4FGRA 1CQIA 1M0WA 2DWCA 4FFLA 3UFXB 2SCUA 2PBZA 1PX2A 1IOVA 1JKJA 4MA5A 2CSUA 3WNZA 1GGOA 5KX5F 2CQYA 1KJ8A 5CAEB 1SCUA 3JRXA 3G8CA 5GONF 3LP8A 4C5AA 3E5NA 4EGJA 4O2BF 3R23A 4MV4A 4I55F 4ZOLF 4I4TF 5HV6A 2ZDQA 3VOTA 1VBGA 1E4EA 4YB8A 1EZ1A 2DZDA 2W6MA 1I7LA 1EUCB 2VQDA 4O82A 5JH7F 1JDEA 1C30A 3ETJA 5LP6F 3R5HA 2R7LA 3TQTA 2NU6A 1CQJB 3PFFA 3GLKA 4HQ6A 4FFMA 2XCLA 3G8DA 5I47A 3RFCA 3AX6A 1AUVA 1ULZA 4DLKA 4FU0A 5K2MA 2YV1A 1KBLA 3MWEA 1EYZA 1KJIA 3U9TA 2CNUA 4ZHQF 4HR7A 5IYZF 4HNVA 1GSHA 4QSHA 1CQJA 3ETHA 4E4TA 4L1KA 3GIDA 2NUAA 2QK4A 2FPGA 3VPDA 2YZMA 4O7SA 4EG0A 1DV1A 3RV4A 2GPSA 3ORQA 2I80A 3HBLA 2FPIA 4ZI7F 1VKZA 3U55A 5BMVF 4FE2A 3TINA 2J9GA 2DLNA 4YAKB 4MAMA 4Y8VA 4IWYA 1EUDB 4TV8F 2FP4A 1Z2PX 2FB9A 2NU9B 3QFFA 3BG5A 5JQWA 4MV7A 3DF7A 4XYLB 5DMXA 2VPQA 1JLLB 4EGQA 2YS6A 2ZDHA 4MV8A 4FFOA 2P0AA 2NU7B 1KEEA 1B6SA 3KREA 2NU8B 2R82A 4M9UA 2YV2A 3R9RA 1CS0A 3TIGA 5BPHA 2X0SA 3TW6A 2HGSA 2VR1A 3V4ZA 4FFNA 1UC9A 1EUDA 3UFXA 3JZIA 3I12A 2NU9A 2FPPB 4XYMB 2W6ZA 1JLLA 2PN1A 2R84A 5HBRB 4O7NA 2NU7A 4IHJF 4YAJB 2YZGA 5CAEA 5EZYF 1Z2OX 4O2AF 4HNTA
chains in the Genus database with same CATH superfamily
3KAQA 1KAOA 2EX0A 2XIJA 4XWGA 3ST7A 3AUTA 1E8MA 3BYZA 4Q15A 1PEYA 1T29A 4CMBA 2PSFA 5FP0A 2FK8A 5DT2A 3QIAA 1CUHA 4GKBA 4LJAA 2PUFA 4CRWB 5FQOA 3JALB 3CUEF 2W9BB 1KSGA 1RXYA 4GLJA 2RH8A 4DBVO 2UZ0A 3LYHA 5FHRA 1FDRA 2ZJOA 4K86A 4R51A 4L8FA 5BUSA 3FPJA 3AJ8A 5IN4A 1RRPA 4MZXA 2G6BA 3P9YA 4RCZA 3KT0A 3DDWA 1P3DA 1IY9A 1Q0ZA 4IHJB 1U8CB 2C4MA 4UHBA 2WD8A 4NONA 4CM8B 2VDVE 1YZNA 1V4YA 1EGQA 4I4TA 2ZZNA 2VXCA 4C5CA 1NQVA 1O87A 2PVPA 1ZA1A 1CXZA 3L8ZA 1ZD3A 1FUYB 3IQWA 3FAZA 5CM0A 1JWLA 2P1RA 4XDGA 4UAVA 3D0KA 1WVIA 4JP1A 5KFHA 1G98A 1FJ2A 5KMGB 1UPBA 2Q5CA 3L1HA 3O8CA 4P4GA 1RSZA 1GDDA 4Z8XA 3KQOA 1B8NA 2Q5QA 3GY0A 3GJ5A 3H2HA 4YRNA 1WSAA 2JRCA 2HLDD 1U9ZA 3TQCA 3GJZA 4FOOA 1YR9A 4JI2H 2HY7A 5ENDA 1MC5A 1V43A 2FLKA 2AFHB 1IN5A 4MP3A 5IKPA 3RVMA 2XA1A 3TTXA 1IUNA 4LCJA 5C44G 3GIWA 4HCJA 1PV1A 2HA4A 4QDOA 1T6YA 2V6MA 4Z9FA 4FOTA 3GJRA 2PXCA 3Q3EA 3DNPA 5B6PA 1VLLA 1R15A 3OLVA 5IEJA 3AFMA 1J8MF 3UPTA 4EUNA 3AHCA 3P45A 2HBQA 2Y93A 2I66A 1BMDA 1ZD8A 3V33A 2NZXA 3O75A 1U02A 5J2TF 4U2GA 3OOSA 3U49A 3ABIA 2X13A 4HDNA 1U99A 5BQ3A 1PP4A 3WRVA 4PC7A 2TMGA 4GECA 2X0JA 3RFFA 2RJ3A 3H1EA 1SHKA 2VUSA 4PQYA 4PG4A 1XMIA 2D5CA 3OCUA 4CE5A 1FJXA 2PUGA 5AM3A 4BVEA 4AYXA 5B7PA 4RXMA 2WLSA 2WTBA 3LXMA 1UXJA 3DXFA 2QRJA 3CURA 3A9WA 3ANTA 4WN9A 3KUUA 2DZDA 3BKWA 3GLHB 1FRQA 2FW8A 3GGSA 2Q21A 4GOND 5TPZA 2FJ0A 4QX6A 4QFCA 1QRUA 1EU1A 2ZCUA 1J5EB 4EYSA 2OHXA 5A4FS 1R9NA 2BGTA 2QA5A 3RYFA 5CA0B 4LI0A 1XCPA 3GLHE 4DMLA 5BWTA 3HKZA 4RB1A 3KIPA 3LVFO 1FNCA 4Q5IA 5K5EA 4UW9A 1RCTE 1OLUA 3PE4A 1TD9A 4ICIA 5FWAA 1AN9A 5EKTA 4OHOA 3GFTA 4QTTB 4ZI7F 2DBZA 4L5JA 2JFYA 4PIMA 4DL4A 1BN7A 4YUYA 4UHHA 1WDWB 4EHFA 3R0XA 1LUAA 5JCOC 1P8AA 1T5OA 4J2TA 3FDZB 2ZDHA 3N8NA 4HS9A 3OIUA 4G4JA 2X0RA 1T2VA 1Z6AA 1ZEJA 4GNRA 3ZWOA 3G23A 1EUDA 4X66H 4CODB 1GHTA 3K16A 3WLRA 1XNQH 4KR3A 3Q8PB 1TADA 3FZEA 5FPTA 1GPWB 2XUAA 2PWAA 4N3CA 4B6GA 2IE0A 3BMOB 2BFDB 4HH4A 2PMZE 1S01A 4N1AA 1C0LA 2IUTA 3UAGA 1PW7A 4DJEC 5TLSA 2Q29A 3SS9X 2O2CA 3PR2B 4Y1EA 1F12A 2YWFA 5K8UA 1QONA 4DIOA 1A8HA 1PR0A 2WJIA 4D46A 4YBZB 4YR0A 1N7JA 4KPUA 1Z8FA 4G0ZA 1SVOA 2R1VA 3NM4A 1NBME 3LQKA 4NAVA 4WK4B 2GBFA 3KYHC 3FKQA 3ZQ4A 3KJNA 2IEGA 4I50A 4D8VA 3E4DA 3OIWA 2D7DA 4O7ZA 1DBPA 4O81A 1IBMH 1R88A 1OXTA 3VR3A 3Q3CA 3QKRA 1MN6A 1BVRA 4H3KB 1ODKA 4Z8YA 3A27A 3HRHA 2GARA 5JJIA 1D4OA 1NI5A 3EZYA 1BW9A 3ZW9A 4JU9A 3FE2A 1NKTA 2CD7A 4GWLA 3C2QA 2H4ZA 4L5YA 5AI4A 3AHDA 8AT1A 2IKQA 5EIHA 4YXWA 3VQTA 5FPPA 3F5SA 4D4MA 4LG1A 3GOQA 3I2KA 2CXPA 4QECA 3CVWA 4OA8A 3REOA 4NU0A 1E89A 1MEJA 4J0HA 2HTEA 2CUNA 2QXYA 3HRIA 5ESXA 1AQIA 2X5OA 3M5PA 2YASA 1MX9A 2FX5A 3EDYA 4X5OA 5JYDA 1HK7A 1HZZA 2H0RA 3ELUA 1VL6A 4A2CA 3ENVA 4A2PA 1SUWA 2VPTA 3QU5A 3L82B 2WNSA 2OC4A 5JYCA 3DYBA 2PRIA 4RXUA 1GKIA 3H1TA 3RRMA 3AGQA 2WRZA 5DQIA 1O89A 1FP4A 3P5BA 3Q7TA 3MS4A 4ZN6A 3K70C 3OZDA 4NC9A 3UZBA 1FKAH 1TWGA 1L4EA 2X9GA 2QM7A 3FVQA 5KSZA 1OILA 3Q8WA 4UJ3A 5AJWA 3PXUA 3Q40A 5CIQA 4EITA 5C8YB 2XE6A 3FPLA 1M2VB 4PANA 1G5TA 4AJOA 4HAYA 1MNAA 1X8LA 1R8YA 5I7UA 1CP3A 2DHDA 2CV2A 2JIZD 3ZZMA 3R23A 1ZY2A 2NW6A 1TYAE 4FKZA 4CT0A 3DHWC 4HNQA 2HMWA 5A4MS 3AXTA 3UMVA 1JHAA 1X3SA 1QQ6A 3ZY4A 3NDRA 3IAUA 2OQ2A 3HJUA 4LJLA 1E7WA 4D3XA 5F51A 1UP7A 4UNNA 1ONBA 1QNFA 2YXPX 4A36A 2DABA 2P9TA 4LDQA 2OHJA 1H5NA 2YJGA 4MQMA 3OSPA 3E3MA 2FETA 1GZ5A 3SHFA 4IHQA 4MVJH 4HGRA 3SBDA 4U6QA 4IJ6A 3C7CB 3C87A 2OV8A 2P7IA 3R7NA 2GLUA 1YZQA 3ZVKA 3KJGA 1IZ9A 2GI4A 4O02B 2JJ8A 4NVRA 2WIJA 1C3XA 1SUIA 3T5HA 1FVXA 4Q18A 3T7RA 2W6CX 5LMNH 2P5TB 2XCSB 4XR9A 4TKUB 4YRRA 5MN6A 3BWEA 2J9GA 1QP8A 4F4IA 3BFVA 4YJ3A 2R8EA 5TVKA 3IUMA 4YMUA 1P18A 1C4WA 4XRGA 4H35A 5B3JA 4N0PA 