2FPHX

Cell division protein ylmh from streptococcus pneumoniae
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
165
Chain Sequence
GIYQHFSIEDRPFLDKGMEWIKKVEDSYAPFLTPFINPHQEKLLKILAKTYGLACSSSGEFVSSEYVRVLLYPDYFQPEFSDFEISLQEIVYSNKFEYLTHAKILGTVINQLGIERKLFGDILVDEERAQIMINQQFLLLFQDGLKKIGRIPVSLEERPFTEKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cell division protein ylmH from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Dna binding protein
molecule keywords ylmH
total genus 44
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2006-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fphX02
3.30.1370.160 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2fphX01
1VQNS 2DIVA 1Q82T 2D3OR 2MQQA 3PIPQ 2DNYA 3S8SA 3UCGA 1FJEB 2A3JA 3S7RA 1P27B 2JWNA 2LECA 1OWXA 5GMKa 4CH0S 2YH1A 1X5TA 2KRRA 5IQQA 5LJ3Y 2CPIA 2MZSA 2SXLA 5DDPC 2DITA 2O3DA 1WG5A 4TU9A 2PE8A 3NMRA 3BEGB 1H6KX 2L08A 3P3DA 1X4CA 2MPUA 5ITHA 2MQLA 1VQMS 2X1AA 4WIIA 2CPZA 4F02A 1FXLA 3VAGA 2X1BA 2PEHA 3FEXB 3MUTP 1OIAA 2MGZB 2KXNB 2KM8B 3G8SA 2U1AA 1SJRA 1YIJS 2LXIA 3VALA 1X4EA 2KT5A 1X0FA 1VQ5S 3VAKA 2MKCA 2YTCA 3NNAA 2LKZA 2KN4A 5D77A 3TYTA 5CA5A 2N3LA 1PGZA 1X5PA 2AYGA 5FJ4A 1X4HA 2VOPA 2VOOA 3VAIA 1KQSR 3CPWR 1YJ9S 2MY8A 3EGNA 3SXLA 2DISA 3ZZYA 1M5OC 2GHPA 3CMAS 1VBYA 2EVZA 2EK6A 3R1HA 2KU7A 2B0GA 4OZ1A 4LMZA 1DRZA 2XNRA 1YWXA 1VC0A 2GO9A 5HO4A 3CCQS 1WEZA 1NJIT 1VQKS 1WEXA 3UCUP 2CPHA 1NO8A 1VQ6S 2XS2A 2CPEA 1SJQA 4QPTA 2BOPA 2AYMA 2ADBA 4F26A 1U1LA 2CPXA 1YITS 3EX7B 1WG1A 4WFBQ 2M52A 3S6EA 2JVRA 1WF0A 3UCZP 5DDRC 2HYIB 1PO6A 1B7FA 4ERDA 1URNA 2KFYA 4TLQA 2RRAA 1U1PA 2VONA 3DXBA 1UP1A 4Y0FA 4C7QA 2MB0B 4PKDB 2ERRA 5JVHQ 1N8RT 2MZRA 1WF2A 4PRFA 2MSSA 3CC7S 3SDEB 2CQ0A 1U1MA 4IUFA 1X5SA 3I55S 2ZJRQ 1WHWA 2FC9A 2KYXA 2V94A 1A7GE 3H2VE 3MUMP 3G71S 2DB1A 1Q86T 4IOAQ 4RU2A 3P6YC 1G2EA 3K0JA 2G0CA 2CQ2A 2ZJQQ 3ZZZA 3CC4S 2DHAA 3FEYB 1F9FA 3P49B 1HD0A 2U2FA 1UW4A 2FHOB 2DH7A 1K73T 1VQLS 2N7CA 3NNHA 1JJ4A 1U1OA 2M2BA 1VQOS 1XN9A 2CQ4A 3HI9A 3CF5Q 5CXTA 3US5A 5LSLA 3CMES 3CTRA 3UE2A 2MKIA 1ZH5A 3MD1A 2XNQA 2RS2A 4OZ0A 5MLCV 2RVJA 1FHTA 2HGMA 5LXYA 2E5HA 3BO3A 1M1KT 1DBDA 1UAWA 2FY1A 5CYJA 5JVGQ 2HZCA 2DGXA 5IM0B 1FNXH 2ADCA 2KH9A 3Q2TC 2N82B 2ZJPQ 2KXHA 3TO8A 2NLWA 1VC6A 2J0QD 4CQ1A 3S01A 2X1FA 2XS5A 4Z2XA 1M5VC 1HL6A 1U6FA 2YKAA 1K8AT 4WF9Q 1ZZNA 2MKJA 3H2UB 1YHQS 1YJWS 1VBZA 1Q81T 2LA6A 2MHNA 2CPDA 3HHNB 2CJKA 5DDQC 2MXYA 2OSQA 3SDEA 1JJ2R 5HL7Q 3BS9A 3LQVA 2DIUA 3CCRS 1JMTA 3MD3A 2LA4A 4WFNQ 1KC8T 3NS5A 3CXCR 3G4SS 3VAHA 3IWNC 1DHMA 2KHCA 2RNEA 2M8DB 2CPFA 1ZZFA 1O0PA 2LXUA 2MY7A 1L3KA 2DNMA 3THPA 1H2TZ 3OW2R 2J0SD 3Q2SC 3BO2A 2JX2A 2RQ4A 3ULHA 2D9OA 2LEBA 1SXLA 3IRWP 2MZ1A 2RRBA 1OPIA 2CQDA 2DHSA 2RS8A 5EN1A 2MZQA 2MGZA 1HD1A 2J8AA 2DGUA 3V4MA 1U1QA 2DHGA 2DNLA 3THTA 1W2BR 3CD6S 3VF0B 1VQ8S 2KXFA 2OTLS 2M88A 1DZ5A 3BO4A 2M4MA 1JJHA 1S79A 2XSFA 1KOHA 1X4BA 4YOEA 1NU4A 1WF1A 4W92B 2CQ3A 3G8TA 2CQBA 2DK2A 3R27A 2FC8A 2LCWA 3U1LA 1K9MT 4QU7A 2D9PA 2LMIA 3NNCA 1D9AA 2L41A 3CCLS 1N52B 3G96A 5LJ5Y 2FPHX 2DNQA 4WCEQ 4FXWA 2KRBA 5DETA 2DH8A 1U6BA 3G6ES 4UQTA 5GVQA 3TP2A 2VODA 3MURP 1U1KA 1WEYA 2CQCA 1WG4A 2CPYA 1HA1A 3MXHP 2KVIA 2DNOA 2MQMA 3SMZA 2F9DA 2I2YA 3U1MA 1M5PC 3B4DA 1WWHA 2YH0A 4LJMA 4FXVA 1FJ7A 1N88A 4W90B 2LQ5A 4Y00A 1X4FA 2KM8C 2DGTA 2J76E 1D8ZA 2RUGA 4C0OC 2MQOA 1OO0B 2DNZA 4P6QA 2DGQA 3PIOQ 4WFAQ 2G4BA 1BY9A 2DGWA 3CCVS 2OJ3A 2M8HA 2JRSA 1S72S 1VC5A 2DGVA 5GADU 2CQGA 4LIRA 2DO0A 4UY8T 1FT8A 2LEAA 4CIOA 5GAHU 4IOCQ 4IO9Q 4J5OA 4ZKAA 2AYEA 2NZ4A 3CULA 1FO1A 3J7ZT 1QM9A 2CQPA 2DHXA 2M70A 2MJNA 2KG0A 1RKJA 3RW6A 1FJCA 2K8GA 4M5DB 3JB9k 3CCES 2G1DA 2CQHA 1QVFR 1SJ3P 2L9WA 1X4AA 4ED5A 1UFWA 2E5GA 1H2UX 3LPYA 2X1GA 4TU7A 1VQPS 5LSOA 2Q79A 2QFJA 1CVJA 3RW7A 4U67Q 2RU3A 1WHYA 1WI6A 2KG1A 3N9UC 4QQBA 3MUVP 3DLLQ 2MQPA 2XB2D 3G9CA 1IQTA 1WI8A 1RK8A 2MZTA 4EGLA 1VQ9S 3CCMS 1U1NA 2HGLA 2DGSA 2DGOA 2DNNA 1R8HA 3P5TL 2HGNA 2WBRA 3MI7X 2M9KA 5D78A 2XS7A 1QVGR 5DM6Q 5GAGU 1YJNS 3UWTA 4C4WA 2E44A 2MJUA 1YTYA 2KI2A 3D2WA 1U1RA 4F25A 4A8XA 4YB1P 3CCJS 2DNKA 2EK1A 1SJFA 2DNPA 2E5IA 1VBXA 5DDOC 3VAMA 1Q7YT 4TU8A 2UP1A 4BS2A 2CPJA 3VAFA 4WKRA 2MZJA 3I56S 1YI2S 2MQNA 2OIHA 2QA4S 1N54B 1WHVA 5H1SV 1VQ4S 2MMYA 2MKHA 5LXRA 3L3CA 2BZ2A 1X5OA 2DNGA 4CH1A 3CC2S 5DM7Q 1WELA 3CCSS 1KD1T 1KOOA 2YWKA 2HVZA 1A9NB 2OSRA 2CQ1A 3MOJB 2QEXS 2MKSA 1P1TA 1M90T 3MDFA 2E5JA 1M5KC 1WHXA 5IM0A 2RQCA 1VQ7S 2OTJS 1AUDA 2JVOA 1X4GA 2N3OA 3J7YU 2AYBA 2DNHA 4YUDA 4QU6A 2M7SA 5GAEU 3CUNA 3R1LA 2AD9A 1U2FA 1H2VZ 4V19X 2DO4A 2K3KA 3CCUS 2DH9A 2M0GB 3UD4P 3EGZA 2F9JA 3B4MA 2DNRA 1R8PA 5IFMA 4PR6A 3NS6A 3VAJA 2F3JA 2I38A 2MSTA 5BJRA 1SJ4P 2RT3A 2MYFA 1WTBA 1X4DA 3UD3P 2LYVA 2CQIA 2MKKA
chains in the Genus database with same CATH superfamily
