2FPHX

Cell division protein ylmh from streptococcus pneumoniae
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
165
Chain Sequence
GIYQHFSIEDRPFLDKGMEWIKKVEDSYAPFLTPFINPHQEKLLKILAKTYGLACSSSGEFVSSEYVRVLLYPDYFQPEFSDFEISLQEIVYSNKFEYLTHAKILGTVINQLGIERKLFGDILVDEERAQIMINQQFLLLFQDGLKKIGRIPVSLEERPFTEKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cell division protein ylmH from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Dna binding protein
molecule keywords ylmH
total genus 44
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2006-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fphX02
3.30.1370.160 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2fphX01
2OTJS 1R8HA 2CQGA 4LJMA 3Q2TC 3JB9k 1WI8A 2L9WA 2DNNA 3B4DA 5EN1A 5GAEU 1BY9A 1WF0A 2DNPA 2OSQA 2LYVA 2KXHA 2MKSA 2MZJA 4UQTA 1U1NA 5CYJA 1M90T 2F9JA 1VQOS 3P49B 3EGZA 1X5SA 3DXBA 3G8SA 2O3DA 3BEGB 2BOPA 4C7QA 2UP1A 2L08A 2LA4A 1U1OA 2MYFA 2Q79A 2B0GA 2RT3A 1L3KA 5LJ5Y 3TYTA 2KRBA 3J7YU 1VBZA 2CPZA 2GHPA 1N8RT 4WCEQ 2M7SA 2KU7A 1K73T 2DIVA 2DNHA 1WEZA 2KXFA 4WKRA 3MD3A 2CQ1A 2XNRA 3VAGA 2DH9A 2DGSA 1M1KT 1JJ4A 1DZ5A 1WELA 2MSTA 3CC2S 1YITS 1HD1A 2JX2A 1UW4A 4TU7A 5DDOC 1FO1A 4QPTA 5LXRA 1G2EA 3V4MA 2FY1A 2M0GB 3G4SS 3CCRS 4P6QA 2X1BA 4C0OC 3SDEA 1RKJA 3H2UB 1VQ7S 3CMAS 3UCUP 1WEXA 3VAKA 2AYMA 2DH8A 3VF0B 1X4GA 1OWXA 1FHTA 2OIHA 2CPHA 2DB1A 4IO9Q 2HGLA 1YWXA 5HO4A 2CPJA 1HL6A 2MPUA 2DGUA 2OJ3A 2HYIB 1H2TZ 2J8AA 3BO3A 2DNYA 1CVJA 4CQ1A 5BJRA 3B4MA 2LXIA 1QM9A 1X4BA 1X5TA 4QU6A 2HVZA 2DHAA 5GVQA 3SXLA 3Q2SC 2DGQA 2DO0A 5GAHU 2LEBA 1URNA 1X0FA 2FC8A 1Q7YT 4YUDA 2JVRA 3LQVA 3CMES 3ULHA 3SMZA 2HGNA 4QU7A 2CPYA 1SJ3P 1UFWA 4WFAQ 1PO6A 1NU4A 3CC4S 5LSLA 2ERRA 2MZRA 2DNMA 4WIIA 3K0JA 4TU8A 2M8DB 1QVGR 3R1LA 1OIAA 2CQDA 2CQIA 2FHOB 4OZ1A 1D8ZA 3MURP 2RQCA 1YJ9S 3NNHA 5IQQA 1S72S 2KG1A 3LPYA 1KOOA 2RUGA 2CQHA 4PKDB 2CQ0A 4PR6A 1VC5A 4EGLA 1WTBA 1WG5A 1VC0A 2AD9A 2CPFA 3NMRA 1U6FA 1U1MA 2KVIA 2KH9A 5GAGU 3S01A 2N7CA 2MHNA 2AYGA 1X4FA 1WHXA 4CIOA 2J76E 1M5PC 2KYXA 4F25A 3FEYB 3S8SA 3VALA 4TU9A 5CXTA 1X4CA 3CD6S 2DITA 5DM7Q 3HHNB 1U2FA 2YTCA 3G71S 1K9MT 1PGZA 2MZTA 2N3OA 1R8PA 1U1PA 2LEAA 4BS2A 2KHCA 2RU3A 1DHMA 2NLWA 1M5VC 2YWKA 1VQKS 3UD3P 2DGVA 3FEXB 2EK6A 2GO9A 3PIPQ 2MKKA 2MQNA 3MDFA 4W92B 1K8AT 3CCMS 1H2VZ 1QVFR 2J0QD 3MXHP 3RW7A 1XN9A 2XNQA 3PIOQ 4Y00A 2DIUA 1UAWA 3RW6A 2QA4S 3P3DA 2KM8B 2DHGA 1VBYA 2DNKA 1U1KA 2KM8C 2KRRA 4A8XA 3UCGA 2DH7A 3BO2A 2E5HA 4U67Q 4RU2A 2I38A 3N9UC 2CPEA 5JVHQ 4ERDA 1JMTA 1X4EA 1W2BR 5LXYA 3ZZYA 1Q81T 2X1GA 2OSRA 1DRZA 2N3LA 4WFNQ 1VQ6S 2MSSA 4C4WA 2G1DA 3S6EA 3CCUS 1VC6A 3CCSS 2MMYA 2ZJQQ 2KFYA 2MKIA 4IOCQ 1SXLA 2XS5A 2SXLA 2F9DA 1UP1A 3MUTP 3MD1A 3U1LA 4FXWA 1WG4A 2ADCA 4FXVA 2DK2A 5ITHA 1WG1A 2RS8A 5LJ3Y 1X4DA 1HD0A 3NNAA 1YIJS 4PRFA 3G6ES 2MJNA 1U6BA 5H1SV 2LECA 1SJRA 1VQ9S 5D78A 1VQMS 2CQBA 2FPHX 2LCWA 3P5TL 1YJNS 2DNOA 1VQ8S 2J0SD 4LIRA 1D9AA 1X5OA 2DNZA 3ZZZA 5DETA 1YI2S 2M70A 1VQ5S 4F02A 3NS6A 3CCJS 1O0PA 3CPWR 3VAFA 2DGTA 3BO4A 2AYBA 3VAHA 3I56S 1YJWS 1U1LA 4V19X 2DNGA 1A9NB 2BZ2A 1YTYA 3G96A 2LMIA 1WHVA 3L3CA 2ADBA 2RRAA 3VAIA 2M8HA 5GADU 2CQ3A 1U1QA 1IQTA 1X4HA 3HI9A 2G0CA 2LA6A 2K3KA 2CQ2A 3THTA 1KD1T 3MOJB 2U2FA 5CA5A 2A3JA 2DISA 3UWTA 4Z2XA 2RVJA 2MKJA 2MQLA 3P6YC 1KQSR 2M4MA 1FT8A 3US5A 1OPIA 2MZQA 1M5OC 1WF2A 2MKHA 2ZJRQ 2XB2D 1H6KX 2D9OA 1FJCA 5MLCV 2M52A 1RK8A 3R1HA 5FJ4A 3EGNA 4IOAQ 3UD4P 2E5IA 2YKAA 1M5KC 3BS9A 2N82B 4CH1A 2VODA 1SJ4P 4W90B 1X4AA 3SDEB 1WHWA 1YHQS 2QEXS 2MQPA 1FJ7A 1H2UX 3G9CA 2MKCA 3H2VE 3UCZP 5IM0B 4J5OA 1N52B 5D77A 2V94A 2RQ4A 3I55S 2CPDA 2LKZA 4ED5A 2CPIA 2YH1A 1VQNS 1HA1A 2MGZA 3CF5Q 2L41A 3CULA 2XS2A 2M9KA 2D9PA 3MUVP 2AYEA 2DNLA 1AUDA 1FJEB 2KG0A 4IUFA 1U1RA 2CJKA 1N88A 2PE8A 2MZSA 1Q86T 2OTLS 2X1FA 2LXUA 2K8GA 1B7FA 1NJIT 1DBDA 3CCLS 2E5JA 2JVOA 4LMZA 2DHSA 2CQCA 3IWNC 2NZ4A 4M5DB 3CCES 1S79A 2KI2A 2E44A 2DGXA 2JRSA 3R27A 2MQOA 2VOPA 2CQ4A 2MQMA 2KXNB 2E5GA 1JJHA 2XS7A 1VQLS 1Q82T 2U1AA 3OW2R 1WEYA 3CC7S 5DDRC 3MI7X 2DNQA 1SJFA 4YB1P 1ZZFA 2XSFA 3NS5A 3CUNA 3G8TA 2CQPA 4CH0S 2VONA 4YOEA 1WI6A 2HZCA 2MZ1A 1N54B 5DDQC 2QFJA 4UY8T 2VOOA 2DO4A 1FXLA 1X5PA 2CPXA 2MY7A 3D2WA 3NNCA 3EX7B 2FC9A 2WBRA 1A7GE 4OZ0A 3CXCR 2G4BA 2MXYA 3VAMA 2DGOA 2MGZB 2MJUA 2MY8A 5HL7Q 4F26A 5IFMA 4Y0FA 2MQQA 1WHYA 1WWHA 1F9FA 2DHXA 3TP2A 2EVZA 1NO8A 1VQ4S 2KT5A 1KC8T 2DGWA 2HGMA 2F3JA 1WF1A 2PEHA 2JWNA 3TO8A 5DDPC 1P27B 1P1TA 2DNRA 3VAJA 2YH0A 4QQBA 1VBXA 2MB0B 3U1MA 1KOHA 1OO0B 4WF9Q 2M88A 5JVGQ 2X1AA 1ZH5A 2RS2A 4WFBQ 3UE2A 2RNEA 2KN4A 2RRBA 1FNXH 2D3OR 3MUMP 3IRWP 4ZKAA 3J7ZT 1JJ2R 2I2YA 3DLLQ 5DM6Q 2LQ5A 3CTRA 3CCQS 1SJQA 2EK1A 5LSOA 2ZJPQ 5IM0A 2M2BA 3S7RA 4TLQA 3CCVS 1VQPS 1ZZNA 3THPA 5GMKa
chains in the Genus database with same CATH superfamily