4K46A 1OB5A 2JFBA 4JWKA 5HKAA 1II0A 4CVNA 4OAQA 1CR2A 4XVHA 1PFQA 3B5IA 4JLPA 3H16A 5AM4A 3PG5A 3T1VA 1J2TA 4ZEVA 1JIXA 4QOIA 4MQFA 4KEAA 3CKMA 3EF1A 3CEHA 3FNBA 2VK2A 3WOVA 4QLAA 4AM8A 2Z4RA 2QRNA 3H2SA 2B36A 4KGXA 3QWFA 4BGVA 3TE6A 2WB1E 1R18A 4X1KA 4F7WA 3RSZA 4P4TA 4A15A 2GAOA 3Q15C 2Q6TA 4UMVA 2OECA 4EO4A 5JE8A 1H85A 2I67A 3SQOA 5ECDA 2MHCA 3GTJA 2EW8A 1BX0A 3L4BC 1N1EA 1HNZB 4NH4A 4BNDB 4BNVA 2PKYX 2CCGA 3BWDD 2AF3C 4D98A 2VJMB 3JVUA 1OH6A 3OHBA 1A0GA 3SQXA 1TCAA 4LRTB 2ZE6A 5COQA 4FJ1A 1EDDA 1XU4A 4F4JA 3RBEA 3G6YA 1T9CA 3I58A 4Q9KA 2VHJA 2GVDC 4E70A 5E1BA 2ZIXA 5MFPA 1E3QA 4D74A 5SZHB 4B3CA 2ODWA 3GTKA 3LOQA 1BDMA 1K2VN 2B7LA 1XMQB 4Q37A 2ZUBA 3F3YA 2BGJA 1KOLA 1GZ3A 4A23A 4CU2A 3K5HA 3HFRA 2IPXA 4UVDA 1V8BA 2HD4A 4YHBA 3SXUB 1R00A 4BRUA 3U13A 1VXOA 2F59A 2C4KA 2EGGA 1VBKA 3EVCA 4Q4AA 4BB6A 1Y7TA 1SY7A 5I9MA 4BNFA 1XPJA 1HF3A 4Z4EA 1NPTO 3EG5A 1RR6A 2Z08A 4EA8A 3CX7A 5K05A 4C0HA 3IP7A 3GLFB 1ZRHA 1PLLA 3PICA 4K6GA 5HZGA 1NR5A 4LF8B 1Y3DE 3LDUA 1JNXX 4FGWA 3S4YA 1YWGO 1KSHA 4MA0A 3C6MA 1UBUS 2BCEA 1TFUA 2W58A 1A5TA 2PYDA 5ALYA 3LWDA 3IMEA 2ZRJA 3MGKA 1DFIA 3H8SA 4R2MA 1UMCB 2BFFA 1FVFA 4L8WB 4FBGA 4KPFC 3HPQA 1M0TA 5MFZA 4KR6A 3CNHA 2K4MA 1XNJA 2MR6A 5DG9A 1GYRA 3DAOA 2OD7A 4CKBA 2X5XA 3O4JA 2ZRNA 4FCTA 1U9IC 3B9BA 2DPXA 1DAKA 1WO8A 3DTFA 2O9JA 1DIKA 4DE5A 5KFQA 1CHNA 1EKFA 1ZK3A 2ZVPX 1R9GA 2QR3A 2N46A 3GA5A 2XOEA 3AQ4A 2HFKA 2RARA 3PWSA 3O2JA 2BYTA 5EQFA 5HQJA 4DREA 3F7TA 2OXCA 5TGZA 2DVMA 2FQQA 1D3AA 2J9ZB 3L7AA 3K6KA 5F2KA 4FOSA 1NUTA 2Q50A 4AIRA 2F1RA 4QEDA 3GRFA 1NM5C 3W7BA 2P75A 1ZJWA 3AWDA 3DH0A 1KEZA 2EFCB 4CF7A 2M9MA 2XTNA 3WMFA 1U0OC 2QL7A 1VKHA 4JBNA 1V4NA 1HNWH 1NONA 3EXG1 3F6YA 4DIBA 1JR2A 4RSGA 2CKDA 1DLJA 2Q1TA 4EZBA 2P30A 5B1HA 5B3LA 2RG7A 3UMJA 4MK4A 4KKVA 2I1QA 2PU7A 2YXDA 2WDTA 3CCFA 1K6MA 3QU9A 2CNUA 4HAOA 3LA8A 3A1TA 2PH5A 5IYZF 1Q17A 5J47A 1JAYA 3I9OA 1GQFA 2VF7A 2YFKA 5HFAA 4QNMA 4NY1A 1FP2A 3T38A 2PZEA 1PL7A 1G3RA 5BXYA 4KR9A 2HF2A 4L3VA 4O7SA 2ZR8A 2IYRA 4DRXB 1RQ7A 4R6XA 4RD4A 3QTLA 2N42A 3QV2A 3QQPA 5D3QA 2CNNA 3MSXA 2DPMA 2OZLB 1WSBA 2X9LA 1DC7A 4OMUA 5ENVA 1E66A 1V5GA 2UZ1B 1SQ6A 4YRGA 1F3OA 1I01A 2J30A 2Z8XA 1N0VC 4TQSA 4FFOA 5ITZB 5KOHA 1Z4OA 2JEFA 4NK4A 3E05A 3IESA 4KR0A 2W8BB 5E7MA 4F9FA 1OAKA 4LYGA 5JISA 5EJMA 1ISJA 1P1RA 2JW5A 1O95C 5J2UA 3AL0C 4H7KA 3FCYA 2J0UB 2GGSA 8ATCA 3WFZA 5AVWA 4MUBA 5FULA 5LLDA 4REQB 1J00A 3PXXA 4YCCA 2WIFA 4N39A 3VNQA 3BL5A 5C8YF 4DRZA 2B8NA 1IY8A 3I9V1 2GPTA 2FDRA 1V0JA 4XUCA 3PD1A 2X9NA 1QU3A 4WH0A 4HVAA 3JQQA 1ZIDA 2IDMA 1Q16A 4P34A 4DUGD 1P16A 1MA3A 3UQYS 3KB6A 2IEDA 1ZM9A 4FN5A 2CK3A 4BQPA 3QYPA 1MCZA 1V1JA 2QPAA 4C2AA 5JQGF 1U0RA 4QUBA 4A82A 3LQ1A 1EQAA 3TGWA 1NXPA 4WNAA 3I9JA 2O7RA 3RIEA 3VO8A 4O7RA 2B0JA 3LPMA 3AJAA 3RBXA 5ALRA 3W77A 1BDJA 3DBRB 3UT0A 3D1LA 1MBZA 5KYGA 4ZGBA 1NV8A 3S55A 3N3AC 1GY8A 4RVCA 3PE6A 4D0LB 1VZ3A 2NYRA 1GZDA 1C4XA 1NN5A 4W5RA 1IWBB 4G86A 4O83A 1YB1A 1E1QA 4O1IA 1OFHA 5EXPA 2OEPA 4AJ1A 1GDHA 3GELA 4YMHA 1KGDA 2QN7A 2XH8A 4HMOA 2E4YA 4Y9SA 3EARA 3W5HA 4CGZA 4Z1MD 1V1MB 1LX6A 2D1YA 1PLJA 2C3YA 4ZCSA 1UXKA 5AMXA 4W5HA 1F2TB 1LI7A 2PFGA 3FCSB 1TTQB 3CEAA 1X7DA 3QEMB 4A3KG 2Z3VA 4WZBB 1CE8A 4L4SA 1BS1A 2XQFA 1EDEA 1B42A 3RS0A 1NL3A 2NO4A 2JH8A 3CM0A 1WPXA 3G2OA 5BR8H 3PPYA 1UJ6A 1OF1A 3TQSA 1KP3A 1KU6A 3AUSA 3UZUA 1Y9EA 2AN4A 1DQPA 2WINI 4MIYA 1AGRA 1OZGA 3AYZB 3ZTYA 1NRXA 4AG3A 2H4WA 2O3UA 1NBOA 3EGEA 3H9QA 4BFVA 4KVFA 1E6LA 2MSCB 1JDSA 1LD3A 4WZBE 2ZRHA 2EZ9A 3S5UA 3BAZA 3HL0A 4PCLA 1FDOA 3KG2A 3C1AA 5KFCA 3NX4A 3I53A 2JASA 5T6MA 3VDMA 4HEHA 2GN1A 4RBNA 4M8KA 4IV5A 2BSQA 1RJEA 2CJWA 4NYIQ 4IM7A 1QGZA 4ND1A 4B74A 1QFSA 1Q1NA 2AFVA 3PUYA 3EGIA 1XEAA 3HABA 2O6LA 3K8QA 2XAUA 1ESMA 1J2RA 2OBMA 3SC4A 3ZJ5A 1Z0JA 3C6QA 3E9YA 1JRLA 2ZM6B 5FORA 5ALNA 3PO2G 3UHOA 3BM5A 4EKDA 3B9RA 3MRXA 4DKJA 1MOSA 2B4QA 5AKIA 1NVGA 5F4ZA 3K94A 1KAGA 2PRJA 1XZHA 2O1SA 3OEHD 2MMCA 3FMIA 2VYVD 3PPIA 4CM9A 1KKLA 1I2BA 3KZKA 3DLAA 1SYXB 2HQOA 3PZBA 5HILA 1FFXA 5KQGA 3AFHA 2XE7A 4D1YA 1W48A 4DQUA 4F2GA 4FUQA 1MP0A 1YQQA 2VRCD 1FP6A 4UEJA 4EG5A 4II3A 3CSUA 1GGNA 2ISQA 1XQYA 2ZBDA 1L7EA 2HMTA 5CK5A 3Q7RA 2JFPA 4M9SA 5C3EG 1M76A 5DTEA 1KVTA 2OFPA 5ICFA 2F3PA 3GLGA 3ZIDA 1ZS9A 3I2IA 1CS0B 1EP2B 4NECA 1E2JA 4WOCA 4IDNA 1R4MA 2GBLA 1XFAA 3I5XA 5DMXA 3BMQB 1VCOA 3IHWA 5GPBA 4RLHA 3CV3A 4MI9A 1EQ2A 3ETCA 3IR6A 5E0KB 4DEVA 2XB6A 3KQTA 3I12A 2JJYA 1T2CA 2QAGC 5E6RB 1SXJE 5HBRB 1HKHA 3N0TA 4BEVA 3V9AA 4ZRMA 3B9PA 4ZOQI 3PPWA 3ICQB 3KXKA 1Y5IA 1Y7IA 2W70A 1SUPA 1KFBB 5LBTA 1E5TA 2DBRA 1QMGA 1BE1A 2XRYA 4KQKA 4RAQA 1GTJ1 5E9QA 3NBZC 5CIYA 2G76A 4M89A 2I55A 4LV6A 1MEEA 1UJ5A 3I9NA 5JSZB 1M2KA 2QUZA 4M1YA 1KT8A 1U0BB 5D3MA 2FZWA 3W7AA 4DAOA 2WILA 1ZHOA 2C5EA 1H2HA 2X1LA 5KG7A 4YASA 3WLTA 3QE2A 2V9CA 2AE1A 4QBFA 4DA6A 2IZ0A 5IYBG 2PD4A 1K66A 2ZYTX 4LYFA 