2OGUA 1HMVA 2CWFA 4L72B 1M5SA 4WTOB 1TUGB 3MFHA 1FVQA 2HK3A 1KLNA 2FLPA 5CQGA 1HNXH 1NXUA 4RW7B 1ZYQA 4OYPA 3UCGA 2JJ4D 4F0HA 1CJTB 1X7VA 1HI0P 2JWNA 1RSCA 3DM2A 3MEDA 4CO3A 4ZK7M 1R43A 2ZUAA 4DV4J 2E5LJ 1OWXA 2ASYA 2HBRB 3DRRA 3IC1A 5BYRA 1X5TA 3IAS9 3QT8A 3ZFVA 1HI1A 2FZCB 2SXLA 4XTTA 3MCSA 3TNVA 5LJ3Y 1S0NA 1L3TA 4DFMA 5F41A 2Z2ZA 4O23A 1F3VA 1H7WA 2QO3A 4TY8B 3W7BA 2P2CB 1ZOTA 1H6KX 2L08A 4OV6A 1Z1ZA 1QUVA 5ITHA 2MQLA 2J9DA 1NSQA 4TQSA 3RB6A 3ZTSA 4EK2A 4ZLLA 1VQMS 2UUBF 4DOZA 4F02A 1RT5B 3MFIA 4LR7A 2G2YA 1CJKB 1YLXA 4ZPWR 2LTLA 1HNXF 4M5DA 3V6DA 2IVYA 2QLXA 3IRXA 1R7IA 3KUGA 3MEKA 2ZH3A 3O1LA 2V63A 1ELOA 5KOXA 3C15B 4WXWA 2R7SA 1FNMA 2HQGA 2MGZB 5KG0A 2KM8B 4WKYA 3HPOA 1QE1B 3RTVA 5AE1A 3M32B 2UUWA 4P72A 4F4KA 1UPPA 4Y2MA 4DV2H 4RUHA 1X9SA 1Q78A 1Q8LA 1RA6A 2A2CA 3I96A 4O44B 3ET6A 4O4GB 5E33A 1RWKB 1XR7A 3OQ2A 3WIUA 2ZWOA 8ATCB 2KHDA 3OLAA 1DAXA 4W98A 3WX4A 1X0FA 1TK0A 5ADZA 1NPKA 5ETRA 5GADI 1LWFA 1VIGA 4DUYH 1G6BA 1PC4A 2KN4A 5D77A 2AW0A 1CJUA 2FHKA 2N3LA 1IBKH 3AOAA 4A46A 4RBUA 4IRKA 1VCTA 3OTOF 2AYGA 4KPYA 1CSJA 2NZ4A 2K06A 3I31A 2G2OA 1S6OA 2YNIB 5HAOA 4C9DA 2ROEA 1KLMA 4KE5A 2MLZA 2XWXA 2BE9B 4ZHRB 3AD9C 3DLGA 1IKXA 3DMJB 3GSDA 3SXLA 4F67A 3TAQA 2VV5A 3TA0A 1OMSA 1RHKB 3GFXA 1M5OC 3PACA 1VBYA 3CJ8A 5HI7A 1DTQA 5KFMA 2QL5B 3R1HA 4DL3A 1NJWA 2B0GA 2E1PA 4QBUA 3OHBA 2CG8A 1ZAXA 2NCKL 1S12A 4IH6A 5E3AA 1QD1A 4J37A 4DF8A 1DRZA 1YWXA 2IJNA 1VC0A 1BQNA 1WC4A 3FQKA 3IAM9 3NAIA 4C0BA 4C3KA 1UMJA 3V6JA 4OMFG 1SUQA 4A8YA 3LWLA 5HO4A 1NPRA 3OTBA 1TP7A 3CCQS 1WEZA 2UZAA 4PYDA 2UUCJ 4L3KA 2CPHA 1NO8A 4N7TA 1VLOA 2CVEA 3DYAA 3NBPB 4IH5A 1SJQA 2IVMA 3C19A 3M7VA 2ZM6F 3DRXA 2BOPA 2AYMA 4CP5A 3QGIA 4DR2J 4ZVPB 3QD7X 4F26A 5LSRA 3F41A 3KLFA 4JI5F 1K0VA 2JEAI 1YITS 4BCAA 4LFCF 4LQ3A 3EPIA 2WHOA 2GC8A 4NLQA 3KJVB 1NUEA 3I4PA 2V8DA 3KDNA 3MEEB 2JDJA 1WF0A 3GZ7A 3H8YA 3NOGA 4ZVSB 3UCZP 4U8VA 4H4MA 1XR6A 1YBAA 4WE1B 1PO6A 2MHEA 1RT4B 4H4KC 2B8QA 2W2NP 2RSQA 1HBNB 4USWA 3T1YJ 4B3MJ 4NXMF 4LFCJ 2KFYA 3DRPA 1U0SA 4G65A 1VYAA 2OD4A 2WAQD 5HJYA 1VLYA 2IAJB 2XG8A 2GJ2A 2BEFA 2FHJD 4KIAA 4Y0FA 4ICLB 5H9FJ 4C7QA 8RUCA 3OTCA 4Q45A 3GQCA 1RAHB 2ERRA 2MB0B 4FF2A 2ZBIA 1M1HA 1YVFA 4RJVA 1KQKA 2OPQB 4PG6A 3D7SB 3UW1A 2CQ0A 2O01C 3GFHA 3SDEB 1PBAA 5KFIA 4CWBA 1BLUA 1X5SA 1U1MA 4IUFA 2GAGC 4JI2H 3PYEA 3VQSA 2CNOB 3R6LB 2V94A 3OFEA 2R8GA 3FMWA 3UOEA 1S9EB 4P71A 2UXDH 2PA8D 2XWYA 4Y2IA 4IG3B 2Z0GA 3GLJA 1WC6A 1TVRB 2F8HA 3IO1A 4WJBA 3AFGA 4DR1J 1B99A 1JLGB 3E01B 4NE9C 4ZA1A 4ZCIA 5H9EJ 4FF4A 1T11A 3N6LA 5F9NA 4DN9A 5KFQA 5IWAF 3T1HF 1MROA 1KS2A 3QAEA 3T1YH 1Q5VA 3E01A 5JJBA 2D41A 4I2PB 5C7PA 1HW9A 4UW2A 2NPFA 4OYWA 4R8UA 4IG3A 3NNHA 2Z2YB 1EAYC 2W2QP 3JSMB 3GYXB 5IZHA 4F4YA 5KFRA 1XN9A 2QLBB 3DU5A 4Y34A 3ILJA 3J7Z5 1QTMA 2CQ4A 3HI9A 4EC5A 3AA9A 3SZ2A 2F65A 3Q23A 1QSSA 5LL6b 3PEHA 4M5HA 5LSLA 3CMES 2OFGX 3UE2A 1HQEB 2ASJA 4C8OA 1WACA 3KFWX 3MD1A 3W2VA 1HNWJ 1DLOB 1V3SA 1BQXA 1JQGA 2A18A 3HVAA 1FEEA 5SUHA 1NDPA 3CCTA 4JI8H 1FHTA 1I6UA 1VJWA 1CULB 4I4BA 3M6WA 4U9RA 4NBQA 3UR3C 3RZAA 1JKHA 1F5AA 1UAWA 2HZVA 4K0KF 3D1OA 4PPZA 4MKAA 3K17A 1KQGB 4LF6H 2DGXA 3BYRA 1JLBB 2V34A 1PBUA 3H5SA 2N82B 4RUAA 5KFCA 3KJVA 4DN0A 4DR2F 4B3TJ 1G7CB 3FCHA 1RAJA 2ZJPQ 5B0AA 1FVSA 3HHKA 2PA3A 3TO8A 3M8RA 4DV5J 1E6YB 4CQ1A 1UVMA 3AOBA 1CQMA 2YKMB 3CGIA 4OI6A 4B3RF 2RILA 4K4WA 2X1FA 1PYSB 2P5VA 3RRKA 3DHWC 2YNHA 3KLFB 1CEZA 1M5VC 3K7RA 4S0MA 3W1YC 5A76A 3MMBB 2W7PA 3DYAB 2FTRA 5IXUA 3OHAA 1K8AT 2YNHB 3AH6A 1H72C 3PFEA 1Q81T 1HNWH 3OBIA 2PIIA 4GC6A 1EC6A 2B3TB 2RHSB 4WZQA 2CPDA 1NKBA 1KP6A 4KHPH 4ZCMA 4O0IA 3RR7A 2EFGA 2HIYA 1BGXT 1QAIA 4DL2A 1LWEA 3PX0A 1JJ2R 2R7WA 4FBUA 1VQYA 2B7CB 3BS9A 3LQVA 5T7LB 2R7QA 3QWUA 3CCRS 4BA2I 4NYZA 4FJUA 1FCAA 2IVFB 4E8UA 2I5JB 1FKOA 2ZOGA 4ZP9A 1IR0A 2AHOB 4K4YA 1UG8A 1KC8T 1IBLF 1FEHA 3CT9A 5DLGA 4DV5H 1X4MA 3PKMA 2KHCA 1JXLA 2M8DB 1DURA 1T3NA 1I6JA 2MY7A 4GVLA 1CJUB 1EKSA 2V2QA 1JLAA 2DNMA 4QIGA 1FD8A 5M2RA 3THPA 2AGPA 5H9FK 1I5OB 1CS4B 3EYZA 4CCHA 2VC0A 2J0SD 2ZH4A 1TL7A 3BO2A 4PXBA 5HJXA 4CLSA 2HFUA 5FLXY 2XO7A 2CFXA 2D9OA 4NASA 5IQ6A 2POKA 1SXLA 4DV2J 1VMBA 4LIJA 2J7UA 4R8UB 5D4OA 4ZPTR 2RRBA 1S1VB 2BQ3A 1ZM9A 2FJDB 2D1CA 2EG1A 2MZQA 2VB6A 4LRCA 2MGZA 1S57A 4LSLA 5C24B 1RTDA 2CZ9A 2DGUA 4A8KA 1HD1A 4NOHA 2BA9A 2YX7A 2BOAA 2XZTB 4DL6A 1TAQA 5KFUA 3CD6S 2X3GA 4HACB 2LDIA 1FKPA 2M88A 1NSPA 3ADAC 4M5KA 3PJ9A 3OFGA 4IOBA 2XM3A 2HRYA 3BO4A 1MWQA 4TKTA 2CTEA 4MT1A 4K4UA 3BH6B 2JC0A 1S79A 1RADB 3PVXA 2CZVC 1Q16B 1X4BA 3QFHA 1FXRA 1TKTB 2RD5C 2BX6A 4HLBA 4M8LA 3OUYB 2LQBA 2LCWA 4NEZA 2Y0BB 1UWBA 2D3ZA 4GVBB 4YB6A 3LAKA 3ZZTA 1RKIA 2C2KB 4JI4F 4QU7A 4ZPAA 4CM0A 5LL6d 1RQ0A 3R5DA 3I0PA 1UWBB 2W1BA 4GVBA 2RF2A 2CKWA 1JWWA 2HFNA 3M8SA 3CCLS 2FPHX 4ETZA 2PD1A 3B8HA 3D54A 2KRBA 1UTAA 2DH8A 3P5BP 5DETA 3ENVA 3OTDA 1OYDA 4KRWA 4PG4A 4DR7F 4NCGB 3TUZC 1JNRB 3H90A 5C0XG 2C28A 1JJCB 5DT9A 2ZHOA 4G08A 4DR6J 4KH1B 2G8YA 3SCIE 1WG4A 2CPYA 1HA1A 4FYXB 4X4QA 4DFPA 1EP4B 2DNOA 2MQ8A 1WC5A 3JYTB 2DRBA 5HBMA 4ELUA 4K0KJ 2UUAH 1V8CA 4TY9A 3CE8A 2HG4A 2A2DA 3R8YA 3TANA 1M5PC 1UVLA 3PRBA 3B4DA 2ZHAA 2DD8S 4DSKA 1WOOA 3QRPA 4NLYA 2W4DA 4J9RA 1VS3A 2B51A 2QMUB 3NBPA 4FXVA 1S03G 4B08A 3CWJA 4HH1A 5HSPA 2CWXA 3MAQA 1TL7B 1JLQA 1X4FA 3H0PA 1FNOA 4FNIA 2R7VA 2MLYA 2DGTA 4C0OC 2UXCH 1RWXB 2MQOA 1KTQA 4OHZA 3AEVB 2DNZA 2ZWPA 2KVQE 2IRYA 2D3O1 1NJYA 2CYYA 4P6QA 3K8WA 3ZZOA 5KT6A 2HMIA 2E1AA 1S10A 3RR8A 3KKFA 