2FPHX

Cell division protein ylmh from streptococcus pneumoniae
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
165
Chain Sequence
b'GIYQHFSIEDRPFLDKGMEWIKKVEDSYAPFLTPFINPHQEKLLKILAKTYGLACSSSGEFVSSEYVRVLLYPDYFQPEFSDFEISLQEIVYSNKFEYLTHAKILGTVINQLGIERKLFGDILVDEERAQIMINQQFLLLFQDGLKKIGRIPVSLEERPFTEKID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ylmH
publication title Cell division protein ylmH from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Dna binding protein
total genus 44
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2006-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fphX02
3.30.1370.160 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2fphX01
1X4FA 1S79A 2JRSA 3CC2S 5CA5A 1FJCA 2LEBA 2KH9A 2HYIB 3MD1A 5LXYA 2KXFA 1N8RT 2DO4A 3VAFA 2CQ3A 1M5PC 2MZQA 2O3DA 2AYGA 2RVJA 2MKHA 2F9DA 2KI2A 1URNA 5IQQA 1YJWS 2X1AA 3SDEB 5LJ5Y 2JWNA 4PRFA 3R1LA 2CQBA 4WFAQ 5CXTA 2CQ2A 2AYBA 1U6FA 2XNQA 3MURP 1VC0A 2DGOA 1M90T 2CJKA 2DISA 2RQCA 2KT5A 5DM6Q 2LQ5A 2CPIA 2M8DB 5JVGQ 1K9MT 3US5A 5D77A 1X4CA 2CQ4A 2NLWA 1IQTA 4TU7A 1W2BR 3U1LA 5GAGU 3CCSS 2ADCA 2ZJPQ 2DGUA 1DHMA 1YHQS 3SDEA 3CUNA 3H2VE 5HO4A 1WEXA 3P3DA 1JJ4A 2LKZA 1K73T 4W92B 4J5OA 4EGLA 2E5JA 1KC8T 2F3JA 3J7YU 4QU7A 2CPYA 4Y0FA 1SJRA 2VOPA 2MZJA 2KRRA 2BOPA 2AYMA 2MSTA 3CD6S 2K8GA 1ZH5A 1VQ5S 3VAGA 2L08A 2FC9A 3UD4P 1U6BA 3MUTP 4WF9Q 3CC7S 1H2TZ 2L41A 2XB2D 4U67Q 4IOAQ 2GHPA 5DETA 1D9AA 3VAHA 4F02A 4F26A 1SJQA 2DB1A 1WHYA 2HVZA 4ED5A 1BY9A 2FC8A 1H6KX 1WI6A 1N54B 5IM0B 5LJ3Y 2E5GA 3CCJS 3MUVP 1Q86T 2G4BA 4ZKAA 3JB9k 3L3CA 1VQOS 1XN9A 2MJNA 2MQMA 3OW2R 4QPTA 4CIOA 2DNPA 2L9WA 1VBXA 4WKRA 2DIVA 2U1AA 1WHVA 2KHCA 3NNHA 2MY8A 2MKCA 2KG1A 1L3KA 2MPUA 3RW7A 1SJ4P 1N52B 2MYFA 2KFYA 2KN4A 5LSLA 1VQ4S 3SXLA 3MOJB 2OSQA 3G9CA 1M5OC 1CVJA 4CQ1A 1YJ9S 3D2WA 2XNRA 3NNAA 1FT8A 2DNOA 2CPEA 1VQ8S 3PIPQ 2D9OA 1UAWA 2YWKA 2DNHA 3S6EA 3IRWP 3VF0B 3CULA 1VQMS 5GAEU 5BJRA 2VOOA 3I55S 5DDQC 5GAHU 2KG0A 1AUDA 3S01A 2CQDA 3LQVA 2MQNA 1WG4A 3HHNB 3U1MA 3LPYA 2X1GA 2KXNB 2EK6A 3MD3A 1ZZNA 3CCQS 3RW6A 4TU9A 2M0GB 2D3OR 2AD9A 1WWHA 1VC6A 4RU2A 3TYTA 4Y00A 2I2YA 1D8ZA 2DHXA 4IUFA 2HGLA 1U1LA 1FNXH 3CXCR 2ZJRQ 3NMRA 3H2UB 1O0PA 4YUDA 3VALA 3CCMS 2CQHA 5GADU 3BS9A 2YH1A 2ADBA 3G6ES 1Q82T 1WF2A 1FO1A 2B0GA 4LIRA 5LSOA 2PEHA 1VQPS 2MKSA 1HL6A 1ZZFA 2MJUA 2K3KA 3CCVS 2J76E 5D78A 1VQLS 2HZCA 2F9JA 5MLCV 3BO3A 1DZ5A 1OWXA 4PR6A 3N9UC 1U1PA 3P5TL 2MB0B 5GVQA 2MSSA 4F25A 2VONA 2ERRA 2XS2A 5GMKa 2KM8B 2LECA 1X4EA 4P6QA 3CCES 2YKAA 1VQNS 1NJIT 1S72S 3CCLS 1P27B 1K8AT 2CQ1A 1VQ6S 5HL7Q 2RT3A 2RU3A 2XSFA 1WHWA 3B4DA 3G71S 1HD0A 1SXLA 3CCRS 5EN1A 3VAIA 4CH0S 1JJHA 2KM8C 3UCZP 2JVRA 1PO6A 2CPJA 2V94A 2MKJA 3DLLQ 1VQKS 5IFMA 2DNNA 4BS2A 5DDPC 1WI8A 2D9PA 2KVIA 4A8XA 4FXWA 2N3OA 3TP2A 4QQBA 2DGTA 1G2EA 3V4MA 3J7ZT 2DGSA 1U1RA 1HD1A 2KU7A 3THPA 1A9NB 2DNYA 4WIIA 2M9KA 3I56S 2DNKA 2MQQA 2RS8A 1B7FA 1YITS 5H1SV 5FJ4A 2MGZB 5JVHQ 2EVZA 2M7SA 2DGWA 1WEYA 2NZ4A 2MKKA 5IM0A 2RS2A 3NS5A 1X4AA 3SMZA 2HGNA 3EX7B 4IO9Q 2CPHA 2QA4S 1U1MA 3MDFA 2QFJA 2RRAA 2QEXS 3CMES 2VODA 2M88A 3VAMA 4IOCQ 3BEGB 1X4GA 3G4SS 3UCUP 2KXHA 2X1BA 2YTCA 3EGZA 2I38A 4ERDA 1FJEB 1WG5A 1WTBA 2MGZA 4W90B 2SXLA 4LMZA 2DITA 2LXUA 3MI7X 1YI2S 2HGMA 2JVOA 1OIAA 2RUGA 2YH0A 1R8HA 2MXYA 4C0OC 4YOEA 2MHNA 4CH1A 2OSRA 2XS5A 1F9FA 1VBYA 4WCEQ 2DIUA 1M1KT 2DHGA 2MQPA 4V19X 2RQ4A 3FEXB 1PGZA 1H2VZ 1Q7YT 2OJ3A 4Z2XA 2ZJQQ 1Q81T 2KYXA 1KD1T 3TO8A 2DH8A 2A3JA 4LJMA 1OO0B 2PE8A 3VAKA 2CQ0A 3G8TA 4C4WA 1YTYA 1QVGR 2AYEA 2DGQA 3UWTA 1VC5A 1X4BA 2FPHX 1SJ3P 5DM7Q 3P49B 3P6YC 3B4MA 2DNZA 2LCWA 2MQOA 4WFBQ 3BO4A 1U2FA 2CPDA 2M4MA 1UW4A 2DNMA 1WF1A 4OZ0A 1KQSR 1WG1A 1NU4A 3EGNA 2KRBA 4FXVA 1QM9A 2RNEA 2OTJS 2DHSA 1X5OA 3K0JA 2DNLA 3UCGA 2EK1A 2DGVA 2FHOB 1X4DA 2M70A 2M2BA 2DGXA 1SJFA 4UY8T 1H2UX 5DDRC 3CMAS 3CCUS 1U1QA 1UFWA 3CF5Q 2DNQA 2LEAA 1RK8A 2LMIA 2N7CA 2MZSA 3CPWR 3BO2A 3ZZYA 3ZZZA 5ITHA 2X1FA 1N88A 1JMTA 1VBZA 1R8PA 1KOHA 1UP1A 3R27A 2MMYA 2M8HA 3CTRA 2G0CA 1FXLA 2BZ2A 2M52A 1X0FA 4OZ1A 2MZ1A 1YJNS 1X4HA 3DXBA 1YWXA 1M5VC 2DK2A 2E44A 2CQIA 2MKIA 1X5TA 3ULHA 1M5KC 1WELA 2DNGA 2OTLS 2DO0A 2E5HA 2N82B 3IWNC 2RRBA 1VQ7S 4PKDB 2JX2A 4M5DB 1U1NA 2J0QD 3FEYB 1QVFR 3PIOQ 2OIHA 3UE2A 2MQLA 1WEZA 2Q79A 2UP1A 1WHXA 2DH7A 1A7GE 1X5SA 2DHAA 1HA1A 2J8AA 3Q2SC 2CQCA 3G96A 2CQPA 2N3LA 1NO8A 2DH9A 1U1OA 2CPXA 5CYJA 2CPZA 4UQTA 2LXIA 1KOOA 3NNCA 2MY7A 1U1KA 2GO9A 2MZTA 3Q2TC 1DBDA 5DDOC 2MZRA 2XS7A 4TU8A 3G8SA 2U2FA 3UD3P 3MXHP 2LA4A 2CPFA 1FHTA 2CQGA 1DRZA 3NS6A 4QU6A 5LXRA 1P1TA 1FJ7A 2LA6A 2G1DA 1YIJS 3MUMP 4TLQA 3S8SA 2LYVA 1RKJA 3CC4S 2E5IA 2DNRA 3THTA 4C7QA 1OPIA 4YB1P 1X5PA 3R1HA 1VQ9S 2WBRA 2J0SD 2FY1A 3S7RA 3VAJA 4WFNQ 1WF0A 1JJ2R 3HI9A
chains in the Genus database with same CATH superfamily