1WMDA 4LDZA 3ACDA 1TVCA 3GN1A 3BH6A 1PFWA 5DBHX 3C5VA 4MYTA 1ZJ5A 2D6FA 4QULA 1TUBA 1FNDA 4O2AB 4NBTA 3WZ2A 2A5GA 1DKMA 1UWVA 1XG5A 4PFJA 5DBEX 3VR6D 4PIVA 4K6KA 1YQ9A 1G7SA 3M8KA 4Q3CA 1XL0A 4ECSA 3EX7C 4XGRA 5KCMA 2ET6A 2RKOA 4OGWA 1UOQA 3VYSB 4BTVA 2I3BA 3MAGA 1DVRA 3MFQA 3UXHA 6REQA 1KYTA 2C5BA 1FFYA 1R12A 5JDCC 2RMKA 3H75A 4WCFB 2P2ZA 2QZJA 4HEA1 3WNDA 4C0QC 2A5YB 1YL6A 2FOIA 4YQZA 3SICE 4NULA 5F77A 2O06A 3WLQA 1DC6A 3HYRA 4PG7A 1HYBA 1BDIA 4BX9A 2PIAA 1A4IA 3L79A 2V97A 2CT8A 1OHHD 2ZUDA 4NPCA 2IX9A 1L6IA 1ULBA 4LK3A 3M33A 4PVDA 3WGTA 2BFAA 1BDBA 4C1NA 3V1UA 1ZD2P 4CLXA 3RV3A 2VQSA 3OZTA 3H9EO 5IXYA 2C2XA 1YKSA 4XKJA 1QFZA 1OX6A 3S29A 4BFLA 3NBAA 4A91A 2ZT8A 2UU9H 2C83A 3F7NA 4KR2A 2XMDA 1WW8A 4XYEA 3CPHA 5THQA 3SIRA 1TYEB 4IVNA 3GZTB 4L6IA 1RPZA 1DPGA 5C8DA 3M7IA 1XZDA 4QDJA 1X1EA 3NALA 5JZBA 4ZC8A 1W29A 5HMMA 3JQ8A 4O4LB 1R6DA 3BGIA 1HT0A 4F5ZA 3CW8X 5BQXA 1CYEA 1Z0DA 2JDID 1YUNA 4IILA 3T4XA 3EEIA 1EFHA 3SEQA 1WXFA 3NGDA 3DBHA 4AVYA 4LWQA 4DNFA 1SBCA 2GZ1A 1N6IA 4GXTA 3ELYA 1NUPA 1PJ2A 1E9FA 3E4CA 1XF9A 3DWEX 1AKVA 4E22A 4KSYA 1DX6A 5DBIA 4MA4A 3VUFA 1OV6A 2Z6QA 5ARCA 4IRXA 2X2PA 4I6EA 3LU1A 1SURA 4AY2A 3ICEA 1RXUA 1XZJA 3FGNA 4RL4A 1JR3D 4GKVA 3J80W 3WFJA 2PUTA 3IOEA 3T5CA 1RDFA 2L42A 1JIIA 1ENOA 3DKIA 4DLWA 3RC7A 4ZYYA 4JASB 3O9ZA 2ZRQA 2VUIB 4YV0A 4U7PB 3I5MA 4TTVA 4C0SA 1QH1B 3ZVNA 5EL0A 4K6MA 1XTSA 3DT8A 3AFGA 3DZJA 4I1SA 2PNFA 3Q85A 1B41A 1K4YA 1UFOA 1ORTA 2HLHA 1ZJZA 2X0SA 5TXGA 3EXFB 3V4ZA 3DGFC 4OJKA 4ZYZA 1KO1A 1U2PA 3UKDA 1I14A 3T54A 4GR9A 2PY6A 3PEFA 2XMQA 2ASLA 5FAKA 2WT9A 3IEVA 3FF4A 4JC8A 3IERA 4BYGA 3G2JA 3R7DA 4CTOA 4AYBA 4HNTA 4O0MA 1NUSA 1U7TA 3QPCA 3KSDO 1MO5A 4YROA 4OH1A 2A3NA 3B8EA 2PUHA 3O1LA 4RCYA 3WR5A 4KXQA 3HCNA 3LHIA 4TTJA 5JVDF 2FSVA 1BZYA 1SM4A 1RHRA 2G17A 1PQWA 1FMCA 5D2CA 2DPYA 3IIKA 5HG0A 3NT2A 1VL2A 4X6XA 3CB4A 2PKXA 2PDAA 4XI9A 4UAUA 1PDVA 3WKDA 4JI5B 4GVLA 3PHGA 4L4ZA 4OL0A 2IYVA 4BFCA 4JR1A 2ZKLA 4NXMH 2OXRA 4U7GA 1MOQA 2IPAB 5FO0A 1V9SA 2P65A 1XUOA 4JL8A 3RIXA 3ZQUA 4YAFA 2D7JA 3KKOA 5AW0A 4JB2A 2VYNA 5HIKA 4KIFA 3F8WA 5CXQA 3MJFA 3MG9A 3DBOB 5TV2A 1AVTA 4P4SB 5SYAA 2FUCA 3G0GA 2A7QA 3ZY3A 1GFSA 5DISB 3NWEA 2AG1A 2OZEA 4XPIB 3GJSA 3P32A 2Q8NA 5AW4A 1DDIA 1OR8A 2IYOA 3L4EA 2AN1A 4ZOAA 2HHFA 1FUUA 2AMFA 3S6JA 2OD9A 5I48A 3Q2OA 5EWMA 2BM8A 1DX9A 4L9WA 4LMRA 3EQ9A 4EB3A 3O3NB 4LGCA 1ZI9A 3OJOA 3KHLA 1ZMTA 4P4NA 5EJ8A 3D8UA 1H4QA 1EK1A 4YT5A 3CF6R 5ALXA 2Q3MA 4CQJA 3AMVA 2UXBB 5L4NA 5B30A 3QX8A 1DEKA 1L7DA 4GICA 4AKIA 4C7BA 1JN0A 3PSHA 3QPBA 2W4MA 1JG7A 3RJ9A 3S7TA 1TQDA 2NO0A 3I52A 2PUVA 5HRCA 5ESDA 2BTQB 4C7MA 4B33A 4QSMA 2VH2A 1ZR4A 4AW9A 3U44A 3UAOA 4TKVA 3UGQA 1L7PA 3VC1A 1CR1A 1HQCA 3SD7A 1ZCZA 1OI3A 5DNYB 2FEWB 3RBZA 3ICCA 2XB4A 3K3VA 4FCWA 1JHRA 1WSWA 1PCXA 2R8HA 1UJBA 1WXDA 2F62A 3CRZA 2CLMB 5A9SA 2QTZA 2ZOSA 3MINA 4CCSA 4XFDA 2YFHA 4RY2A 5ICMA 3ISTA 3GEPA 4F91B 2DT5A 3OKAA 1W4LA 2O48X 3L0PA 3FSJX 1SIBE 4OF4A 1UBFA 3JATA 4OHZA 1Y3FE 1UBKS 2CFIA 3BB1A 1S3IA 4IJUA 4N7BA 3A2LA 2XT6A 4JJKA 1K97A 2WM9B 1MJFA 2IUFA 4UE3S 3BWVA 5IKMA 1WUYA 3FCXA 3JRNA 1PTJA 2Q1XA 3OD1A 1YC5A 5IS2A 4Z49A 5E7QA 2J3JA 3UWDA 4B80A 1FJGB 1AZLA 2WT4A 2AL7A 4O4HA 1RQXA 1CUWA 4AKEA 4QWEA 2IY9A 3LQ4A 3C8HA 3NP9A 1G4AE 3KTOA 4IWYA 4HB3A 2R96A 2NU9B 2RGDA 1HLDA 1DDOA 1USVA 1LJUA 2CXUA 3JYNA 5KYUA 5FPYA 1Y6GA 1P0IA 2CLHB 1LTQA 5GGYA 1MABA 4RDXA 4TYPA 2VQEB 4PN3A 1OH5A 3M49A 1EFVB 1YZFA 4RZXA 5EPEA 1XA0A 3IIIA 1T3SA 1GG2A 1NIJA 1YA6A 1EFPA 3JV7A 4AFNA 1E0SA 3F6EX 4NS4A 4QUEA 1D0VA 1II8A 3USES 2XIGA 2E2IA 1K92A 5D1PA 2CJPA 1AHHA 4YJ2B 4NF2A 1MC8A 4NE9A 5KAPA 2NTNA 1V2GA 3Q9NA 4QUIA 1TD1A 3D4PA 5B64A 4S1PA 1H1LA 4P5EA 4NOJA 2NNWB 3FKSA 3LLMA 4BX3A 4A3SA 1NVMB 2W71A 4PGHA 1UDWA 2OFXA 3OZXA 2CN1A 3CRVA 4LOAA 3GAZA 4WNCA 3H0KA 3QBTA 1A0OA 3RS8A 4BWGA 2EHDA 4EW1A 5BO5A 3INYA 3W2IA 5C32A 2ATLA 3UOAB 3L07A 3MLEA 4MQ5A 1MG5A 3QLEA 1WABA 1W581 4JJEA 4R7RA 4MKHA 2GK4A 1HDIA 3H11B 3RABA 5E95A 3OOJA 3NGMA 5JJ5A 2LGJA 2FRVA 1AKNA 3G89A 5F3DA 3UJNA 3GYGA 4Q66C 5IULC 2X5KO 3QPDA 5FTJA 1GL7A 4O4JF 3NAGA 4A27A 5LQNA 1M6WA 2F7SA 1PU2A 1XVUA 2JI6A 4DA4A 5CH3A 3TBHA 3VXKA 4LXGA 2JI8A 4HZGA 1HXHA 4JV0A 5BN5A 3ZPXA 1ANKA 2EG5A 4D56A 1YZVA 2DJ5A 3PFGA 2NT4A 4GW3A 2ZJFA 3HZZA 4DF3A 2GK3A 2OBNA 3KE8A 4JBGA 2OO3A 1A9XA 1T1SA 4NE2A 3W8NA 4GLXA 2A0KA 5AO9A 3SJ7A 5BUCA 5A5FA 4LYHA 5CNIA 1H8HA 1FVIA 4FIZA 2FA9A 3V4PB 4YIHA 5DHFA 4FI3C 3AM5A 3WK5A 3CEPB 3KQPA 1EFRD 3MJSA 4LWOA 3MQ2A 2DM6A 3FR8A 4BE4A 2BELA 2VCEA 1WQ4A 1Z56C 3H4IA 2AEFA 3GZ4A 1BH6A 5K6RA 3ZHCA 1V48A 2O2HA 3HFJA 4MVJM 1P7ZA 4PLPA 1K8XB 2AD5A 3HPRA 1BWPA 7REQA 2Y0SA 4Z9AA 4FLMA 4DT1A 2Q3LA 1D4FA 4HQ6A 1A9YA 3WWIA 1VE9A 3EH1A 3AUJB 4TN1A 3BJEA 2WMOB 3BK2A 2Q3BA 4JHLA 1RTKA 1BA2A 3N75A 4C6RA 1S2NA 2WTUA 4AT1A 5EC8A 2JS7A 1FXWF 2W57A 4FTWA 1FS4A 4JKOA 1IM2A 