2HKEA 3CJ4A 5L8RC 4WFAQ 1MMNA 1Z2LA 2HBYB 4AD6A 2CJYB 1OSDA 1BY9A 2GNKA 3MMAB 2QMWA 3H25A 3CCVS 4JI1J 4QYZJ 1PSDA 2JRSA 3DU6A 3FGVA 5GMKa 1S72S 1H7XA 2DGVA 3HSDA 5HK4A 1JXEA 2DCUB 3R3TA 2IRXA 4NLRA 3RBZA 4A4JA 1FT8A 9RUBA 3EVOA 1RAIB 2C3OA 3A3PB 2LEAA 5IC4B 3QJLA 2H51B 2XYHB 4IO9Q 2BR0A 4LF8J 1C4CA 4RNNA 1JNZB 1RWOB 1RTIA 4HVZA 2OO4A 4ZKAA 5A8RB 1PCAA 3F44A 4ED8A 1ICEB 1PJ6A 2ZFHA 1FO1A 1HI8A 4I69A 2XSJA 2O4CA 1HARA 4Q2MA 2DHXA 2NXNA 4ECZA 2M70A 2MJNA 4X4OA 1RKJA 3RW6A 3CSKA 3C15A 3O8WA 1LK7A 1CC8A 5ETMA 3DGPA 2JEGA 4M5DB 3V6DB 3PTWA 3JB9k 3JTPA 2UVVA 1Z2IA 2FVQA 2PI4A 1V9OA 4YFUA 2E5GA 1H2UX 2JEBI 3LPYA 1VBKA 2IBOA 3D0HE 5HMXA 3TJ9A 4MYTA 5LSOA 4O3OA 4KGMA 1SV5B 2UUBJ 4USKA 4HHUA 4XO0A 3HVWA 4LF5H 3M8YA 3KWMA 3P96A 3J7AK 3UVJB 2RU3A 1WHYA 1OSCA 2KG1A 3KLIA 2VC1A 3MZIA 3MR6A 3VGUA 4P7VA 2ASDA 4DR6F 1CJTA 1G3OA 1SIWB 2E66A 1FDBA 3KJQB 5CHCB 3H4DA 4LRBA 4EGLA 1IVZA 1VHFA 3FEZA 3CCMS 2YKPA 2HHPA 2LQ8A 3GR0A 2GVZB 1U1NA 1RAGB 2DGSA 2DNNA 3CVKA 1IKYA 3MHYA 3PXGa 5KG2A 4OX6A 3HHEA 1RGVA 2FIUA 4ZVFA 4I2PA 3PFOA 3U1KA 4J9KA 5KAKA 3JAMU 2IRUA 2H9ZA 2XMKA 3EDRB 4LSZB 4WYLA 4UQGA 4LF9J 2PMZD 1EETB 2KT3A 1EHWA 2J6SA 4F0KA 2AMCB 3OVAA 4DUZJ 3QRQA 4JV5J 5L9XA 4DV6H 2KI2A 3A8KA 3OTOJ 1U1RA 1K1GA 3MTJA 1XERA 3M9OB 4LF5J 3OD2A 1DQ9A 3RG6A 1Y5NB 5J2NA 2R7UA 1FRJA 2EK1A 1SJFA 4FJSA 4DL7A 4URSA 3QGHA 1NDLA 1NK4A 3H2LA 3FZBA 1TK8A 1IBLH 3JS9A 2L3MA 4MK7A 3VZHA 1D09B 5D4NA 4DV6F 2B5JB 5BR8J 3I56S 2HNZA 2VPYB 3TARA 3DRPB 4C8MA 5JUMA 3KK3A 2M3DA 2QA4S 3O3LA 1V9NA 3BSNA 4XAKA 4ECTA 5H1SV 2PI5A 1ZPVA 1XEZA 4KJIA 2CWKA 2Y1IA 3IA0A 2BXJA 5LXRA 4DV6J 4ZVGA 3J7AN 4JV5H 3MR3A 1TL3B 1X5OA 1YDLA 4KKOA 5T41A 3KXDA 4I64A 1IKVB 5L1KA 1RBOB 5IT9W 1FRKA 1F0XA 3C6TB 4EU0A 5KFDA 2NXUA 4H4OB 2ZBRA 4DU8A 3CC2S 4ETXA 5KG5A 1N5VA 4BLGA 3LALA 3ETMA 2UVRA 5AJ3J 1HHTP 2HQCA 2V6AA 1IR1A 1WC0A 2DR9A 4LF5F 3H59A 2UU9F 1KOOA 3V69A 1KEKA 5A2QW 1A9NB 2ZBQA 3MOJB 2ANNA 1VK8A 5MAOA 1FJEB 4NRUA 4B3SF 4O3RA 1RAFB 5CCLA 5A2QY 3TAMA 1EQ0A 3MDFA 5ETPA 2YXLA 4EZ9A 4B8TA 3LP1B 3EGVA 4NZRM 2GZOA 4NX9A 3Q8VA 4QZVB 4NXNJ 3FBEA 5KFWA 3OVBA 1AUDA 2WTFA 3MWBA 4BA1I 2HAFA 2ACYA 3I82A 2JVOA 2E9RX 4UY85 2HQDA 2QT7A 3CDWA 3BN4A 3SQOP 2R8IA 5DJBA 5JMNA 2KTQA 1CPZA 2YKQA 2ALZA 2OEMA 4MH8A 2IPOB 3FJ2A 3HKZD 4WYWA 4CLZA 4DPWA 3GYGA 3ZZ0A 3EICA 1U2FA 4K2XA 3TQEA 4ZPDA 2YWFA 3UDLA 4AM3A 3ISZA 4FP9A 1U0HB 1DJ0A 3GCXP 3PX6A 4UF4A 2K3KA 3RAXA 2DH9A 2IC3A 1MSZA 2M0GB 2UUAJ 3V81A 1IKWA 1S1TA 4GRSA 1RABB 2NUUG 2OP5A 1BQMA 2N4DA 3B4MA 3MCOA 3X3UA 1R8PA 2UXDJ 3HHLC 4X65F 3BGUA 3H42A 3MPDA 4PR6A 3NS6A 3QATA 3TZYA 2F3JA 2KT2A 1U47A 5KFEA 1YJ7A 1SJ4P 1S0OA 2C3UA 2MYFA 2C2DA 1PQXA 2PMWA 4J91A 1RI7A 4OX9J 2NSBA 4L75A 4XIUA 2QLJB 4UOGA 3AD7C 3ITHB 5CYQA 4DU7A 1E6VA 2H3EB 4WXOA 2V8GA 3ENQA 2DIVA 3MR5A 1RTIB 4DV1J 4IRCA 1HYSB 1Z2ZA 1VQNS 1KVKA 4Q44A 4ZCLA 2MQQA 4DF4A 3PIPQ 1B0PA 2DNYA 3TVYA 2QL9B 2YPYA 2H65B 1N33H 4Q7AA 2O5DA 3ICLA 4B17A 5M2UA 4CLYA 3MMAA 5KFKA 2J9DE 1B70B 1D9DA 2EBGA 2Z4PA 5F9LA 4P7TA 2ILZA 2J0WA 2YH1A 3S7RA 2C3PA 2ZH1A 3ZTPA 5IQQA 4O4RA 4NMLA 3NGUA 3HFKA 2Y8YA 2NQPA 1WG5A 5I3UB 4USJC 4TU9A 2JLGA 2QN6B 4B9TA 1ODHA 1PILA 1U24A 2PE8A 3E3XA 4CTAB 1J5KA 3BB5A 4N47A 3BEGB 3QSYB 2UUAF 4NMXA 2LRRA 2XMVA 4LRAA 2BBEA 1QSYA 2X1AA 4NLWA 2QYGA 4WIIA 2UXBF 5KG7A 1LK5A 5IT9U 2BABA 2V9KA 2CPZA 3DLKB 3I87A 5D4LA 2HURA 2VFVA 4EO6A 2PY9A 2X1BA 2PEHA 3FEXB 3T9ZA 5A0YB 2XHCA 3MUTP 4DR7H 1RT1A 3G2XA 3VZIA 2KO1A 1S76D 1NK6A 2VBXA 2VG5B 2YPZA 1SB6A 5IV4A 3GPAA 4F04B 1TKZB 3QZ8A 3PJWA 3AB4B 2LXIA 5DO2A 1QSLA 2JEJA 1Q5YA 3CB4A 3UQSA 3HMJG 3DLKA 1HQ2A 3OVSA 3VALA 3H98A 1S48A 4NXNF 1VHIA 3D6HB 2VJVA 2CJQA 3W9IA 1DARA 3IRXB 4YN3B 4N8OA 5A6WA 3F56A 3OJUA 3NNAA 1KFSA 5F8JA 4X66F 4I2QB 4JB8B 1SL1A 1PGZA 4NA3A 2BKNA 5HVFA 3CIMA 3MCNA 1FA0A 3QFWA 3E2EA 2NN6G 5FJ4A 2J0XA 4HL9A 2Z0SA 4ZDNA 1YK9A 1MW7A 4DQIA 3CPWR 2MY8A 2VPZB 1IBKF 1KN6A 4DR7J 2GHPA 2GO8A 3CMAS 3MAAB 3WDOA 3J80U 3M1VA 5E2QA 1U26A 2VG6A 4OJGA 4OZ1A 5L9NA 3ELHA 2CJXB 2B8PA 2YNFA 3LO3A 4HI1A 4RLEA 3BSCA 1KHVA 1TL5A 3C16B 5C2CA 2FJXA 4ZLPA 1RJJA 2GO9A 2X7IA 2ZVIA 4DR5H 2EKNA 2VDIA 2C3YA 3PG9A 3U7JA 1WVNA 1XR5A 2HFZA 2C2ZB 3NL0A 2CA9A 3UCUP 2HK2A 4YB7A 5G0RB 3R5JB 4U8YA 3KJFB 4J9LA 5K14A 2DEJA 1RTHB 2VA2A 4ILRA 2UV8A 4KFBA 2CDRB 2KKHA 4CNZA 3BBFA 1BWEA 2ZQEA 2CPXA 5C24A 1WG1A 2PO4A 4GKJJ 4TYBA 5EWFA 2LF0A 2K1RA 1RT1B 3GSIA 2VU5A 1YBTA 1FESA 4I68A 4KYZA 2FGOA 3S6EA 1WUUA 1BC6A 2JVRA 2BL5A 4Q0BA 1CS4A 2CDQA 3GJTB 2OPPA 4E2FB 4UTGA 5HROB 3GR1A 3SFUA 1IBLJ 2XTJP 4LBHA 2P2RA 2HYIB 1YJRA 3C6UA 2XY7A 3EM1A 2RJZA 3EVWA 3LH2S 1BE4A 4LSNB 4GKJF 4K4ZA 1U25A 3BQ1A 1URNA 2W25A 1JB0C 5BR8H 4LQ9A 4PQUA 4NPOA 2FLNA 2B43A 1M5HA 1JLAB 4HHJA 1U1PA 3KTQA 3MEGA 5I3UA 1FKOB 2EW9A 5A8KA 1U7LA 1BD6A 4OIXA 4DWIA 3EZJA 1YRTA 1K44A 4Y6IA 1WF2A 5JVHQ 3SI8A 3LP1A 3ISNC 4L3NA 1KTVA 4ANCA 2QYCA 3GIKA 3FBCA 2C2NA 3FFIB 2GVDA 2FQQB 4FS1A 1NB7A 4JI6J 3MUMP 4DV0F 1WHRA 3WBZA 4RU2A 4LBPA 1U02A 1UW9A 1G2EA 2OELA 3M6UA 2AWZA 2OAUA 2YX1A 4RU9A 3OXGA 4LF7F 2VUGA 1C1CA 3PHTA 4LF6F 3K0JA 1WKLA 4LF4J 4OL8A 1VGYA 2CQ2A 3CDEA 3ZZZA 3OFFA 2Y1JA 4J9SA 