1WKJA 3OBIA 1T9WA 4P74A 2UU9H 3D66A 3HDSA 1NXUA 1W25A 4B3SH 4UTGA 2F9DA 1C0UB 3UO0A 2QL7B 1WE8A 3OSPA 3GP9A 1M90T 3FKBA 3HZGA 1BQXA 1T3NA 4QYRA 2OFGX 2LP4A 2AJ1A 3BV8A 2HAFA 2ZJPQ 2WBMA 5D0GA 4EO8A 3VGSA 1EQMA 1V3ZA 1ZM3A 3S1TA 4ED3A 3A12A 3M2UA 1PBAA 4DV0H 1PSDA 3X1LB 1RYSA 1OMSA 2ZHOA 5KTQA 2VOPA 3G6VA 2LRRA 4GO5X 2FZGB 4YB6A 3C6TA 4DUYH 4QBUA 4F0KA 3UD4P 1MWZA 1LWFA 2GIQA 2I6WA 2Y1RI 3L7UA 3PYFA 1F5BA 1HQEA 1T8EA 3T5KA 1N32H 3NWRA 5LJ3Y 4RNMA 4LBHA 3KK2A 3JB9k 5DLFA 5D0HA 2HVEA 1I1GA 2ILZA 3G82B 1F3FA 3CEDA 5A2QU 4NYZA 5K8MA 1LWCB 4BDPA 2IM1A 5LMUJ 3C46A 1IKVB 3ETMA 1DARA 1W26A 1RBAA 4KFBA 4NMXA 3D2WA 5HI7A 3D28A 3VF0B 2CNNB 4ED0A 2VOOA 5JJBA 3IC1A 1SUQA 3ADAC 5KG4A 2EK6A 3JTPA 2V4JA 1E6YB 2D3OR 2DPJA 1SV5B 1RAEB 1F9EB 3HPOA 4ILMA 1XNRJ 1F5CA 2BDPA 4ECRA 2ADBA 1NSQA 1JLGA 3SCJE 2V8PA 1A0OB 2FHMA 4FF2A 2R7OA 2CNKB 3EGVA 2HZCA 2F9JA 3QAEA 1RCOB 4IFVB 3DFEA 5GADI 3P5BP 3GV5B 4HKQA 4KR0B 3N79A 1HMVA 2AKWB 3M8YA 5HQ8A 4C3LA 3ZFVA 3AQOA 1NJWA 2CJAA 1XR6A 3J81U 4P71A 3U02A 2HNDA 4HYKA 2ZE2A 2ZHAA 2F4VJ 4GRSA 1RWWB 4XDCA 2AIRB 1HHQA 2J9CA 1FNMA 4WIQA 4OV6A 2IPOB 4G6VB 3PX6A 2W24A 3HJVA 4C8NA 3NGKA 3V4MA 3H4BA 2HHUA 1LXNA 5DJBA 2LTLA 3MR7A 2DNYA 4KHMA 5LL6d 4HR2A 5IC4B 1W7WA 3LWMA 1DTTB 1HNWF 1NH7A 2MKKA 2ZD1A 3SMZA 2VG6B 1LW0A 2D1CA 5KT4A 3DYAA 4KQZA 3IN5A 4WZQA 1YBAA 5L39A 2I38A 4BA2I 4M8LA 4AL6A 3FRYA 4AT1B 1WTBA 4IG0A 4OI3A 2LXUA 2QLWA 5EX0A 4LFBF 3Q22A 5J1NA 1Q8BA 4N56A 3QT6A 1XERA 1LFPA 4EU0A 5DG9A 1QUPA 1CG2A 4I2QA 2HFVA 5HBMA 3AA9A 1SIWB 4DEZA 4ELTA 4FJUA 4NYPA 3H4DA 2FTRA 5KFGA 3MWBA 1KVKA 5B09A 3V6DB 2H48B 2B3TB 2CTJA 4PEOA 2XEXA 1PJ5A 2LCWA 4EBEA 3NOCA 4OHVA 2XMAA 2CG4A 3K59A 2EFOA 5K8NA 3ILOA 1IR0A 1TKZB 1MW7A 2DR8A 1HQ2A 2VBYA 1OSCA 1YJRA 2VICA 4NLVA 3DM2B 3BN4A 1EIYB 2I5JB 4DV1J 3KKFA 3V81B 5ITHA 3BO2A 1JLCA 3IM8A 3R27A 4KV8A 5AE2A 1U24A 3DU5A 3HVTA 2AJ2A 1M5VC 1RHKB 2E44A 1FFSB 1KNZA 3IWNC 2RU9A 1F2GA 5E3CA 2UP1A 4OQJA 4C97A 4EEYA 3DNCA 2EWHA 3TJ8A 3ET6A 2N3LA 5AE3A 1U1OA 3CW2C 4UQTA 4DR7F 2HRYA 1MSZA 3Q2TC 3HVRA 2JLFA 4ED6A 3PZPA 4ZVRB 4LF4H 4LF6H 1BXNA 5KFPA 3QGGA 4WALA 1V5VA 2YNGB 1GT8A 2BE2B 3N01A 4RW9A 4KHPF 1VIGA 1OYEA 2J0SD 3EWGA 3S7RA 1NK0A 4K0KF 3IMQJ 4NEYA 3HT3A 1APSA 2KL8A 1H7XA 4U7UD 3T1YF 2VD3A 4NEZA 4JI5F 1L3TA 2V34A 3LO3A 5KT6A 4JP8A 2B9YA 1YJWS 3SDEB 3MMAB 4PQUA 5LJ5Y 1XR5A 2CQ2A 5A8RB 1RABB 1JLBA 5I3PA 5DM6Q 1PAEX 1KP6A 4MJKA 3TX8A 1IQTA 1W2BR 5EDWA 1HBNB 5GAGU 4CLZA 5FDLA 4J90A 1SCJB 5HO4A 4B3RH 4M63A 3IAM9 3QLHB 2UUAF 2ZDPA 3QSIA 3JS9A 3VGUA 3VQTA 5BYRA 3W5YA 1ROFA 1CC7A 1RHJB 2YPZA 1WC5A 5IT9Y 2WZ1A 3DDIA 1N36H 4F2RA 1GEHA 5B0CA 2CPQA 1KTVA 3Q23A 3WIVA 2HVZA 4ED5A 2JJ4D 1N54B 1CJUB 1Y9OA 4J9KA 4CLFA 4JI1H 4PWDB 4NZ0A 3OJSA 2KT2A 4DV5H 1XEZA 1S9GA 4I64A 3FQKA 2RSQA 4ECYA 1CVJA 2JEBI 2HHWA 4WYWA 2FHKA 3OUYB 5LL6b 2IDEA 3F56A 3DOKB 2RDIA 3H59A 1SI9A 1DT4A 4NA1A 3MM6B 4ED4A 4DU7A 3CCQS 4N77A 2IM0A 2W25A 2YNIA 2JZXA 3LGNA 4J9VA 3WDOA 3R2DJ 1CJVB 3I0RB 4YR3A 3CCMS 2YH1A 3BS9A 4EYIB 1ICEB 2MKSA 3OL8A 1S4FA 1NXIA 2QLJB 2WTFA 2BM0A 5KOWA 4DV4J 2X7IA 4F0HA 3G6YA 1MROB 2CNOB 2UUCH 1OWXA 2J8SA 4OJ1A 2DT9A 3CDEA 4OYAA 3PKYA 2XS2A 4OZ5A 3AOAA 4HI2A 2DD8S 1Q5VA 4OYZA 4F4XA 3BB5A 4JI3H 1HWJA 3CCRS 5KFWA 5LMUF 2JLGA 5KFYA 3SYZA 3I9V9 4TYAA 3WC2A 5KFVA 2CVIA 4LRAA 4B8TA 2JH3A 4ECWA 1TAQA 3JAMY 4A8XA 4IH7A 3H2LA 3I96A 3L09A 2OPQB 1TUAA 1J2VA 1A9NB 4RBVA 4B9MA 2CTFA 3I56S 3IO1A 2UVVA 1XJWB 4ILRA 4V19J 5DS7A 2M7SA 1NJZA 1XNRF 2BANB 4RPFA 3EX7B 4IDKA 3KLGA 2QFJA 4ZVGA 3TA0A 1IJFB 4NWBA 4QW9A 4RW6A 1KN6A 5DGAA 2Y0SD 2ROGA 1WG5A 2VH7A 4MYUA 5KFDA 4FYVB 4DF4A 5H9FK 3FK4A 2XHWA 2Z4PA 4TY9A 1U49A 2B51A 4ELVA 3OSSD 2MKYA 4DXLA 3FEXB 3GIRA 3W5XA 1IVZA 2COLA 1KD1T 1MN9A 2LQBA 2D69A 1MLAA 3PX4A 3SQGA 2F4VF 4C4WA 1QVGR 2R7UA 3MR6A 3EZUA 5C25B 3K2YA 2DNZA 4WFBQ 2CKWA 5L1JA 1UPMB 2ZC4A 3T1AA 1ACMB 1DLOA 4Q0BA 1DTQB 2V63A 2O5DA 1HNIA 3QGIA 3T9NA 4P75A 2XZWA 2E5LH 4OZ2A 1Z2ZA 4K8RA 5KFRA 2B6AB 1C1BB 1KKHA 2W4PA 1RT5A 1KOHA 2UXBH 3Q8QB 2DY1A 2EPIA 2PT0A 2F4FA 2DTJA 4C8MA 2QO3A 1SIZA 4G65A 2FJWA 2MKIA 2KFZA 3QJJA 2C3OA 3T41A 4MKYA 3PEHA 4LIJA 2AQ4A 1LW2A 3IRXA 2MQLA 3CCWA 3Q8SB 4CYUA 2HFOA 3B78A 2VC0A 1HBMB 4R25A 1R43A 4ZVUB 1T9XA 3G6XA 1BQNA 3EMTA 3GJTB 2ZH2A 3IA0A 3KOAA 5J2NA 3MXHP 4NYOA 3CIZA 2C3UA 4JV5H 4Y2MA 3CJKA 2ASJA 2W8KA 1RJJA 2JA9A 2POKA 4X4TA 4JI2J 1MWQA 3TUJC 1SQGA 2E5IA 1R8BA 3EZOA 1UA0A 4K4VA 2AJFE 3ZTRA 1QJHA 1JLFB 4IR1A 4YP3A 2C3YA 4TN2A 1QLNA 1S12A 3B54A 4O44B 4LIWA 2W2PP 1RISA 4DV1F 3EM1A 2DR6A 3R1LA 1E6VA 1U6FA 2XCPA 3Q8UA 3AAWB 2EFVA 2DISA 1R8CA 2KT5A 4DL3A 2CPIA 4DSLA 1X4CA 4JI6H 2XHCA 2GJ2A 1KVIA 1NKCA 1C0UA 2JSXA 4FF1A 3U1KA 5K14B 5AXLA 1I6JA 2E5JA 4DL5A 4QU7A 1RTIB 1SJRA 3VR1A 2NXJA 4DR3H 3OL7A 1EKSA 4GKKH 3Q8YA 2YWEA 1JB0C 1IBMJ 1ZZKA 4NCBA 4GC6A 3KLVA 5I3UB 1A6LA 3FZBA 4QWCA 4RUAA 3RB6A 1SL1A 1AXQA 3O8WA 4DR5J 4OHWA 4JI7H 3KLEB 1XMBA 3T6JA 3BR9A 2GQ2A 1I94H 1FDDA 1R6VA 4DFKA 3R5CA 2ZH1A 2E7VA 2D9IA 3NNAA 2DNOA 3DGVA 1NDPA 1UAWA 4X4SA 3L7PA 1N6QB 5E3RA 4DL7A 2HAIA 3I55S 2XMJA 4UUXA 1LWCA 1IBKH 2MQNA 3MD3A 4HT5A 1TL1B 3RW6A 1J5EJ 2P9GA 1V6HA 2I2YA 3G86A 3CXCR 2JDJA 2CQHA 3G6ES 4YMEA 3H98A 3RR8A 