1HKAA 1SQEA 3KDNA 4MK8A 3H40A 1KVJA 5FIIA 4RBTA 3OTEA 3LUYA 3PYFA 1RJJA 2CQGA 2HW3A 2AEMA 4OJ3A 5HATA 4HH1A 4LFBH 4OLPA 4MK9A 3HP6A 2RRNA 3MM5A 4DFMA 2Q43A 2OELA 2DNPA 3KG0A 1JXEA 3BN7A 3F41A 4NCGA 2K7JA 3AD8C 1DQ8A 2HFOA 4DN9A 4G1QB 4RUAA 2V2QA 2KXHA 4NZ0A 3DMJB 3I0SB 1NHUA 1WC0A 2CXEA 4ZP9A 1U0HA 4DUZJ 3EVOA 1U1NA 1R0AB 1VRUA 2EFNA 2MEWA 3M8QB 1VQOS 3P49B 3JTOA 3EGZA 4GKJJ 4DR2H 5B08A 1XR6A 2FJDB 3EJMA 3ZXWA 1U2RA 1X5SA 2AEFA 2Q66A 3BEGB 1GTEA 1AA1B 5K8OA 3OR2A 4B3SH 4ZCMA 1SQFA 1QUPA 4AXIA 4D3GA 5CD4A 2F4FA 2IY5B 4X4VA 2YQ1A 3Q8VA 4WTYA 8RUCA 4LQ3A 4OX9F 4LF6J 1MMNA 2N4CA 3OFFA 1RE1B 4WYLA 3LA0A 5G4DA 5KFFA 4DV2H 2V8PA 5AXNA 3OL6A 2ZH2A 2MHEA 2ZVSA 2GV1A 2Q3PA 4GO7X 1XC9A 2BUNA 3GCWP 3Q24A 4JOUA 3QT5A 1C0TB 2CPZA 2GHPA 3D4JA 3MEKA 4Y3CA 1XMQH 3HHDA 2QA1A 2C22A 4LF4H 2KU7A 3MM9B 1Y5IB 2OUGA 3BGRA 2BJ1A 4B9VA 4AL5A 4P75A 2DNHA 3QFHA 1D8YA 2KXFA 3JYTB 4EEYA 4DG1B 4C11A 4F2RA 2E5LH 1QLNA 2HWTA 4RO0A 5KTQA 1L3SA 4U7CA 3CSKA 3C46A 3BBBA 5A8RB 1M1GA 3K5LA 3FJ2A 1WELA 4Z7YA 2P8IA 1HD1A 1U47A 2Z58B 5A2QY 4H4KA 3ZZPA 4XK8C 1I51B 2YWGA 3BYPA 2ZC4A 5K14A 4ECRA 4M63A 5I3UA 2D3O1 4B3RJ 1TVRA 1OPZA 2QLWA 1HQUB 2WB4A 3BGUA 4LBHA 2AGQA 1FKAF 1D09B 2OP5A 2OD6A 4YEAA 1G2EA 3V4MA 2IYGA 1NZAA 3D7SB 4PEOA 4ZVFA 1WTFA 5KG7A 2GJIA 4YR2A 1SC3B 4CLUA 4JBCA 1FVSA 2BRLA 4MKYA 3SDEA 4NZRM 1N36J 1AXQA 3QRPA 3KK1A 4OV6A 1RI7A 3IMQJ 2F63A 4ZPVR 3JTNA 2ALYB 4NOHA 1JNZB 3R6GB 2XMAA 2KT3A 1X7VA 1V6HA 3NKYA 2ZE2B 5KG3A 3MTKA 1M1HA 1RWKB 2HHPA 1WEXA 1ZAWA 2XYHB 3KJQB 2DH8A 4R8UB 4EC5A 2R8KA 1EKRA 2W9BB 3F56A 1JKHB 1W7WA 4K7QA 2UXDJ 3ENAA 1T3OA 2AX1A 3I5AA 3VF0B 1RYSA 3J81W 1XIQA 1OWXA 1RTDB 2Y1RI 5HMZA 1TL5A 1YJVA 2YVSA 4B08A 2LRRA 1VI7A 2HGLA 2LVWA 5KFXA 5KG2A 3K5NA 4OYMA 2ZVIA 5HO4A 4RNNA 2XSJB 2W4CA 2DNYA 2XYGB 3KNGA 4AM3A 2FIUA 2LXIA 3G86A 3U1NA 1RGVA 3KDOA 3VR1A 4F7VA 1C0UA 3I5BA 4F2SA 3BDEA 4ZLJA 2DHAA 4OYAA 4CZCA 4B3TJ 3MMJA 5T14A 4ZA1A 3J80W 2HSEB 3QAUA 3EWGA 2FC8A 5M2RA 4AXJA 1NB2A 3EDQB 5HBMA 2KYZA 2WSFC 3GIIA 4NLXA 2BW7A 5CH7B 1N5YA 5KT4A 2V4JB 2IAJA 3SMZA 2K3IA 3H98A 2KFZA 3N0VA 2YNHA 2OPQA 3IAS9 4DR3F 1OY8A 2Z30B 1NU4A 4UF4A 4WP3A 2BJEA 4FP9A 5AE3A 3CO0P 3GR1A 2EBGA 4XDDA 1KS2A 2QJ3A 4TU8A 4HT5A 3ZNJ1 4DV7J 3PO5A 1PIEA 4N7TA 3R7SB 2FY8A 2IDLA 3MPDA 5E2QA 1YQHA 2FZCB 3D6TB 3MEEB 3H42A 2DCLA 4H54A 1RHMB 1SV5A 4RW8B 3J7AN 4K0KF 2BQ3A 3NMAA 1T0TV 3D9BA 4FVMA 1VLYA 4D3HA 3PW7A 3FRZA 4KTQA 1CJTB 2RUGA 1K1GA 3FCHA 5CYQB 2NREA 1DFDA 1MWYA 4NLQA 1Z2IA 9RUBA 2FJWA 1KKHA 4EGLA 2VKZG 2HFVA 4PYDA 3W9JA 5MAOA 3M8WA 2HH3A 1S7IA 1UCNA 4X66F 2CWFA 3ZTQA 1MWZA 2AD9A 4YN3B 3MEDB 1FJGF 5DG8A 3LP2A 2KVIA 3QNWB 5KFGA 1TV6A 2J8SA 2KH9A 2GIFA 2MHNA 1RISA 2XZTB 3HFZB 2AYGA 3I0SA 5EX0A 1R0AA 3HK2A 4B8CD 3BBFA 3TA2A 1N0VC 4CIOA 2O01C 3H4DA 2R7SA 4PQUA 2RDDA 4OHZA 4LFBJ 1RHKB 1Q5YA 3EVMA 3N6NA 1QSYA 4PUOB 2B5JA 2HFNA 3P96A 4PXBA 5HVHA 3TANA 1KN6A 2HFUA 1XR7A 2C2ZB 1U0HB 3VALA 4Q5VA 2Z2ZA 5HK4A 4TU9A 5CXTA 3O1LA 4CLSA 3BSOA 4LF8J 4X65J 1HI0P 3T1HJ 2DITA 5DM7Q 1TTHB 1IWGA 3M6UA 4ZCLA 1QAJA 4CO0A 2UUWA 2WZ1A 4DCOB 2E9RX 1IKYB 1S9EB 4J9VA 3M30A 1BLUA 3G71S 1XNRJ 1PGZA 2N3OA 3NRBA 4G1PA 2LEAA 2UU9J 1U49A 3CJQA 5KFIA 3Q8QB 4LF1A 3FCWA 1S77D 3C19A 3OTBA 2UXBF 4KGKA 2P6SA 1AZSB 4TY8B 4WTOB 1XEZA 3GYNA 3P45B 4L3KA 2BE2B 3G82A 1XMBA 1IUJA 3MDFA 3TVKA 2MKKA 4QWEA 3B8HA 2VQFF 4B3MF 4GO5X 4S0MA 5JJBA 2V8HA 2VHGA 4BA1I 2OPSA 3ET6A 4MT1A 4WXWA 4ANDA 5H9EJ 3SSSA 2J0QD 2OEMA 3MXHP 2DTJA 5J1PA 2R7VA 1HW8A 1URRA 2KHDA 1VFJA 4C6AA 3PIOQ 3V69A 2ZM6H 3CJ4A 2FJVA 4Y00A 4A8MP 2YKMA 3O8WA 1K47A 1V5IB 5THWA 5DT9A 2O1PA 4JI0J 3SCJE 1GTHA 4B9TA 2UZAA 2CJQA 4C8YA 3AFGA 1CPZA 3GB0A 4LR9A 2HNYB 2DNKA 3JAMY 2DXEA 5D3GB 4OI4A 4NPOA 2KRRA 3EXCX 3R2CJ 3PCOB 4DV0H 4JYAF 3SCKE 5JEAG 2XY7A 2YX1A 3C66A 2XHCA 4BWMA 3BO2A 3N9UC 4NXNH 2XTJP 3OTOJ 1IBMJ 1X4EA 2E7WA 2OEJA 1KLMA 3IA0A 4M95A 3DOLA 2FJEB 2EPIA 5E41A 2LTMA 1OQ3A 1X0AA 2VQEF 1IM6A 4GRSA 3VV2B 4DR2J 4K4WA 1YSJA 4USKA 2V2ZA 1H38A 4KKOA 1AN7A 4WFNQ 2FJXA 1VQ6S 3PW5A 2RILA 1PCAA 4DFPA 1VC6A 2MMYA 4LSNA 4V1Ak 3TNVA 3OFHA 1NK5A 4K4UA 4K0KH 2YQ3A 1TELA 3N79A 1N36H 3BV8A 3CIMA 4QWAA 3KLGB 2XS5A 1C1BB 2RMLA 2SXLA 2ZH4A 3LF0A 2F9DA 4FNHA 2CG4A 1UP1A 4WK1A 3K58A 1HNWJ 2HHHF 4OZLA 3T9NA 4LRDA 1YJRA 4C48A 4OI3A 1QAYA 2OPPB 2ZHOA 4DL0C 5KT2A 4AIMA 3U1LA 1LW2B 2IMOA 2VDHA 4O3QA 4FXVA 1X60A 1DJ0A 4JI0H 4QIGA 1ZM4A 2ILZA 3IGVA 2D1CA 1RT3B 1JLGA 1HBUB 2RS8A 5C25B 4IQXA 1KHMA 5K36G 1R0CB 3SCIE 1RT7B 3AJ1A 3OVAA 5SUHA 3MFHA 4K4SA 2I8EA 1F60B 1U6BA 2C42A 2IFXA 4P74A 4RUCA 2UUAH 5H1SV 5C42A 2CJAA 1VQ9S 4Q0BA 3M8PA 3LAMA 2DRBA 3RF2A 2CYYA 2EWHA 3EVWA 3VVTA 2HHVA 3D0GE 3GKUA 3MAAA 3AD9C 1E6VA 1YJNS 2HK2A 4CLZA 2ZKUA 4MAKA 1VQ8S 3D3CJ 3R7NB 1X9ZA 3GABA 2ASYA 1Q7LB 1SL0A 2AJ4A 3T9ZA 5B0GA 3O3LA 4F02A 1P9QC 4L73A 3QRQA 4TYAA 1K44A 4DV5F 3M8ZA 4PQAA 5K8MA 3TUJC 1UETA 1KHWA 2WVEA 1SKWA 2BVZA 4O4RA 3BDPA 4X65H 2VF3A 3NLCA 1YJWS 1U1LA 4DI6A 3FFIA 3NEKA 4ELTA 4V19X 3KJNB 2J9EA 3ZZOA 3PW0A 4DR4J 4DL6A 2GW8A 2LMIA 2QFIA 3FBFA 1N32J 2ADBA 2R2RA 3VAIA 5D0GA 1FX4A 2FVCA 3A13A 4MH8A 2KKHA 4J9NA 2M8HA 1D3WA 2XI2A 2FLLA 3W62A 4ZMMA 2CQ3A 3BPSP 3J7A1 5J1EA 1HNWH 2C2NA 4DX6A 1DLOA 2YBVA 3HI9A 2YNFA 4F50A 4PWDB 1S6PB 2FYXA 1R3NA 4NYOA 1HWUA 2K3KA 4CM0A 3W5YA 4DPTA 2WSEC 2W2PP 1KD1T 4UOGA 2A3JA 3OFEA 1ROFA 5LL6b 2LQBA 2FD2A 4LT6A 2JJ4D 2MKJA 3WC2A 1S0NA 1N34F 1TUAA 4OV1A 2R2SA 1YDLA 3GPAA 3BPDA 4UQGA 1RAIB 3US5A 3HSGA 1OPIA 