1HIYA 3CC4S 1F9FA 3BR9A 1HD0A 1E6YA 3P49B 4JI6F 2AKWB 2VJUA 4EWTA 4RW4A 4CO4A 3HDSA 1RB0A 1UPMB 2N7CA 4DV4F 5D3GA 1ZZKA 1AYEA 4NLDA 1LWCB 3ONQA 4MIAA 3MPWA 3GIMA 2K7KA 1OQ6A 4L76A 3A4TA 1JLCB 2FMRA 2VFSA 2HNYA 3M8WA 1Y11A 3O5TB 2Y3YA 3MR2A 5AE3A 2W7OA 2XMJA 2DKOB 3DRYA 1VRTB 1VISA 1WORA 5KG6A 3US5A 3CF5Q 3C8YA 4ILMA 1ZH5A 1WSVA 2MKIA 3K89A 3L7OA 1IWGA 2BRKA 5THWA 2ZHBA 4ECSA 1R0AB 2BJ8A 2XNQA 6FDRA 1XC9A 4OZ0A 3I0RB 1FRLA 1ZM4A 1WDDA 5MLCV 4K59A 1NZ8A 4RWXA 4XK8C 3ILOA 4LFBF 5D8HB 1UL3A 2EFOA 2FHJA 5IS2A 3BO3A 5FLXW 3MM6A 2HW3A 4I1TA 5EX0A 2B9EA 3LP2A 4YHHF 3BPDA 1TUAA 4R5PB 3O44A 5CYJA 2WCXA 4Y2CA 3D9BA 2P6TA 1FNXH 3BGRB 1FE4A 1GFWB 4AFFA 2ADCA 3Q2TC 1R6VA 1FWPA 1F9EB 1YSJA 4EUVA 5I42A 4LF6J 2XI3A 5J2QB 4X64H 1F1BB 3Q83A 2A6OA 4WK3A 1XNQF 2OFHX 2GW8A 1F5BA 1UETA 5HANA 2HWIA 4KFBB 2N4CA 1S1WA 3G6XA 3M2RB 4RW6A 4WU2A 3UN2A 3ZTQA 2LLZA 4CRJA 2FVRA 2E3UA 1HL6A 3G82A 1Y3JA 4ZP8A 2BW2A 1U6FA 3L4BC 1RT6B 5KFHA 4WF9Q 3M2RA 4RW6B 2XI2A 1A0OB 2GVZA 1ZZNA 2AGOA 4O3SA 1T03B 2CG4A 3I0SB 3W2WA 5A8WB 3K5NA 1JLGA 2HWHA 4A48A 4EBCA 1S0MA 1AFIA 4KKOB 3TJAA 2J7KA 3TAPA 2CJKA 2V67A 4G1QB 2MXYA 4NXMH 3SDEA 4JI3F 5HL7Q 2VG6B 1UWAA 3B82A 2VQEH 3M1VB 3UR0A 5LMUJ 4UUXA 3MGJA 5AT1B 4WFNQ 3UPFA 2IYIA 4W4MA 2C2RA 1YG0A 3QJJA 1T05B 2F7VA 1CBKA 3G4SS 2IM1A 4ECVA 1RHUB 2P9EA 1NHVA 5CABA 1S9GB 4ID5B 4KHRA 2XY5A 4YDXA 1VIOA 2R7OA 4U7UD 2MLXA 1O0PA 2ZM6H 3RAQA 4ELTA 2WSCC 3HFVA 8AT1B 1TUVA 3FRZA 3HP6A 3GIIA 1WTFA 2GFFA 1ACMB 3R5BA 3GIJA 5LMNJ 2DR8A 3Q2SC 3GR5A 2JX2A 2ZBCA 3IG1A 5GMEA 4K5RA 4AL5A 2RQ4A 2DTJA 2QA4G 1QLNA 3ULHA 1RYRA 2EG2A 3D0IE 4EYHB 1KNZA 5AXLA 2MZ1A 5J1PA 3KHLA 4OYZA 4M5LA 1FRMA 2GCFA 2RS8A 2KB2A 2V2ZA 3DGVA 2VG5A 3NEKA 1HHSA 3QT5A 2J8AA 4WWSA 4JUZA 3MTKA 1X8DA 3RB0A 2HQFA 1W2BR 4IO1A 2O67A 2ZH2A 4B3OA 2VL1A 4C6AA 1YZ6A 1T9XA 3D5MA 4KAIA 1F6TA 4J9UE 1DZ5A 4M5NA 2HH2A 2GMHA 3OTOH 3MAHA 4KY3A 5EDWA 2M4MA 1JJHA 1DTQB 1SUQB 1TU0B 2OMOA 4ZS6A 5HQLA 1I3OB 2ZM6J 2B6AA 1KOHA 2IIHA 4KH0B 5DZ6A 4EBEA 3PV8A 4YOEA 2YWWA 3T5KA 3QPIA 2AZ1A 4ZJOA 2FC8A 3KLIB 3MPUB 2XLIA 1U48A 3U1LA 4CTAA 1K9MT 1H98A 1XNRJ 2WOMB 4OZNA 2D9PA 3TI0A 1NHKL 2NXCA 4A8SA 1C0UA 3KMSA 4NLGA 1D9FA 2FD2A 1N48A 3FC9A 2IA6A 1LW2A 1HWJA 4RW8B 4YY3J 2B7BB 3R5CA 4DPTA 3BBBA 4ZHRA 3KHRA 4DV2F 5LJ5Y 1QAJA 3BQ2A 4WCEQ 1R31A 1LWFB 3Q86A 3NS7B 4UZCA 2V9WA 4CLFA 2JZ5A 2V0NA 4UQTA 4FDFA 1VRQC 4PYAA 5KFZA 1JX4A 1WOSA 3IFEA 1AROP 4P2FA 4BC9A 1L3UA 3MURP 2VODA 2JE6I 3NGTA 5H9EK 4DR1H 2CQCA 1B0VA 1ULRA 2CJBA 4L6V3 4F3QA 3PW2A 2UUBH 1JK9B 3MXHP 2KVIA 2HQIA 4FPRA 2MQMA 3SMZA 2HNDB 3C3LA 3I9ZA 3U1MA 2HHHH 3OR2A 3SEOA 4YR2A 1HR0H 3LP0B 3I5BA 2HWTA 3I32A 4KV8A 2J9EA 4ZN1A 2Z57B 3BKTA 1TKXB 3DLBA 1OYEA 4W90B 2LQ5A 4Y00A 3MOZA 5D15A 5I3PA 3W61A 4OX7A 2IBKA 1N0UA 3BF4A 3WC0A 4URQU 4DZ6A 2W4PA 2BJ3A 2UUTA 2ZNZA 4DUZF 4LF1A 3IR7B 2FFMA 4XPEA 3FSIA 3NGDA 2ZC4A 4PWDA 3MAAA 4LF9F 2E5LF 4OO1G 1SI9A 2ZKUA 2FJAB 3TEHB 4RNOA 2BDPA 3HT3A 7FDRA 3MM9B 2KZMA 4K2JA 3AXKA 1GMVA 2RDJA 4JI7H 3IXQA 2M8HA 5I3QA 1S5ZA 5JXSA 5B0EA 1RWPB 3KDOA 4ZMMA 3BREA 3SCLE 4GKKJ 2D7SA 3DM2B 3MEDB 4X4RA 4UY8T 2QX0A 3NG8A 3DHXA 2J6UA 1AZSB 2IY5B 4WP8A 2G1HA 2PQUA 1VOMA 5DGBA 1Y4ZB 2LQ9A 4LF2A 2Q6BA 1Q0NA 5A8WA 5CZXA 1R27B 4GKKF 2QA1A 2AYEA 2R2RA 2ZZMA 1ZS6A 4OYMA 4PG5A 3CULA 4B3OB 5KG1A 3GG0A 1AB8A 2A10A 3PYDA 1C1BB 4H4OA 2GMJA 1NKCA 2HLUA 4QWEA 2E29A 5J2QA 4IRDA 4DR4H 4OX9H 4TN2A 2DR6A 4DL5A 2ALYB 2VQFH 5ETLA 3IS9A 4KR0B 2UV8G 4B9MA 3D0GE 3HHLA 4PABA 1UFWA 2WONB 4QIVA 1F9HA 4TNOA 4R5PA 1EIYB 2F40A 4AQYF 1V6HA 2KDOA 2ZE2A 4HHHA 3IM8A 2J8SA 2VPWB 3KK3B 2OHDA 1VQPS 5E0OA 1D8YA 1F3FA 1N5YB 2V8PA 4LRFA 4OZ3A 1WKJA 1XMBA 4XDCA 3BKFA 4C8LA 2MEWA 1K47A 2QFJA 4X62H 4ZCKA 3M6XA 2FHMA 3CJ0A 4P9SA 3O6QA 1T05A 2YWHA 2VD3A 2HBQB 3L95X 3FBFA 3NWRA 4QQBA 3R97A 3MUVP 3KG4A 1VRUB 3CJQA 3OSPA 3DLLQ 4X64J 1T9WA 1JLCA 1RK8A 4X4TA 4OLPA 5J2NB 3DFEA 4WFYA 3CJ2A 4AXIA 4CYUA 5HQ8A 4YMEA 3IP0A 2BANB 3D28A 2F4VJ 4HACA 4OYOA 1FRIA 1Q7LB 1D1UA 4YY3F 1R3NA 4NLXA 3V4IB 1FFSB 2YKMA 1U1QA 1O5JA 5DZ7A 3CJKA 4ATNA 3KOAA 2UUCH 1OQ3A 2IM2A 1SKWA 2V4JA 3W5ZA 3CDBA 4EI2A 3J80W 2BMBA 4RBTA 2MJUA 3K58A 2DR7A 4M5IA 4K7QA 1FDNA 1HBUB 1LW0A 2QLFB 1SC3B 1OY8A 3N28A 5D4PA 4A8XA 4YB1P 4Q5VA 1UA0A 2DNKA 2NR0A 2GVDB 3DRSB 2IC3B 2R7RA 1X31C 4M94A 2YX4A 1KQFB 3JTOA 4X65J 3THVA 2DVIA 4DR3J 4U7UK 2XQCA 4XPCA 2GGPA 2WBMA 4WK1A 4LF8H 3TJ8A 2UP1A 4B3MH 4USTA 2CPJA 3FVYA 2MZJA 2NS1B 2QSWA 2MQNA 4DPYA 2OIHA 1ZZIA 3EZ5A 2F8MA 1REVB 1N54B 2AX0A 4OZ5A 3WX8A 2ZH8A 2N7YA 2G0JA 4ZN3A 4AL6A 3FRYA 5J2MA 1F2GA 1RBAA 2BVZA 4N5SA 1R0AA 4FYDA 1C4AA 2EC2A 1SH0A 2MMYA 4OZLA 5F0WA 5HROA 2MKHA 2QL7B 2BZ2A 3KG1A 3VHQA 1DTJA 1QJHA 3BGOP 4ZPBA 4RNMA 1RU1A 2BJEA 2AF6A 4RBVA 5BYSA 4DV3J 5HVGA 3PY8A 2VG7B 1X9ZA 2M6QA 1UVJA 3DCAA 3QZ7A 1J2VA 1DQAA 1VIXA 4N77A 4DR5J 5KFTA 2DCLA 2JHEA 4YEAA 1XBWA 4AT1B 1XMQH 1J5EH 1FFGB 3PYGA 1S7IA 3CCSS 2DYAA 3HD1A 1ZTGA 2XLJA 1KD1T 1S59A 4FBTA 4V19J 2AEFA 2BANA 3E8OA 3B78A 4NYOA 4DR3H 1N34H 4Q8FA 4JI0J 1KKHA 2AXYA 5B7WA 2HVZA 3C6TA 2P9GA 3HZEA 5J1EA 4G3IA 3N79A 5AJ3F 2DRAA 2HS3A 3AAWB 4IR9A 4KTQA 3M8PA 4B9NA 2Y9HA 1RP5A 