1E6YA 2KYZA 5HQLA 2JZ5A 3BQ2A 2VF3A 4ZCMA 3MGJA 1YDLA 2IMOA 5KG5A 2GHWA 3M8QB 5JXSA 2A2CA 2RHSB 3CCLS 2CJQA 3ZZUA 5IC6B 4C11A 5MAOA 3CJ8A 4IFVA 5E3AA 4YFUA 4HACB 3PW2A 1FEEA 1JIHA 3MM7B 4Q43A 1SVDA 3ITHB 2DNNA 3I6PA 4RNHA 2D41A 2RQMA 3OR2B 3BKTA 5ADZA 1KWMA 1F60B 4WIIA 2DGRA 1IR2A 2AGPA 2NZ4A 2YKOA 1F1BB 1BQMB 2CYYA 1U1MA 3J7AK 4K50A 1WSRA 2UUWA 2KXHA 1F9HA 1RT7B 1YGYA 1DTTA 3D1OA 1UEVA 2VFUA 3R5DA 1HWKA 3SBMA 2YH0A 5CCLA 1S49A 2VG6A 2O4CA 4PYAA 4CNZA 5BXIA 4G3IA 2XMWA 2AWZA 5C7PA 2OELA 1H2VZ 1IKWB 5H9EK 3MMJA 1EJ7L 1F6TA 2DGQA 5K9FA 3DRRA 2O01C 1U2FA 4DUZH 4DPTA 3HLUA 1S5ZA 2B7CB 1C2PA 2EFPA 2DNLA 4LF4J 3V6DA 2NUUG 2AZ3A 3PW0A 5HLFB 2FQQB 2FMRA 1S9EB 3GFZA 2QLBB 3QIPA 1QTNB 4MT1A 2D3UA 5CHCB 1YRXA 3UDEA 3MPVA 4PG6A 4LF5F 1UVMA 4Q7AA 2GC8A 2M52A 3GG0A 1X4HA 4A8YA 2C3PA 3DM2A 2W2OP 1WELA 2I5JA 2E5HA 1S59A 3V81A 1QVFR 2G2OA 1N5TA 4I2PB 2ZM6H 4WE1B 4U8YA 2ABYA 4HDHA 4ZJLA 3AJDA 2HHHJ 2KO1A 3FBBA 2FUG9 3W8GA 2MZRA 4S0MA 2HHPA 2LA4A 1FHTA 2B4OA 4DV7J 1FE4A 5LXRA 4A8WA 3DDNA 2QMUB 3RAQA 1U2CA 2HVDA 2ZOGA 5KFIA 3WX8A 3LH2S 3CC2S 1GTEA 1RT4B 3W60A 2OI2A 2LEBA 5KFUA 2VPWB 1N8RT 2RVJA 2YNGA 2R4FA 2WVCA 2BE2A 2HH3A 1B3TA 2AJQA 3R2CJ 3CD7A 4NX9A 2WVDA 3L4BC 3OTDA 2RQCA 3AFGA 1V3SA 1K1SA 2XG8A 3W61A 4EYHB 1OS5A 2DGUA 5AE1A 4CRJA 3SDEA 4H4KA 4D3GA 5A8RA 3T3FA 2IM2A 2J7KA 4W92B 4JI0H 3M9OB 2DCUB 5KFAA 3VZHA 5GAGI 4LBPA 1VLOA 5I4MA 1HBNA 4WKYA 3GJRB 2OPVA 3MUTP 3V6HA 1S20A 3NXZA 3EYZA 4JI2F 3TA1A 5DETA 2OPRB 3H40A 3I5BA 1AYEA 3QLHA 4F02A 1FKPB 1U47A 2L3MA 1PJ6A 3PYEA 4R5PA 2V68A 1S03G 3RB3A 1XN9A 4QPTA 4CIOA 3A3PB 2C28A 3DRPA 2E1AA 2IM3A 2BACA 3I32A 2FHJA 4AFFA 4Q45A 1MN7A 4DS5A 1WC3A 4DQQA 4USKA 2AZ1A 1V8CA 4OZ3A 4JI8J 3G9CA 4PWDA 2AX1A 5FIIA 2CJ9A 4F4ZA 3OLAA 2HFNA 4O3OA 3A4TA 1WG4A 4ZVQB 4CLTA 1HQUB 3R7BB 2XSJB 4USIA 2JEJA 4RU2A 2AGOA 4MIBA 3H5SA 3OUYA 2RB7A 4HLBA 1O0PA 5KFQA 4Y2CA 5LSRA 4X65H 4AE5A 3DOKA 3VWSA 4EO6A 2QMXA 3MM6A 1IBMF 2YQRA 3BH7B 1G4CA 1QSLA 2XMUA 1T03B 3N9UC 2Y8WA 2MB0B 3HXMA 1CJVA 3I0RA 2JC1A 2J0WA 1RT1B 2FLLA 4NLXA 4DR5F 4O3QA 4TVAB 1GK8A 4KGKA 3MPYA 4FKXA 5CAAA 2P9EA 5BR8H 1MROA 1BGXT 4Q44A 2V8HA 2HPUA 1Y10A 2PO4A 2V94A 3DLLQ 2AF6A 3TNVA 3QT5A 2CWFA 2VA3A 1RTHA 4ID8A 1HW8A 4F3QA 3TP2A 2DGTA 2BV3A 2Z30B 3D6TB 4NXMH 1J5EF 4M5MA 1B7FA 1C4CA 2IA6A 5T14A 1UFKA 2KT3A 4AUKA 3MPWA 1NKEA 4CLUA 3OFHA 3RB4A 5IM0A 3GV7B 1X4AA 2W4DA 4IO9Q 2BQUA 1GTHA 2BOAA 3W63A 2QEXS 2HLTA 4IOCQ 4CO0A 2B43A 1CQMA 3V5RA 2WRMA 4FNIA 2E5LJ 3FSXA 1FCAA 4WP9A 5CD4H 3QRPA 2BANA 3BF4A 3ONQA 2XLKA 3U27A 4B8CD 3NEKA 2G2ZA 2OSRA 3HFKA 1F9FA 3GTYX 1LV5A 2PMZD 2EBGA 4P73A 2PEBA 3H25A 5HVHA 3A3NB 5DZ6A 2PE8A 4IRDA 1G7CB 4RWWA 2ZH5A 4XTTA 2XC9A 1N5VA 4ZITA 2DR7A 1R89A 1M1GA 4ID5A 2VDHA 4RUBA 4A47A 1WF1A 2LDYA 1F0XA 2HBZB 3F44A 3I0SB 1X5OA 3L9ZA 2FHOB 2VUGA 2ZBQA 4C0HA 2DGXA 2R2SA 5C25A 1NH8A 3CMAS 4N8OA 1UFWA 3DHWC 2FJDB 2J6UA 2M8HA 1Z2LA 2F40A 4I6YA 2G0CA 1DTQA 1EETA 1SH3A 5E33A 3PJXA 2EG2A 2MLYA 3FCHA 2NQPA 1C1BA 1G6BA 4M5DB 2HFZA 2MLZA 1Y5NB 2DHAA 1OQ6A 1M0SA 3T19A 1N5QA 2Y0BB 2XS7A 3W9IA 3SI8A 1R3NA 4X2BA 4WXWA 3EZ5A 3DMJB 2RMLA 2H65B 3NS6A 4PYDA 3FC9A 5KFLA 1TV6B 4RW7B 1N5YA 1HBMA 1RT6B 2PI4A 3QIDA 5D4LA 5J2MB 3W9HA 4WFNQ 4USMA 5C5JA 3U7JA 4LF4F 3CDBA 5ETPA 2W9AA 3MM5B 1P1LA 4FDFA 5KG3A 5D0EA 3FBCA 5E3QA 2FYXA 1AFJA 3TJAA 1JLFA 2AYBA 1Q53A 4Y2AA 3D4JA 3PM9A 1Q7LB 2EKYA 4WBFA 3UDLA 4WJBA 3TQEA 3TUIC 4FYWB 4TNOA 4QWBA 3H7HB 4X4UA 1SH2A 4OI0A 2B4UA 2A0FB 2YWWA 2HHHF 2W7AA 1SL2A 4OI4A 2K8GA 2L9DA 2HHTA 2NN6G 1Z1ZA 1JLEB 4DV7F 1RWVB 1KLNA 2WSCC 1HWUA 3D0GE 5K14A 4Z7YA 2MEWA 3UPFA 2EBEA 1RTIA 1H6KX 2FLNA 3C8YA 2E5GA 1HNWH 3CCJS 6FD1A 5E3PA 4YB5A 1NNDA 2BW7A 3N6LA 1NEEA 1RAHB 1U02A 4KH0B 4CT9A 1TUVA 1L3KA 1SJ4P 5KFMA 3Q0AA 1RADB 5LM7E 3OTOJ 5I3UA 3N6NA 4LFBH 1T02A 2V2KA 1FT8A 2CPEA 4EMDA 1DTJA 3UQSA 3S6EA 2JNJA 3KLEA 4ZP6A 4FN5A 2GA7A 5GAHU 1YJUA 2FJAB 4PXCA 3VQSA 3MECB 1YBUA 1HARA 4Y00A 3CCTA 4OI2A 1ZTWA 1N6QA 1ZBTA 4IRCA 1RWXB 1FTRA 3B8HA 2OEMA 4J9SA 3CJ0A 3M05A 2K3KA 5MLCV 2WOMB 3MR5A 3K89A 2EI5A 5ETKA 4I4BA 2CTLA 1S6OA 1TKXA 2XO6A 2EFNA 5HMWA 3B82A 3KJNB 2CNLB 1CULB 3CDUA 4MFBB 5LOQA 2VQFJ 3FEZA 4JI8F 2OEKA 3RJMB 5KT5A 2ZH3A 1JKHB 3FBEA 4BS2A 3R5GA 2AXYA 3W7BA 5KG2A 2ANNA 5HROB 1WHRA 3GABA 2GNKA 2OHDA 3IGVA 1H7WA 1UCNA 3N4WA 4RJVA 3PTWA 4Y34A 1YITS 3ITHA 4ZS6A 3SFGA 2BR0A 3VKEA 4KHPH 3OR2A 2ZBIA 4IQMA 3PCOB 4NXNH 3CMES 4LRCA 3UCUP 1NB7A 3JXOA 5ETRA 1I6UA 3T1YH 2OP5A 4JI5H 1I3OB 5L9XA 1R7IA 1BQMA 2C3MA 4L72B 2HZAA 2R7SA 1UJ4A 1TL5A 1LQ9A 3R6LB 2KYXA 1FKAF 4PCQA 3TO8A 1RT7A 4LJMA 2VKCA 1R0CB 1TR0A 4A46A 2BJ9A 4J9QA 4QWEA 2UUAH 1OQ3A 1B64A 2VPXB 4OHZA 1IKWA 3UCGA 3C3LA 2M2BA 3DLKB 3M6UA 3TVKA 3FBFA 2XCAA 1U1QA 4ANEA 1RK8A 5SZTA 1IKXB 2QSFA 3BSAA 3TAPA 2V2QA 2X1FA 1RTJB 1FDNA 3K17A 3KK2B 1TU0B 3RUBL 1BC6A 2MZ1A 5ETTA 1VRQC 2LQ9A 3DXBA 2DK2A 2RQKA 2E5LF 1WTFA 4QR1A 2ZNZA 3E51A 5HLFA 1M5KC 1ZZIA 2HS4A 3C15A 1S9EA 3K8VA 2FY8A 3GIIA 3GFHA 1TL7A 4C98A 3HHDA 2R9LA 2Q79A 1KFDA 4KFBB 