2HRUA 2W7PA 1NK9A 1M5OC 1UVLA 3M30B 3DLBA 4M5KA 2GQQA 3MR6A 1FJCA 3IS9B 1IM4A 3UFCX 1WKJA 1GX6A 3C14A 3QZ8A 3GCXP 2YKAA 2JFDA 4CH1A 2HNZB 2VODA 4W90B 1OJ4A 3D28A 3SDEB 4QR2A 1YHQS 4JV1A 2HQGA 1JLBB 2HLTA 2LXFA 3CIZA 4HHUA 4HDHA 2CNKB 1WD6A 3HDSA 4DSJA 1S20A 5KFAA 1H2UX 3F0NA 3LGHA 4ZJOA 3GIRA 3G9CA 2ACMA 2R9LA 2UV8G 2FTRA 3MCSA 2WOMB 5B09A 1TP7A 4OI1A 5D77A 4IR1A 1HBMA 2ZDOA 3K8VA 4YS2A 2BQRA 3RYLA 4O23A 3T3FA 3V5RA 1EKSA 2GZOA 3LP0B 4IG3B 2YH1A 1SJ1A 1NUEA 3KLHB 5D8HB 2QE5A 1R43A 2X3DA 1ODHA 1YBUA 4GVBA 2XS2A 3DRRA 1JLFB 2QSFA 3DLEB 4F36A 3M7VA 3OTOF 1RB0A 1RT5A 3MUVP 1IBMF 5BYRA 2PI4A 4A8SA 4M94A 4CT9A 1FJEB 3MPUB 3I31A 3ENVA 4LREA 2KG0A 2WAQD 3GG0A 5ETPA 3CB4A 4LF7H 2R8IA 2UXDH 2HMIA 4A46A 2MZSA 2ZH6A 1UVNA 2ZQEA 3A8EA 4ZHRA 5C5JA 2HAFA 2X3GA 2V68A 4OX8A 4C8KA 4NEYA 1B7FA 3QGIA 1WC3A 2P2CB 5KFBA 3MR3A 2ZHBA 4EBEA 1TK8A 2B8QA 3DLJA 5B0CA 3VZHA 3RB3A 1N0UA 1XNQF 4NX9A 3QGGA 4DCJB 3OUYA 3OVSA 2IJFA 2YKNB 2EKYA 5IT4A 2J6SA 4KFBA 5KFWA 5KG6A 1YBTA 4KR0B 1VOMA 2JLEA 2E44A 4LSNB 4QIEA 3CMQA 3LAKA 5KFPA 3H25A 4DQSA 4NXNJ 3D1HA 1GMVA 2HEKA 1S1VB 3DKDA 1OS5A 3H5YA 2JZXA 5HBMB 2FGCA 1IBKJ 3O44A 1VIGA 1WOPA 1PJ6A 4GMKA 3UN3A 5IS2A 5DDRC 3CC7S 2DNQA 3DHWC 1SJFA 3RBXA 3RR7A 3D54A 2WHOA 3KMQA 1RWXB 3A3NB 2NXJA 4DU7A 1QE1A 2BX6A 4DFKA 2JEFA 3G8TA 1QAIA 3OL9A 1N33J 3DLKA 1U26A 5HQMA 1OQ6A 1QAXA 2WBMA 3FKBA 3NBPA 4LRBA 4OMFG 5IV3A 4N8NA 3W1YC 4O3SA 2B9YA 4O44B 5B0AA 4ZN3A 4X65F 1WI6A 3RG6A 1BQXA 4DOZA 4C0BA 1N54B 3A3PB 3B54A 5DDQC 4DR6F 1UEUA 1Q16B 5F0UA 4UY8T 4USTA 2HHQA 4J9PA 2MY7A 3AA8A 3C15B 5KFLA 3NNCA 3T1YH 3KXDA 4X4SA 1RP5A 2UVVA 2R7XA 1A7GE 2G4BA 2HBRB 1SCJB 3MAAB 1AUSL 1TKTB 3A4TA 1NXIA 5KFOA 2MGZB 4X62J 1KHVA 5C24A 5HL7Q 3BH7B 3D5MA 3UO0A 3QGHA 2JE6I 1WE8A 4JI2H 1BQNB 3GFXA 1XTZA 1Y5LB 3FAUA 1NO8A 2JDJA 1Q8IA 1S0MA 3FSYA 2K1HA 5IWAF 4IFYB 1Y4ZB 2UUAJ 5CYMB 2F3JA 3TVYA 2BKNA 1L5UA 1J5OB 3RRGA 2BV3A 2ZBIA 2QLXA 3HFVA 3MECA 2HAIA 2CG8A 3GIMA 3HPOA 4DSEA 1QTNB 1H3DA 3AOCA 5HLFB 3VAJA 1IKVA 3E01A 2G8YA 1JLCB 2ZITA 2DGRA 3MM6B 5HVGA 4LF9J 5H9EK 3HHLA 1KOHA 3KNAA 1OO0B 4MFBA 4NASA 1S1XA 2X1AA 3X1LB 4OZJA 5A6PA 3DYAB 3ILJA 3PJWA 2UUCF 4HI1A 2V9WA 2PI5A 4F0KA 1B4SA 1HFEL 2KN4A 4IFYA 3M8RA 4CO3A 3JYTA 2QZ8A 2D3OR 3J7ZT 1JJ2R 3DI6B 3CTRA 1UFKA 1FWKA 1SJQA 2X06A 3ICLA 3HFKA 1N32F 1S1WA 2B8PA 1I94H 2Y0BB 1GMUA 5LSOA 4FF2A 2N7YA 3PDNA 3C16A 2M2BA 1AB8A 5IM0A 5BR8J 3T1YJ 2NYHA 1FKOA 4JI7H 1J5EF 2HRYA 4G1QA 2NSCA 1LK7A 2YNFB 2E9TA 1S12A 4DQQA 2VG6A 1HNIB 1N5VA 2B4UA 3A8JA 2VZ9A 2RKIA 1J27A 1EP4A 1RWUA 2Z57B 1RT1B 1R8HA 3K7RA 3SV3A 3JB9k 2OPRB 4EYHB 2Z4PA 4EFAC 1RTJA 1GEHA 4CI0B 4KPYA 2DNNA 2BA0A 2I5JA 4FS1A 4YHHJ 3THVA 4RNMA 1X31C 2L9NA 2QMWA 4LFAF 1BY9A 5RUBA 3TEGA 3CCTA 4QWCA 2GAHC 2OSQA 2PA3A 3PRVA 4WZQA 2MKSA 1FKOB 3K2YA 5J2PB 1HMVA 4UQTA 2CVEA 4DL7A 3U1KA 2OAUA 3NGUA 4P52A 3PR5B 3SI8A 2P5VA 5KT5A 1G1XA 5KFUA 5KFQA 3D1OA 3G8SA 2QX0A 2E5LF 3W61A 3QT8A 2HNZA 3L95X 4C7QA 5CD4H 3IR7B 3OHBA 2RHQB 4J7CA 3PEJA 5EUHA 4IG3A 3L9ZA 4DEZA 3LP1A 4IRDA 1K1QA 2F4VJ 3HJFA 4ILLA 4C8ZA 2BANB 4DV6H 3GU0A 1RYRA 3KWMA 4DSKA 2J0XA 2W4PA 4JUZA 3G87A 4NRUA 5LJ5Y 4ECUA 2DR7A 3TYTA 2KRBA 1P1LA 3DRYA 1VBZA 5L1IA 3PZPA 2ASJA 2VFTA 2HS4A 1N8RT 1G6BA 2OPPA 3AJ2A 1HR0F 2BA9A 2COLA 3CDWA 1K73T 4FBUA 2DIVA 2LU2A 3FBEA 5J2MA 4ZVUB 2W2OP 3V6JA 3BR8A 3PJ9A 2GNKA 1IWAA 1RT5B 2CQ1A 2XNRA 4LF8H 5M2UA 1PBAA 4JI1H 2DH9A 4YB5A 1HW9A 5KFRA 5K14B 5I3UB 1HI1A 1KQGB 2BKPA 3CC2S 4ITSA 1DZ5A 1WORA 4ECXA 3ZO7A 3BSAA 1R6VA 2YY3A 4TU7A 2Q6BA 3OLBA 2B9EA 4DSIA 5LMUH 4Q0BB 4HI2A 4DV4H 5KFCA 3GSDA 4E2FB 2W2QP 5DRKA 2VV5A 4FPRA 3Q0AA 2XEXA 3IXQA 3OSSD 3AA9A 5J1NA 4DLGA 1CC8A 1JNRB 2M0GB 1RU1A 4ED6A 1T7PA 1S03G 2OEKA 4JI4H 3CCRS 1V9OA 2XY6A 1T05B 4DFJA 1MWQA 3DRPA 4C0OC 2VUGA 5F8LA 5IT0A 4OI6A 4B9SA 3IM8A 1QDUB 3G2XA 2DYAA 1V3ZA 4W4MA 3Q8RB 1VQ7S 4LF6F 1NSPA 2W25A 5I42B 2VKCA 3Q86A 3NCPA 2CJ9A 4FPIA 5HN0A 3MCMA 1NDCA 3UCUP 3DGPA 2BABA 2E5LJ 5ETLA 1XJWB 4ZPTR 3KHHA 4UOHA 1F2HA 4TXSA 3EMTA 4PPDA 5C7PA 1T9XA 2IRUA 3PW4A 2DBBA 1TK0A 1FHTA 1FKAH 4GC6A 3M2UB 2CPHA 2ZOMA 2DB1A 1LWEB 3TW0A 4B3MJ 4WK3A 2YNGB 2CPJA 1HL6A 4KRWA 2HQCA 4RL1A 2MPUA 4LFAJ 2JFKA 1N5TA 1N6QB 2B3TB 3PVXA 1RWOB 2A6OA 5BJRA 1S59A 2P6TA 1QM9A 4C8NA 2Z2MA 3EGVA 1X4BA 3W9IA 3H90A 2EW9A 2HVZA 4QU6A 4N76A 4AL6A 1EJ7L 2NPIA 2XULA 5GVQA 3SXLA 4QPXA 3L09A 3B78A 3ZTPA 4ED0A 5JMNA 3M9OB 1OMSA 4PCQA 2ZH5A 1XNRF 4DV1J 4QBUA 2J6TA 3PG9A 4YUDA 1IVZA 3LQVA 5H9FK 3RJMB 2WVCA 2C3MA 2IJNA 4C3KA 1LEOA 5E5NA 1S6PA 4L3NA 4MFBB 3EUNA 3ULHA 2VBWA 4QJVA 2W7OA 3VCDA 4LF8F 4Q8EA 2X7IA 3DRSA 1RCOB 5E3RA 2W8KA 4NZTM 3F73A 1RBLA 3N5FA 2NUHA 3C6TB 3TQEA 3TI0A 1ZM9A 1M5SA 5K8NA 3GIJA 1AYEA 1GXUA 1O5JA 2QL9B 3TAPA 4ZLNA 3FZ2A 4ELUA 3IS9A 3QO9B 3FMBA 4FKXA 4FZVA 4WIIA 4YB6A 2J7WA 1HYSB 3A12A 2XO7A 3HO1A 3K0JA 1NH8A 2V8VA 4CT8A 3ZZ0A 2AWZA 1HI8A 9ATCB 2AJ1A 4KO0B 3AH6A 3KDKA 3R1LA 1OIAA 2CQDA 2CQIA 2XMUA 1S1TA 3IBWA 4X66J 5CABA 4DV3H 2QTWA 1YJ9S 4PG6A 2I9SA 1NMEB 4OYOA 5IQQA 1FFSB 4NLOA 4IOBA 3UR0A 1PQXA 1KOOA 3BGRB 4DX5A 1D1UA 1RAGB 2CQHA 1FFGB 2CQ0A 3HHKA 3IFEA 3MOZA 4PR6A 3W5XA 4ZP7A 1VC5A 4OJ1A 