1T2AA 3UAWA 4G4GA 2FPUA 2GR9A 1GNLA 1NXOA 4UD6A 3ADCA 3K5WA 3VZSA 4GUAA 1NJFA 1WXEA 2HHJA 2NACA 1V11B 3PFNA 2UVUA 5AW3A 2ATIA 3QA9A 5CG1A 4XGQA 2FUNB 4TYQA 4QYSA 3D81A 4XVCA 1XCJA 4CLOB 3AVTA 3WP1B 3N42B 2O20A 3N70A 4DA8A 3FOCA 3ROKA 3WKBA 3TTVA 1M10A 5ALGA 1SEVA 4RZRA 4KGVA 4QGBA 3ZY2A 2OBLA 2RAVA 1T2DA 5E38A 4LJSA 1SU8A 4B8ZA 1LPPA 1TM4E 2ZU0C 3ABSB 4GLFA 1UJMA 2YMLA 4LXUA 1TQHA 1X1AA 4YP1A 5AWFC 5LFAA 4PR3A 3ITDA 3K53A 3OFVA 4HXGA 1BFUA 1AXGA 2O07A 1FMFA 5TNXA 1E96A 3HDYA 4TRRA 2OV3A 1YRYE 1U94A 4YQFA 4XVUA 2HEGA 2GMWA 3HGQA 1RQRA 3VSEA 2G07A 5K8CA 3EY4A 2ORWA 1JDNA 1RQLA 1ES9A 2GRAA 3VH3A 2AFHE 1GP2A 4F2HA 2CVZA 1Q7RA 1MENA 3U3KA 1HFEL 1JW9B 3T06B 2B9EA 3K6JA 3T9AA 4RMGA 2V7QD 4BVAA 4MV3A 1ZJ6A 2W6QA 2FG6C 4F56A 4UATA 3O8OA 4RMHA 2ECOA 1U31A 3NFRA 1JFFA 4Y2XA 3DCJA 1ENYA 1ISSA 3F8TA 1RPTA 1TZCA 3H0CA 1I4DD 1XCMA 4UKDA 5JJLA 1THTA 2VL7A 2DLCX 3E1GA 4TVKA 4R8KA 2DWOA 4Z3OA 2GLTA 3PDHA 4DJFC 1I2DA 3WRXC 2OFFA 3HJRA 3BMNB 2QF7A 2HDNB 2QRMA 3EA4A 5L1LA 4PRZA 1DL5A 2XKKA 4HYKA 1KJYA 2QWXA 4DEXA 3TLGB 3ZHOA 4AG5A 2WMYA 5DFAA 2AKEA 1L7MA 3U4HA 3GH1A 4MS3B 4Q3EA 2FWIA 3E84A 4FYWA 3JQCA 3SSNA 1F6WA 5IPFA 2QTHA 4DDTA 2ONYA 2VA3A 2WD7B 3IP9A 4RELA 4NXNB 4WJKB 3ZWNA 5B36A 1ZHQA 1TCUA 3UG7A 1WF6A 1OT3A 4KQMA 4YAEA 3J7AC 4GM0A 4LMPA 1JPNA 4EUEA 2PKRA 5KC9A 4INZA 3HJAA 4ED3A 4YJ2F 1EFKA 5LA6F 5DCUA 1LF0A 3BL8A 5ELMA 4MIKA 5ER9A 5JYEA 2HF9A 4YR2A 1PBNA 2B4KA 1FMTA 3CNBA 1UNNC 5BR4A 2IS2A 3P0RA 5K0JA 3LSYA 1JHQA 1E8DA 3DE0X 2JA6A 2P2SA 5IJ9B 2NPFA 2BZSA 2ZYVX 4LTNA 4DQDA 2QDKA 3AZPA 1LDEA 3TLBA 2GPJA 3MTDA 4TXLA 4A3LG 4OA5A 1RTTA 2AG5A 2XGGA 2R751 3KKQA 3LY5A 3SYNA 5L1IA 3GCWA 1ZKDA 3HKEA 5LOVA 1TJ4A 1FDIA 2VHUA 1GCUA 4WKGA 4NNJA 3N53A 3HOVG 5LZ9A 3OLQA 3EMBA 3D59A 4AICA 3KLBA 4E5NA 4NIMA 2QRQA 3TX6A 4YDHB 4J7CA 2A5FA 4QEKA 4LHVA 4E4TA 1SFOA 3R7SA 4ZEMA 4LRQA 3WNBA 2WF6A 4AJJA 2VQ3A 4RL6A 2O7NA 2CNWD 1CC1S 2CLKB 1WF3A 5IC4A 5B4TA 1RBZA 4UDOA 3G8BA 1T9GS 5ALOA 3JTMA 3KQQA 5DTRA 1C8VB 1VKZA 1DS6A 3SMVA 1DSSG 4MB6A 1U9YA 1XTTA 5GJVC 4OLBA 3Q3IA 5HVNA 4QRIA 3VAZA 1Y42X 2PO5A 5KQLA 1YL5A 1E7SA 4W6QA 4DV6B 3N2IA 2LPMA 3MFYA 2WZBA 3LK7A 4BVKA 5AHXA 3NGXA 4L22A 4PWYA 3PUXA 4AECA 2CJYA 4ZK2A 3V80A 1ORRA 3GRVA 5FI1B 1S0MA 3L04A 2ZXUA 2I8LA 2RAFA 1SUSA 4M7EA 1M9NA 5HSGA 2JAOA 4PC6A 1ZVMA 1US8B 5BVHA 3UA4A 1DPFA 5IYZB 2HIXA 4MOWA 4QDZA 4TRNA 1TUIA 4L4RA 1Y4UA 4CKEB 2GFQA 2EQAA 1Y7PA 3K70D 1T4MA 4JI8H 2ZJ1A 2NUPB 1DO0A 1TM3E 2V7GA 1SBQA 5JRDS 2BCJQ 4D42A 4HDKA 2XUFA 4C0JA 3MPOA 1FYWA 1Y1VA 5B58C 2JVIA 3JSLA 1ITZA 1S2IA 2HA2A 4RS4A 4GZ6A 3DFMA 1N5MA 1Y9ZA 1H94A 1NTOA 5EJGA 4RK7A 1V47A 3NXSA 3TEMA 3OWXA 4BWSC 3MSCA 5CYOA 1CJKC 4ER3A 5B1EA 1UXIA 1GGFA 3ROQA 1WHSA 3GQVA 4QW8A 1NV9A 3A11A 3JARA 5FPRA 4G25A 2JA5G 3UPDA 2GPWA 3W3ZB 4EB6A 1XL1A 2XXAB 1CZOA 1FTWA 1EJBA 4N3GA 1A2KC 4X64B 4M0KA 5JCJA 1S9FA 3T5GA 3R5SA 3WK9A 4RKYA 3ESZA 5IBQA 1EVYA 3PITA 2UUAB 4PZCA 2SBTA 5LNK6 1JDBB 2R6AA 3DWFA 2PL9A 1JG4A 1ABBA 2REOA 5J5CA 3K96A 2O7SA 1K3UB 5JQGB 4IX1A 3EJ6A 3RK1A 1YACA 2VZ0A 2L17A 3M1IA 2GQRA 4HUTA 2X2FA 3FSEA 1X1CA 2YJTD 4TZTA 1AO0A 3ECSA 4G23A 3B53X 1JJAA 1I24A 2DPJA 4C0BA 4EYHB 3EZ7A 1VMEA 1P6QA 2CFOA 1NC1A 1YNSA 1KWGA 2JJ1A 5FI5A 3RHSA 5C7LO 4QHYA 3V2HA 1DKQA 3K0HA 3RBAA 4GYYA 2O2XA 3FZGA 5JWRA 1SOUA 1HEYA 3TAXA 5BQPA 1Y4ZA 5BYKA 3MEQA 1HUQA 3N2ZB 1JIKA 3B48A 1Z36A 2EFEB 5H02A 3L8HA 3EVTA 4QAQA 2VPSA 1H2WA 4X95A 5JDIA 3G85A 4HNRA 4Y6SA 1NMSA 4DIKA 4DLZA 3GEHA 3L3BA 1JEJA 2XQKA 2Z8YM 1QLJA 3IO5A 2Y67A 1AA9A 1L1FA 1E61A 2Q7OE 2ZUTA 2EFDB 3IAM6 4M53A 4XJSA 1YF3A 4B4DA 3DWGA 1T3NA 1WOMA 1SC9A 3DCNA 4YJKA 3BGSA 3JR3A 3DYVA 2VQDA 1PWYE 4R2HA 1XTZA 3EZXA 4GUDA 5MGNA 2SHKA 3FN4A 2CFSA 1NT4A 4DV7B 3HQ4O 1J2EA 4RTPA 1QJ4A 1FLDA 1U2EA 2J9XB 3EIFA 3PPVA 4YI5A 5EJ6A 1CRQA 2OORC 4L15A 2B4YA 4KQWA 3QWBA 1L5VA 1OTHA 4YO7A 3U9TA 3UQZA 3MCUA 1GQRA 4DUZH 1X7XA 1N5DA 2P9FA 1CY1A 5DB4A 2YDYA 4LAFA 2DULA 1D1TA 3T5LA 5CDFA 5J58A 4Q45A 4ZHSA 4YUXA 5BSWA 1GD1O 2AQ4A 5BNZA 3GWGA 2WU3A 2ABWA 3VR5H 4AUMA 1TTTA 1XKTA 4HB0A 1G6Q1 5CA1B 3RF6A 1DEAA 1Z07A 2I0FA 2EARA 3B12A 4R8SA 3KDSE 4GWGA 1WW2A 4JB0A 3C48A 1G291 3PGJA 2Q07A 4ITRC 2O5VA 3EFHA 4R3UC 4WY2A 3K4HA 3QKIA 4W9NA 4F2PA 4DR4H 2BJHA 4CKYA 3EIUA 4FT2A 1EX6A 1I3LA 3FRHA 4EX6A 5FBQB 3BPSA 4RK1A 1HT1E 4G1MB 4MLCA 4EFNA 1VBFA 2JEOA 5HTOA 1Z5GA 3C8DA 1NDQA 4TSRA 4A03A 1JWBB 4PSVA 4NYMR 2Z6AA 5FTKA 2XCPA 1E1LA 3OUTA 2XVXA 4WPGA 4MUNA 3EWSA 3D5TA 5F3WB 2NP6A 2COUA 4PRLA 2FN3A 3R7WB 3VR0A 5G0UA 2YNMC 1YFKA 4G0MA 4JT9A 1T36B 1E1RD 3KQWA 1DXQA 4ENVA 3CIFA 3T3MB 1T6ZA 3WYBA 3GLFE 3M3PA 3A6LA 1CF9A 4P81A 3E0XA 2K87A 3OX4A 4F97A 2ANCA 3UUFA 1RNLA 1IBLB 1RLIA 4MB2A 5DMHA 3L77A 3FSGD 2QJWA 1JFVA 4FQ7A 2GM9A 3OSZA 4L07A 2VWHA 4X62B 2J7PD 2EX1A 1B3BA 3VA7A 5DG7A 3TUJC 4KQGA 1THZA 4TL9A 5KS8A 4HUQA 1U2SA 3ONEA 1O5TA 4BVBA 1X1DA 