1NO8A 4I7FB 3O6QA 4KJIA 4ED2A 2HQFA 2Z57B 2BJ7A 4TU8A 3UD3P 1D9DA 1SUQB 1UETA 3OPKA 4I2PA 2IAJA 1ZETA 2V4JB 4IYQA 2PFDA 5J1EB 1N0VC 1FDBA 2FY1A 2FJVA 4CM0A 1LKZA 1JLGB 1FRIA 2UV8A 4LRFA 1AUSL 4GMKA 1RB0A 3CO0P 5M2UA 2KH9A 5LXYA 2ZUGA 2VB6A 2ASLA 1AN7A 3WBZA 3NGRA 4K4SA 4ZHRA 3SSSA 4NLUA 1RWKB 1XMOH 1RT4A 4FF4A 2R7TA 2VFVA 3HFZB 2CQ4A 4WFXA 1RHQB 2NYIA 5LMUH 5IT9W 2JEAI 2G0IA 2LKZA 2NPIA 2XZTB 1Q8IA 4EGLA 2AU0A 4J7CA 2BOPA 3BSNA 4A8KA 4FS1A 2CPMA 4N7TA 3CD6S 2C42A 5FD1A 1IKYB 1BD6A 4DQPA 4R8UA 5DO2A 2VQEJ 2JFDA 2QMWA 4YR2A 2YNFB 1H2TZ 5AJ3J 2V9WA 2Y3YA 2R8IA 1HW9A 4WK1A 4OX6A 1SKUB 4F26A 2F65A 2DJWA 4DR6J 3AA8A 4O0NA 1HR0J 4DR3F 4P52A 1XNRH 3ELHA 2G4BA 3L3CA 3M8RA 3HKZD 4KGXB 5F0WA 2HWTA 3HHLC 4I6AA 4QWDA 4ETZA 4ETXA 1FKPA 3D6MB 4DZ6A 4KC5A 1KQKA 3UDVA 2OPUA 4MK9A 1RWMB 2M6QA 2BMBA 5K20B 1XNQJ 5RUBA 1RZMA 1Y3JA 1OPZA 3PRDA 4OI1A 3V69A 1BMQB 1JK9B 5ETVA 2F4VH 3A8EA 1QSYA 1KRPA 1EKRA 4IUFA 2HGLA 1FNXH 3NMRA 3H2UB 4DOZA 3R5AA 3CSKA 3OSNA 1IBKF 2B0GA 4EBDA 1SL0A 4WANA 1GMVA 3PJWA 3NCVA 1HQUA 3FCVA 2XSJA 4ZVOB 4DSKA 5T7LB 9ATCB 4URGA 5ETNA 2VV5A 3W2WA 1HBUB 3LTOA 2GVZB 2MSSA 2JHEA 1PKUA 5IS2A 3K5MA 2E1MC 5GMDA 3A8JA 4JOUA 5HL7Q 2RT3A 4KY3A 4B9UA 5L1IA 2ZOFA 1NK5A 4DLGA 3CO9A 3VAIA 3WQPA 1T03A 1L5UA 2HHQA 3OTOF 1PO6A 4Q8FA 2WVFA 1RT1A 3M30B 2DY9A 4NE9C 1Q8LA 5CH7B 1KTQA 1WI8A 4RZRA 2JC0A 5KFFA 2J6SA 3GPAA 3J7ZT 1U25A 3RGIA 5K8PA 1MSWD 2OPSB 2M9KA 4NA2A 4KGMA 4GVLA 3CJTA 2MGZB 5JVHQ 2QGFB 4OI6A 1X60A 2CTEA 4PXDA 1KVJA 1NB2A 3GWCA 4ZPCA 3AD9C 5CYMB 3OLBA 2YVSA 1VK3A 4UOCA 2ZZNA 4DV1H 3SV3A 1R8HA 5GAEI 1U0SA 1JXLA 4XPCA 2UVUA 1NSKL 2VPYB 1JLBB 3AD8C 2AJ0A 2W8LA 1DQ9A 1C0TB 1UG8A 2VQFF 2HFUA 2CQ0A 3OR1B 3FNNA 1FD8A 4PUOB 3MR3A 2RIJA 4WWSA 2IMWP 2C2RA 2A6OA 1S97A 2OH2A 3EGNA 2CWKA 5F41A 4ZPDA 4X4NA 1TVRB 1NDKA 2GAGC 2J7WA 1SPBP 4RBUA 2N7CA 2MZSA 3I0SA 1S6QB 2OGUA 4JV0A 4X66J 4J9RA 2Z0SA 3CTRA 3JSBA 5HSPA 2BXJA 3NOGA 4C8LA 3A1YG 1BHNA 3NG8A 1K0VA 2JX2A 4QPXA 1NJYA 1U7LA 2ACMA 1X5SA 2V5HG 4LFAJ 2J8AA 2HBQB 4DU8A 5A8KB 2DH9A 5KFNA 4KT0C 1X0AA 3LAMA 2VKRA 3M1VA 5FLXU 4M5DA 2ZM6F 4RNNA 4PZVA 1X8DA 3ZZOA 1LWEB 1RKJA 3THTA 2BKPA 1OPIA 1PBUA 2V50A 4B9SA 2WBRA 4WK3A 3MCOA 1Q0NA 4U95A 1HWLA 3DMJA 2GV1A 3HF5A 4MAKA 2HYIB 3VAFA 4J9NA 1YRTA 2MZQA 1TV6A 4RW7A 3R6GB 3J7A1 1RT6A 1TK5A 3RAXA 2GX8A 1YJ7A 4PRFA 4B3MJ 3MURP 4ER8A 1T9UA 3SSQA 3HHEA 2ZBRA 3MM5A 2HSEB 4RKUC 2BJ8A 1DHMA 1GX6A 3H2VE 3BPSP 2KVQE 3KMSA 1Y11A 2F7VA 1CEZA 3KDNA 1EZZB 4DWIA 2XB2D 4U8VA 1NDCA 3SFUA 3UFCX 3ZNUA 4CLLA 3MM8B 4J91A 3OD2A 4H54A 5HANA 1ZTTA 3PXGa 3VTIA 1QD1A 3IR6B 2MQMA 5DQHA 4UZBA 1BWEA 1JLEA 4P7TA 4DFJA 4KBIA 4RW6B 1WHVA 4DV4H 1CLFA 1YBTA 2RF2B 3J7AN 2PQUA 2QC3A 2EKNA 2H54B 3QBCA 2FVRA 2OFHX 2J7UA 2QE5A 4B9LA 1H72C 3RRKA 2LF0A 2CWHA 4ECVA 2ZH6A 2ALYB 2QG9B 1S1VB 4JV2A 1KONA 4ZCIA 5KAKA 3IBFB 1ZZNA 4ELUA 3RAMA 2AD9A 2L48A 5C24B 2VZ9A 1TL4A 1VISA 1RCXB 1YZ7A 4DL2A 3M2VB 3DI6A 2XGQA 2QZ8A 2VQEF 5AJ3F 1AT1B 3MEKA 4M5LA 1T9YA 3TUZC 1HNIB 1KSPA 1SC3B 3C6UB 2YX4A 2VG5A 4NMLA 4NCAA 4DR6F 1HR0F 4FF3A 4X65F 5I42B 2K06A 1VQNS 3H0PA 4NXNJ 2GMHA 2EC2A 1VQ6S 2J6TA 4QCLA 1XTZA 2D3ZA 2XSFA 1B70B 2K3IA 3B4DA 3G71S 2DR5A 2WOMA 1FK9B 5EN1A 4CLKA 2JVRA 3K58A 3FAUA 1UJ5A 5DZ7A 3LANA 2CZ4A 4E9JA 5HJXA 4KE5A 1S6UA 1CJKB 3NBPA 1XNQF 5T41A 3R7SB 1ZA1B 2IRUA 3KFWX 1ZTGA 3OFEA 2Y3MA 2OO4A 2PMHA 5J2NB 3QYYA 4MFBA 3EXYA 5B08A 4A48A 3N5FA 3OTCA 2AT1B 4CLSA 1X9MA 1JKHA 1FXDA 1BE4A 3K5OA 2QIFA 5KFBA 4XPEA 5HROA 1B0PA 3DXSX 4NXMF 2W9CA 3WZ0A 1T0TV 2G8YA 2DRAA 1FX4A 1VYAA 4ERDA 3M6XA 3AB4B 5ETQA 1RWPB 1VIOA 4W90B 2V9KA 2SXLA 3LAKA 1Y4ZB 1S0NA 2H4YB 4DG1B 1U8WA 3BBBA 4FBTA 2YWHA 3PNIA 2GFFA 1M1KT 4KHRA 5IWAJ 4V19X 4GKJJ 3DOLB 3OVBA 2ZUAA 3OXGA 2IJNA 1TTHB 1CJTB 4LF7J 2F1FA 3EZJA 1YTYA 3UWTA 3GMGA 2C2NA 2FPHX 4OX8A 3KK1A 4IH6A 2XMVA 4LSZB 2CPDA 2F5GA 4AM3A 1FRHA 3KG1A 1FVQA 4FVCA 4NOHA 2K7KA 2XO7A 2M70A 4ECXA 1YLXA 1H73A 4JI2H 3CF5Q 2DNQA 4K2JA 4HTJA 4ZP9A 1REGX 1R8PA 3MCMA 3PVXA 4RX6A 4M5NA 1RWOB 4DL6A 1S6PB 1JX4A 3DLKA 3HD1A 1GMWD 2WK4A 2OTLS 1IKXA 1RTJA 2YNHA 1HA1A 2WVBA 1AA1B 3AD7C 4K4UA 2PA8D 1NSAA 1HYSB 1XMOJ 3KXDA 2P6SA 4DHVA 4RWXA 2XQCA 1PC5A 3EICA 3HT0A 1WDDA 4QYZJ 3CB4A 4L73A 4RLEA 4I7FA 1Q78A 1VDHA 4B3TH 2PD1A 3PDNA 1ZYQA 5HMZA 1YSJA 4DX7A 4DJBA 3T5JA 4O23A 5H9FJ 3OVSA 4EFAC 1RWUA 2BABA 2O3DA 3BGUA 1IBMH 1UFLA 5J1EA 5D3GA 2WCXA 4X66F 2FVQA 3L7ZC 1UA1A 2C1EB 2ANRA 1IWAA 2V8DA 4OZNA 2VA2A 4DR5H 1FJGJ 2CDQA 5ETMA 4C11B 3QAUA 4QR2A 4A8MP 2LFVA 3T9ZA 4P10A 3IBCB 3MR2A 3ILLA 1D1UA 1J27A 4LFAF 4LREA 1ZM2A 3QRRA 1NK4A 1KC8T 2IHR1 4L74A 2I0XA 2QJ3A 2HS3A 1VR6A 2BQRA 5HP1B 1U6BA 4K4WA 3I87A 4ZN1A 2CXEA 1J5EH 2H1YA 1SJQA 2DB1A 1WC1A 4QIWD 4DUTA 4C3MA 2P8IA 4IQXA 1IKYA 3OW2R 1HNZJ 2YNFA 3A13A 3OTBA 1J5OB 3DN9A 5F9LA 3NNHA 4F3OA 5L9NA 2MPUA 3QATA 4OX9J 2LU1A 4B3MF 3AJ2A 4M5IA 3MPUB 1VQ8S 2RILA 2H5EA 1VBIA 1JWWA 1FF2A 2IRYA 2X1GA 4ZPVR 4N47A 5D4PA 4CT8A 4P2FA 5KG1A 1TELA 3DRRB 4HT7A 1D8ZA 2DHXA 2DYAA 2HHVA 3BYRA 4LIRA 