1TFYA 1WG5A 2DT9A 1S49A 4C8MA 2CPMA 1HNIA 4IH5A 2AXYA 3GYXB 2PMWA 2UUAF 2K1RB 2QLFB 3GG1A 4ICLB 4OHVA 4RR5A 4A8KA 1NKEA 3PY8A 1U6FA 3NMRA 1YX2A 3F44A 2HS3A 1HBMB 2AJQA 2GGPA 4P2MA 2VPZB 3PYGA 1XMOF 4DV7F 3PKMA 1QY7A 4RW7A 1WHXA 4M5IA 3SZ2A 1VK3A 4OX9J 3E3XA 4JI5J 2KYXA 3NXZA 4CTAB 1XWLA 4DR1J 1TL7B 1R8CA 2QRRA 2VQFH 4I6WA 4DG1A 3CNQP 2BRKA 2OPRA 1TKXB 4OYWA 5ETMA 2QL7B 1X4CA 2BW2A 3DOKA 2RQKA 5D4NA 4DR6J 4BDPA 1LV5A 3CD6S 2R7OA 1EB0A 3UPFA 4RNHA 2CWXA 3W65A 4M5GA 2XM3A 4DV1F 4X2BA 2P2RA 2CZVC 2ASDA 2MZTA 2VPXB 5LL6d 1U1PA 2HH2A 2AIRB 3E2EA 2RU3A 3EZOA 3LOUA 1DHMA 4B8TA 1RWNB 2CWKA 2NLWA 3G8QA 3FDSA 3MCNA 1TQLA 2RE1A 1Q79A 3TUIC 2YWWA 1PSDA 2DGVA 2KVQE 1PJ7A 2XGPA 3HT3A 4CTAA 3TZXA 3TX8A 1DTTB 4R0EA 3GJTB 4P2FA 2LDYA 4DS4A 3CCMS 4OI0A 3QD7X 1IKWB 2C3PA 3BM7A 1TKZA 4NYZA 1IBLF 2AP6A 2IC3B 2JEGA 4NXNF 4QYZJ 1RWVB 3PV8A 1SKRA 3L7PA 1XN9A 1S1UB 2DRAA 2X51A 2XNQA 3KLEB 1F9HA 3PFOA 4JI8F 3I5CA 2HHWA 5E0OA 3OR1A 4HHJA 5E3CA 4ZVEA 5KFJA 3SQGA 2PY9A 1EIYB 2QA4S 1GX5A 3RBZA 1CJVB 3P3DA 4ZVHA 1HLWA 4QIWD 3GQCA 3KDGA 3D68A 2V4JA 1SIWB 1U1KA 3PEHA 2C2EA 1BD6A 2NXNA 2ZC3A 3JSMA 4F04B 3OV7A 2VG7A 2DH7A 4EU0A 1IKWA 2E5HA 4RU2A 4I64A 3VGTA 2RQMA 5F8GA 1JMTA 1RHRB 1XERA 1YZ6A 3C6UB 3DRPB 3KKFA 3QWPA 5KFSA 5JUMA 3NWRA 1Q81T 4B3RF 3KJFB 1KR4A 1PAUB 4X4UA 3MPYA 4OZNA 4FJSA 4NLUA 1O6XA 3PXGa 4ZN1A 5I42A 1TKTA 3ENQA 4TNOA 3E51A 2UU9H 3M9NB 1HHSA 3GTYX 2ZNYA 4IH7A 1ZPWX 2AW0A 2N3LA 1S6UA 3KK2A 4JI3J 4OD6A 4ECSA 3TA1A 2AJ0A 1Q0NA 4C4WA 2DKOB 3FQLA 3MMAA 4ES2A 3CCSS 3CCUS 3EXYA 2ZJQQ 2YPYA 1NLKL 4KQZA 2KFYA 2MKIA 2G2OA 3IRXB 2VJUA 5E33A 2YKPA 3SFUA 1HR0J 1HBNA 4IOCQ 2E1MC 1H7WA 5KFNA 2GHVC 4LUBA 4F3MA 5LT5A 1PYOB 4DF4A 1NPRA 1RU2A 3I96A 4ID5B 1GNKA 3I32A 4KH0B 5KOXA 2EC2A 3EPGA 3WDOA 1JLCA 4PXEA 3BREA 2B4PA 3MEEA 3PHEA 3OFGA 4A8YA 3T5KA 2AMCB 2UXCJ 2V0NA 2W9CA 4QZVB 2CDQA 3ZZRA 1RDRA 2J9CA 2PDAA 2L9DA 5ITHA 1KBRA 3X3UA 2V4QA 5LMUJ 2IMWP 2MJHA 4HYKA 4JI1F 1K1SA 2VPYB 2HNDA 2MJNA 4JI1J 1T9UA 4HTJA 7AT1B 1C0TA 5L39A 2QA2A 2BMBA 4R25A 4ZCIA 2LU1A 4Y34A 5KFDA 4JI7J 1RT6A 3TVZA 4F67A 1VQMS 2ROEA 4OX6A 3HSDA 3V6HA 4ZDNA 2UXCF 2Y3YA 2QYGA 4Y6IA 2E7VA 4OYIA 3BQ1A 2PSZA 4YDDB 4JV2A 3R7BB 1YG0A 2FHMA 2QYCA 3ZZZA 1X5OA 4J9SA 1YI2S 5HP1B 1VQ5S 3WIVA 2IVFB 4E98A 1SEIA 1CS4A 1X4MA 2W1BA 3Q8UA 2XLJA 2GVDA 3H5XA 2BYCA 3NGDA 2UVWA 2HHTA 4TY8A 5EGYA 3HVWA 1RQ0A 1O0PA 3QGPA 4HVZA 3W7BA 4AQYJ 2QO3A 4EBDA 2XMJA 3QO9A 2L48A 1OYEA 2DGTA 3PRDA 3VAFA 4LRAA 4HTIA 1H74A 3G6XA 2BR0A 2MLYA 1DTQA 3BN4A 4ALZA 4HKQA 2KT2A 3IM9A 2FUG9 5J2NA 3RAXA 4FF1A 3AT1B 2DNGA 4CCHA 3VQSA 2QNDA 4DV5J 1FRLA 1FRJA 2WK4A 4FYVB 4PYAA 2D3ZA 2CTKA 4CLLA 3N6MA 1Z4UA 3OL7A 1WKLA 3BH6B 1S99A 1RLCL 3K17A 1T9TA 3HVTB 3MM7A 4G6VB 5GADU 3V4IA 4IRKA 5C0XG 1IQTA 4NZ6A 1X4HA 3HVRA 3DDKA 4F0HA 3K8WA 1XMOH 2G0CA 2LA6A 5SZTA 1N32H 2D7SA 2HURA 2F4VF 1V9NA 1Z2ZA 3R5GA 2D74B 2XWYA 1RTIA 2U2FA 4U8YA 1EAYC 3W66A 2DISA 2R42A 1UJ5A 2YQ0A 3CCZA 4Z2XA 2JA9A 4MKBA 4HH0A 1Z1ZA 3BKTA 3D0HE 3GIKA 3QFWA 3T1AA 3BQ2A 2A1SA 2CA9A 3W63A 1VCTA 4JI8J 4K50A 2C3YA 1SKSA 4WZMA 3TZWA 4K4TA 4UTGA 1ZZKA 4W98A 2MKHA 3C14B 3DU6A 1LQ9A 2ZJRQ 1KVKA 3DLHA 4FDFA 5D3GA 3KLIA 4I7FB 1RAFB 4AL7A 1DQ9A 1T03B 1MMDA 5IQ6A 1RK8A 3R1HA 1N4LA 5FJ4A 4P72A 1MROB 3VGUA 3E8OA 1TKZB 2EI5A 4CLTA 1HNWF 2RUSA 4IOAQ 1AW0A 1BE4A 1SC4B 3BKFA 2RHSB 2OFHX 4I56A 5L1KA 1WHWA 2I0XA 3AB2B 1KLMB 2AGPA 1P8GA 2CTMA 2MQPA 3TUPA 1REGX 2FDNA 3QIPA 2RAQA 3HF5A 2NZCA 2BL5A 3HKWA 5HANA 3UCZP 3ZTSA 2ZOGA 3AD7C 2HQDA 4J5OA 4M5MA 4DR4H 1HQUA 1N52B 3QZ7A 2YX4A 3OPKA 1LW2A 4ECZA 3D0IE 4RUHA 2FHJA 2RQ4A 2DEJA 2HQ3A 3T1YF 2JSXA 3ELHA 3W8GA 1VQNS 4KC5A 1F3FA 3CF5Q 4GKKF 2A0FB 3WIUA 3KJVA 4K4YA 3W3SA 2M9KA 3OL8A 2IBOA 1VRQC 2D9PA 4P7VA 1UA0A 1HPZB 1MN9A 1CJTA 3KLEA 3GR0A 4OZ2A 5KFTA 5CYMA 5L38A 5KFHA 4IUFA 2RSQA 2KFNA 3OLAA 3W2WB 4NEZA 2Y1IA 4RBVA 2CJKA 3GSIA 3K89A 3BGLA 6FDRA 4CO4A 4U6PA 1S76D 1SVDA 1H98A 4QOTA 2XCPA 2FVPA 4I6YA 3W2VA 4LF9F 4PPZA 3CDUA 2K8GA 2YNGA 4YFUA 3JSMB 1NJIT 1FD8A 3J7AK 5L9NA 5D0EA 1XK8A 4FBTA 2E5JA 4QWDA 5L1LA 3QT7A 4DR6H 3T6JA 2DHSA 2CQCA 3T1HH 5M2PA 3KJVB 1BMQB 4I68A 1UJ6A 3IWNC 2WSCC 3SFGA 3BBCA 2C3OA 4M5DB 4WFXA 4R5PB 3CCES 2R2TA 5FLXY 2DGXA 4NLVA 4ID5A 2CQ4A 2W4DA 5IC6B 2KXNB 2VOPA 1S57A 4RW9B 5K20B 2E5GA 1JJHA 1SUQA 4IH6A 2R7TA 3HHEA 3J80Y 4J91A 1T9VA 3OW2R 1WEYA 4ED1A 4HR2A 4M1KA 3C15A 1OSCA 2G2YA 4C3MA 5I3QA 5FDLB 2JEJA 1ZZFA 5HQ8A 1F2GA 4ED8A 4LF7F 3T41A 3VGSA 3L7OA 4IG0B 2VDIA 5J1EB 1ZA2B 1T8EA 4CH0S 1RACB 2PA8D 3KTQA 1F1BB 2DXDA 3CDBA 1XNQH 1VRTA 4FXDA 1ZTGA 2HVEA 1HWLA 1UWBA 2RU9A 2VU5A 3NGTA 4LIWA 4CO2A 4DR5F 3T5HA 3MCOA 4FF3A 2MZ1A 4H8AA 4B3OA 2RB7A 1NDPA 5EWFA 1YKWA 2I5JB 4KGXB 2VOOA 4BBYA 2CPXA 4Y28C 3MR5A 3H5UA 4Q44A 3D2WA 3GJRB 5K5MA 4ZLPA 2B7BB 4CLFA 3EX7B 4PG5A 4DR7H 4LF7J 1RUSA 2DEIA 1UPPA 2MXYA 1WACA 3OTDA 4DUYH 3IN5A 4LF5H 4F26A 1YJUA 4JV0A 4Y0FA 4IG0A 3N4WA 4OO1G 1WHYA 1WWHA 2ILYA 2E29A 4OL8A 4X64H 2A1BA 3TP2A 2IA6A 1FJGJ 2ZEJA 5ADZA 2GMLA 2ZH7A 4NCGB 3VGVA 5KFYA 1WF1A 3LP2B 3Q22A 4U7UD 3RZAA 3TO8A 3AQOA 1P27B 1VS3A 5DZ6A 1B0PA 3PNIA 1P1TA 2D9IA 2OGUA 1HWKA 2DNRA 1Q95G 4NMXA 