4DFJA 1PC5A 1RT2B 1LNQA 1N36F 1RT7A 2E5JA 4UZBA 5IM0A 4HTIA 1VQ7S 4NZ0A 3H20A 5KFLA 3LF0A 3L7PA 4MK9A 2XZWA 3HSZA 1KONA 1OPZA 2I0XA 1X4GA 2H1YA 3DI6A 2FLLA 1CULA 4YY3H 3RBEA 2DNHA 4YUDA 2XHWA 5CAAA 4QU6A 5DS7A 3J81U 3VWSA 2EI5A 1URRA 2M7SA 2QFIA 3IBCB 2GQQA 1SJ1A 4QWAA 4NZ7A 3CUNA 4PUOA 1Y3KA 1HNZF 3LTOA 1HNXJ 1VI7A 4X4UA 3EMTA 2AD9A 3K2YA 1XNQJ 2BJ9A 1IXKA 1LFWA 1S0VA 3VV2B 4RW9B 3MEEA 2CTMA 4NA1A 1SKUB 2QZ8A 3W60A 2LVWA 3UD4P 2D69A 3C6UB 3UDEA 2NXJA 4ALZA 4K4TA 3HHLB 3CIZA 3QO9B 4OFZA 4X62F 3OETA 3K5PA 3IS9B 2C2MB 4YHHJ 1LFPA 5FIIA 1HWKA 1SBRA 5C42A 1RZMA 1KHWA 4B3TH 1H73A 4WTYA 3DLEA 1KBRA 5CYMA 3WQPA 1EX8A 2CIMA 2RT3A 5HBMB 1SPBP 2CQIA 3OLBA 3D68A 2HZAA 3WZ0A 2CTJA 5K14B 3OL8A 2BE2B 2HHVA 3W8GA 2MKKA 3EJMA 4QWBA 3M8ZA 1HBMA 3NCQA 4OHWA 4JV2A 1Q82T 2BE7D 1RT3A 3D6TB 4IQMA 3AODA 1S9EA 3DOLB 5KFVA 3TVKA 4J9MA 2BQRA 4MK8A 1Q53A 5K8NA 3ZZRA 3KNGA 2A3JA 4HTJA 2GQCA 2AJ4A 4PCQA 1RE1B 2H54B 2QE5A 4QIFA 1P27B 2HFOA 3ZNJ1 1XNRF 1DT4A 2V69A 1U4BA 3AOCA 1IN0A 4M63A 4PWUA 4CH0S 3UVJA 3KJNB 2KRRA 5DDPC 2CPIA 2MZSA 4DSJA 4EZ6A 1B0TA 1JXVA 2DITA 2ZKTA 5U47A 3NMAA 2Q3PA 2KL8A 2XO6A 3OL6A 3OUYA 1Y9OA 4B9LA 1TFWA 3NMRA 3DOMB 3RRHA 1SEIA 1WTJA 1LKZA 4OJ1A 3MECB 3P3DA 1X4CA 2MPUA 1HWUA 2Z30B 5L39A 2PMHA 1GX5A 2GJIA 4K50A 1F5CA 1MG7A 2GQ2A 3K5OA 3V5RA 5CD4H 2AZ3A 3HJVA 2RE1A 3GMGA 3ZC4A 3D67A 3HHLD 1SVDA 2PC6A 4CZCA 3T9NA 3G6VA 5F3ZA 4IG0B 3SSRA 1TKXA 3V6HA 1U8SA 1F60B 1OIAA 5I4MA 4KV8B 4BWJA 3G8SA 1NCLA 1RXOB 3W66A 3MMCB 3MM5A 5HQMA 1RDRA 2BUNA 3GE9A 1RWUA 3M05A 3P45B 1QAYA 2KT5A 2OLWA 4R25A 4ZVOB 5A8RA 2R8HA 4F4ZA 4LFAF 1XJWB 1DFDA 3KHHA 4P74A 3OTEA 2MKCA 3CJRA 5F8NA 2LQJA 2YTCA 1D0EA 4QR1A 3TYTA 5CA5A 4GO7X 2WW8A 2MJHA 2ZUGA 4LF4H 4OD6A 2FZKB 3L7UA 4JI0F 2L48A 5ETSA 1C0TB 3FSYA 2VOPA 2VOOA 1GTHA 3G87A 3VAIA 1NNDA 1KQSR 1YJ9S 3EGNA 2B9WA 4PQAA 2DISA 3JSYA 3ZZYA 2HQ3A 4PG8A 1K0TA 1RCOB 2HS4A 3GG1A 4QIEA 4DR1F 1U45A 1JLFA 2JL9A 3W5YA 2EVZA 1FK9A 4EMDA 3PW5A 4ZOSA 4DV3F 4QPXA 4LMZA 3UFCX 2XNRA 2CWHA 1T02A 4DV7J 2C22A 3JTNA 1U8WA 2DPJA 4KPCA 3FDSA 1U09A 2XYPB 4UOHA 5HMZA 1NJIT 1VQKS 4KHMA 1ZM2A 3D6MB 4RR5A 3RAMA 1QAXA 2XBPA 1TL1A 3DLEB 2CPEA 3R9LA 3ET6B 1N6QB 1WKKA 3ITHA 4Y2KA 5CYQB 3OJSA 4HKQA 2R7XA 1UEUA 3BSOA 1U1LA 4C8NA 4DSIA 4RZRA 2CNNB 3QO9A 3HVRA 3TEGA 3I5CA 3A1YG 3QGGA 1XMOJ 1V5VA 3KLGA 4C97A 4DR3F 2FLOA 2HHXA 1FRXA 2FJEB 1S6UA 1TL3A 5KFFA 1TK5A 2A0FB 1S1UA 1XMQF 4KC5A 2F63A 2ROGA 4X66J 2JZXA 1GAOA 3MF5A 3GJRB 1RWMB 4YB5A 2XMMA 1H3DA 1S9GA 4ID5A 2VH7A 3QYYA 4JBCA 3EXCX 2Q6CA 1XMOF 1NKEA 4FZVA 2QG9B 4YQWA 3PRVA 1XTZA 2NUHA 3M2UB 3DXBA 3ENWA 1V5IB 5D0GA 1T3OA 3PM9A 5DGAA 4KGZB 4A8QA 4LVNP 1HQEA 2P6SA 2MZRA 3HF5A 4PRFA 1B4SA 1NZAA 2MSSA 3DKDA 1RT7B 5K9FA 2GMLA 3CC7S 3TRGA 1OY6A 4ES2A 3R6GB 2CJ9A 2FZGB 3I55S 4LF8F 4DV3H 1T0TV 5B0GA 2W2PP 4JVHA 2BV3A 3G8QA 2FJVA 4JI4J 5LMUH 4HDGA 3H2VE 2QV6A 3MPVA 3T1HJ 1WC1A 2QA2A 3AY0A 1Y10A 2HS0A 3GCWP 5J1NA 1Q86T 3M6VA 4IOAQ 3P6YC 4ZVTB 4DZDA 1FKPB 2Y3MA 3BR8A 2G0CA 3PEJA 1NPPA 1MROB 4OZJA 5KFAA 5KT7A 5KFGA 1FRHA 3FEYB 3K8VA 2W7AA 3RF2A 4J9PA 1XNQH 1H74A 1UW4A 3VVUA 2JOQA 3C2PA 1UCNA 1XWLA 2I1RA 4IYQA 3W9HA 5FD1A 5I42B 1K73T 1VQLS 5LMNH 3D66A 2X51A 4J90A 4JI3H 4L74A 3M8QA 5E5NA 1JJ4A 1U1OA 1VQOS 1IKVA 1VDHA 4QMFB 2EFPA 2KJVA 3LW5C 3TQ1A 2LU2A 4NZTM 4HDHA 5CXTA 4RW9A 2RB7A 4DV1F 5HLFB 3CDAA 3CTRA 1I51B 4RKUC 1YQHA 4NLOA 4Y65A 5B0FA 3VGTA 5K8PA 5EWGA 2RS2A 3KUHA 2OPUA 3EVMA 2GIRA 1S1XB 2DJWA 2RVJA 1IBCB 2ZOMA 5GAGI 3M2UA 1X9WA 1FF2A 2A6MA 4J9OA 1VRTA 2ZBPA 3QT7A 1J27A 4DS5A 1M1KT 2I5JA 3CMQA 1T9TA 3Q89A 1NAQA 2HZCA 2RQKA 4H4MB 4IFVB 4WE1A 5IM0B 1HW8A 1V3ZA 2ZH9A 1FKAF 4IFYA 3NGKA 4D3HA 3LANA 2YKNB 2ACMA 4AQYH 4URGA 3I9V9 3DOKA 4TVAB 4LF7J 2OI2A 1GNKA 3UI3A 3VGVA 1VJQA 5K20B 2J0QD 2HHQA 1XNRH 2JA9A 1VR6A 1KVIA 2V8VA 1IJFB 3S01A 1LWCA 3GV5B 3QQCD 3RRGA 1SH3A 4Z2XA 1C1CB 1Q95G 3C66A 3I4HX 2QMXA 3NAHA 1IBMF 3IMQJ 4DCJB 2YKAA 3IBFB 1S4FA 2XMAA 4ZLJA 2IMOA 2MKJA 3K5LA 1YJWS 1VBZA 5GAEI 2MHNA 4HT5A 3EZOA 3RB4A 3NY0A 5K8MA 3HHNB 5CZVA 2ZD1A 1GMUA 3V2UC 5DDQC 2OSQA 2ZZTA 4D3GA 1D3WA 3PRDA 4DJBA 3TVZA 4TXSA 4XDDA 1DQ8A 3UO0A 5EHHA 4B3SJ 2EC0A 4ILLA 2DIUA 2PGCA 1JLFB 2I6WA 4JI6H 3M9NB 4I6YA 1S6PB 2LA4A 3VKEA 1NJXA 4NA2A 1JKHB 3D3CJ 4O3NA 4X4SA 3MEGB 4MKVA 4FYWB 6AT1B 3NS5A 1P9QC 5K8OA 1N5YA 4LF7H 9ATCB 4B8CD 3HSJA 1DHMA 4K5SA 1S1XA 1FX2A 3R7NB 2HMIB 2CNLB 1Q1KA 1SH2A 2LXUA 3MCMA 3CW2C 2X3DA 1CC7A 4NLPA 4X62J 3KLVA 3PW7A 3OW2R 1RLCL 1RTJA 3KG0A 4H4KA 2Q43A 2E5LH 1FJGH 1RA7A 4USMA 1LQ9A 2O1PA 5KG4A 3DRSA 5J2PA 2BJ1A 1OY9A 4F7VA 4F3OA 2LEBA 1FD2A 3ZNUA 3J7YI 5E3QA 3IRWP 1H38A 4Q0BB 4NZ6A 1G1XA 2F4VH 4KGKA 2GHVC 2CQDA 2VICA 1RHQB 1UJ4A 2QIFA 2CAJA 1U6ZA 3LOUA 5EN1A 1X0AA 4OJ3A 4F8RA 4OI3A 4GKJH 3TW0A 3CCZA 1EP4A 2WSEC 2VKRA 3A13A 3FCVA 2DHGA 1PAUB 3FQLA 5E3RA 3V4MA 1HNVB 2W9BB 4KT0C 3A8EA 2K1HA 2KXFA 4JYAH 1MN9A 1TVRA 1WC3A 1YJTA 5G0RA 4F36A 2W9CA 5IWAJ 2AJ0A 5EUHA 4CT9A 1NDKA 4BBYA 4E9JA 2JLEA 2HVIA 2GJFA 2BYCA 3E51A 1NU4A 1WF1A 3AXMA 2CQ3A 1RCXB 2JSXA 3HM9A 2W2MP 1QTNB 2DK2A 1HBOB 1RYSA 2YWEA 3BDPA 1HNIB 1PJ7A 2YKOA 4RNHA 5B0BA 3AD8C 4DBQA 3P4UB 4WU3A 