2PDAA 4F8RA 2F63A 3EPGA 2MJUA 3BO3A 2X51A 3BGLA 2BQ3A 3CCZA 2FJEB 4DX8H 3BZQA 4ZLJA 3QIPB 2ERRA 2KM8B 4P6QA 2YKAA 2H4WB 5JUMA 3I5AA 3QZ8A 1P27B 3M4XA 1HI1A 3D5MA 5IQ6A 3GLJA 2B8QA 2E1CA 5T7LA 5DT9A 3NCRA 1MMLA 1HBUA 3UCZP 3AEVB 2GVZA 2CPJA 1WTJA 1B0VA 4DPUA 3HZEA 2B56A 1UWBB 3O5TB 4WP3A 3ZTOA 2UXCJ 2KVIA 3V6KA 4E8UA 3BGRB 2ZVIA 2A6MA 1HD1A 1P6TA 4LRBA 4FVMA 1G3OA 3IG1B 4QIVA 2J5AA 3M30A 4BC7A 1J5KA 2EVZA 2HHXA 1XC9A 2DGWA 2UXDH 1UZDA 2R3VA 2FJXA 3CGIA 4WZMA 3MDFA 4FBUA 4NZRM 4NPOA 4C6AA 2M88A 2OPSA 4DV6J 2PN6A 2MGZA 2ATCB 4ALZA 3MI7X 4BA1I 2RUGA 4UT4A 1FFWB 4CH1A 4NXNF 4X4PA 2KFNA 1VBYA 3ZZPA 3MEGB 3PW7A 5CYMA 4GVBB 2ZJQQ 1Q81T 1Q1KA 4OJHA 1PAUB 5DG7A 3FGVA 3HO1A 3G8TA 1IBLJ 2BJDA 4ECTA 3HMJG 3P49B 3QGPA 3K5LA 1S1UA 4TKTA 3T1HJ 3LGHA 1WG1A 3RYLA 1NJXA 2HHHH 4ZVSB 4L76A 1C0TA 1TAUA 1RTDB 1ELOA 3OR1A 3BBFA 5KFSA 4DV7H 4UY8T 4PUOA 1CS4B 3M32B 1X9ZA 4R5PB 4O4RA 2JEFA 3EE3A 1OSDA 5KG6A 1JNZB 2BRKA 2BL5A 4J9UE 3DRPB 3BYPA 1YWXA 2LEPA 1TVRA 5BYSA 1S0MA 2DNGA 1RU1A 2W7OA 2OD6A 1S6QA 4B9VA 4U96A 3TARA 4EI2A 1PCAA 3ZXWA 3GJSB 1QY7A 5IWAF 3H5UA 2CPZA 1ZAVA 7AT1B 4GKJF 2MY7A 2MZTA 4F4WA 3VZIA 2GJIA 2V67A 4LF7F 3LA0A 2LQ8A 3PO5A 3KJVB 1FRMA 1R0BG 5A8KA 3CC4S 3GYXB 4IFYB 1S48A 1WUUA 2FFMA 1LK7A 1TUGB 3R1HA 1G1XA 2FHJD 4DR4J 2HNZB 2P6TA 5C0XG 4WTYA 3GIMA 2XI2A 4ZLNA 3POTB 3W9JA 1ITPA 1NZAA 4ZP7A 4BHQA 2BJ1A 4U9RA 4FS2A 2WSFC 3F0NA 1Q5YA 2JVZA 1LWEA 2XULA 3QSYB 2YKPA 4DCJB 3ZZ0A 7FD1A 4RW8B 2H5JB 3TEGA 1GXTA 1K9MT 4QR0A 4FPRA 3QWUA 2GAHC 2ZZTA 4MK8A 3RRGA 4GC7A 3TJ9A 4JI8H 3KG4A 1XMOF 3R8YA 1RTHB 4ZPBA 2MSTA 4C9DA 3I4PA 5EUHA 5AXMA 2V4QA 2W9BB 3KLIB 2L41A 5KG7A 2Z0GA 2XZDB 1T9VA 2PA3A 4NL5A 4YB7A 4BC9A 5IM0B 1MNEA 2KTQA 4U7CA 3TAQA 4BCAA 2VBXA 2WW4A 3EPIA 5C2GA 2KG1A 3MM8A 3GU0A 1HNXJ 4CLWA 2AMCB 4MKAA 4A8FA 1VQ4S 3TZWA 1YJ9S 2D9OA 4P2MA 5KOXA 3CMQA 3G2XA 1V3RA 5BJRA 2RF2A 2Q43A 1AUDA 3KLFA 3PKMA 2K2PA 4LFCH 2YWFA 1FKAH 1VHIA 2E1RA 2FDNA 2W2NP 5K8OA 4TU9A 2XMMA 2EXUA 2AJ4A 5EGYA 2QLXA 4ID5B 4MIWA 3M8PB 1UVKA 4W98A 2AEMA 1S1VA 1U0HB 2YX1A 3EUNA 5AT1B 1TUWA 1RKIA 1FWKA 4H4OB 2D3O1 2J76E 3T5HA 1NK9A 5C24A 3DRXA 3M2VA 4B02A 4EZ9A 2CAJA 1VMBA 1X4EA 5KG0A 1NJIT 1HNZF 1K8AT 1EETB 2CQ1A 2HWHA 4DV3H 3C6UA 1Y3KA 1ZAWA 1RXOB 4HL9A 4OX9F 2M3DA 2KM8C 1HHTP 5IT9U 5I42A 4H8AA 4ZIVA 5K5MA 3DDKA 3TR5A 3LPEA 5KFOA 2NUHA 1IM4A 1U4BA 3H90A 4UW2A 1FK9A 1RBOB 3THPA 3IR7B 3QFWA 4AL7A 4BBYA 2GIRA 1N5YB 1GH8A 2RS2A 1CJKA 3MHYA 2OMOA 5F8NA 2FLPA 4ZA1A 1PYOB 5CQGA 3MAQA 3VAMA 1VBKA 3G4SS 2X1BA 4PDBA 1NBEB 2H5IB 4NLSA 3KG0A 3KUGA 3ZTQA 2JL9A 2MXYA 3HJFA 4F4KA 1X0PA 4WPAA 4WYLA 4Z2XA 1S4EA 3RZAA 1Z4UA 2XLJA 2BBEA 4DX5A 1IXKA 2MLXA 4ZPAA 2FIUA 1QTMA 4DG1A 4L6V3 3TA2A 3DCAA 2E66A 2RDJA 3B4MA 3BO4A 1GFWB 4PXEA 2UXCF 1M5SA 3OXLA 2QTWA 5C42B 1KQSR 1JXEA 1QM9A 3DOLA 3UD5A 2GJFA 4H4KC 4DPXA 1CJTA 3TEHB 4OV1A 3JSYA 1SJFA 4DPWA 5ETLA 4N41A 2HFSA 4B3TJ 3LW5C 2Y1JA 3ZZYA 3ZZZA 4Z37A 3GILA 4ICLB 4AQYJ 2XY5A 2V69A 2FJBB 4DV6F 4HI1A 4DR2J 2AHOB 2HQDA 1X5TA 4D3HA 1K0TA 4BWMA 4DCOB 4EZ6A 3ICLA 1WHXA 2DH7A 3BKUA 3F41A 3P8BB 3GCWP 2CQPA 2CPXA 3OL9A 2NSCA 1T95A 1H38A 1S6PA 5F3ZA 3Q83A 2CVEA 5A2QY 1MWYA 2ZKTA 5F8LA 4YHHH 4ED7A 1IBLF 2R7QA 1ZM4A 2GQQA 5CZVA 1AW0A 3M2RB 3HKWA 4NZTM 1X7VA 1YIJS 3C14B 1RA7A 4ECSA 4DPOA 4UOFA 1HYSA 4ZVHA 4DL4A 3DOMB 5B0BA 2VKZG 2R8GA 1SH0A 1QUVA 1LNQA 2WAQD 2CFXA 4KGVB 5CA5A 1UEKA 1SKRA 2KXFA 1TL3B 4KYZA 3PJ9A 2I9SA 2JWNA 1S77D 1S9FA 2R7XA 5A0YB 1U2RA 1TKXB 4K7QA 2EEYA 2M8DB 3V4IB 1VJWA 1I51B 4ZPTR 3DLEB 4E2FB 4K0KJ 1PYSB 1UJ6A 5F8MA 1U48A 1YHQS 4DF8A 5KT7A 3LALA 3OTOH 3KDOA 3CD0A 2F3JA 3CT9A 4JUZA 4N5SA 3NCQA 2GW8A 3J81Y 4JI4J 3IWXA 2C2KB 3D3BJ 4Q2LA 1ZS6A 1FRKA 1QAYA 4IOAQ 4FP9A 2BUNA 4JVHA 2RKIB 4Y2KA 2ZZMA 5GMEA 2ZBPA 5HMYA 3AOBA 4DR4F 2CJYB 4NLRA 4LR8A 3HSDA 5HP1A 4XIUA 3ISNC 2J0XA 2UVRA 5FLXW 4WKRA 3MEDB 2R2UA 3G8QA 2KHCA 3Q24A 3GJQB 1DURA 2G13A 2ZWOA 2C2OB 2XGPA 3FQLA 1O51A 2JOQA 2LDIA 3VV2B 2ZH9A 2YKQA 4ANDA 1J5OA 4B17A 3IRWP 1O8BA 4DV4F 1TKDA 4DS4A 4TY8B 1RLCL 2G1HA 2IC3B 3OT9A 1NK7A 3QMQA 2YKMA 1CPZA 2VQFH 3FCWA 4HTIA 1U1LA 3TZYA 4ES2A 2ZJRQ 3NCPA 4QZVB 3D0HE 2PEHA 1VQPS 4ZIWA 2XYGB 3E01A 2OKQA 3AQPA 2E1PA 1S1TB 1P9QC 2QL9B 2UXDJ 5GVQA 2AX0A 1TMJA 2QN6B 1M5HA 1RHMB 4QW8A 1VS3A 3PW5A 4USUA 2W4CA 4UQGA 2NZCA 2CJBA 4NLYA 2ATLA 4PXBA 3J80W 4CH0S 1HNXF 3J7YI 3C15B 1GXLA 1PYTA 4FXDA 1TL7B 3BQ0A 1XWLA 1NHVA 5DDPC 1HIYA 2O66A 3D1HA 1YJTA 3H20A 4FXWA 4QQBA 5IT4A 3MMBB 2DGSA 4EWTA 4PPDA 3RR7A 3O3LA 2OUGA 2Z58B 2HZVA 4MK7A 4X4QA 2IYIA 4NA3A 1Q16B 5HAOA 4OX7A 1UW9A 1FI4A 1UWBA 5FJ4A 2IAJB 2HMIB 3NS5A 1D9FA 4E98A 3BGRA 2ZBCA 1NM2A 3RF2A 2PIIA 2IIHA 2NXCA 1TKTA 3IG1A 3FRZA 2HK2A 1ZPVA 3RB0A 3MCSA 2HGMA 5F9NA 4HH0A 4NCGB 4ZHRB 5D8HB 4YOEA 1L3UA 4AXJA 1V9OA 3IM9A 2MQPA 1NSPA 3TX0A 5DLGA 4DR1J 5C2CA 2E9TA 3LP0B 2OJ3A 2DH8A 3W66A 1NHKL 1OO0B 4W4MA 1XMQJ 3EDQB 3Q8VA 1IQZA 3MEGA 2W01A 1M1HA 1UW4A 4OYPA 3H5YA 3LOUA 1NU4A 1HLWA 4GVBA 5F8GA 1NK8A 4YS2A 2DGVA 4R8UB 4ZMMA 4G1PA 3CCUS 4DCPB 