2YH0A 1Y00A 4K2XA 3T6BA 1RHQB 3SYZA 2PO4A 1VBXA 4OYBA 4KHMA 1NK8A 1PO6A 3U1MA 1X8DA 5GAGI 4NXMJ 4WF9Q 2RF2A 1R0BG 2M88A 2ROGA 2WRMA 2ZBRA 4WANA 1RTIB 2RRBA 2NR0A 3IRWP 1XMQJ 3RB4A 4UUXA 1JLAB 2GAGC 5J2NB 2E66A 2ABYA 2LQ5A 3DOLB 4DV3F 3JQJA 5A2QU 2EK1A 2CZ4A 4UOFA 4DMZA 2UV8A 3V6KA 3RBEA 4TVAB 1KLNA 3CGIA 3I4PA 4Y2IA 2VASA 4TLQA 1VMBA 1LW0B 1YRUA 2AV5A 2WB1D 2HMIB 4FN5A 3TAQA 3GMGA 2GMHA 3HSJA 1DTTA 3H2LA 5ETTA 5F41A 1VQPS 3DDNA 1ZZNA 3M2VA 3LP0A 5GMKa 3D6MB 1S5ZA 3R8YA 1CJVA 4MK7A 4Q8FA 1I94J 2OTJS 3UQSA 3V4IB 1MROA 3NOCA 1YLXA 3PACA 4ANEA 2HBYB 1Q5VA 2QLJB 4IFVA 4DV2F 1UVIA 3Q2TC 2M6QA 3O6QA 4OJHA 1HNVA 4BC7A 1RAJA 5IZHA 2IM1A 2F8MA 3I4HX 1LFWA 4I2PA 2CZ9A 4KGVB 3B4DA 2H54B 3QIPB 2FVRA 5EN1A 2C2RA 1WF0A 3HD1A 3KUHA 5GADI 4QW9A 2VBXA 4V19J 4OCHA 1CQNA 2CTFA 4LF4F 2LYVA 4A47A 4HLBA 2MZJA 4NLWA 5CYJA 2AZ3A 5C25A 4ZVQB 2ZWOA 3H4BA 1M90T 1E6VB 4CNZA 4TN2A 1UKUA 3DXBA 3MTJA 5HQLA 4K0KJ 4DV1H 2O3DA 2W24A 3CCWA 2CRLA 4J9KA 1S0OA 2KZMA 2Y1JA 4KFBB 2FLOA 5KT7A 4KYZA 3DGVA 1RADB 2JLGA 1I5OB 2D3UA 3IBFB 4C8OA 1HIYA 1SIZA 1XR5A 1RT4A 4I2PB 4R8UA 5HMXA 5DG9A 1S1VA 2EFPA 4UZBA 3AAWB 1FDAA 4KGMA 4ED7A 1U1OA 4LFAH 3HLUA 3MPVA 4YR3A 2RT3A 4OHYA 2LLZA 2W01A 1Y5NB 3J7YU 2YQRA 2H5JB 2JL9A 4WJBA 3FFIB 4WCEQ 2YWEA 4YP3A 4DV7H 3W2WA 2FJAB 5GAEI 4RLEA 3KG4A 1WEZA 4DV2J 4NL5A 3R2DJ 2J9DE 3R5AA 1JJCB 2HVIA 2OHDA 2YWHA 3MD3A 4OYXA 3TAMB 1RTZA 1LK5A 5DQHA 4EZ6A 2DGSA 2WVBA 3UNYA 5GAHI 1M1KT 4CLPA 1NKCA 1JJ4A 5F8MA 2YNHB 1YITS 4FS2A 4RW9A 4NLSA 2NXUA 1RT4B 1SL1A 1J5EJ 1FDDA 1UW4A 2VFUA 4CLYA 2VQEJ 2C1EB 5DDOC 1FO1A 2BEFA 4M5DA 4R5PA 2G1HA 4QPTA 2ZM6J 2DJWA 3TX0A 4KJIA 3BF4A 3JTPA 2BJ3A 5HLFA 1Y3JA 2VD3A 4K5RA 2MLZA 1UTAA 3UDCA 1RT2A 4NLDA 3ZFVA 3RB6A 3BGOP 2UUBJ 2GJ2A 1RT3A 1EETB 4PAAA 2NCKL 2BQUA 3HHLB 1XMQF 2XMKA 2DR9A 1UMJA 3G6YA 1NDKA 1UEVA 2UUCJ 4USVA 1W2IA 1TL3A 1CS4B 5ETOA 3HZEA 5FDLA 1HBOA 1DAXA 1X9SA 5LMNF 1FWPA 1S7HA 1RKJA 4M5HA 3TAMA 4NXMF 2WVDA 4J90A 1VGYA 4RPFA 3BGFA 2MDAA 2XI3A 4ZVPB 4JI0F 1WOOA 4X4PA 2JOQA 3CMAS 2VICA 1S9GB 1TFWA 4FYWB 3SCLE 1F6TA 1SV5B 3M2UA 3PYEA 4MYTA 4P10A 1ZTWA 5IT9W 5ETSA 4M5LA 1HNZJ 1C2PA 3QAEA 1X4GA 4ZIWA 3PM9A 2PGCA 2XZWA 4NRTA 2CWHA 1EC6A 2NXCA 1EETA 2XC9A 4J9MA 2F8HA 3CD0A 3I9ZA 4LQ9A 3MFIA 3AJDA 4F3OA 2V4RA 3FSIA 3H8YA 4I4BA 3ZZUA 2QIFA 4MKAA 3GR5A 4JYAH 2HHHJ 4JB8B 2OPUA 1H2TZ 1X0PA 4P9SA 4CQ1A 4WP9A 5LSRA 2ZH9A 4DV0F 1JLBA 1U4BA 2K7KA 1J2VA 1NBEB 1VIXA 2R3VA 3GONA 5EHHA 4J9LA 4ER8A 4DL2A 1SH2A 3Q2SC 2DGQA 3JQKA 4H4MB 4B9MA 1XQIA 5GAHU 3HD2A 3VTIA 5F8IA 5DGAA 1Q7YT 4MKVA 1ZAVA 2GCFA 2JVRA 3T19A 3CE8A 1X9WA 4NZ7A 4JI3F 4DX8H 1LNQA 1PYSB 4KAIA 2VIHA 4QU7A 2VG6B 3GJQB 4UY85 1N33F 3U02A 2EG1A 4WFAQ 2VPWB 5KAKA 1FDBA 1TKDA 2A2CA 1NK6A 3RR8A 1U0SA 3DLEA 4WKYA 3CC4S 2XYPB 5LSLA 3D3BJ 3RAMA 2RF2B 1TL1B 3AODA 3AOBA 2XY5A 2Z0SA 2H9ZA 3NG8A 2J9DA 1CSJA 2DXFA 2VFSA 4H4OB 4K4VA 4B3MH 5D15A 1EQMA 4JYAJ 1RAEB 1NEEA 2BJ8A 2VL1A 4OX7A 2GHWA 1JQGA 4PG7A 3TJ8A 5K8PA 2ATLA 3SBMA 4DJBA 1IBKF 2DPIA 4F4KA 5HAOA 1LW0A 3OR1B 3ISND 4U7UK 3PKYA 1FX2A 2FHOB 2YXLA 4DSFA 1D8ZA 3MURP 1XRHA 3NNHA 1S72S 2KG1A 4JI6F 2OFGX 3LPYA 1T3NA 1CEZA 1UL3A 3WBZA 4G3IA 2OPSB 3ET6B 1KFDA 2K1RA 4ICLA 1FEHA 3FSXA 4L76A 2HHXA 1U02A 1TL4A 3OBIA 5KFZA 4C3LA 1FXDA 1ICEB 5T7LA 5D6GA 1LWFB 1R27B 4O0NA 4I0WA 2AJ2A 2E1CA 2ASLA 4RWWA 4L74A 3POTB 4FNIA 3QRRA 2CPFA 1LWCA 1FRXA 1H0HB 3EM1A 4TY9A 4JI4J 1N6QA 1R89A 1EQ0A 2WW8A 5GAGU 2GIQA 4PG8A 2FHJD 5EWEA 2MTLA 2N7CA 3LTOA 3FNNA 5F3ZA 4ZVOB 2LDIA 2EFOA 3H5SA 4A8FA 2P9GA 3NCQA 1NJWA 2J76E 2MQ8A 2V63A 3OT9A 4ECYA 1M5PC 3TR5A 2Y0SD 1KSPA 4F25A 3OJSA 1CQMA 3HM9A 2RDIA 3M1VB 3QMQA 4FVCA 1HPZA 4N47A 3K5OA 1HQEA 4YR0A 2KZZA 2IA0A 1Y7PA 2OPQB 1U2FA 3FRYA 3N5BA 3T1HF 4XPEA 2CTLA 3H0PA 2YTCA 1IXKA 1C1CB 5ETRA 4XPCA 1W25A 3V81B 1R8PA 5AJ3J 1KRPA 1S0VA 3CO9A 2KHCA 1IR2A 4DR1F 1LWXA 2NUUG 3DHXA 3LWLA 2XWXA 5LM7E 1SL2A 2HBZB 1QSSA 3DLGB 4JI5F 1FI4A 3OETA 4ZITA 5CQGA 1VQKS 1UPMB 3DOMB 1SB6A 2NN6G 3UD3P 1OSDA 1KQFB 2NPFA 2EK6A 2DVIA 1GXTA 2GO9A 1XMOJ 1NHVA 4N77A 2MQNA 5AXMA 2A2DA 2PIIA 3PX6A 4XDCA 1K8AT 4A48A 3RTVA 4LR8A 1QVFR 2JEBI 4NI2A 3CWJA 3KHLA 3HZGA 1VHIA 1S1XB 2J7UA 3CW2C 3DNCA 3LH2S 2BDPA 1KVIA 3C6UA 2CJYB 5F8NA 3AEVB 2BKOA 4YY3J 4PABA 3RW6A 1YGYA 2ZUAA 3IG1A 3J81U 3MMBB 3TOQA 2DHGA 3NGKA 1F5CA 1REVA 4NMLA 5FD1A 2QV6A 4F8RA 2AHOB 1LWEA 3JXOA 1U48A 1ITPA 1FRMA 4DN0A 2R8JA 5G0RB 1OYDA 1PYTA 4K2JA 4DQPA 4A8XA 3M8PB 3NBPB 2HHHH 2B9XA 3IR6B 2I38A 3N01A 1P6TA 5JVHQ 4ERDA 1HHQA 1KNZA 3FQKA 4XAKA 1RLDA 2ATCB 3CJKB 5E3PA 3RU0A 2VJVA 3KK2B 1W2BR 4BA2I 3CD7A 5AXLA 2PFDA 2X1GA 3JSBA 1YJTA 2EG2A 4DR4F 4JP8A 3I87A 1APSA 2OSRA 5AE2A 1RT2B 2LTLA 2QG9B 1HNXJ 1H7XA 2QC3A 3GFHA 4IKAA 1DRZA 4K4XA 3CVKA 2B4VA 3LGNA 3IRXA 4F4YA 5KFKA 2XLKA 2FB0A 1WTJA 2MSSA 2QLBB 1RKIA 2G1DA 3S6EA 3DRSB 2G2ZA 4U95A 2UVRA 4O3NA 1U8WA 3TEHB 4XO0A 2V69A 3PW2A 3GLJA 4WIQA 1PAEX 3IO1A 3H59A 2ZUGA 1VYAA 2XMWA 4BCAA 1PC4A 4DR7J 2HIYA 4I2QB 2YNIA 4DUYF 1PILA 2KJVA 2Z2LA 3R5CA 4LRFA 3MPWA 2KB2A 3I82A 4ZP8A 1FNMA 5L9XA 1S97A 2IHR1 1RAOA 2FVSA 3OQ2A 2J6UA 1FE0A 4ENOA 2B6AB 5DLFA 5IT9U 1CLFA 4FXWA 3GFYA 4WU2A 