1D9AA 2ZITA 3AJ2A 1TELA 3GFYA 3Q8YA 5HMWA 2E1MC 5KFNA 2L41A 3J81j 1N52B 3J80Y 2HBZB 2DNQA 2YQ3A 4L73A 2BACA 5ETVA 5L38A 2HVHA 2HH3A 1YZ7A 5AXNA 3G6ES 4TQRA 2DY1A 1ZAWA 3TP2A 2H4WB 3L09A 1U1KA 4JYAJ 2F1FA 4ECXA 2JVZA 1S1UB 2WVCA 1LEOA 3AB2B 4ANDA 2VFUA 2ZZNA 2QC3A 3C46A 4DPXA 1UVIA 3PO4A 3I6PA 5CYMB 4CLWA 2UXBJ 3IR6B 4NLTA 2NYHA 4YDDB 2I2YA 2YQ0A 1S1VA 2HLTA 2JFKA 1PIEA 3R7SB 1N5QA 4EYIB 3KLEB 3PZPA 2CJAA 2YH0A 1N6QA 2HVEA 4X66H 1TL1B 2H4YB 2EKYA 2IHR1 3ILLA 3QJPA 3QIPB 3WIVA 1I94F 1FJ7A 2BA0A 4ZP6A 4ECWA 1HNZJ 3TOQA 4C8ZA 4I7FA 4AXJA 4Q43A 1EB0A 5AXKA 2J76E 2RUGA 1D8ZA 2RAQA 1BXNA 2GHWA 3HZGA 3QNWB 5FDLA 5F0UA 3W5XA 3POTB 1R0CB 1VFJA 4DG1B 1TUWA 1N32H 2XZDB 5B0CA 5A6PA 4PUOB 5IT9Y 4ER8A 1R6YA 3A8JA 1N33J 1CJVB 1PKUA 1TTHB 3MM9A 5GMDA 4DV7F 3QT6A 1N36J 2E1RA 2V8HA 3DI6B 3DLGB 4DQQA 2G4BA 4K8RA 3KNAA 1N32F 3HFZB 1S6PA 1B64A 2YNIA 4LIWA 2XGQA 2EXUA 4C8YA 2UXBH 1C0TA 5T7LA 1KR4A 1VC5A 2LXFA 2XMTA 4P2SA 1P6TA 5C25B 1RT2A 1XQIA 3HT0A 4R0EA 2DO0A 1NK9A 3JAMW 4E98A 4CO1A 4MKYA 1I94H 1R8BA 1TMMA 4ZPCA 2AJ2A 2GIQA 3EPGA 1IJEB 2JNJA 4NI2A 5BYQA 4ES1A 1F2HA 2VQEF 1RUSA 2R3VA 4OQJA 4NLVA 1N5TA 3N01A 2RUSA 4J5OA 4CO5A 2C2OB 2QLWA 4QW8A 5CCMA 4O44A 2XYGB 4OI2A 1N32J 2J6TA 1Z4UA 1SQEA 3M32A 2CQPA 2R42A 4G1IA 3RYLA 3TZXA 2HNDA 3BDEA 3A3OB 3I5AA 3J81Y 2KG0A 1GTEA 1FX4A 2C2EA 1N33F 1WJ9A 4DX8H 2OUGA 3DOKB 3FMBA 2K8GA 5DG7A 3CCES 2G1DA 1CJKA 3D1QA 3G86A 3SBMA 4IFYB 3UN3A 1KHMA 1PJ5A 2AX1A 1X4AA 2AJFE 1BQMB 5HMYA 1GMWA 1SJ3P 3CO0P 4USVA 3Q8RB 4ED5A 1IKWB 1YBUA 5AXMA 4CLTA 4Z37A 3BH7B 2IMWP 2X1GA 3CJ3A 3OSSD 3MECA 1REVA 1U0HA 1PYOB 4RPFA 4TU7A 3RB3A 3CEDA 3PR4A 1SQFA 1ZBTA 2EFQA 4IDKA 4F4XA 4I6AA 2PT7G 3HULA 2VFTA 2XMUA 4FVMA 2EPIA 2ABYA 4FKXA 4M5JA 5KFYA 3W2VB 1CVJA 1FE0A 3PCOB 3TR5A 4JVYA 4IFDG 1LXNA 3N9UC 4CLUA 3OT9A 2MQPA 5FLXU 2R4FA 4ED2A 4N41A 1WSRA 4RO0A 4FF1A 2XB2D 3H7HB 5ETNA 4DLGA 4C98A 2ANRA 4DV4H 1WI8A 4RW7A 1VQ9S 3B6BA 3GKUA 4KQZA 3DOLA 5KTQA 1T03A 1HBUA 2FUG9 1FTRA 5KFBA 1ZTTA 3R5GA 4K4VA 1J4WA 4ZJLA 1I1GA 3CJTA 1FI4A 3P5TL 2ZD1B 4ID8A 3FCWA 5KG3A 4KB7A 6FD1A 1SC6A 4OCHA 2BE2A 2H48B 3U02A 3MI7X 1S1WB 2JFDA 5D78A 1KVJA 1G4CA 3SSSA 3IR5B 4AL7A 3A8IA 3DLJA 5GAGU 1GQEA 4A8OA 4FN5A 1W2IA 2AV5A 3N0VA 4RUCA 1FJGF 4M5MA 4F25A 5ETQA 4JI7J 1GXUA 4Y3CA 4B3SH 4V1Ak 4UT4A 3CCJS 3MPYA 2IYGA 3SFGA 4CI0B 4ED0A 1UA1A 3J81W 2UU9H 2IM3A 2CNKB 4QR2A 1DTTB 3LAMA 3HSGA 4H8AA 1W26A 1GMWD 2K7JA 4DUYJ 4Q8EA 1ITPA 4PWWA 4DV0H 5DDOC 3HVTB 3VAMA 4C3MA 3KK1A 1Q7YT 2XMWA 3CDUA 2PN6A 3T41A 3U27A 2WVEA 1CG2A 4O0NA 2R9LA 3VAFA 2NPIA 3Q22A 4WKRA 4ZVUB 2KJWA 3BM7A 1NSAA 3C14B 4RL1A 1EKRA 2H5EA 5E41A 1YI2S 1FJGJ 1DTTA 1WHVA 1FXDA 1DLOA 4LREA 1V3RA 2X06A 5DG9A 3KK1B 1VQ4S 4CDIA 4U7CA 3PKYA 3J7A1 5BR8F 3L3CA 1GX6A 2ZH7A 4A8MP 2OEJA 4KSEB 4OHXA 1X4NA 4UOCA 3PX4A 1EETA 3KUEA 5F8LA 1VBIA 5CD4A 3TZZA 1S6QA 1NHUA 5HN0A 4FYVB 3SCJE 4DX5A 1CLFA 3SV3A 4WANA 5F8GA 5DG8A 3NP5A 3T6JA 3G82B 2ZH6A 1HR0J 1VIHA 4QW9A 2Q1LA 5KFPA 3HK2A 4AUKA 4QR0A 2VIHA 4A8FA 4WP3A 1UJ5A 1ZAVA 2CQ1A 2VG7A 2E9TA 3JSBA 2MTLA 3CD5A 4F4AA 1P1TA 2A1SA 2RHQB 2CUYA 1IKYB 3ENAA 2XLKA 4MJKA 4CLKA 4PEOA 2ILYA 1FK9B 5IOLA 4DR5F 1ZZJA 1AT1B 1Y0HA 2Z2MA 2V50A 1KDNA 1K1QA 2G0IA 5J2MB 2IDEA 1BMQB 4E0DA 3M2VB 4QJVA 2JC1A 4P73A 3J7YU 2AYBA 1KLMB 4P10A 2CTLA 4DV1H 5DQGA 1UKUA 2V2VA 3IGVA 2P8IA 3SV4A 3MM8B 3TA1A 3K59A 2YNGB 4ECRA 3R1LA 1MWZA 3KLHB 2HAIA 1AW0A 3GB0A 2BJDA 3ILIA 5D6GA 4QWDA 4CH7A 4DR6H 4R0JA 5ETKA 1HWIA 4JI2J 3JQKA 4X2BA 4WALA 2K1RB 3OL7A 3KYLA 3T5LA 1R8AA 2F9JA 1NH8A 1BWVA 4DX6A 3EGZA 4DPOA 2YBVA 1YGYA 4I0WA 2DNRA 2IA0A 2XSJB 3WC2A 2EBEA 2M8WA 1S7HA 2B4OA 2Y1LB 4WP9A 2EEYA 4DXLA 3VAJA 1TKDA 2I38A 5BJRA 4NXNH 1WE8A 1WTBA 4IG0A 3KHGA 3JSRA 3QGPA 4LRDA 4F4WA 5D0RA 3A3NB 2CADA 2L9DA 3BPSP 4NI2B 5LMUF 1SKSA 4DV7H 1TMJA 1X9MA 1S4EA 3Q8PB 3C16A 3RJMB 2LDYA 4JI3J 4HR2A 2D3OR 2PT0A 1Q4RA 2B9YA 4F3MA 4G1PA 1SC1B 2FVCA 2FB0A 2GIFA 3RBDA 3S8SA 1WNEA 3EUNA 3DOMA 4ZPVR 2NREA 4OYXA 1ZM3A 4PG7A 2RU9A 4ECYA 1LW2B 4RW8A 2LECA 4ZVRB 1FFWB 1T9VA 3OFHA 3UN5A 4EBDA 4ELVA 2OPVA 2WOMA 3AJDA 1XMOH 2XY6A 2O3DA 2VBYA 4WPAA 2WW4A 4BWMA 1J5EJ 1UVNA 3GYNA 1MN7A 1X0PA 2HFVA 3JXOA 1N34J 4N8NA 4KGXB 3D1HA 4J9NA 2E9ZA 3H40A 2ZE2B 1RU2A 4TYAA 2B4VA 4AE5A 4WZMA 1UEVA 1N56A 5FDLB 1HBMB 3IM9A 3IWLA 3EE3A 3KDGA 3HCXA 3RGIA 3VAGA 3KLEA 1FXLA 2B4PA 4IQXA 1O6XA 2FJBB 3DDIA 3L7ZC 5B09A 4HYKA 4RX6A 2FJWA 3W65A 1M1GA 3QIDA 3D4JA 2KXNB 1HQUA 3FK4A 2U1AA 1SJRA 1YIJS 2CRLA 2MDAA 3CJSA 3Q8QB 2P9CA 3BGFA 1QE1A 2UXCF 1X4EA 3RU0A 4DDFA 4C48A 4B9VA 5M2PA 3W64A 3R2CJ 3LGMA 4QIWD 2FVPA 2E7XA 3AT1B 4IH7A 3VAKA 3LGHA 1VQ5S 4OHVA 2GS8A 2VFRA 2VF3A 4X65H 4O3QA 2ROPA 3UDCA 1RT5A 4C8KA 2J5AA 1R89A 1B7YB 1QDUB 2LKZA 3S1TA 2YNFB 1SQGA 3N5FA 2QGFB 2EFVA 2B56A 4CO0A 2RF2B 1X5PA 4JI4H 3EWGA 5B0DA 2ATLA 2OH2A 1XRHA 1GXTA 2R8JA 2YVSA 5KT4A 1JLEB 1X4HA 5KFXA 1DY3A 4ECQA 3IWXA 4TY8A 4JYAF 2ZEJA 2BKOA 4Y2AA 4NWBA 4LF4F 4BDPA 2ZC3A 1O51A 4X4NA 1XIQA 3PO5A 2EK6A 3DRRB 1WDTA 2KU7A 2AQ4A 4MIWA 2F4VF 2W9CB 1PYTA 1RWVB 1X60A 1TR0A 4I2QA 3SSQA 1FDAA 4G1QA 5EX3A 1E6VB 4YS2A 2AJ1A 2R2UA 4LFAH 2RMLA 5K5MA 2V4QA 3I0SA 