2V54A 4XTCS 4NQZA 3IEIA 5KFTA 1A8QA 1Z6GA 2B2NA 2ZYIA 4JENA 1GFWA 4QPPA 3ITEA 3OUZA 1IMJA 1N2HA 5SICE 1X38A 1NHWA 2F9FA 3VR4D 3K72B 3TAHA 4DR2B 4MWOA 4BASA 1B33N 3VYRB 1ZETA 3R2JA 3G0IA 2G88A 3L0CA 4RABA 4JLJA 3GJQA 3GN2A 1X7WA 1CQWA 3S2FA 4B31A 4MKRA 2IW3A 5IANA 5MGBA 1OYWA 2GRJA 3WAJA 1FFCA 3AXSA 5AK6A 3PUIA 1O95D 4MW5A 2GJ4A 4RENA 1K4KA 3TRIA 2I54A 5FWXB 3LAWA 3RT9A 2WK1A 2HJRA 5ALJA 1KZ1A 2D5BA 3NUGA 1OJ7A 4I4NA 3ZJYA 3PT5A 2ERXA 2ZIVB 2B8JA 4JVMA 2IVZA 3FSRA 1U7OA 1IJFA 4PCVA 3T9DA 1VL1A 2JEJA 2OHOA 4EQ5A 5KTMA 4MQ6A 2WWTA 2B20A 3MJCA 4QJFA 1QIEA 1G7RA 3NETA 4HX2A 5H4GA 2QD2A 4UUMA 4R0NA 2CCJA 2BF4A 5F52A 3FYUA 3G5AA 2YX1A 2WUDA 4CN8A 3FUUA 5A5DA 4RHUA 3B52X 1TGVA 1I1KA 1CZUA 3U1BA 1YS9A 4QZVA 2EKLA 1GYPA 1M2OB 4ZOBA 5AH0A 1CYDA 4IGIA 2CC2A 4P31A 5DT9A 3IVAA 4IH4A 1KY5A 1UPAA 1JA1A 3O4RA 3EMKA 1RJQA 1X7ZA 4HF7A 4B3MH 1Z0UA 3KVYA 1FSSA 4BNHA 1JT2A 3CNEA 5E2BA 1W5SA 2VP3A 4O8ZA 2GNPA 3BC1A 5JXJA 3L6BA 2IU4A 1GQSA 2ZUFA 4DV5B 3F67A 4IRKA 3INGA 2CKZB 1IYEA 1E3EA 2PFSA 1ISMA 3WI7A 4XYGA 5C7IO 3U4CA 2CVFA 1RI5A 3VSAA 3LT1A 3QOYA 3QFFA 5DNWA 4JAVC 4NSNA 1RLOA 1YB7A 3DUWA 2PQ2A 3I1JA 5ANRB 1E79A 2A67A 1LV7A 1WUKS 4CW7A 4RFSB 4Z5XA 3ZK8A 1I0ZA 4DR5H 2ZRIA 3GTPA 1VLVA 4FZJA 4Y0AA 1JAZA 2YCLA 2DAPA 4FQ8A 2CZQA 4M1EA 1VXRA 3H40A 4EOGA 4MLDA 1W8IA 1UXHA 4Z7JA 3EVEA 3CUWA 1SVLA 3R6GA 4Y9TA 4JBWA 4XB6B 2Y05A 2FKNA 4II7A 1X15A 5BYBA 3THYA 2NP7A 3WO1A 2F1HA 5FTWA 2X9QA 4LI3X 5K0EA 1XQWA 5DLPA 2VFAA 3OESA 2GM4A 3AK4A 1GPUA 1ML3A 2HCBA 4OK3A 5BNWA 1DRWA 3G7UA 2QLFA 2LUOA 2PJDA 4TL7A 4JBIA 3PNPA 2BF7A 3NHPA 3A9VA 1D2GA 5TIIA 2HHHH 2V5UA 4PSDA 4QBIA 5DCWA 3UCEA 4OQYA 4LIPD 2J9FA 1SC6A 1EG7A 2Q3FA 2X8LA 2X9VA 2EZ4A 3HN2A 1RI1A 4IWXA 2UUPA 3JD2A 4IHAA 4QGAA 4B3FX 4F04A 5HQ3A 4W7HA 2F1JA 3VVMA 5T3UA 1NGSA 2UAGA 4X91A 1FYEA 3AINA 3L1UA 4E51A 4C7VA 1WTCA 2IIBA 1V7CA 2H4JA 1XEWX 3N7TA 5JVDB 1OMOA 2Z98A 3OCYA 3EXHB 3AIKA 3JYOA 2XUPA 3II6X 3AEUA 1DNPA 2H57A 5CA1F 1CZNA 4Y9UA 1E1MA 5CGQB 2F55A 1IOLA 3P94A 4FGSA 4UPVA 4H15A 4I36A 5AM5A 1Q84A 5C4IA 4NMMA 4XM0A 3PXGA 3CW9A 3LOUA 1LPSA 2VSYA 4MB0A 5G4LA 1JALA 1G2PA 2IW1A 4XQ0A 2DPLA 3O7MA 1W4CA 1U1GA 2J0VA 3LPNA 3D9QX 3D8BA 1D1PA 4P93A 3PKZA 3D3JA 4MITA 1GUBA 3A3YA 5D51S 1VKOA 4X85A 4RUCA 2FK7A 4FS3A 2RIPA 3A4VA 4QIHA 4GPD1 4QXQA 3HSKA 4RJ2A 1JQJC 3KELA 4F1JA 4L16A 2Q5FA 3D6VA 3OFKA 2WFZA 2ZB4A 2GEVA 3ZLTA 2XZTA 4YN3A 5IARA 2AW5A 4DANA 2XUHA 3F96A 2VHWA 4YJHA 3SXJA 2H65A 3GAAA 5KNDH 3T15A 4F06A 4KMMA 1PEKE 4WL0A 4AMYA 2ZSIA 1EKVA 3Q7QA 3ETNA 1WEKA 1JSCA 1DKOA 2SCUA 1WUHS 3DCIA 5D3ZA 5D6OA 1PZHA 4K0KB 3KBOA 3EISA 4GDFA 3LBHA 4GI3A 4AMZA 3ANSA 2PA3A 2JD0A 3FOZA 2H7XA 5IJAA 1FRNA 2PPLA 1GGMA 4HQLA 4X20B 3LZCA 3I64A 1I7LA 4PZ7A 3LY8A 2AFIA 3ROMA 2HGWA 5LSAA 2D2VA 2ZG6A 4Y7CA 3KV3O 2PEYA 5LZ7A 5IF3A 4NJOA 4RACA 1CQJB 5ILOA 1E3TA 1BSVA 1PQ4A 4FFMA 2X5JO 4HBGA 1NAIA 3K0CA 4X1OA 2CFMA 4W63A 1NI4B 2B1JA 3K0SA 4LVNA 2B61A 1XWWA 5TDHA 2AR7A 4UNRA 1U0JA 4FXPA 4NDAA 1NY6A 1OKKA 3GIDA 1NQ5A 4A0HA 5EPOA 5C5CA 4EG0A 4K9MA 3DZIA 3PUJA 4LFBH 3RV4A 1Z0SA 5EKXA 1JL3A 1FSGA 2ANBA 1Z0FA 2ZSKA 4MNTA 4UEKA 1V71A 4LOIA 3CR7A 1LKZA 2PGAA 4Y8VA 5K03A 1WP4A 2R6JA 2ZUCA 2WDPA 4A8TA 2FF5A 1JJVA 2QMHA 4CM4B 2Y27A 1G7CA 3PD7A 3GCZA 3IUSA 1ZN9A 1CIPA 3HCCA 3NOQA 2IDJA 1X19A 1GADO 1F4VA 1T3HA 5EJAA 4U9IS 1JU3A 4DUPA 4FWIB 5BR7A 4JQSA 3OPYB 5DIFA 1KJZA 1KY4A 3GDFA 2PLAA 3O4GA 4RV9A 5JXIA 4OSEA 3PHLA 3RB4A 1QPZA 1GZ7A 2QLJA 1NW5A 2QDXA 2HQ1A 4MO9A 3UKJA 1F4PA 1DTEA 2AOTB 4XYMA 4GC7A 3R1IA 3IT1A 2ZYDA 4PYRA 2PBRA 1R9TA 4GXNA 3BRCA 4Q01A 4YRQA 1FZQA 1E94E 2ZQYA 1U7PA 4CF4A 4WLOA 5DK4A 5LZ4A 2W9CB 2Q27A 4BTEA 4D6XA 3UV3A 5REQB 5IAOA 1R0ZA 4WBNA 1KHTA 1EVZA 4NMLA 4NS1A 2C8JA 4TZ0A 5HXAA 1HMYA 4QG3A 4LFCH 1H0SA 5I5WA 1SVIA 4JXXA 2ZBQA 1FNNA 2AMLA 4M7WA 3GK3A 4QJ4A 1NF3A 5A71A 2W2TA 4B6PA 3HY6A 3V7YA 2I3AA 1Y5NA 3WRYC 1JSLA 1RRVA 5DWQA 2VUMG 2HLPA 3FMAA 1MOZA 3BIXA 4TM5A 4E5VA 4Y6GB 1YC2A 4C0KA 3ZWCA 1E4EB 3UW3A 3PNMA 3M3DA 2VT6A 3ILSA 2Q5EA 1FVHA 1ABEA 4OMDA 3RADC 1YZKA 1SB9A 5I7OA 3CXUA 2CZGA 3R6TA 4L74A 1R5JA 5CTJA 4AMVA 1MUUA 2IUYA 2BJWA 1I36A 5HM8A 1Z34A 2VAWA 2OLEA 2XIQA 5KNBA 1WCMG 4RQTA 2V65A 1R9MA 5CB6A 2PR7A 4YX9A 3ZDEA 4CMDA 4B17A 4BOYA 4X3OA 2D1QA 4FHDA 4LJ8A 1GCGA 2PE5A 4EAQA 1CSEE 4EUFA 1FDUA 5PGMA 5JXHA 2P77A 4NV0A 1LQUA 3RIGA 1V4BA 2I6FA 1FLNA 3FLMA 4AZ3B 4HVLA 3BWCA 4A5OA 3MCVA 3DV0A 3O8RA 3PUWA 4O4JB 3GEEA 4C9BA 5KFXA 3VOBA 2IZ5A 3SXPA 2WG0A 2PGLA 2W7PA 1JLSA 5FRDA 1Z4JA 3GJ3A 4I9GA 4TWZA 1F9EA 1U4SA 1GGOA 4PNEA 3HHPA 3AVOA 4WOBA 2UYOA 5EP3A 3U6KA 3PF9A 1JKMA 4TV9A 2NXWA 3VO1A 3TWOA 4EVQA 1V9CA 1V8OA 5K1ZA 4EATA 2W6ID 2EIHA 3ZI7A 1BRMA 1GTL1 2C7GA 3I62A 1JHDA 3IIMA 2FK3A 2OCKA 1JHUA 1OWPA 4MVYA 3DMTC 4CMFA 2AMYA 1SOWA 2XRFA 4LE2A 4EPYA 3R0QA 5IP5A 2RHMA 2HO4A 1LDBA 4EMTA 4X61A 5CTAA 2L82A 1IXRC 5H9VA 