2LEAA 4Z7CA 3KWMA 2HLUA 1FRJA 5KT3A 1HPZB 1S1XA 2EG1A 3GE9A 3OFGA 1RTDA 2CQIA 2RDDA 3KLHA 3KNAA 1OY6A 1CS4A 3M32A 2J0QD 3BM7A 3SCLE 4K4ZA 4WU3A 1R27B 3RTVA 1FKOB 1RDRA 2YWGA 2QA2A 3W64A 1KOOA 3NNCA 3O1LA 2Z2ZA 1EP4A 1RAIB 1FXRA 4ECQA 1ODHA 2GO9A 1LEOA 2GIFA 2BJEA 2WB1D 4DZDA 4QWAA 2FVSA 3OHAA 1DRZA 4IKAA 3SCKE 4QU6A 4K59A 1K47A 3MUMP 2X3GA 3AH6A 3HHKA 5CYQB 4O4GB 1WF0A 2L9NA 4YY3J 4F4YA 2CA9A 2XMKA 2VQEH 4DQRA 3NWGA 4F50A 3MF5A 3KJVA 4B3TF 3W2WB 4IFYA 4DR6H 3N28A 3QQCD 1DJ0A 1HR0H 4AQYF 2HNZA 4JVYA 3O2IA 3JTNA 1FESA 1VC0A 3POTA 3R5BA 4DR2F 4LF9J 5D6GA 1IUJA 2LQ5A 3TVZA 2ZQEA 3M8WA 1RHUB 5JVGQ 2HURA 2NXEA 3MEEB 3P96A 4OHXA 3U1LA 5ETSA 3D6FB 5J2PB 4AL5A 2B4VA 3BREA 5E5NA 1WEXA 5THWA 4J5OA 4RW8A 1VIXA 4Y0FA 5K36G 2KZMA 4F04B 1Q8KA 1GAOA 1K1QA 4CM2A 1XNQH 2XI3A 3CJ4A 4NLGA 4LFCJ 2QT7A 4WF9Q 4K4YA 1R6YA 4CI0B 1JQGA 1OJ4A 4EC5A 1Y5LB 4IG3B 3GR1A 3OV7A 1TQLA 2X06A 1B7YB 2O1PA 2W9BA 3KLIA 3NAHA 2CG8A 1EQ0A 3ENVA 1VQYA 2PC6A 1KHWA 2QSWA 3WX4A 2KFYA 1FDAA 5EWGA 3A8IA 4URSA 3NLCA 3TQ1A 4CQ1A 2VPZB 4J37A 3PIPQ 3M7VA 4O3RA 5EWFA 4JBCA 4DV3J 2Q6BA 2FGOA 5GAEU 1UKUA 9RUBA 4OJGA 2CQDA 4ED8A 3TRGA 4DN0A 3TYTA 4USVA 1U45A 4JI4F 2NXUA 1EC6A 3NP5A 1O5JA 3PR4A 2AEFA 5D4NA 5B0GA 1TMMA 4C8KA 1Y7PA 3K7RA 5LSOA 5A6WA 3CJ2A 2HEKA 3PG9A 2IJFA 1VQLS 4RBTA 1CBKA 4JB8B 2R8JA 1S0OA 4TYBA 3W62A 1WKLA 1YX2A 4U7UK 1RI7A 3ENAA 3QT7A 5KFZA 2FZCB 2Z2MA 2VONA 3M8PA 4HHJA 1U0HA 2K7JA 1AZSB 1Y00A 1H74A 4H4OA 1WC4A 3AXKA 1SXLA 2KKHA 5HJYA 5HVGA 1SC1B 4OHYA 1RT3B 1UWAA 1YZ6A 3DLGB 4LVNP 3NGSA 1AFIA 2Y9HA 5IFMA 4JYAJ 3NL0A 1GNKA 4LSLA 1LK5A 3Q89A 3DU6A 3M1VB 5J2QB 3EGWB 2DXDA 3GQCA 3KHRA 3KJQB 1OY9A 2MQQA 3GYGA 3KJFB 2GVDB 1RHRB 1WEYA 2G2YA 8RUCA 4CLPA 1N0UA 3EVOA 3P4UB 2IRXA 4PG8A 3GFXA 2VODA 4USJC 4ENOA 3V2UC 3C2PA 4OZJA 3K8WA 3L95X 2Q3PA 1SC6A 3IS9B 4MIAA 2UXDF 3RBEA 1FWLA 4YN3B 3MFIA 1JLAB 4ZK7M 4X66H 2HQGA 4X64J 3GSIA 2JEGA 1N5SA 1XQIA 3NGDA 3IR5B 3R97A 3BGFA 2N4CA 3WHIA 1X4BA 2P2CB 3PHEA 5DM7Q 4RW4A 4LFAH 3MOZA 3RBXA 4KPCA 1Q79A 1SC4B 3K0JA 4LF8J 2BEFA 4YHHJ 4ZCKA 1X4DA 4KTQA 3GSDA 2EW9A 1URRA 3OTEA 3BR8A 2RD5C 4OLOA 3MM9B 3QT8A 3AOCA 1KLMB 5C42A 2QNDA 1J4WA 3GIJA 3KK3A 2VC1A 2IDLA 1X0FA 3OETA 3PRVA 4GO7X 1PIEA 1HKAA 3JSMB 4J9LA 3HSGA 3PYDA 2DO0A 2IJRA 3QFHA 1RU2A 1Q95G 5G4DA 1N34J 1W2IA 4M1KA 4WTOB 1OY8A 2XWYA 2A1BA 4ICLA 4B3MH 3H5XA 1IWGA 2H3EB 4DR1F 2EFQA 7FDRA 4QYZK 3G8SA 2U2FA 2J9DE 2LVWA 2HG4A 1GQEA 4LF5J 1XMQF 1EHWA 2CPFA 4AXIA 4IOBA 2WONB 5U47A 1FJ7A 2LXFA 2LYVA 1IR1A 2UVWA 1B4SA 2C2EA 2BX6A 1VQ9S 3D68A 1ZPWX 3VAJA 1JJ2R 3DI6B 2R2TA 4WU2A 1QAXA 3HHLD 2JRSA 4I67A 4FPIA 3DGPB 1FJCA 2WSEC 2R7RA 2E9ZA 3M2RA 2DO4A 1HNVB 2XYPB 3CNQP 3HVAA 3C14A 2VG5B 2VFSA 3EDRB 2VL1A 1S57A 4DV2J 3W2VB 3I0PA 3DOMA 2GZOA 3C66A 1BLUA 2ROPA 3Q8RB 2NLWA 2CIMA 4TU7A 1XK8A 3F73A 1TL3A 2PT7G 3C16B 3W8PA 3CUNA 1VRTB 3P3DA 4XK8C 3MPDA 2JFKA 2JEIA 1NDLA 5KFEA 5A0YA 3QZ7A 3HK2A 1REVB 5L8RC 2AYMA 4KAIA 3V4IA 4ZN3A 5HVFA 5L38A 1RE1B 3NBPB 3DLEA 3GB0A 1VQ5S 4KPYA 4FJSA 2K1HA 2UU9J 2YKNB 4CTAB 1C1CA 3R3TA 5A8WB 4ED1A 2R7WA 4NZ6A 1FERA 4B3SJ 3VAHA 4DSEA 3WIUA 4UF4A 1WI6A 4OD6A 4YY3F 1QAJA 4L3NA 1X4NA 2W9CB 2HVHA 3KMQA 1VBXA 1Q4RA 4KKOA 4EK2A 1DFDA 3D0IE 2MKCA 3JYTA 2HQ3A 4DSIA 2MYFA 2RKIA 3PY8A 1VHFA 1UVNA 1LWXA 4FYXB 3AHPA 4DFPA 4Q8EA 3SXLA 3PX0A 1FWPA 4DV0J 3MOJB 4LF9F 1NUEA 3R5JB 5DQGA 1MU2A 4WP8A 3MEDA 4F2SA 2FGCA 3DHXA 1VQMS 4DUYJ 5A6PA 2QFIA 3AT1B 4IH5A 1NAQA 3LQVA 2P9CA 4X62H 3LPYA 1DAXA 1R0AB 4CNYA 5JMNA 2AV5A 2DR9A 3HD2A 3ZZTA 3LP2B 3KK1B 2XYHB 2C2DA 1N32J 4ANCA 1T7PA 4YUDA 1WVNA 1PILA 3LUYA 4TY8A 4LFCF 2V8GA 3JQMA 2KDOA 1RAOA 2IC3A 2PFFB 3L7OA 4RUCA 4KIAA 2W7PA 3DKDA 1DQAA 3UI3A 1N33H 3P5TL 1GMWA 2OMLA 3VVUA 3KHGA 3M6VA 1NPKA 4RUHA 4M94A 3I82A 1WOPA 3DLJA 3EJMA 2ACYA 4F7VA 1HD0A 2MJHA 5AXNA 4A8OA 3SV4A 3DLHA 1S1TA 4F36A 4RL1A 2GMJA 5IZHA 2MKJA 1SKSA 4B08A 1CSJA 1HFEL 2YNHB 4EUVA 4ZPWR 4OYOA 4DV3F 1TK0A 5IWAH 1UEUA 2KZZA 4GKJH 2YPYA 4LF7H 2ZWPA 3D67A 3ISZA 4YDXA 1KEKA 2RS8A 4OYIA 5H1SV 1WC0A 1P8GA 1UVJA 4IR9A 3NRBA 2HGNA 1T9TA 3MMBA 1IBCB 3HP6A 1RWNB 1EARA 3G82A 4QIGA 5IOLA 1TK8A 2HMIA 2ZKUA 1S1WB 2YQ0A 1IKVA 4YEAA 3SQOP 5D3GB 4PPZA 2MHNA 3R9LA 5HATA 3T6BA 2OPPB 2HQIA 2RQ4A 2AEJA 4LSNB 1HWIA 2ZITA 4QOTA 3HSZA 1SV5A 4NCGA 4JYAF 2BRLA 2NXNA 3P6YC 4U6PA 2MQOA 2B5JB 2Q6CA 4NBQA 2C2MB 3LP0A 2CADA 3SSRA 4IFDG 2G0JA 4M5HA 3UVJB 3CE8A 4PQAA 3FMWA 4DL0C 2QX0A 1MMDA 2BA0A 2PSZA 5I3QA 1O6XA 3TANA 4I6WA 3I31A 2P2RA 1UL3A 2ASYA 4P2SA 1FFGB 5SUHA 2E29A 2RE1A 2YBVA 3AJ1A 2YQ3A 5F0UA 3GFYA 4RO0A 3PIOQ 2OIHA 1VRUB 1HPZA 1VOMA 4Y28C 2Y1IA 1NK6A 4X64F 2CQCA 5CYJA 3CJ3A 1SQEA 4ES3A 1FJGH 4MH8A 3UR0A 4ILLA 1T11A 3P45B 2CQGA 3IGNA 3UDCA 1EX8A 1FKOA 3HVWA 1VCTA 4FYYB 4YB1P 1TZ0A 1X5PA 1FNOA 2LU2A 4LF8F 1X4FA 4YHHF 3LGMA 1VLYA 2WVEA 1UTAA 5IT0A 4X84A 5CYQA 4IO1A 4O4GA 2D74B 3B6BA 3FJ2A 5CXTA 4CZCA 3ENWA 4OIXA 4DMZA 2CJKA 3AB2B 3TOQA 1HNZH 2Y8YA 2ZHBA 1RT2B 3US5A 5D77A 1D0EA 4RNFA 4KO0B 2ADCA 3ZNJ1 1N34F 1RSCA 4Y3CA 4LF6J 