3W2WB 3UD3P 2RIJA 2VDHA 3HD2A 5IC6B 1TFYA 1T95A 3QBCA 2O66A 4JI8J 1CQNA 3GU0A 1WEXA 1YRUA 1RTZA 2B4UA 1EARA 2DXEA 3MM7A 1VQ6S 2XS2A 4QPTA 2JH3A 4HH0A 5KFJA 4HI2A 4ZVHA 1HNVA 2VPXB 3JAMY 2XC9A 3HLUA 4NL5A 2W8KA 2ADBA 1XK8A 2YQ1A 4MMOA 3BZQA 3X1LB 3HKWA 2YWGA 1HQUB 3N6NA 4ED6A 3EX7B 4WFBQ 1RBLA 2M52A 3GWCA 4OJHA 3V81B 1AA1B 2GA7A 2XCAA 3M4XA 4QYZK 3V6KA 3MR7A 2OPSA 5GAHI 4N76A 1NK7A 4LFBJ 1RLDA 4MKBA 4JV0A 5DDRC 4CT8A 1U49A 3BN7A 1B7FA 4ITSA 3LUYA 5K36G 3MM8A 4YP3A 3GABA 4X84A 3MM6B 4JV5F 4ERDA 3AJ1A 4CLPA 2OPRA 4FVCA 1M0SA 4LFAJ 4DEZA 1N5SA 5SZTA 3KK2A 4TLQA 2RRAA 2VONA 2HRUA 2R2TA 1T94A 3NGRA 1QUPA 1YX2A 1UP1A 4PXDA 4PKDB 1N8RT 2E7WA 4KHPJ 4FXDA 1IBMH 1MU2B 1FWKA 5C2GA 3PW4A 3LWMA 2ZJRQ 4UUWA 1WHWA 2FY8A 3N6MA 1HHQA 1YJUA 1MNEA 2FC9A 2KYXA 1P1LA 3LA0A 5IT0A 1A7GE 2G13A 2K3IA 3OR1B 2LP4A 2DB1A 3CO9A 3QLHA 5KFSA 3OSNA 2WVFA 3G71S 2DRDA 4FF3A 1LWEB 2PEBA 3IGNA 1IM4A 3M8PB 1FKAH 1GK8A 2V4JB 2XULA 1WOPA 4USHA 1IBKJ 2MKYA 3N4WA 3QSIA 1N0VC 2ZJQQ 2FDNA 2NSCA 5D0HA 2DHAA 4OI1A 3T19A 4F50A 4LBIA 3ZO7A 2U2FA 1T7PA 3M30A 4BC7A 2FHOB 2G2ZA 4DSEA 2DH7A 2W9AA 2DGRA 2YKNA 3OV7A 1NRKA 1P8GA 4LVOP 3SYZA 3CCWA 1K1SA 2BJ7A 4CYUB 2V5HG 3OR1A 3QLHB 3T1AA 2M2BA 4KHPF 1HNZH 1IBMJ 1HNWF 1BHNA 4LUBA 2HNZB 1H0HB 4BHQA 2ZDOA 3KMQA 4KO0A 4IFVA 3T6BA 1EJ7L 4MAKA 2LU1A 1NXIA 5LMNF 2AGQA 2AT1B 1NK8A 2FVSA 4P2XA 4ZVEA 2HGMA 5LXYA 2VASA 3UNYA 1HPZA 2E5HA 4NEYA 3VVTA 2JEIA 2OPRB 3KK2B 4DR2H 1N36H 1DBDA 2YQRA 4J9QA 3BKUA 2FY1A 2Q66A 2HFSA 3EZUA 4QOTA 2F4FA 2Z8QA 2VQEJ 5JVGQ 4Z7YA 2J9CA 4Q2LA 3HHDA 3NCRA 4ZLNA 1RWWB 2KH9A 1N34F 2KXHA 2VBZA 2NLWA 2PDAA 4Z7CA 1VC6A 4OHYA 3KDKA 3JSMA 3HO1A 4QWCA 1LW0B 3Q8SB 2XS5A 3FNNA 1RTHA 4JP8A 2HHSA 2IDLA 3NWGA 2C42A 3EXYA 2WSFC 2KZZA 3F0NA 4J9VA 4M95A 2E1CA 1YHQS 3H2UB 3NOCA 4OX8A 3GONA 1NB2A 1S6QB 2DPIA 5JEAG 2LFVA 2LA6A 4NYPA 4P75A 2EWHA 1HKAA 3D6FB 4RNFA 4ZIWA 3QWPA 4H54A 2CVIA 1Y5IB 1Q8IA 2RDIA 1MLAA 2VBWA 4OI4A 4J7CA 1JMTA 2ZNYA 3MD3A 5IT4A 4ICLA 3GV8B 4B3MF 3BV8A 3T1HH 3GJQB 1RHJB 2QSFA 4C2MA 2E7VA 1SIZA 4IDKB 3CXCR 1L3SA 3BQ0A 3C14A 3VAHA 4WIQA 3K57A 4ANEA 1WD6A 4I6WA 1S20A 2LEPA 3IWNC 4PWDB 1HBNA 1RAEB 2RNEA 4G6VB 4LT6A 5ETOA 2CPFA 5KOWA 5DQHA 2UXDF 1ZZFA 1JIHA 3VQTA 3U1NA 2APOA 1L3KA 2IAJA 1Y7PA 1LXJA 2IJFA 2K2PA 1H2TZ 7AT1B 5ETTA 2UXCJ 4JI5J 5F8HA 2G9OA 3BSAA 4NRTA 1IUJA 1NK0A 1AFJA 5BXIA 1NMEB 3L9ZA 2DT9A 2OMLA 1NLKL 2Y8WA 1Y00A 3NCPA 5DQIA 3NKYA 1VQSA 3MMJA 5D3GB 2AEJA 2D3UA 2WK4A 2ZOFA 4QYRA 1OPIA 1RAOA 3OR2B 4PZVA 4RW4B 2DHSA 2Z2LA 3LPEA 3M30B 3TX8A 3UDVA 1FTCA 3PHEA 2R8KA 3B54A 2WVBA 1C1BA 4RUBA 3CNQP 3SQGA 2DNLA 3DNCA 3THTA 2BRLA 3VF0B 1VQ8S 2OTLS 4PXCA 1EZZB 2XEXA 1AN7A 5L1LA 2CPQA 3AQPA 4U96A 3PDNA 3A12A 7FD1A 3HXMA 3DDKA 4JI0H 1NH7A 3P8BB 5D0EA 1T9YA 1LOUA 3TUJC 1J5OA 4NCBA 2XSFA 4LFCH 2DXFA 2PFDA 3PR5B 1AZSA 2AJQA 4OYAA 2UU9J 4W92B 4JI5H 3G8TA 1IKXB 2CQBA 1IM6A 3DC2A 4U6PA 3R27A 1MSWD 2HHWA 5G4DA 1CJVA 4DV0J 3VTIA 4PXEA 3ZZPA 4USUA 4TLRA 4DCOB 2LMIA 1EQMA 4DX7A 3UNGC 1UFLA 4Y28C 5EWEA 3Q0AA 1B3TA 3NNCA 3CD7A 3DMJA 2RH3A 2BW7A 3IBWA 3R2DJ 2PFFB 2VKCA 3G96A 1T8EA 5F8IA 4FXWA 4ZIVA 2B6AB 2PSZA 3WHIA 5AE2A 1C2PA 1SCJB 3CD0A 2QTWA 2VQFF 3DLHA 1U6BA 1J5OB 1W25A 3NRBA 2FYXA 3NLCA 5GVQA 2DBBA 3OXLA 4CO2A 1YJVA 3QIPA 1YRXA 3EDQB 3FBBA 3QRRA 5HATA 3RBXA 1P9YA 1HYSA 4ED1A 1TAUA 1TV6A 1WEYA 3H5UA 4O4GA 2OPSB 4P52A 5LM7E 4ENOA 2Y1RI 1OS5A 1ZPWX 4AYBD 2OEKA 3DGPB 4C11A 2HPUA 2HHUA 2A1BA 3T3FA 3DN9A 3R5AA 2F9DA 2KFZA 2IFXA 4GKKH 2DY9A 2V2KA 3LP0A 1KRPA 3VGSA 1S99A 3MM5B 1BUXA 1WWHA 3MMCA 3QMQA 4GO5X 4LJMA 1UZHA 2BM1A 4KBIA 3MM7B 4EFAC 4DUYF 2D74B 4DL4A 1S1TB 1N88A 4X4PA 4NCGA 3IG1B 4C11B 3HJFA 4NCAA 4DL0C 2KM8C 3H4BA 1PAEX 1TV6B 5E3CA 2QJ3A 3JQJA 1S97A 1LWXA 1OO0B 3KLHA 1REGX 2W8LA 5C25A 2NXEA 3EGWB 3BBCA 4ZITA 3O2IA 4LF9H 3BGLA 2DGQA 3PIOQ 2HSEB 3N5BA 5LT5A 1HBOA 4DQRA 3M2VA 5EGYA 2F8EX 4CM2A 4DUZH 3QAUA 2DGWA 2OJ3A 4WFZA 1C0UB 4GMKA 4B3RJ 1SC4B 1UEKA 3CJ5A 4DV5F 4DCPB 5GADU 2CQGA 4B3TF 2HHHJ 3GFZA 4LIRA 1RT3B 2W2OP 3TAMB 3TWZA 5KT2A 1HMVB 4OLOA 2C3MA 1HFEL 1HR0F 4CIOA 5KT3A 5GAHU 4IOCQ 1NBEB 3RUBL 4K4SA 1U2RA 2Y0SD 5C5JA 4FS2A 3H5YA 3JQMA 2HHHF 1GH8A 2M5YA 2AIRB 4LSLB 4C3LA 1A6LA 3R7BB 3M9MB 2HIQA 2BQUA 1RTDB 2DR5A 3FKBA 3TX0A 4DQSA 2UVWA 1GEHA 2IJRA 4OV1A 5C42B 5HVHA 5L46A 1LV5A 3J7ZT 1QM9A 3NGSA 4KGVB 1TKZA 2IM0A 4IKAA 3SQGB 4ED3A 3OL9A 2DHHA 3NXZA 1KFDA 4FPIA 4YR3A 1S49A 1TL4A 4HEA9 3GV7B 1SL0A 3OPKA 2LTMA 4N56A 1FJCA 2R7TA 1IWAA 4ED4A 4PAAA 2CQHA 1QVFR 2BM0A 1FDDA 2FGCA 2L9WA 1UJ6A 4I67A 4B3RH 4ZVQB 5IV3A 4OI0A 3ZTOA 1SKRA 4UOFA 4ZP7A 3LP2B 3T5JA 2AEMA 3DXSX 1MMLA 4DI6A 3GILA 4K4XA 4MFBB 5KT5A 5KFOA 1HPZB 3FAUA 3TUPA 3SB1A 4DFKA 2B5JA 2I9SA 3VR1A 3AQOA 4NLUA 4DSLA 2Q79A 1T9UA 3W62A 2D9IA 3BJYA 3W63A 1NK5A 4K0KH 4P2MA 1APSA 3RW7A 4U67Q 2COLA 4KO0B 5DRKA 1WI6A 4DHVA 1HNIA 3Q24A 3ZZUA 1J5EF 3T5HA 1RAAB 4JI8F 1TKTA 1NJZA 3G9CA 2HNYB 1IQTA 3ZTRA 2MZTA 1VK3A 2V68A 2ZDPA 3DDNA 5J1EB 1ZETA 1Q8BA 4C0HA 4ECUA 2HGLA 4DR4J 2DGOA 3UD5A 1S9FA 3GTYX 3F73A 1R8HA 4WBFA 1HWLA 4YR0A 2HGNA 3MMBA 1GXLA 1Q8KA 2VQFJ 2ASLA 2WBRA 4DQPA 4JI1F 2CZ4A 2M9KA 2W24A 1NSKL 3H5XA 