2AZ4A 1WR8A 3VV3A 1W85A 2W2KB 5JNLA 1XZIA 1G9XA 3CUTA 1UFRA 4EQ6A 4DLUA 5DXJA 3PC8C 3RUCA 3H5VA 1KSFX 2XMBA 1CUIA 2NSLA 3B1KA 4KSCA 3HMQA 4EUSA 1UODA 4EW6A 3TSWA 1Z5VA 2BGNA 3VPSA 1HH4A 4IJWA 4Y3UA 5EEGA 3QBDA 4M1SA 5LIPA 4FJ2A 4OYHA 1PVOA 5THXA 1KI1A 5IWCA 3LCJA 2WFLB 3AR2A 5C5DA 1XVAA 3PL1A 4AO6A 3ZIAD 3TTWA 4MIOA 3EOAI 1IFXA 1N78A 5EAIA 1LI5A 2BWJA 5DW0A 1FFBA 1N9GB 5K0ZA 2Q4RA 3KX2A 2IUSA 3CZCA 4JSTA 3H18A 2NO6A 1U0NA 4CMIB 4WY5A 4RPJA 1G41A 1I5EA 2DCMA 2I6GA 2H1IA 3RSLA 4PG8A 1RCFA 5KSYA 5I3ZA 1DJLA 4X94A 5B12A 4P2BA 3LLSA 4R1SA 1A4UA 5KFSA 2VJBA 3OX2A 4UE6A 2FSFA 1PJQA 5HKKD 1J8DA 4XIGS 3UJ3X 1N8TA 4RHFA 4B87A 2EC5A 1C8KA 3RVBA 2J46A 1WVGA 1XXHA 3W5IA 1ESZA 4C43A 4WXHA 4XUEA 3RARA 2Y66A 4YCMA 3N58A 5EG5A 4BNIA 4F3YA 2HYDA 2PPVA 2VWPA 3DVSX 2C3OA 3R7BA 3NTQA 3PGA1 3H0GG 4OI2A 5CEFA 2P91A 3RIMA 1RHUA 4GS5A 3TQIA 2QSUA 4KQ9A 3L0ZA 4J3NA 1M5RA 3ZI4A 4ND8A 2X1VA 1Y48E 3MLAA 3L02A 1M6NA 3T3OA 1IVYA 5KJ1A 3ODPA 2WSSD 4MEJA 5CDGA 2JZCA 1AU9A 1TZJA 1N32H 1HT2E 1E9AA 2E1RA 5CHYA 1BQEA 3S68A 3MQFA 3HXMA 3ER9A 2IH2A 2DPIA 4C3UA 1UKZA 4XQ9A 4ZFNA 1MQ8B 4LFAB 3DDUA 1O96B 1KSJA 2VKTA 4IIBA 4Y98A 4BV2A 4TRMA 4JWTA 3UY4A 2HDHA 1BROA 1OREA 3RREA 16PKA 4ZQFA 1ORDA 1RWWA 2XGSA 3HCDA 3RSCA 1XPOA 3JQFC 4JI3B 3KHKA 5G02A 2V6IA 4A8JC 1BE6A 5AFSA 1FSPA 3S5JA 1UMDB 1J0CA 4ARZB 1ZL2A 2QAGB 3ENNA 1EE1A 5BMVA 5LPNA 1LB1B 3A6ZA 1W88B 3KQHA 5FA8A 4CPDA 4TM7A 1Z62A 8OHMA 2DHEA 3T95A 1GZHB 2XGPA 4RJJA 4C06A 1Y3AA 4XRRA 1KPGA 5IM4F 4FW8A 4WNYA 1QLWA 3GGPA 3WGVA 5EHGA 3NBZB 1GPJA 3MTIA 3UO8B 4DUYB 4QGFA 1S0NA 2ZYRA 1KAHA 1NMXA 2H9AA 4Y9DA 4QLOA 2B8TA 1MZPA 1R0YA 4OJMX 1T6BY 3PL5A 1H5UA 3S44A 3L7BA 3FA2A 1YZLA 1WEHA 4N41A 2DQ4A 3LO8A 3L93A 3RFTA 2PUJA 4FSXA 3MFIA 4AP5A 5EA2A 4E3WA 1GYFA 1PSDA 1Z06A 3R3WA 3DD1A 3MOSA 1YDFA 2BBTA 4CEIB 2VZ8A 3O1JC 1TTHA 1I7SB 4NAUA 3T1YB 3NDIA 1JH8A 3Q8QB 1REQA 4F8JA 3BK7A 1GKKA 4Q9IA 1PJCA 5JBQA 1R6BX 3OZFA 1U98A 2YCHA 2YN0A 2O8DA 2HGZA 1BH2A 4EEQA 5LA6B 1L5ZA 4IXMA 1RD4A 4RNCA 1NNEA 1VL0A 5M34A 1U7DA 5AK3A 3TW0A 1W0JD 3M1LA 2JC3A 1I10A 4HATA 1C3OB 1ZVJA 4BY1G 3R9XB 3SKXA 4UBLA 4ZVQA 2FPGA 2JIPA 3QWIA 2HA6A 3DP9A 2WT8A 4ENPA 1WB9A 3UK1A 1JP7A 4C7OB 3U31A 2RB4A 1XALA 4S1NA 3WLNA 2ZKIA 2NSJA 4DR7B 1BXZA 4QL3A 3DL4A 3BRWD 1COZA 2E2HA 1SIWA 2GCIA 4BIMA 3HO6A 1XLTA 1R6AA 2R92A 4PLFA 2POQX 2BDEA 5U1PA 3QQMA 3TQOA 2UVWA 1NZDA 4KRFA 2FTKE 3A7EA 3E8MA 2V98A 1W0CA 4KLZA 1JWAB 3PNQA 2QGZA 1ZUNA 4N3NA 2GPBA 4I1IA 1BIFA 1QC5B 1VCMA 5BORA 3IV7A 3FBWA 2O6HA 3QYFA 5A7GA 3TEKA 2HDKA 2B63A 3WZLA 4HQKA 4TTAA 5I9IA 4ED0A 4WLVA 2F4VH 4OVKA 1FQKA 4DJDC 2AG0A 1DAHA 3DFFA 1RWQA 1V7ZA 1O3YA 1EUCA 1SCDA 3G6XA 1S2GA 3HU3A 3F46A 2QTVB 1YHZA 4H08A 3RIHA 5E4TA 4WIAA 3G9QA 2OCBA 1NMYA 4MV6A 4C7KA 3JWJA 5K4HA 1CFZA 1Y37A 4JNCA 4HZUA 2HIHA 3UT5A 4UQLA 4ERXA 2NO9A 4C3ZA 3KR9A 3WHIA 1YDGA 3GIIA 4P5PA 4Q7LA 1JB1A 1R4AA 1RZUA 1Y98A 3QI7A 1WB6A 2ZYAA 4LZPA 1S9DA 1JKJB 4E21A 4UBKA 3AYXB 2DQKA 1EFLA 2ZIWB 3G1WA 4FONA 2I7VA 5JW6A 1UJ2A 1QWSA 1TFRA 2L19A 4UHCA 2C1EA 1MO2A 3AC0A 3T9BA 5CH5A 3R6WA 3EAGA 3QKSA 3W5OA 4IYJA 3P19A 2GAAA 3KYCB 1OX5A 2R48A 4GOKA 5JPCA 2PQ6A 2XJ4A 2BEUA 1DARA 2EHJA 4M2LA 2W6JA 4OB6A 1BCSA 4EA6A 3AFNA 1EXNA 3W8FA 2UXCB 4V3BA 1EGAA 2FW0A 4EKNB 1OIWA 3TLJA 2X7XA 3T94A 5G4KB 3LI2A 5CDSA 1HI9A 2NUAB 1TF7A 5KQPA 5D7NA 4E11A 1RHKA 4ZVTA 2R5FA 3RSQA 4WGFA 1JBEA 4UBMA 3C3MA 2J67A 1A9OA 3OCCA 5LQUA 3V8VA 3A1NA 2EJVA 4E2XA 4BP1A 1SHZA 5SZJA 1WV1A 1V41E 1LNZA 5FUVA 2R7NA 3GB9A 4QFDA 3ZD7A 1TJNA 3STUA 1YASA 4TWRA 4C6SA 4IDGA 821PA 4TLBA 3VPAA 4ZA2A 2BONA 1IULA 4CMEA 2YWBA 4DV4H 3R76A 3TB6A 2IXFA 1NPYA 2I4LA 3HT5A 1HRDA 4HYTA 1JR3E 1I9GA 2XODA 3M9OB 3LYLA 4JUDX 2X3YA 5CLQA 1G38A 5FWNA 5EZ6B 2XMRA 4POAA 2NV2B 4HVCA 4DM7A 5K0NA 4Y6OA 4KRYA 3NHBA 4KIWA 3E7DA 2JBHA 3MWKA 1E1CB 3OTHA 3DDHA 5EHZA 4W5TA 5I9LA 1ZVVA 4ZAWA 2RHHA 3OQIA 1O0CA 3I1FA 2IYFA 1ZPDA 3EWAA 1X70A 3SHWA 1H3NA 3PCXA 3GLKA 1QZTA 2BISA 3R41A 2PZBA 1EFUA 1ESNA 2HF7A 1SIUA 4JEHA 2X0FA 4M1QA 2O8EA 2F9LA 2MSNA 1DAFA 5GOTA 1DJPA 5TPWB 3ZW7A 1G8PA 4JYAB 4FHFA 1U63A 1ESDA 1OASA 4ZJYA 1KI3A 2NNLD 3FIUA 3VU0A 3L9XA 3OQBA 2QK4A 1CQPA 1B1CA 4RNDB 4V02A 3ESBA 2VSNA 1SWVA 3H42B 4GT1A 1JVBA 4EBCA 3GUUA 4DTIA 3VI4B 4FNAA 3SYTA 3N39C 3T1NA 3QEBZ 1MVNA 2WM8A 3QI2A 1QVZA 4Q4DA 1ILWA 4G9GA 4QNRA 1E5VA 2XKAA 3F73A 1YT5A 5MN4A 1N1DA 2R6GA 2IYSA 3AKDA 2WAQE 3GLSA 4XJTA 1B2RA 1F17A 4KNYA 4LHZA 4QE3A 4JJ6A 1ONPA 3PHJA 3BEDA 4YALA 4P7FA 4H4CA 4IS3A 5D7BA 2PN1A 1LSSA 3KKZA 3A6EA 1YR8A 3EEYA 2X0KA 2KSWA 3TB4A 4LK2A 3PVSA 3PC7A 1MPXA 4OU5A 4BRWA 1CUYA 1NXSA 4HDRA 1XVLA 3DV2A 3GVCA 1KAEA 4LQLA 3EZ2A 4XCQA 1LK7A 4DR1H 3WLAA 3W1VA 4W82A 2GJ8A 2WJWA 3MXTA 1G63A 4M9QA 1BFKA 2IP1A 4B76A 2RHOA 1ZN7A 2P8SA 1O57A 2B3TA 1HQKA 1VGQA 4X8OA 2AJLI 2QLNA 3NJRA 4CQLA 3E9ZA 4LBYA 2O03A 1CKMA 3UMGA 3V4SA 4OQQA 1DAMA 