2ADCA 3O2IA 2A6MA 2WONA 4RW7B 2BE2A 3CDAA 3HHLD 2WCXA 5B0DA 1WG1A 2VB6A 3FC9A 1VRUB 3M8QA 4O3PA 1JB0C 1YJ7A 1IKXB 3HSZA 1X4DA 1HD0A 5LJ3Y 2UXDF 2Y8WA 2VQEH 2OMOA 4DQIA 1JLAA 4C2MA 2Y1LB 2DD8S 2VC1A 2V6AA 2KJWA 1EARA 2Z0GA 1BQMA 3EZJA 5E3QA 2LECA 4NE9C 5D78A 1FTRA 5J2QB 3Q8PB 2VC0A 4LBIA 4ZOSA 2FMRA 4JI2J 2BANA 2CQBA 4O4GA 5ETQA 4X4RA 2FPHX 2LCWA 2QN6B 1RBOB 3P5TL 4OI2A 4Y2KA 4CP5A 1ZETA 1QUVA 3Q8SB 4ED3A 2DNOA 3R5DA 2CIMA 2Y9HA 1D9AA 4DUTA 5DETA 1GAOA 3J7Z5 2HKEA 5EX3A 1GQEA 1TK5A 3OXLA 3PJXA 2ZDPA 3NS6A 2G13A 2V9KA 4DCPB 3IWLA 2ZH1A 4J9RA 2V8DA 5L46A 2BJ7A 4Y65A 2I6WA 2XSJA 4GC7A 3BO4A 3KG1A 3NCVA 1WJ9A 1B7YB 4Q2LA 2RD5C 3G6VA 3VAHA 5FLXW 1V3SA 3I56S 4DR2F 4GKJH 1RZMA 1U25A 4BWJA 4B9LA 2HK3A 3ZC4A 4NBQA 1A9NB 1GMWD 1M5HA 2BZ2A 3HVTA 2BACA 2PC6A 3ILOA 3MM7B 5KT6A 3KHGA 4ANCA 1SC1B 3L3CA 4ECVA 3D1QA 1MU2A 1WDDA 1R6YA 2RRAA 3JAMU 1K0VA 2LF0A 3VZIA 2MKYA 4P7TA 5B0BA 2QA4G 1OY9A 3KHRA 1U1QA 1RHJB 4NLRA 4ZPDA 3TRGA 3KMSA 2V34A 2NS1B 1RHUB 2EFQA 1UWAA 2CFXA 3MEGB 2XGQA 5DG7A 2DPJA 4P2SA 3P8BB 1F5BA 3THTA 3MOJB 2VG7B 3NY0A 1B70B 1PBUA 2QGFB 2RVJA 5U47A 1I6UA 3P6YC 1V8CA 3BKUA 4RUBA 4CLKA 2BE7D 1N5SA 1RWPB 3ILLA 2GX8A 3VWSA 1FT8A 1RTHA 4HACA 1HNXH 4JI3H 4KY3A 4ZS6A 4IO1A 3UD5A 2MZQA 2XHWA 2ZKTA 4KSEB 1GXLA 1WF2A 2YWFA 4DZ6A 4U8VA 4DUZF 1IBLJ 5IT9Y 2VBZA 1ZBTA 1H6KX 2D9OA 2POKA 1ZA1B 4YDXA 3NAIA 3CEDA 3GFZA 4EI2A 8AT1B 3MZIA 3DLGA 5MLCV 4TQSA 2VQFJ 1MLAA 1NNDA 1RSCA 1Y3KA 2DY9A 1FK9A 2VG5B 3EGNA 3VKEA 2E5IA 2PT0A 2IRXA 3BS9A 1JKHA 2N82B 5KT3A 1M5KC 2UXBJ 1CULB 4UOCA 4O3RA 5A76A 1TL3B 7FDRA 1L3VA 1P9YA 4JV5F 2UUBH 5A8WA 1EHWA 3RAQA 3CJ2A 4P71A 1B3TA 1X4NA 2UU9F 1LKZA 1RA7A 3QLHA 1BUXA 2MKCA 3H2VE 3HULA 3FK4A 1R8BA 1YZ7A 2J5AA 1SH3A 3JSRA 4RNFA 5F9LA 4RNOA 3EPIA 3PX0A 3QJJA 2AGOA 2CPDA 1S48A 2LKZA 4WFYA 4DUZH 3EDRB 4ED5A 1ZAXA 4B3TH 3MAQA 1T94A 1RXOB 2CPIA 2H5EA 3MMAB 4C97A 5BR8F 3K5MA 1WUUA 1L3UA 2OH2A 4JVHA 2MGZA 1NSKL 1GFWB 2HS0A 2NSBA 3IWXA 2R7UA 1I3OB 3NCRA 3CJ0A 1NJXA 4OLOA 3IP0A 2NYIA 2VA3A 3ONQA 2AYEA 2H3EB 2DNLA 4CLWA 3FEZA 3R5JB 4KH1B 5BYSA 2IM0A 4O3OA 2OI2A 3R9LA 2PFFB 4N56A 5A2QW 4NWBA 1NSQA 1H73A 2W9AA 2PE8A 4QR0A 3MHYA 4NCBA 1Q86T 2OTLS 3SSQA 2ZBQA 4LFCH 3ZTOA 2LXUA 3DXSX 4C0HA 1DBDA 4ZIVA 3CCLS 1SI9A 1S4EA 2GVDB 2M3DA 2JVOA 1JLQB 1MN7A 2ZD1A 5E7OB 4U96A 4DV4F 2NZ4A 1KTQA 1S79A 2KI2A 5JXSA 2VBYA 2JRSA 2JZ5A 3R27A 3OTOH 1IBMH 1F5AA 1NK0A 4GKKH 3PYDA 2XS7A 4A8WA 2UUCH 8ATCB 3EE3A 3CJTA 3MGJA 4K8RA 3SQOP 1VQLS 1S6OA 2LQJA 2RJZA 2U1AA 3DOKB 2Z2YB 3RRKA 4KHRA 2WONB 2DR5A 1HWJA 4LF5F 3R97A 4DPOA 1J4WA 5DQGA 2XSFA 3NS5A 1UWBB 4DR3J 3L7ZC 1FNOA 3CUNA 2ZH8A 2CQPA 4QIVA 4ECTA 1IR1A 3LPEA 2E9ZA 1FXRA 1TKXA 2ZBPA 1TL1A 4ZCKA 2H4YB 3WX4A 4A8OA 4DHVA 3IGNA 3GZ7A 4RW4B 1TV6B 5AXKA 3MR2A 1KQKA 2LQ8A 4IFVB 1S1WB 3DC2A 3KOAA 4QMFB 4O4GB 2FLNA 5F8JA 1FRIA 1ZYQA 1IJEB 2QFJA 4AT1B 1LWFA 2DO4A 1BQMB 1SC6A 1RTJB 1B64A 1VJWA 2PMZD 2JC1A 4NLTA 4PXCA 4ZJLA 2FC9A 2WBRA 2A18A 3QSIA 4ZPBA 3GV5B 2DR8A 3JQMA 3VAMA 2DGOA 4AYBD 1IKXA 3KLHA 2RKIB 2EC0A 2PQUA 5IFMA 4ZP6A 4EZ9A 4G65A 4CRJA 2MQQA 2RDJA 2V50A 2CAJA 3LALA 1FWLA 4KV8A 2HVHA 4QW8A 1VQ4S 1VISA 4CH7A 3KK1B 3QJLA 2KT5A 3PX4A 4RW4A 1U2CA 3UN5A 3QJPA 3AHPA 3WX8A 1KC8T 3VQTA 1TUGB 3QYYA 4PG4A 4DS5A 2Y8YA 2PEHA 1IQZA 2JWNA 2OD4A 1A0OB 3GP9A 4CYUA 4ZHRB 5D4PA 5A8KA 3ETMA 5J2PA 1IBCB 4B3SF 1XNQJ 1ZZIA 1IR0A 4EO6A 4X4TA 4JI6J 1ZPVA 1CBKA 4L6V3 2K2PA 3NGSA 1EZZB 2E3UA 3KFWX 2YX7A 2MB0B 1UVJA 1G3OA 3GV8B 2XBPA 4QYZK 4AE5A 4ED2A 3OJUA 4F4XA 1JLGB 1HBUA 1UZHA 3DFEA 1CJKB 1MU2B 1HQEB 3I0RB 4X64J 2GJFA 2HWHA 3M32B 3RGIA 1ELOA 2LQ9A 3UE2A 2IM3A 2VFVA 2RNEA 2O67A 4XIUA 1YBAA 4OIXA 2HFZA 5ETKA 2G0JA 5DM6Q 3DLLQ 3MEGA 3CCQS 1C0UB 1NHKL 2Q6CA 3PHTA 1ULRA 3GYGA 1MG7A 4O44A 3DCAA 1E6YB 1GT8A 4NI2B 1FCAA 1WNEA 1Z2LA 3DOMA 5IC4B 3S7RA 5KG5A 1HARA 4J9QA 1QTMA 3VVUA 2NQPA 1VK8A 1U6ZA 2R8GA 1BHNA 4NA3A 1S10A 3P5BP 2OKQA 2IJRA 4F4WA 2F1FA 3CDEA 3N28A 2CADA 2H65B 4YMEA 3MMBA 2F7VA 2B7CB 4MIBA 4CDIA 4WFZA 4X84A 4LJMA 4JI5H 3FVYA 3KK3B 4PXDA 1WI8A 3V2UC 2QSWA 4DV0J 2L9WA 1LOUA 2XQCA 2VA2A 3BZQA 4ED4A 1KDNA 3J80U 1NK4A 2LEPA 1M0SA 1UZDA 4UW2A 1N5QA 2PT7G 1Q8KA 4KIAA 1QD1A 3SQGB 1CULA 3IC1A 1B0VA 4JI2F 1VIOA 4EK2A 2ALZA 1BQNA 3OSNA 3OHAA 1T05A 1CG2A 4LFCF 2F9JA 3QLHB 4DF8A 4KHPF 1C1BA 1Y0HA 2JHEA 2Y3MA 1PJ5A 4DQRA 2BOPA 1WSRA 1VQSA 3CJRA 3KUGA 2EFVA 1MMLA 2V8GA 5CCLA 5HP1A 1N34J 2XO6A 2UP1A 3K57A 5D0RA 1FERA 1J5EH 1UFLA 2ANRA 2OMLA 2L08A 3OSPA 3A8KA 2Z56B 2AZ1A 1YRXA 1SUQB 2CNNB 2FHKA 2LA4A 3MMCB 2MYFA 1F0XA 2Q79A 4B17A 1WSVA 2D41A 1KONA 2B0GA 1L3KA 4YHHF 2W8LA 4DUYJ 1WC1A 1WKKA 1F9EB 2FJBB 4QWBA 2UUBF 4N8OA 1UVMA 3OVBA 1JLEA 2XLIA 3J81Y 1GH8A 2M7SA 1NSAA 4L72B 4I1TA 4PUOA 1LFPA 4LF6H 1XNRH 3UN2A 2F4VH 1Q78A 4DU8A 4JI8H 1V5VA 1NDLA 3W9HA 3B82A 4WKRA 1HBNB 3VAGA 1KEKA 1HBOB 4HDGA 3TWZA 2FQQB 1RT1A 2KDOA 1TUVA 2H5IB 2MSTA 3C6TA 3IBCB 3JSYA 3MEDA 1Q8BA 2JX2A 3C8YA 4LBPA 1HNXF 3ITHB 1IKYA 1S9EA 4IDKB 4H4OA 4DR1H 4ZK7M 2H1YA 4B02A 2ANNA 1ZZJA 5A8RA 1NAQA 5LXRA 1TAQA 2F40A 3ADAC 4H4KC 4UUWA 4DZDA 1RABB 2WTFA 3KYLA 3I0PA 2QL5B 1EP4B 3D6HB 3KUEA 2FZKB 2FVQA 2B5JB 2O5DA 