4OX9H 2F8HA 3PACA 2MHEA 1XIQA 1JJ4A 1YJVA 2A2DA 4F67A 3JAMW 3MEEA 1ZH5A 1TKZA 1F5AA 2FC9A 5J2PA 1AROP 4U67Q 4EBCA 1XBWA 2G9OA 4O3NA 3CJ5A 1BY9A 2UUBH 4DI6A 2HHSA 1VQOS 5E2QA 4MYTA 1F3VA 3RW7A 4DV2F 1RAFB 2K1RB 4B3RJ 2GMLA 1U26A 4IG3A 3GR5A 3CULA 4H4MB 1PJ7A 3T5LA 2MTLA 3MAAB 4ZJQA 1RA6A 1N36J 1T05B 1VC6A 1RLDA 5KFJA 4QJVA 3CIMA 5LMNH 4OZLA 4KGZB 1S1UB 2IY5B 3UN3A 3MMCB 2ZH8A 2UXCH 2HQCA 2F8EX 4JI1J 2UU9F 1S7HA 4B3SF 4DV5J 1T3OA 1IJEB 2HNYB 4C8ZA 3J7Z5 2NPFA 4ZVFA 2A1SA 4OFZA 3MMAA 4NLQA 3RRHA 4TQSA 3CCES 1R31A 4B3OB 1VGYA 4PABA 3BH6B 2NS1B 3KUHA 4FZVA 3KYLA 1KHVA 4DV6H 4LR9A 1JLQB 4NI2B 2XMTA 4DV0F 1BWVA 1WORA 5B0DA 2E7XA 3QO9B 1VQKS 1AZSA 1HBOB 2VU5A 4DUYF 1H3DA 1WKKA 1U1RA 4P72A 4R0JA 1F2HA 1RT3A 2GGPB 4PG5A 3DLGA 2DNKA 3KNGA 2UUCJ 1IBLH 3MAHA 1N32F 2DBBA 2CDRB 1YG0A 3ZZRA 1CJUA 1KR4A 3T1HH 3Q86A 2V2ZA 5JEAG 3LP1B 2KHDA 2QA4S 1YK9A 2YY3A 5J2QA 2VJUA 3BEGB 2IVMA 4B9TA 2YTCA 2DEIA 4JI3J 4G1IA 1IM6A 4J9OA 2GVDA 1KS2A 3SIPB 2DITA 2DKOB 1NPPA 3N0VA 1YI2S 2V2VA 3AY0A 1TP7A 2M5YA 5A76A 3QRQA 1Q7YT 1Y5IB 1YKWA 3IS9A 2GO8A 2A3JA 3D54A 2ALZA 1KBRA 4MKVA 2JLEA 3ZO7A 1NCLA 1JLAA 2PY9A 2W1BA 2Z8QA 4XO0A 4UUWA 1S0VA 3E2EA 3TAMB 3N6MA 4ZVEA 2OTJS 4NLPA 2XY6A 2H51B 4G1QB 5DQIA 4K4TA 3PV8A 4P2XA 4C3KA 2W2QP 1SEIA 2BE9B 4HH1A 3BDEA 3ENQA 1TFYA 4DR4H 2BA9A 2FLOA 2CJXB 5J1PA 2VHGA 4OZ1A 4L75A 1QE1B 3J80U 1NLKL 3ULHA 5A2QW 3QJPA 3RBDA 3MM9A 2VFRA 2EFGA 2RRBA 4HHUA 1KLMA 1VQ7S 4DQIA 3TZZA 4BLGA 1U1NA 4OYWA 3FEYB 2ZC3A 2J9DA 3Q2SC 3HSJA 4A8SA 1X4MA 3U1NA 3NKYA 2IBKA 3E8OA 3W3SA 3JSMA 2OPQA 4WXOA 3TI0A 4LF1A 5M2PA 3KLFB 2ZEJA 2HS0A 2VBZA 4DN9A 2BW2A 3S8SA 2BVZA 4OMFG 4CO4A 4ES1A 4C7QA 4Q5VA 2UXBJ 3HI9A 3SB1A 3MTKA 1S79A 3BKFA 1RQ0A 3HX9A 4UOGA 1D09B 4A8QA 2WONA 4KRWA 3D6HB 6AT1B 1NMEB 1AB8A 2CQ3A 2AYGA 1C4AA 4LT6A 4NLOA 4USWA 3DRSB 4OJ3A 4ZLPA 2XNQA 4Y65A 3EVMA 3DGPA 3UOEA 1XR7A 3J81W 1HNVA 3CCSS 2FVCA 4JV5J 2GQCA 3BJYA 1HNXH 3W2VA 2UUTA 2HIQA 4O3PA 2ASDA 3AXMA 3ILIA 3IBWA 4M5GA 2KRRA 4CO2A 2L08A 4X62J 3CC7S 3C16A 4LF2A 1VRTA 2GHPA 4QIFA 2M8WA 2VBWA 1RGVA 2XLIA 2B6AA 1S7IA 2VASA 1REVA 4ZKAA 2ZVSA 2MJNA 5HK4A 2YKNA 2L9WA 4CTAA 1P9YA 5A8WA 3I5CA 3UW1A 4JI6J 2MY8A 4ZVPB 3K5PA 3GG1A 5L1LA 4TXSA 1N33J 1X31C 4YQWA 3BPDA 4CDIA 2HWIA 1M5OC 1FRXA 3SEOA 3UR3C 2BKOA 4I69A 2YWKA 3GV8B 1RP5A 4DR3J 2HBRB 4GKKJ 1EAYC 2KG0A 4ITSA 2HVIA 3S01A 4QMFB 3HHNB 4LF6F 2APOA 3U1MA 5L1KA 3A3OB 4MTPA 5EX3A 2V6AA 4CLYA 3DC2A 5B0AA 2LTMA 4ECZA 3VALA 2CZVC 3JTOA 1WF2A 4CP5A 5LT5A 2DRDA 2XTJP 3ETOA 1ZZFA 4DX6A 4NRTA 1HI8A 2PGCA 4JI7J 3CCVS 1R0AA 3RU0A 3UNGC 4O44A 5D78A 4KSEB 1DZ5A 2ZNYA 3EVWA 4PR6A 3LP2A 2RH3A 3E3XA 4XAKA 5E41A 3GYNA 3FMBA 1I94J 1QSSA 4BWJA 2E7WA 3UNYA 2LECA 1S72S 3NAIA 4PWWA 2CUYA 4HHHA 2MQ8A 4N76A 1IBKJ 5D0RA 3DLBA 3FFIB 4B3RF 2RHQB 4MMOA 2A18A 4M5JA 1D8YA 3IFEA 3HHLB 4DSFA 4CO3A 3PR5B 1HI0P 5KFTA 1KQFB 1U6ZA 4P9SA 2KU7A 3CJQA 4OYXA 1DY3A 2VIHA 1RAJA 3WC0A 1N36F 2B9EA 5F8IA 2WHOA 3MTJA 1FTCA 3CD5A 2V8VA 2OLWA 4KH1B 3W65A 3OJUA 1RBLA 1DQ8A 4JI1F 5G0RB 2RRAA 4CWBA 4PG7A 2CTMA 4A4JA 4DV5F 1X4GA 2FVPA 3D3CJ 3UN2A 1FJEB 5F8JA 1SBRA 3SCIE 2XWXA 4LBIA 3FSIA 1LFWA 2PMWA 1ZOTA 1OIAA 6FDRA 5F3TA 1BUXA 4AQYH 2DIUA 4J9PA 2RUSA 1IN0A 4DR2H 2Z56B 1KQGB 1ZA2B 3CVKA 5KFXA 3PO4A 2CRLA 1S1WA 3AODA 1TL1A 3HFVA 4KB7A 1VC5A 2A10A 3MCNA 5KFKA 2AW0A 1GMUA 1RUSA 3OVAA 1N4LA 4PG4A 4PWUA 4DBQA 2OPPA 4DFMA 4X4RA 4LSNA 1WJ9A 2I8EA 2KRBA 2QRRA 2RNEA 2DHSA 4OYMA 2VG7B 3BGOP 3QD7X 2EK1A 2UUCF 4C8OA 1UVIA 1VJQA 2YQ1A 2B5JA 1ZAXA 1N88A 3M8QA 1VBZA 2IYGA 3BBCA 4XDDA 3CJSA 2BZ2A 2XY7A 1RAAB 4JI3F 1YJNS 3GIKA 2GS8A 3UVJA 4DR7H 1WD6A 4K5RA 2N4DA 4HACA 2N82B 4PKDB 2ILYA 5EWEA 3MM7A 3LWLA 2FZKB 2DRBA 3QGHA 3G96A 4DUZJ 2ZDOA 5IV3A 8ATCB 3M8ZA 1DBDA 5DDOC 2KJVA 4K0KH 4NLTA 2ZOMA 3X3UA 4DPYA 1VRUA 4HVZA 2YKMB 2G1DA 3RBZA 1WOOA 5CD4A 4OCHA 3D7SB 2CWXA 1B0TA 3IAS9 1RAGB 4TQRA 1ULRA 5B7WA 4JI4H 3K57A 1WNEA 3FDSA 4QIEA 3VCDA 2BM1A 4ZOSA 1LOUA 1D3WA 3E01B 3MD1A 1WOSA 1M5PC 2BKNA 5CCMA 2GCFA 3G87A 2KI2A 2EC0A 1URNA 3D1QA 5IQQA 2UUBJ 1H98A 2X1AA 2B4PA 2ZM6J 3KUEA 3M2UB 4NRUA 4G08A 3MZIA 2DGOA 5IXUA 4AIMA 1RACB 1UZHA 4LR7A 4ZVTB 3W5ZA 3C6TB 4FYDA 4J9MA 2FB0A 4I0WA 2R8HA 2ZH4A 5IV4A 1LWFB 3OXFA 1K73T 5L46A 3PEJA 3J7YU 4C2MA 1HQEB 1KHMA 4M95A 1RT2A 3QNWB 4KO0A 3VAGA 5KFHA 4PAAA 2IVYA 1PG5B 1X9WA 1D9AA 2R8KA 5LMNJ 2FC8A 2AP6A 2UXBF 3MUVP 1JXVA 2RJZA 3ZC4A 2DNPA 3GONA 1SQFA 4LVOP 2DIVA 3K5NA 1TKTB 1GX5A 5M2RA 1MG7A 1S99A 8AT1B 2MDAA 1N52B 1RYRA 2B8PA 3BN7A 5LSLA 4WE1A 4JI0J 1PQXA 3THVA 2QA1A 2RRNA 3PYGA 1FE0A 4I56A 3H8YA 5DDQC 4JV5F 4LUBA 2K1RA 3M9NB 2UZAA 2M0GB 3NGTA 1WWHA 2NREA 1WACA 4V1Ak 3NS7B 4ZP8A 1HMVB 4RR5A 5GADU 4H4MA 1H0HB 1Q82T 4B9NA 4X62F 2JE6I 1VIHA 4DDFA 3FZ2A 4C48A 1LXJA 3MAAA 2E3UA 4NASA 2ZFHA 2O67A 2Q1LA 1T05A 2BYCA 3M9MB 4CO5A 2HNDB 2ZE2B 4AYBD 4YDDB 2KB2A 3MMCA 4F25A 3TVYA 2Z2LA 1S1XB 2PI5A 3OHBA 3M6WA 4JI6F 1WHWA 2HNYA 3D9BA 1N33F 4USHA 3KLHB 3VGVA 1U8SA 3BDPA 1V9NA 3TWZA 1FRLA 3A8KA 5BYQA 3Q8PB 4B3OA 