1EA5A 1Z47A 4I5GA 3R3XA 2NUTB 3TEJA 5BWVA 5T64A 4XLZA 1T5LA 2IWHA 6LDHA 5CBPA 3B6MA 1L5HA 5CM8B 3K0FB 1B4DA 4CQMA 2ZJ4A 1P9NA 5F78A 4IRUB 4OGGA 2WMDA 2AKYA 2E49A 3BWXA 2X77A 1JE0A 1TMOA 5JANA 3H2ZA 1FUKA 1BXGB 4A3JG 2GD0A 4D0RA 2MSWA 4DCSA 2PL3A 3CUYA 1U3CA 4J0MA 2DBQA 2GTHA 3RTCA 3QQ5A 1G8YA 3ZNPA 3ZBPA 1H2YA 1RYDA 3K20A 2X0EA 3U7QA 1DOZA 1UBJS 4MI6A 5A3QA 5G0SA 5KYXA 4K6NA 3WV5A 1CUEA 2HPHA 3DE1X 1T5TA 1U3DA 5AW7A 2LRHA 4EP1A 3DMNA 3TNFA 5H3CA 4IINA 3JW8A 4Q1CA 4OFXA 4XSVA 4H1HA 1Z38A 4TKLA 5ELXA 3NW9A 3TSCA 3U4GA 5KBYA 4MV1A 1OT5A 1Y33E 2PR2A 2WSBA 2O2YA 3J7TA 4QQNA 3AEZA 2QN2A 1EGVB 3SEAA 3DMRA 4R1QA 1C9DB 4EBFA 5KT4A 1QFMA 2V7WA 3G88A 3GUYA 2N1BA 1M7HA 4ZALA 2WYIA 2PBZA 3AETA 1K2WA 3T7KA 2J09A 4OQDA 1O6CA 2PQ0A 1OW3B 3H84A 3KTAA 4ENTA 1S4MA 2MSKA 4D3ZA 2Z30A 1J49A 4JI7H 5I5UA 2ZR0A 1CJSA 2CL0X 2XA9A 4B9AA 1JV2B 4P3OA 3BXZA 5FUMA 2FAXA 4TVSA 4L8LA 2GBCA 3QVWA 5J1TB 2PYIA 1SULA 2Y0BA 3EA0A 5E8RA 4C6HA 2QRHA 2XUDA 3UBMA 2DWQA 1UQTA 1QTQA 5K3FA 3FHJA 2PL5A 3B2EA 3P1JA 2R8BA 1MOPA 5EKDA 1VL5A 3F6RA 5FDFA 5BV2P 2VBIA 4ZWNA 2OHFA 2CLIB 3AU8A 1Y1LA 3HXLA 4J6FA 1OXUA 2FRDA 3E3NA 2UZ3A 2ZAYA 2P3QA 4R2KA 5EWLB 2ECKA 3C8UA 2C28A 1DCKA 5JO0A 3LS2A 2X22A 5EHQA 1LW6E 1RWVA 4H3SA 4CF5A 1KI9A 1ST3A 4EGAA 4S12A 5HQTA 1OBHA 3WNQA 1ISGA 4MUYA 4ZRDA 3GRPA 3RF2A 4UCRA 4LF6H 1J9ZA 1Y3CE 3GA7A 4L3WA 3RNLA 3WSVA 3DAHA 2QP9X 2YJ6A 4DQ0A 1MQ9A 1L4BA 4EW2A 4ARSA 1YTLA 4A8PA 9ATCA 5L40A 4KN6A 1LWOA 1VSVA 2AQHA 2XSZA 2VP5A 3HUUA 2JFQA 3OE7D 2PAFA 4YAJB 4CDGA 1IN4A 2HWYA 3LFHA 1U0FA 1G59A 4X65H 1NE7A 4PINA 4K9LA 3TQHA 4R5MA 1BVUA 1CB7A 4JSRA 2HA7A 3UUWA 5IUJC 2BMDA 5IYCG 3X2EA 1LLDA 5EJ5A 2PXHA 2C99A 4BZZA 2BRUC 4RJKA 5FPHA 2FKLA 3O8QA 4Q82A 1H23A 1QU2A 4BNNA 3IHTA 5T4HA 4JJ7A 3S7ZA 2QBYA 1E4GT 2CNLA 4MR7B 1GA4A 3B6EA 4A3IG 1N34H 1VCIA 1WPQA 1JBQA 3KSRA 2V0GA 3UKOA 4JBLA 1Y81A 5EJ7A 3H1AA 3DC7A 3MGGA 2FXIA 3AFIA 4BGDA 3AHGA 1QYDA 1L4FA 1PGOA 1LBQA 3L1VA 2P2GA 3EDMA 3I9MA 1IPHA 4ECUA 3QVUA 4DV3H 1AQUA 2BE9A 5B1DA 1RAGA 1WCIB 3PDUA 3HKCA 4EGCB 4X0EA 4B4VA 3PC3A 4JSYA 1N36B 1AJEA 3OH8A 3EXAA 4KWCA 2FEOA 1PFUA 3TTUA 2RCYA 2GQ0A 4O7LA 1CZRA 1T2EA 3A3PA 3ISJA 1WNFA 1C9KA 4D9IA 4KLRA 5HNKA 1H93A 4WLUA 3QF4A 2QS9A 3ZHUA 4ALMA 5B3JC 2J08A 3ZCXA 1D2HA 3BFJA 5KFYA 2Y1CA 4BWFB 3H05A 4DDHA 2YZLA 4R7TA 1C14A 1IVNA 5AVZA 1Y1WA 1KC3A 3JQ7A 2CYCA 2PCLA 3DV9A 4ARIA 3BTOA 4HFRA 3SZGA 2PVCA 4V38A 1ZXBA 1N5RA 1U8XX 3NV9A 1V25A 4QQFA 2GN8A 2XUZA 3WGYA 3DUFA 1P2BA 1HDYA 1ODTC 4N5HX 2ZBRA 5ISMA 4XIJA 2HCJB 3GLIA 1U3UA 1SEPA 3UFXB 3DJYA 4GXRA 3ZYCA 4KQ6A 1WOYA 2W2PA 4LW8A 4XJVA 3H4DA 4BNYA 2EVWX 2YNMD 2ES4A 4BN4A 5L9XA 5KFPA 1GILA 3L9WA 4GI2A 1F1JA 1XDSA 4H7DA 1PSZA 1PQYA 2IA5A 3NVAA 2Z5LA 2CFTA 5CK4A 3DDCA 1QHGA 3BBLA 2VHXA 3U09A 3FNIA 3OA2A 4DCGA 4NESA 4YT4A 3SFZA 3R3ZA 2H29A 1E4VA 4JI6H 2NU6A 2ZT5A 1NDUA 2VDWA 4IZIA 3SQDA 3BB3A 3QV1A 1SHLA 3FH0A 1X8KA 1A8PA 3AUKA 3TEFA 2Q6LA 5I47A 3U39A 1J0BA 2C96A 3ESDA 2W9AA 1H6AA 2WU8A 2Y1DA 4XJXA 3ZKWB 1L7BA 4I4IA 1T9ZA 3P20A 2QJTA 5G1NA 3W04A 3V4FA 4Q7JB 1QFJA 5I8PA 2VOEA 1PKXA 1E2EA 1N6OA 4LWZA 3ZWXA 4WFJA 4WKBA 4RORA 3FFXA 3ZE0B 3IVCA 3TLCA 3INNA 3D6TB 1VJDA 5KYKA 4A0QA 1DC4A 5TF0A 1XQXA 1FS6A 1RKVA 4JA0A 5LQCA 4M22A 4DG8A 1NVVR 4J9OA 1GQQA 2FH5B 1RPAA 1EDZA 2OYCA 2D2EA 4I08A 4B6EA 1BVHA 2Y1XA 2AJCA 3WVNA 1VIAA 4HJXA 3ZBUA 1FS5A 1JLLA 1R8SA 1GZVA 2R84A 1QIFA 1EDBA 3HV2A 4J0IA 3PXEA 2G1AA 5GINE 4Z9YA 3FPSA 4QATA 4Q7QA 4JIMA 2QVYX 1L5YA 3ZLVA 2DFKB 1VGRA 1GSOA 1W52X 5G3ZA 2O0KA 4FQ5A 4LGMA 1ABFA 2MOKA 2H9YA 2CDCA 4G0WA 3QNWA 4OMCA 1RZRA 4QARA 3R0JA 2CNQA 1AN7A 3U0BA 1Q7BA 3CF2A 5EIOA 2FR1A 5IK2A 3P96A 2GHIA 1IJBA 3VZRA 4OJQA 1Z16A 4ZEOA 5T4EA 2FSHA 1S89A 1K08A 4OKSA 4IGFA 1CDZA 4L02A 5GQSA 3F5DA 5JI2E 4BYMA 3WB2A 4UMDA 3T3PB 2GJAA 4R2XA 4XOIA 1ORHA 5AKGA 2K7ZA 2WF7A 3JZ6A 3H8JA 5C52B 1RJ9A 5KG1A 4HRXA 2C61A 4KRXA 1Z29A 4LDPA 5ALUA 2UUCH 1CFJA 3UC9A 1ZJJA 1N0HA 5JSHA 2G5PA 1NFQA 2D8MA 5EWEA 2WPDD 2LKCA 1QG0A 1XTUA 3EXEA 4NYMQ 2ZVJA 5DWDA 3RC3A 4ECEA 2YOHA 2MCFA 2A1UB 2Q2OA 1A7KA 2R1ZA 1RBYA 4MS4A 3DTNA 5TVGA 1X9NA 2OGSA 5LCXA 2NU8A 1T13A 1SEIA 1N0WA 5AK4A 1XO1A 4ESOA 2VRNA 1Y5RA 3ZE8A 1ZG3A 5HOEA 1Z6TA 5JFGA 2WZCA 2EKZA 1CS4C 5CR9A 1XMJA 2A5LA 2C3MA 3GVHA 3SBOA 2X8AA 4JEIA 2H4HA 4K7JA 1J0XO 1N7HA 3O74A 2Q0XA 3N8GA 5BURA 1V3UA 5EFOA 3L6OO 3O95A 4LOLA 3P97A 4PFQA 3WGQA 5AVUA 2LIPA 3AW8A 2VHCA 1XRSB 4AN1A 1NASA 2H1SA 4MCHA 3RSGA 4XM1A 4MVJA 4FI3F 3UMBA 2IOFK 1U65A 3HJCA 3HVKA 2XEDA 3Q3HA 5IN5A 3CRQA 3FKIA 3K8OE 4DC9A 1Z9BA 1EBBA 5E9AA 2NGRA 4I3HA 4AKTA 1XQ6A 2HNKA 3DMFA 4YJGB 1TQ2A 1VYHA 2G77B 1QJCA 3DT6A 1UCFA 4H6XA 4YY3H 4IMPA 5I9NA 2YHAA 1ZK0A 2IYTA 4CUKA 5LZ5A 4R8UB 1F8GA 1ZISA 2PMFA 1ZEMA 2G7MC 3OICA 4EWLA 5B6JA 2XQVA 4PBTA 3K70B 1AO3A 1M1ZA 1NVAA 2ZZKA 3O03A 5AHKA 5AK5A 2ZRCA 2V3WA 3ILYA 2X4LA 3GQBA 5JASA 