4ZPAA 3G4SS 3RB0A 4YHHH 5C2CA 4P6QA 1QJHA 1S1TB 2X1BA 1U8SA 4KBIA 7FD1A 3Q8YA 3V6DB 2FZGB 1RAAB 2HLUA 3NWGA 2BJDA 1CC7A 2OLWA 3H2UB 3M2RB 4I69A 4MIWA 1Q8LA 3MM5B 4YQWA 4YY3F 1VIHA 2ZWPA 3VAKA 4IFDG 3N6LA 3W60A 2AYMA 2IPOB 1PKUA 1TVRB 3GILA 2IBKA 5E3AA 4DBQA 4KHPJ 3R5BA 4IYQA 4JV5J 2JH3A 4MMOA 3UOEA 2XCAA 2GGPB 4F4AA 1AZSA 2OIHA 5IWAJ 2M8WA 4IO9Q 4LF4J 4OHXA 5A0YB 1YWXA 1FTCA 3TUZC 3J7YI 5ETNA 4DR3H 1RWWB 2APOA 2FGOA 2DGUA 3IAM9 4IQMA 3SSRA 4DV6F 3BO3A 1AT1B 2J8AA 1TMMA 3M1VA 3M2RA 4H4MA 4OYPA 4RX6A 4UZCA 1TL7A 3B4MA 4ZVRB 3TZYA 4X62F 3SV4A 4I6AA 1X5TA 4DL5A 2GC8A 5A8KB 4OJGA 5F8HA 5AJ3F 4DV5H 1MW7A 1S4FA 2DO0A 2ZBCA 1SH0A 3ZNUA 3QT6A 2LEBA 1X0FA 1URNA 2AJFE 4M5JA 2KTQA 2HPUA 2HNYA 1ACMB 2HGNA 2ZOFA 3D67A 3A8IA 5HMWA 2CPYA 2GQ2A 1SJ3P 5D4LA 3A1YG 1UFWA 4KT0C 2ZH3A 3UI3A 1N5YB 2BJ9A 3M8YA 1FJGH 1C4AA 2YKQA 4DV3J 4GVBB 4X66H 2WOMA 3FBCA 2NXEA 1T02A 3J81j 2MZRA 2DNMA 2ERRA 2IVMA 2QMXA 2Q1LA 3HKZD 1MNEA 5EWGA 2H4WB 2P9EA 2IC3A 1QVGR 1VJQA 4CO5A 2ZFHA 2HHUA 4BHQA 1S6QB 2GO8A 3B6BA 4OZ1A 1HNZH 4K4ZA 2RQCA 3EZ5A 1E6YA 2B56A 2PEBA 3FBBA 1CJKA 1WC5A 5HMYA 1NKBA 3KLIB 4I7FA 4E9JA 4USWA 4ID8A 3K5PA 4RW8A 3POTA 1SPBP 3I9V9 1UJ4A 5DS7A 5HVFA 4PKDB 2W7AA 4Z7CA 5KFMA 4G08A 5D0HA 4PDBA 2PMHA 3DU5A 5ETVA 2IDEA 1NCLA 2YKNA 4HL9A 5C42B 1WTBA 3HHNB 2HG4A 3ISZA 1VC0A 1YK9A 4I67A 2ACYA 1FXLA 1D9FA 3WC0A 4KPCA 1TUWA 5I3PA 4LSLB 1WDTA 3GWCA 4P2XA 2R2UA 3ZTRA 5GMEA 2AX0A 1U1MA 3S01A 2CNOB 4B3RH 2R7QA 1JX4A 1X4FA 3AB4B 3OUYB 3T5JA 4QYRA 4Y2CA 1K0TA 5CYQA 3NOGA 1NJZA 4B9NA 4ECWA 1SBRA 1NB7A 3FEYB 1NZ8A 2LFVA 4WXOA 3M8SA 1W26A 2HZVA 1FE4A 1VRTB 3S8SA 3D66A 3KK3A 2PD1A 3DLKB 1GK8A 4ZVTB 4X4NA 3MM8A 5KOWA 4DR5J 2GQCA 3FMWA 4USJC 3KLVA 1JIHA 2H48B 3FUYA 2C3UA 3L4BC 4DXLA 3TZZA 5DGBA 3HXMA 4RWXA 1LXNA 4URSA 5AE1A 4M5NA 4ZVGA 4FKYA 1K9MT 2YNIB 4URGA 3BB5A 2KO1A 1ZOTA 4C9DA 3FCVA 4RKUC 2I1RA 4DL4A 3PRBA 4BS2A 3ISNC 1M5VC 1TMJA 2YWKA 3UVJA 2Z8QA 1BWVA 3H7HB 3NP5A 5DO2A 1WC4A 4Z37A 3EYZA 4DL3A 4TQRA 4LF5J 3SB1A 1TZ0A 3FEXB 2VFRA 4USHA 4MJKA 3TJAA 3VHQA 3PIPQ 5IOLA 1KWMA 4RW6A 4X4QA 4HT7A 3KLFA 1F3VA 4W92B 4ZPWR 6AT1B 1H2VZ 4GVLA 4C8LA 2QMUB 2XG8A 1CVJA 2N4DA 4R0JA 2IVYA 2CTEA 4LVNP 1RWMB 3C3LA 1FD2A 3BSCA 3RW7A 1HNZF 5FLXU 4DV4J 4YB7A 3IR5B 1REVB 3HX9A 2DIUA 3AQPA 4OHWA 1UAWA 1HHTP 4ELVA 1PC5A 3HCXA 5A6WA 2UXCH 1IKVB 2EEYA 2MLXA 4JVYA 2KM8B 2HNDB 3BYRA 1RCXB 2YKOA 5LMNJ 1VBYA 1J5OA 1YRTA 5K9FA 2KM8C 3BJYA 5T41A 1SQGA 3RBDA 3W8PA 3CD5A 2VH7A 2CTJA 2DY1A 4ILRA 3UCGA 1DQAA 1Q53A 3PO4A 2UXBH 4U67Q 3DN9A 2CPEA 2JNJA 3ITHA 2C2MB 3M2VB 1QSLA 2EKNA 4NYPA 3V6DA 4B3OB 5LXYA 3ZZYA 2OPVA 2ZM6F 1R8AA 1TAUA 4N41A 1HNVB 3R6LB 4Q45A 3DYAA 4A8QA 1IN0A 2B6AA 3M6WA 1AFIA 4KV8B 1Y10A 4FYDA 5C2GA 5B7WA 3DI6A 1FKPA 2G9OA 2C28A 3NS7B 3C2PA 4EMDA 3L7UA 2A10A 2VKRA 4I2QA 5GAEU 3QQCD 4RZRA 1N33H 1DTQB 4BLGA 2OJ3A 4NA2A 2J7KA 4WP8A 1JLFA 4OX9H 3DRXA 1SXLA 3I0RA 3AY0A 2L3MA 3MR7A 2XMTA 4Q2MA 1FF2A 4U9RA 5A0YA 3WZ0A 5KFVA 4CYUB 4WWSA 1D0EA 1FFWB 2HYIB 5J2QA 3MUTP 1O51A 3MD1A 3DM2B 1VBIA 1I6JA 5HROA 1Y11A 4TLRA 4KKOB 3BR9A 1RA6A 1WG4A 4NLPA 4LF9H 2V2VA 2CUYA 4OZ3A 1VDHA 2BXJA 2DK2A 5CCMA 5BYQA 3RUBL 4QCLA 4WALA 4EUVA 4HHHA 1R31A 4USIA 4K5SA 2R8HA 1ZM2A 2GVZA 2UUTA 3QPIA 4B9UA 1YIJS 4XTTA 3NNAA 4PRFA 1FEEA 3G6ES 3I6PA 3HMJG 3DRRB 1YVFA 3ENWA 3ETOA 4AQYH 1NK7A 1TU0B 2R7RA 1SJRA 2B43A 4F0MA 1T03A 2W2MP 5CZVA 1RT7A 3JS9A 2PN6A 3TJ9A 1LWCB 3LP1B 1X9MA 3HJVA 2XMMA 1T9WA 2CNLB 3LO3A 2XZDB 2DR6A 2IM2A 4WE1B 3CJ5A 4CNYA 1BWEA 2J0SD 1S6QA 4LIRA 3NGRA 1HQ2A 2DNZA 2AEJA 2M70A 2GFFA 4J9UE 1MSZA 1VQYA 2HQFA 2GA7A 1FA0A 4M8LA 3CCJS 3MWBA 2W2NP 1CJUB 2B9WA 2CJXB 1I94F 1T95A 4OFZA 3CPWR 1N34H 4RBUA 4URQU 2AYBA 4DR5H 4Q7AA 3UDLA 2M5YA 2P9CA 2RIJA 2BM1A 1C1CA 1OY6A 4AQYF 2E7XA 3U7JA 3EZUA 1RTDA 1YTYA 4NCAA 3G96A 4WE1A 1WHVA 4ECQA 3HHLC 3MF5A 3MMCA 5GMDA 4LSLA 4WBFA 1S9GA 4DX7A 3QWUA 1S9FA 3NL0A 1NPPA 1J5KA 3NAHA 2D69A 3CJ3A 1CJUA 3CT9A 2ZHAA 1DTJA 1AROP 5CZXA 3W2VB 4X64F 4N5SA 2R7WA 3A3OB 4LVOP 5I4MA 3MM8B 2IRYA 2CQ2A 4K59A 2HQIA 3W5ZA 3QATA 5CA5A 1FK9B 2VG5A 4C98A 1DLOB 3UWTA 4UT4A 3PR4A 4JI7F 2HIQA 4QR1A 4PWDA 1IBLH 2MQLA 3UDEA 1HR0H 1KQSR 4EBCA 2XMVA 4WYWA 3HT0A 2M4MA 5CHCB 2W9CB 2BE9B 1ZTTA 4DSLA 1JLEB 2QT7A 3M05A 4DPWA 2EBEA 2G0IA 2WVFA 4KO0A 4ZLLA 5LMUF 1SKUB 3E01B 2RH3A 1DY3A 1I1GA 3IG1B 1FVQA 4LFCJ 4OYZA 4GKJF 5C24B 4KE5A 3LWMA 2XB2D 3LANA 1UA1A 2JEIA 4LF2A 4IRCA 6FD1A 2M52A 3Q83A 3S1TA 3UVJB 4Q43A 3BQ0A 1RT6B 4PWUA 2CDRB 4AD6A 3UD4P 2AQ4A 4NLGA 4IDKA 1SJ4P 4DR7F 4DWIA 1X4AA 5LMNH 5L1JA 4CM2A 2C2DA 1JXLA 1Q1KA 1UVKA 4OZ5A 2AT1B 3K59A 2UVUA 1T11A 5B0EA 2AU0A 1GMWA 1U45A 1FJ7A 4AFFA 3C16B 5IM0B 2V94A 4JI6H 4FF4A 4BC9A 4J37A 4O0IA 4KGZB 3OXGA 3FGVA 3I55S 2QEXS 3M9MB 5B0FA 1FESA 1U09A 4EO8A 1HWIA 4MIAA 2V67A 3OTCA 3P4UB 3QSYB 4MYUA 3CMES 1DT4A 5KG4A 1BC6A 1HA1A 1WC6A 2L41A 3LGMA 3CULA 4J9OA 3OR2B 1JLQA 1BGXT 2E1RA 1DURA 2ZD1B 3UW1A 2BBEA 4C11B 4LFBF 5KG1A 2R4FA 2CJBA 2JC0A 5F0WA 1KFSA 4NA1A 2V2KA 1WHRA 4DDFA 1NJYA 3QIDA 4ZPCA 1AUDA 4DPYA 3PTWA 4X62H 4LRCA 1U1RA 3D6FB 1D9DA 5IWAH 3MM9A 4F4ZA 4PQUB 2JLFA 4ETXA 1N88A 2HWIA 2OO4A 2BM0A 5HJYA 