2W9BA 3GJSB 2XS7A 1QVGR 5DM6Q 1O8BA 1Q79A 2L9NA 2RRNA 1RT6A 2HRTA 1YJNS 3UWTA 4C4WA 2CTFA 2E44A 2KYZA 4RWWA 1SL2A 1YTYA 2W4CA 3T1YF 3D2WA 4GC7A 1NM2A 4NXMJ 5IWAH 1JLBA 1MMDA 3FZ2A 2AP6A 4OZ2A 5E3PA 1MWYA 3FSXA 3AA8A 2UVUA 3G6YA 4M5GA 4AIMA 2HEKA 5J2PB 2J7WA 1XMQJ 5F3TA 1ZA2B 1I94J 4DMZA 2DNPA 2RKIB 1RTJB 2H5IB 2E5IA 2WVDA 3BGRA 4DLEA 1VBXA 4B9UA 1FWLA 5HP1B 1TZ0A 2YNGA 4X4VA 4JI2F 4TU8A 4BS2A 1AXQA 5B08A 2VHGA 2AU0A 1SV5A 2VZ9A 3AHPA 1ZTWA 1R8CA 3HX9A 4PPDA 3TUIC 2CXEA 3SCKE 3ISND 4O3PA 4B02A 1L5UA 2CPMA 2UUCF 1NEEA 2XGPA 4LSNA 1IQZA 2C1EB 2GV1A 2WRMA 1KWMA 3I0RA 2W01A 2GGPB 4LR9A 5A2QU 3LGNA 5HP1A 2ZVSA 2XCPA 4USIA 3M8QB 4EO8A 4OYIA 2OPPB 2VA3A 2RKIA 4DS4A 2OD6A 4FYYB 4A47A 3BYPA 1Y5LB 2DNGA 3PJXA 4DUTA 4CH1A 3PW0A 2BKPA 1KSPA 5DM7Q 1WELA 3OXFA 4JV1A 1UVKA 1AUSL 1W7WA 2HVDA 4HT7A 5F8MA 1RWNB 4X64F 4B9SA 4F2SA 3D3BJ 2NZCA 3PNIA 1PG5B 1RHRB 3CJKB 4A8WA 2I8EA 2JLFA 2YWKA 2YY3A 3TA2A 2OSRA 2V4RA 4FNHA 1N4LA 3GP9A 2QEXS 3ZXWA 1U2CA 2MKSA 4NLSA 2OKQA 1M90T 4YHHH 1QY7A 3TZWA 2F5GA 1ROFA 2OPQA 4ZJQA 4LFBH 2ATCB 1WHXA 4OYBA 2RQCA 1M5KC 2VKZG 5DLFA 2WB4A 2GAHC 4QCLA 4JOUA 5L1JA 5L1IA 2OTJS 1ZA1B 1UFKA 1HLWA 3FFIA 4MYUA 4U95A 3K5MA 1VRUA 2EFNA 4JI1H 4OX9F 3W9JA 2N3OA 4DR4F 4M1KA 1MU2A 3VCDA 1L3VA 2GX8A 4MFBA 1R0BG 1JLEA 4I56A 3FUYA 5GAEU 4PDBA 1RT4A 1OJ4A 5A8KB 4ED7A 2RDDA 2WONA 1S77D 3POTA 4DG1A 2H5JB 3HVTA 3PYFA 3NCVA 3V4IA 2B9XA 1H2VZ 1UZDA 3ETOA 5HLFA 1RISA 4PQUB 4CNYA 4I7FB 4V19X 2DO4A 4LR8A 1JLQB 1TQLA 4MTPA 2ZH5A 3SIPB 3CCUS 4DSFA 2CTKA 2WB1D 4WFXA 2DEIA 5E7OB 5RUBA 5T14A 3KLGB 2HHTA 2KFNA 2QNDA 2JEFA 1FERA 2DXDA 4MIBA 4FKYA 5CH7B 2QRRA 1YKWA 5IFMA 3GIRA 2WZ1A 4AQYJ 1IR2A 2R2SA 1RACB 3W3SA 5LOQA 2MSTA 3W8PA 4EEYA 1RHMB 4DPUA 2Z56B 4ES3A 2Z58B 1X4DA 4F0MA 4CLLA 2LYVA 3JYTA 4F2RA 4JI7F 1NDCA 5A0YA 2RQMA 2NYIA 4IR1A 3Q8UA 1BQNB 3IN5A 1GT8A
chains in the Genus database with same CATH topology
1HMVA 4L72B 1M5SA 3MFHA 1FVQA 2FLPA 5CQGA 1HNXH 4RW7B 1ZYQA 3UCGA 2JJ4D 1HI0P 1X7VA 2JWNA 3DM2A 3MEDA 4CO3A 4ZK7M 2HHVA 1R43A 2BDPA 1OWXA 2ASYA 3DRRA 3IC1A 5BYRA 4AUKA 1X5TA 3IAS9 3ZFVA 5GMKa 1HI1A 5LJ3Y 2SXLA 3TNVA 3MCSA 1S0NA 1L3TA 4DFMA 5F41A 4O23A 1H7WA 2QO3A 4TY8B 3W7BA 1ZOTA 1H6KX 2L08A 1Z1ZA 1QUVA 5ITHA 2MQLA 2J9DA 4TQSA 3RB6A 2UUBF 1VQMS 4DOZA 4F02A 1RT5B 3MFIA 4ZPWR 1HNXF 4M5DA 3V6DA 2IVYA 2QLXA 3IRXA 1R7IA 3MEKA 2ZH3A 3O1LA 1ELOA 5KOXA 4WXWA 2R7SA 1FNMA 2MGZB 2KM8B 5KG0A 3HPOA 4WKYA 3RTVA 1QE1B 5AE1A 3M32B 2UUWA 4F4KA 4DV2H 4Y2MA 4RUHA 1X9SA 1Q78A 1Q8LA 1RA6A 2A2CA 3I96A 4O44B 4O4GB 4CCHA 5E33A 1XR7A 3OQ2A 2KHDA 3OLAA 1DAXA 3WX4A 1X0FA 1TK0A 5ADZA 5GADI 1LWFA 4DUYH 1G6BA 1PC4A 2KN4A 5D77A 2AW0A 1IBKH 2FHKA 2N3LA 4A46A 4RBUA 4IRKA 4KPYA 3OTOF 2AYGA 1CSJA 3I31A 1S6OA 2YNIB 4C9DA 2ROEA 1KLMA 4KE5A 2XWXA 4ZHRB 3DLGA 3GSDA 1IKXA 3DMJB 3SXLA 4F67A 3TAQA 2VV5A 3TA0A 1M5OC 3GFXA 3PACA 1VBYA 5HI7A 1DTQA 5KFMA 1NJWA 3R1HA 4DL3A 2B0GA 4QBUA 3OHBA 1DRZA 1ZAXA 4IH6A 4DF8A 5E3AA 4J37A 1YWXA 2IJNA 1VC0A 1BQNA 3FQKA 3IAM9 3NAIA 4C0BA 4C3KA 1UMJA 3V6JA 4OMFG 1SUQA 4A8YA 3LWLA 5HO4A 3OTBA 3CCQS 1TP7A 1WEZA 2UZAA 2CPHA 1NO8A 2CVEA 3DYAA 3NBPB 4IH5A 1SJQA 2IVMA 2BOPA 2ZM6F 3DRXA 2AYMA 3QGIA 3QD7X 4F26A 5LSRA 3F41A 3KLFA 4JI5F 1K0VA 1YITS 4BCAA 4LFCF 4LQ3A 3EPIA 2WHOA 2GC8A 4NLQA 3KJVB 3I4PA 2V8DA 3MEEB 2JDJA 1WF0A 3GZ7A 3H8YA 3UCZP 4H4MA 1XR6A 1YBAA 4WE1B 1PO6A 2MHEA 1RT4B 4H4KC 2RSQA 1HBNB 4NXMF 2KFYA 3DRPA 2OD4A 2WAQD 1VLYA 2IAJB 2XG8A 2GJ2A 2FHJD 4KIAA 4Y0FA 4ICLB 5H9FJ 4C7QA 4Q45A 3OTCA 3GQCA 2MB0B 2ERRA 4FF2A 2ZBIA 1YVFA 1KQKA 2OPQB 4PG6A 3UW1A 2CQ0A 2O01C 3GFHA 3SDEB 5KFIA 1U1MA 4IUFA 1BLUA 1X5SA 4JI2H 3VQSA 2V94A 3OFEA 2R8GA 3FMWA 1S9EB 2UXDH 2PA8D 2XWYA 4Y2IA 4IG3B 2Z0GA 1TVRB 2F8HA 3IO1A 4WJBA 1JLGB 3E01B 4ZCIA 4ZA1A 5H9EJ 4FF4A 3N6LA 5F9NA 4DN9A 5KFQA 5IWAF 3T1HF 1MROA 1KS2A 3QAEA 3T1YH 3E01A 5JJBA 2D41A 4I2PB 1HW9A 4UW2A 2NPFA 4R8UA 4IG3A 3NNHA 3JSMB 3GYXB 5IZHA 4F4YA 5KFRA 1XN9A 3DU5A 4Y34A 3J7Z5 1QTMA 4EC5A 2CQ4A 3HI9A 3AA9A 3SZ2A 5LL6b 3Q23A 1QSSA 3PEHA 5LSLA 3CMES 2OFGX 3UE2A 1HQEB 2ASJA 4C8OA 1WACA 3KFWX 3MD1A 3W2VA 1DLOB 1V3SA 1BQXA 4JI8H 2A18A 3HVAA 1FEEA 5SUHA 3CCTA 1I6UA 1FHTA 1VJWA 4I4BA 3M6WA 4U9RA 3UR3C 3RZAA 1JKHA 1F5AA 1UAWA 4K0KF 3D1OA 4PPZA 4MKAA 1KQGB 4LF6H 2DGXA 1JLBB 3H5SA 2N82B 4RUAA 5KFCA 3KJVA 4DN0A 4DR2F 1G7CB 3FCHA 1RAJA 2ZJPQ 5B0AA 1FVSA 3HHKA 2PA3A 3TO8A 3M8RA 1UVMA 1E6YB 4CQ1A 4B3RF 1CQMA 2YKMB 3CGIA 4OI6A 2RILA 4K4WA 2X1FA 3KLFB 2P5VA 3RRKA 3DHWC 2YNHA 1CEZA 1M5VC 3K7RA 3MMBB 2W7PA 3DYAB 2FTRA 5IXUA 3OHAA 1K8AT 2YNHB 3AH6A 3PFEA 1Q81T 1HNWH 3OBIA 2PIIA 4GC6A 2B3TB 4WZQA 2CPDA 1NKBA 4KHPH 4ZCMA 4O0IA 3RR7A 2EFGA 1BGXT 1QAIA 4DL2A 1LWEA 3PX0A 1JJ2R 2R7WA 4FBUA 1VQYA 2B7CB 3BS9A 3LQVA 5T7LB 2R7QA 3QWUA 3CCRS 4NYZA 1FCAA 2IVFB 4E8UA 2I5JB 1FKOA 2ZOGA 4ZP9A 1IR0A 4K4YA 1KC8T 1IBLF 1FEHA 3CT9A 5DLGA 4DV5H 3PKMA 2KHCA 1JXLA 2M8DB 1DURA 1T3NA 1I6JA 2MY7A 1JLAA 2DNMA 4QIGA 1FD8A 5M2RA 3THPA 2AGPA 3EYZA 2VC0A 2J0SD 2ZH4A 3BO2A 4PXBA 5FLXY 2XO7A 2CFXA 2D9OA 5IQ6A 2POKA 1SXLA 1VMBA 2J7UA 4R8UB 5D4OA 4ZPTR 2RRBA 1S1VB 2BQ3A 1ZM9A 2D1CA 2FJDB 2VB6A 2EG1A 2MZQ