4G3XA 2NTYC 1W4ZA 3SHOA 1RLJA 3BCSA 1R6TA 4EJSA 1CUVA 3ZDCA 2KX7A 2NUBA 4IMIB 2QR5A 5HM6A 4FMBB 4OBWA 4G4SP 1H8ED 4CDRA 3SZUA 3KEMA 4MRRA 1ADCA 1KH1A 1EG2A 3UYLA 5JAPA 2NAFA 1JNYA 3JAWA 1YJXA 4L8GA 2QZ9A 1CJBA 1Z6PA 3DC2A 3PPXA 4LHSA 4XEUA 4W8GA 1X80B 5EQJB 3M4ZA 4ZOCA 5AQ1A 2VQFH 2HBRA 2PX4A 3V9PA 3VR5A 1OH8A 3A9TA 2X86A 2VPQA 3WXBA 1Z45A 4UEQA 4JI0B 4QBTA 1FDVA 2WY2D 2O5RA 4RLFA 3VFDA 5IU6A 2ZT7A 3GPIA 3QLVA 2C9OA 4I1UA 2Q99A 3E03A 2KLBA 1VKJA 4YFVA 4MUGA 3OJXA 1W36C 2FPPB 3I92A 3OU2A 1GKYA 1M6VB 4IGKA 2YQ5A 1V35A 4K88A 1JX4A 3VVCA 2WMNB 5KFUA 2BL4A 3BERA 3B5EA 1ML4A 1ZKMA 4P0TA 4RCVA 1RAEA 3DR5A 2RJNA 5KFAA 4Q4HA 1PDWA 4CNQA 2BTOA 3CNOA 4NEGA 1FE8A 4EFKA 3A10A 1YS7A 1J0EA 5K0GA 4XASA 4QWWA 4X1YA 1IU9A 5BUQA 5JS1A 4G36A 2FZKA 5JY6A 2HVRA 1WXIA 5GZ6A 4M7PA 3OQJA 4RY9A 1OROA 2R6DA 4EEYA 3B3QA 4YRAA 3OU6A 1P81A 1TMKA 2NZ2A 1LK0A 1K7SN 3FUVA 3AW9A 5KNCH 5KPJA 1FSFA 1E2PA 2YW2A 4ECZA 3IMCA 3VBEA 1ZO8A 1V1RA 5L3RA 3FDSA 5CJJA 1YMUA 4WACA 4DV2H 2HCTA 3PGVA 5GONA 1K7EB 3HB7A 3H5LA 4D45A 1WHTA 2E4UA 3KUCA 2A9QA 1RAAA 1WJGA 1LGYA 2PS0A 2V1UA 4KK3A 1HLGA 1SMKA 3QFHA 4WK6A 4I9NA 2HV9A 3TJMA 3IBFA 4D02A 5JH7A 4ISBA 5LP6A 2C4UA 3L1KA 1YUMA 4WECA 5EKUA 3E8XA 1U3VA 1TI7A 1VYTA 1TAUA 3VR1A 2MIIA 4C04A 2X8JB 3LUAA 5JO9A 1TJYA 3QHPA 4JP2A 2JGLA 4BQIA 5G0TA 4X84A 4AP6A 3FYTA 4MYUA 4ZYXA 4LF4B 4JUAA 1C50A 5LMUH 2ZREA 2EDAA 4LGVA 1AUQA 4Z51A 1Z83A 2OO5A 4QYIB 4HWPA 3I1IA 2XNDA 2WJVA 1O4WA 4OJTA 3SC2A 1XPUA 1K86A 2GCEA 1Z6ZA 3ZOZA 3UMYA 4B1FA 3B6JA 1WRBA 1S0UA 2ZJZA 4Y6QA 1MVLA 3RJMA 2YXEA 5BRNA 2KBEA 1XELA 2OAQ1 4A2QA 4JD5A 4BL5A 1FP7A 1EZ4A 1KZHA 5G40A 2A3RA 4WE3A 2H5JA 3LHFA 1Z8HA 4EG8A 4KX3A 3WNCA 1J0DA 1VECA 1E6EA 1SCQA 3IHLA 3PKJA 1UMKA 1OFVA 4X8MA 1FTNA 4FYPA 4BDSA 2ZITA 3RIYA 3LQFA 4KTVE 1NR1A 4K26A 2ID8A 3ZZTA 3ANYB 1T1IA 1C1XA 2ENWA 3W5VA 5CNMA 4CIDA 4V1CB 3R0VA 2GB4A 3NHZA 1BEZA 1DQNA 1PKEA 2H1HA 1IZYA 3GNQA 1KGSA 1J8QA 3IGFA 2A1TR 221PA 1L4NA 5JSKA 1GRVA 2WHQA 2HREA 1SZJG 2FCRA 4FJ0A 2O1EA 3TM5A 4A93G 1N2JA 3VAAA 1KZ6A 2CW8A 1TZBA 1K7CA 5DYTA 1U6JA 4TS4A 1KVSA 5EWFA 1QX4A 1QG6A 4RWEA 3LPAA 1QK3A 1M1UA 5JJKA 3C43A 2HWWA 4A3MG 2V7UA 3W6PA 3ZHXA 1A7UA 3S2EA 5KYYA 1EBUA 3EFOA 4QOEA 4F84A 4DPKA 4JZYA 2YKGA 1ZGJA 1YFJA 4Z9XA 1GG8A 1P4HA 2ZSAA 4Y1RA 1M8KA 3EN0A 5JSYA 4RZIA 4N6OA 3CF4A 4B5KA 2VTDA 3KFXA 4CEJB 4TV8F 4YV7A 4G1FA 2JLQA 1ACLA 3HH8A 5A0TA 4U3JA 4B2IA 3FDJA 1JU9A 2NVUA 4Q1FA 4LXHA 4CLRB 4YV2A 2YY6A 4RUAA 4UMFA 4IO1A 3AOGA 2PUDA 2JAQA 1Q44A 2WAOA 3WIDA 3PFHA 2BE7A 1IWOA 2EP8A 1Z6YA 4JU8A 2B2XA 1CRZA 2GPNA 2BM0A 5BQOA 1Z7GA 1M1NB 2H2WA 3OM1A 1A4RA 3OTOB 2KWIA 3OEED 4Z4GA 4XZ3B 5HCUA 4MYRA 1CF4A 3GLTA 4D7AA 1KRHA 5A02A 3FXAA 4KITB 2LE0A 3P9PA 2X4DA 2I2FA 4M54A 1GUFA 2PH1A 4OX9H 5TQ0B 1D0SA 1JJBA 3WBKA 4D9HA 3T1QA 1JAHA 2PVSA 3C1TA 4H17A 1GO2A 3F4LA 4ED7A 3KQYA 2XYHA 3QMMA 3TIIA 4JT8A 4CKWA 5J3JA 2EX4A 4XX1A 1NZJA 1NQAO 5EMMA 4I9UA 5CYFA 4KO4S 3FJYA 3C3WA 5T41A 1VPLA 3UK2A 3NYRA 2G4VA 2JGRA 2QG4A 4DZTA 1JQBA 3WIVA 4DQKA 5FAXA 3RUHA 4R9VA 1D03A 1BX3A 2B0CA 3W90A 1CY2A 4ECVA 5BWBA 3RODA 2PX0A 3CRRA 3EGXA 2V59A 1T0HB 3PXCX 4ZD6A 1I13A 5EIBC 5TQVA 1RI3A 4RHXA 4V03A 3EDQA 3R7FA 5IBCA 4IIHA 3IELA 2HF8A 2QRGA 2IHBA 4OFBA 3SVZA 1LTKA 1ZLXA 3EIHA 3TM4A 4IAJA 3BSYA 2AIRA 3UT6A 4JXJA 3SIPA 1D1SA 4RLQA 3H2GA 1K0UA 5C9ZA 2BEVB 4HYQA 3UB4A 1VIDA 2M2IA 2EYQA 4M9CA 4D99A 1TCVA 4M46A 3C4JA 1CVRA 2Z8YA 3DTVD 1IQUA 3GLUA 1E7YA 5MN5A 5MHTA 2ISSD 3N28A 4IDHA 1R66A 2JLWA 2WSLA 1K8RA 1ZONA 1X92A 3N44B 3I6QA 4LSZA 4UM5A 3KP1A 4L2IA 4O3RA 1VDMA 3LSTA 3ZS8A 2PLWA 1XAJA 4EUHA 3K2QA 1W4RA 2Z09A 3IQGX 4XOUA 3FDFA 3RYIB 3H7IA 4I3GA 1G42A 1ZH2A 2WPNA 2H1VA 1KQGA 3DZCA 2FSVC 1O03A 2I4RA 3GJ4A 2REQB 1CQIA 2EZUA 1IVSA 2G82A 3QUTA 3V3KA 3WNZA 5KNDA 4PPQA 3QUSA 1I3QA 4LCBA 4UUOA 2EP7A 1LPAB 1IOZA 4G4SO 5DX1A 3A0RB 3DKKA 5HW0A 1UJNA 3PWZA 4MV4A 3EEOA 5IDYA 5INTA 1IY0A 4CEHB 4UHJA 4FB4A 3RC8A 4D2IA 4JKYA 2W6MA 2CB9A 2WM3A 5A04A 1Q74A 4MTEA 1KMQA 3CZAA 4EABA 4AMUA 1A8IA 1SG0A 4J0JA 2EL9A 5GVRA 2JNWA 3U80A 2IS4A 4YQEA 4QPJC 5KTSA 4PR0A 4BAGA 3LDAA 3DEHA 2FF7A 5IUKC 1UL1X 1XWFA 1WPGA 1HTBA 4PLWA 2JA7A 2AOXA 3DVLA 2CVOA 3AF2A 3W4IA 3TZCA 4BCBA 2WVGA 2FN7A 4TQAA 4H1TA 1TQ4A 1DU4A 3U1TA 1L1RA 1R10A 5HFJA 4P35A 4Q1AA 2LZ0A 2QTRA 3OAAD 4WBSA 4MWZA 4DQNA 1YBAA 5K3AA 4FE2A 3IT3A 4U02A 3A4TA 3W2GA 3EFBA 1QF9A 3FTDA 4WMLA 3Q8RB 1E8NA 3MUOA 3FLAA 3HMKA 4UQPA 3QXSA 2DJIA 3KLNA 1KK0A 1KYXA 4NEHB 3HU2A 4EFMA 1PK7A 1L4MA 3GU3A 3TIGA 5FBWB 1J2JA 2XC9A 4H0NA 2R5WA 1UBTS 1WSDA 3IE0A 2RAPA 5CLLA 3W1WA 3TOZA 4UBIA 3P9XA 2PH3A 1RQGA 2IYWA 3A7DA 1XQ1A 2VWGA 4FYYA 2EGUA 5CFMA 4MW2A 3D6HA 4KTTE 3E5RA 3GGDA 4LY9A 4Q21A 4BNGA 3LW7A 3D3KA 3Q5EA 1USUA 1P61B 1W8DA 3U26A 3O38A 2QE7A 2FV8A 3T3GA 1ZL0A 4WVLA 1L8OA 1PBTA 4QO7A 4WK0B 2BI8A 4O3NA 1CVLA 3VISA 1A98A 2J07A 2ODNA 2PYZA 1WIWA