2FY1A 2B51A 4FYYB 2X1FA 3FZBA 4X4OA 3GJSB 1R7IA 1PG5B 1JK9B 1HYSA 2K06A 1MSWD 4LMZA 5BR8H 4Y2MA 4ZJQA 4B3SJ 2V5HG 1TR0A 2F5GA 4KB7A 5T7LB 3GV7B 2EFGA 5IV4A 3AXKA 3G82B 3TA0A 4EYIB 4A4JA 2O4CA 2MQOA 2GMJA 4DPXA 1NH7A 2MQMA 3Q89A 2HBQB 1H72C 1B0TA 3ILIA 1S1UA 2J0WA 3HVAA 4RJVA 2ZE2A 1N48A 2M8DB 2KL8A 1Q82T 4FYXB 4DPUA 1FRKA 2HFSA 5CAAA 3CJSA 2ZZTA 2EXUA 1HMVB 1BXNA 2C2KB 3H20A 5KFEA 3MI7X 4YB1P 1VLOA 2F8EX 2YKMB 1FKPB 1NPKA 5HROB 1T9YA 3U27A 2FLPA 3AOAA 2GVZB 4MTPA 1WOSA 2AKWB 5LOQA 2HHSA 4GKKJ 4ETZA 1ZS6A 1ZM3A 5BXIA 4FJUA 2ROPA 3M6XA 2VONA 5D4OA 4YOEA 3EGWB 1VR6A 4E8UA 3TARA 3UNGC 1G4CA 2E1AA 4ES1A 4TYBA 4WPAA 2GIRA 2WW4A 4G1IA 1UEKA 1EX8A 2HZCA 3DM2A 5DJBA 1RAHB 3V81A 4WFBQ 4QIFA 3WHIA 1WVNA 2CKWA 1U24A 5HJXA 1X5PA 1AFJA 4B3TF 3AXMA 3M4XA 1FRHA 4NLYA 2W9BA 1RTHB 3CJ8A 3DDIA 4HACB 4OZ0A 3CXCR 1O8BA 2IIHA 2CVIA 4RU9A 1VBKA 1KTVA 1A6LA 2MJUA 3MAHA 2MY8A 2JVZA 5KG0A 2DRDA 5H9FJ 5J2MB 4DV6J 4ILMA 1V3RA 2IAJB 5IXUA 5HI7A 1F9FA 4JI4F 2DHXA 2EVZA 3EICA 4TKTA 3RRHA 1KP6A 1Y9OA 2ZNZA 4HEA9 4OQJA 3Q23A 2O66A 1NXUA 3T5LA 2DGWA 1JXVA 2HGMA 3ZZTA 1VHFA 1U7LA 5AT1B 2ZZNA 1RBAA 4NXMH 2C2OB 5G0RA 1NRKA 2HZAA 3R3TA 5A8WB 1NM2A 2DHHA 5DDPC 1IJFB 3KLGA 4CWBA 1B99A 2LP4A 4YY3H 3LW5C 4ATNA 4AUKA 4EWTA 5HSPA 4QQBA 1LXJA 1DARA 2HRTA 3M32A 5F9NA 4L75A 4WU3A 3WQPA 2B4OA 4PWWA 2F65A 3SIPB 5DLGA 3UDVA 2YPZA 5JVGQ 4IR9A 5L8RC 1JWWA 5DZ7A 4USMA 1UW9A 4Y2AA 2RS2A 3MM6A 1ZH5A 1IBKH 1C4CA 4LR7A 4DLEA 4JV5H 5EDWA 3SEOA 2BOAA 2DCUB 3PFEA 1FNXH 4USUA 3M6VA 3MUMP 2HVDA 1FDNA 4ZKAA 2I2YA 2CPQA 5F3TA 3KLFB 1N36F 3CJKA 4LIJA 3MECB 3DGPB 2H51B 1N56A 4F3QA 3W64A 1G7CB 4PZVA 4ES3A 2ZJPQ 1L3TA 4CO1A 1XBWA 3TQ1A 1Q4RA 2IYIA 3GE9A 2JEAI 4P73A 4E0DA 4KHPH 3CCVS 2E1PA 2GS8A 3DMJA 4ZVSB 5DQIA 3JAMW 2AF6A 2FFMA 3QBCA 3OD2A 1QE1B 3UR3C 4RW6B 1UG8A 3THPA 3BSNA 2ZZMA 3OXFA 4LSZB 3O5TB
chains in the Genus database with same CATH topology
1SQEA 4MK8A 1KVJA 5FIIA 4RBTA 3OTEA 3LUYA 1RJJA 2CQGA 2HW3A 4OJ3A 4HH1A 4LFBH 4OLPA 4MK9A 3HP6A 2RRNA 3MM5A 4DFMA 2Q43A 3KG0A 2DNPA 4NCGA 1JXEA 3BN7A 3F41A 5GAEU 2K7JA 1DQ8A 2HFOA 4DN9A 4G1QB 4RUAA 4NZ0A 2KXHA 3DMJB 3I0SB 1NHUA 4ZP9A 1U1NA 1R0AB 1VRUA 2EFNA 3M8QB 1VQOS 3P49B 3JTOA 3EGZA 5B08A 1XR6A 2FJDB 1U2RA 1X5SA 2Q66A 3BEGB 1GTEA 5K8OA 3OR2A 4B3SH 4ZCMA 1QUPA 4AXIA 4D3GA 4X4VA 4WTYA 4LQ3A 4OX9F 1MMNA 2N4CA 3OFFA 4WYLA 5G4DA 4DV2H 5KFFA 5AXNA 3OL6A 2ZH2A 2MHEA 2ZVSA 2GV1A 2Q3PA 4GO7X 1XC9A 2BUNA 3Q24A 4JOUA 1C0TB 2CPZA 2GHPA 3MEKA 4Y3CA 1XMQH 3HHDA 2QA1A 2C22A 2KU7A 3MM9B 1Y5IB 3BGRA 4B9VA 4AL5A 2DNHA 1D8YA 2KXFA 3JYTB 4EEYA 4DG1B 4C11A 4F2RA 2E5LH 1QLNA 2HWTA 5KTQA 1L3SA 4U7CA 3CSKA 3C46A 5A8RB 3K5LA 3FJ2A 1WELA 1HD1A 1U47A 5A2QY 4H4KA 3ZZPA 4XK8C 2YWGA 5K14A 2ZC4A 4ECRA 5I3UA 4M63A 1TVRA 1OPZA 2QLWA 1HQUB 2WB4A 3BGUA 2AGQA 1FKAF 1G2EA 2OP5A 2OD6A 4YEAA 3V4MA 2IYGA 1NZAA 4ZVFA 1WTFA 5KG7A 2GJIA 4YR2A 4MKYA 4JBCA 1FVSA 2BRLA 3SDEA 4NZRM 1AXQA 3KK1A 1RI7A 4ZPVR 3JTNA 4NOHA 1JNZB 2KT3A 1X7VA 1V6HA 3NKYA 2ZE2B 5KG3A 3MTKA 2HHPA 1WEXA 1ZAWA 2DH8A 4R8UB 4EC5A 2R8KA 2W9BB 3F56A 1JKHB 3I5AA 1T3OA 2AX1A 3VF0B 1RYSA 3J81W 1OWXA 1RTDB 2Y1RI 5HMZA 1TL5A 1YJVA 2YVSA 4B08A 1VI7A 2HGLA 2LVWA 5KFXA 5KG2A 3K5NA 5HO4A 4RNNA 2XSJB 2W4CA 2DNYA 3KNGA 2FIUA 2LXIA 3G86A 3U1NA 1RGVA 3VR1A 1C0UA 3I5BA 4F2SA 3BDEA 2DHAA 4CZCA 3MMJA 5T14A 4ZA1A 3J80W 3QAUA 4AXJA 5M2RA 2FC8A 5HBMA 2KYZA 2WSFC 3GIIA 4NLXA 5CH7B 1N5YA 5KT4A 2V4JB 2IAJA 3SMZA 2K3IA 3H98A 2KFZA 3N0VA 2YNHA 2OPQA 3IAS9 4DR3F 1NU4A 5AE3A 2BJEA 4FP9A 3GR1A 2EBGA 4XDDA 1KS2A 4TU8A 4HT5A 3PO5A 5E2QA 1YQHA 3MEEB 2DCLA 4H54A 4RW8B 1SV5A 4K0KF 2BQ3A 3NMAA 4FVMA 1VLYA 4D3HA 3PW7A 3FRZA 4KTQA 2RUGA 3FCHA 5CYQB 2NREA 1DFDA 1MWYA 4NLQA 2FJWA 4EGLA 2VKZG 5MAOA 4X66F 1MWZA 2AD9A 3MEDB 1FJGF 5DG8A 3LP2A 2KVIA 2KH9A 1TV6A 2MHNA 1RISA 2AYGA 4B8CD 3I0SA 5EX0A 1R0AA 3HK2A 3TA2A 1N0VC 4CIOA 2O01C 3H4DA 2R7SA 4PQUA 4OHZA 3N6NA 1QSYA 4PUOB 2B5JA 2HFNA 3P96A 4PXBA 3TANA 1KN6A 1XR7A 3VALA 4Q5VA 4TU9A 5CXTA 3O1LA 3BSOA 1HI0P 2DITA 5DM7Q 3M6UA 4ZCLA 1QAJA 4CO0A 2UUWA 2E9RX 1IKYB 1S9EB 3G71S 3M30A 1BLUA 1PGZA 2N3OA 3NRBA 4G1PA 2LEAA 1U49A 5KFIA 3Q8QB 1S77D 3OTBA 2UXBF 4KGKA 2P6SA 4TY8B 1XEZA 3GYNA 2MKKA 2BE2B 1XMBA 1IUJA 3MDFA 3TVKA 4QWEA 2VQFF 3B8HA 4B3MF 4GO5X 5JJBA 2V8HA 2OPSA 5H9EJ 4WXWA 3SSSA 2J0QD 3MXHP 2DTJA 5J1PA 2R7VA 1HW8A 1URRA 2KHDA 1VFJA 3PIOQ 2ZM6H 3CJ4A 2FJVA 4Y00A 4A8MP 2YKMA 3O8WA 5THWA 5DT9A 2O1PA 3SCJE 1GTHA 4B9TA 2UZAA 2CJQA 4C8YA 1CPZA 3GB0A 2HNYB 2DNKA 3JAMY 5D3GB 4OI4A 4NPOA 2KRRA 3EXCX 4DV0H 4JYAF 3SCKE 2XY7A 2YX1A 3C66A 4BWMA 3BO2A 3N9UC 4NXNH 1X4EA 2E7WA 3IA0A 1KLMA 4M95A 3DOLA 2FJEB 2EPIA 5E41A 1OQ3A 2VQEF 4K4WA 1YSJA 1H38A 1AN7A 4KKOA 4WFNQ 2FJXA 1VQ6S 3PW5A 2RILA 4DFPA 1VC6A 2MMYA 4LSNA 3TNVA 1NK5A 3OFHA 4K0KH 2YQ3A 3N79A 1N36H 3CIMA 4QWAA 3KLGB 2XS5A 1C1BB 2RMLA 2SXLA 2ZH4A 3LF0A 2F9DA 4FNHA 2CG4A 1UP1A 4WK1A 3K58A 2HHHF 4OZLA 3T9NA 1YJRA 4OI3A 1QAYA 2OPPB 2ZHOA 4DL0C 5KT2A 3U1LA 1LW2B 2IMOA 4O3QA 4FXVA 1DJ0A 4JI0H 4QIGA 1ZM4A 2ILZA 3IGVA 2RS8A 1RT3B 1JLGA 1HBUB 2D1CA 5C25B 4IQXA 3SCIE 1RT7B 3AJ1A 3OVAA 5SUHA 3MFHA 4K4SA 2I8EA 1F60