2ZD1B 4GKKF 2QYGA 1G2EA 4X65J 4DR1H 1LW0B 1EP4B 1JLQA 3OL6A 3CDWA 2HW3A 3DYAB 1YVFA 1WDTA 4NI2A 1FX2A 2OPRA 1XMQH 3QO9A 4IG0B 1HBOA 2XBPA 4UOHA 1YQHA 4X4OA 2DHHA 1MMNA 1NRKA 2HKEA 5FLXY 4JI7F 3LF0A 4C0BA 2GGPA 4WFYA 4I2QB 5HBMB 4JV1A 5BR8J 2AGQA 4X4VA 5D15A 3H42A 1I94F 4LMZA 1B99A 1Z2IA 3V6JA 5KT2A 2NSBA 3KDGA 3LP1A 4UY85 2XS5A 4WCEQ 1VI7A 5HQMA 1PGZA 4F0MA 4NXMJ 4CCHA 2BJ3A 1U09A 1KFSA 3VAKA 5H9EJ 3JSRA 2HK3A 4FNHA 2HRUA 1N48A 2LLZA 4P7VA 2M4MA 2DNMA 3VHQA 2F8MA 1JLCB 3PFEA 3W1YC 4AD6A 4KV8B 4FKYA 2Z2YB 4ATNA 3HVTB 3PW4A 1HHSA 3TW0A 5KFCA 1Y0HA 5DDRC 2UV8G 4HDGA 4OYBA 3HULA 2B7BB 3TAMA 1WSVA 1JMTA 3FUYA 2DXEA 3IWLA 2QV6A 4YY3H 3ET6B 4G1QA 3TUPA 3J80Y 4HEA9 2DEJA 3SZ2A 2NYHA 3ILJA 2H9ZA 5HN0A 2FD2A 3NGUA 4DQSA 1WC6A 4ZJOA 2NR0A 1PC4A 4LF9H 2LXIA 4RW9B 1N56A 2WW8A 1VFJA 4K2XA 2IA0A 5CZXA 1R8AA 1QE1A 1FEHA 4NZ7A 1FA0A 4ECUA 2ZH7A 1L3VA 4Y2IA 2QYCA 1NKBA 2LA6A 1SJ1A 3UN5A 2QA4G 4TLQA 2DNRA 4PQUB 1FJGF 4RNOA 3KTQA 3KHHA 3PRBA 3ISND 5E0OA 3GZ7A 2HH2A 3VVTA 4RU9A 3J81j 1S10A 3EXCX 1K1GA 2MKHA 5FDLB 2VDIA 2ROEA 3NY0A 1TFWA 3CDAA 2YX7A 2CQBA 4WFAQ 3HCXA 2DVIA 3RG6A 1XRHA 4O3SA 2OD4A 1YRUA 3DRSA 2BE7D 4DUZF 2B9WA 2CPYA 2MZJA 2P5VA 2QL5B 4LSLB 2HIYA 2DCLA 4R0EA 1CC8A 5EHHA 2RAQA 4YR0A 5DRKA 4F3MA 2N7YA 4USTA 1S9GB 3FSYA 1WHYA 1KDNA 2WB4A 2Y1LB 1Q86T 4CO1A 3ZTSA 2YXLA 2J9EA 2U1AA 2DPIA 2NCKL 2DXFA 4URQU 2UUBF 4NLDA 2KN4A 2QLFB 1K44A 2OEJA 4LQ3A 2YNIB 2OSQA 2HBYB 2XNRA 5HMXA 4N8NA 2C2ZB 1QDUB 2DNHA 4DLEA 2X3DA 4L3KA 5F8HA 2CTKA 3HM9A 4MKBA 2KXNB 5AXKA 4Y6IA 5J2MA 4RW4B 4JYAH 1HNWJ 2Q66A 4UZCA 3IP0A 1FO1A 2R2RA 1X9SA 3GCXP 5E7OB 1HL6A 2VJVA 4K4XA 4IRKA 3O44A 3OFFA 1I5OB 1UMJA 3PFOA 5LMNF 1OYDA 3PHTA 1U1PA 3R7NB 1VQSA 5D4OA 5B0EA 2D7SA 3I4HX 4ZCLA 3KK3B 5GMKa 4LFBJ 1T94A 1UVLA 5DG8A 1L3SA 2RU3A 2IBOA 2B9XA 1JJHA 4DSJA 3ZTPA 4I68A 4JI0F 2V0NA 5DGBA 3BQ1A 3JQJA 3KDKA 4X64H 2D9PA 2N3OA 4OLPA 4IDKB 3JAMU 3KLGB 4CH7A 4K5SA 1CQNA 3IXQA 4E0DA 3FFIA 4C8YA 1VK8A 3HHLA 4LQ9A 4WFZA 2CPHA 1NHUA 3C19A 2HRTA 4LF8H 1ZM9A 3GKUA 3QWPA 4O0IA 3EGZA 3VGTA 2CZ9A 3T1HF 3SQGB 1RTZA 2E9RX 2JVOA 1SB6A 3BSOA 5G0RA 4C0OC 5GAHI 3I9ZA 3M8SA 4M5KA 2DHGA 5ETOA 4DR7J 1DLOB 4Q0BB 1N34H 3MECA 1EB0A 2AYEA 2GHVC 1SJ3P 4OZ0A 2VFTA 1FD2A 5CABA 3TZXA 1RT5B 4KHPJ 2IFXA 3QPIA 4FXVA 1QAIA 4LRDA 3CJRA 4OL8A 4LF5H 1C1CB 3KHLA 1NZ8A 3T1YJ 1H2UX 4JI5J 1JNRB 4NLWA 3CWJA 2LMIA 3CPWR 1LW2B 3IRXB 1UP1A 1SKWA 1JJCB 2MMYA 4CYUB 1NPRA 3N5BA 1FXLA 1GXUA 2VG7A 2R7VA 1UPPA 5BR8F 3FVYA 2XM3A 1V5IB 1BQNB 4KKOB 2IVFB 1S76D 1CULA 3JYTB 3GR0A 1ZZJA 3MFHA 3CJKB 4TLRA 1FVSA 4DV2H 3UE2A 1WEZA 5B0FA 3JQKA 1A7GE 2C22A 2KJWA 4ZDNA 2UUAJ 1MU2B 1U1KA 4ZLLA 4F4AA 1P1TA 4I1TA 2OAUA 3OQ2A 3NMAA 2W2MP 2LQJA 4OO1G 3BSCA 3DRYA 2V4RA 4Q2MA 1E6VB 3QJLA 2I1RA 2R42A
chains in the Genus database with same CATH topology
5C5JA 1X4FA 3POTB 3U7JA 4YHHF 2UP1A 3OBIA 4LF4F 3CDBA 3LGMA 2W9AA 1NZAA 1VLYA 2UU9H 4ZP7A 3MM5B 1P1LA 4BHQA 4U9RA 5KG3A 4FS2A 3HDSA 5E3QA 5IT0A 1W25A 4B3SH 2WSFC 4X84A 2F9DA 1LWEA 2XULA 1AFJA 2YKPA 5CYQA 4IO1A 1C0UB 4O4GA 2D74B 3FJ2A 3ZZ0A 5CXTA 1JLFA 4CZCA 2AYBA 3ENWA 3OSPA 7FD1A 1Q53A 4Y2AA 4OIXA 4RW8B 4DMZA 3PM9A 1M90T 2CJKA 1Q7LB 3AB2B 2EKYA 3HZGA 3TOQA 3UDLA 1HNZH 4WJBA 1GXTA 3TUIC 1BQXA 2ZHBA 1T3NA 1RT2B 1K9MT 4QYRA 3US5A 4QR0A 5D77A 1D0EA 2OFGX 4FPRA 4TNOA 4RNFA 3QWUA 4QWBA 2AJ1A 4KO0B 2ADCA 2ZJPQ 1N34F 2WBMA 4EO8A 4X4UA 1SH2A 4Y3CA 1V3ZA 4MK8A 3RRGA 1ZM3A 4OX9H 2F8HA 3PACA 4GC7A 2MHEA 3S1TA 4ED3A 1JJ4A 4OI0A 2B4UA 3M2UA 4DV0H 1PSDA 3X1LB 1RYSA 4JI8H 2ZHOA 3KG4A 1XMOF 5KTQA 2HHHF 2VOPA 3G6VA 1RTHB 4ZPBA 1YJVA 2W7AA 1SL2A 2A2DA 4OI4A 4GO5X 4F67A 2MSTA 4YB6A 4C9DA 3JAMW 2K8GA 3I4PA 3MEEA 1ZH5A 3C6TA 4DUYH 4QBUA 2L9DA 1TKZA 2HHTA 1F5AA 1Z1ZA 2FC9A 5EUHA 3UD4P 5AXMA 5J2PA 2V4QA 1JLEB 2W9BB 4DV7F 3KLIB 1AROP 2L41A 1KLNA 4U67Q 2WSCC 4EBCA 5KG7A 1HWUA 2Z0GA 1MWZA 1LWFA 3D0GE 5K14A 1XBWA 2G9OA 2GIQA 2PA3A 3UPFA 2EBEA 2Y1RI 4O3NA 3CJ5A 4NL5A 1F5BA 1BY9A 1RTIA 2UUBH 1H6KX 1HQEA 1T8EA 3T5KA 1N32H 4YB7A 2FLNA 4BC9A 5IM0B 5LJ3Y 4RNMA 3C8YA 2E5GA 1HNWH 3CCJS 6FD1A 3KK2A 3JB9k 5E3PA 2HHSA 1MNEA 1VQOS 2KTQA 4YB5A 1NNDA 4U7CA 5E2QA 5DLFA 3TAQA 3N6LA 1NEEA 4BCAA 2VBXA 4CT9A 1TUVA 1I1GA 4MYTA 2ILZA 3EPIA 3CEDA 2KG1A 4NYZA 5K8MA 1L3KA 1LWCB 4BDPA 3RW7A 1SJ4P 5KFMA 2IM1A 3MM8A 3Q0AA 4DV2F 2K1RB 3C46A 1IKVB 4MKAA 4A8FA 1VQ4S 1DARA 2GMLA 1U26A 5I3UA 3N6NA 4IG3A 4LFBH 4KFBA 1T02A 2V2KA 1YJ9S 3D2WA 1FT8A 2CPEA 5HI7A 2D9OA 5KOXA 3UQSA 3GR5A 3S6EA 3D28A 3VF0B 1V3RA 3KLEA 3CULA 4ZP6A 4H4MB 4FN5A 2GA7A 5BJRA 4ED0A 2VOOA 2RF2A 2Q43A 5GAHU 5JJBA 1AUDA 3T5LA 3KLFA 3IC1A 3PKMA 2K2PA 4LFCH 2YWFA 1SUQA 1YJUA 1FKAH 2E1RA 5KG4A 2FDNA 2EK6A 2FJAB 3JTPA 4PXCA 3VQSA 1RA6A 5K8OA 2V4JA 1E6YB 4TU9A 2D3OR 2DPJA 1T05B 3MECB 1SV5B 2XMMA 1VC6A 5KFJA 4QJVA 3CIMA 5LMNH 4OZLA 1HARA 4Y00A 2AJ4A 3HPOA 3CCTA 4ILMA 5EGYA 4OI2A 1S1UB 2QLXA 1ZTWA 4ID5B 3MMCB 2ZH8A 4MIWA 1F5CA 2UXCH 1N6QA 1ZBTA 4IRCA 2BDPA 3M8PB 1UVKA 4ECRA 2ADBA 2F8EX 1FTRA 1S1VA 3B8HA 2YX1A 2UU9F 4J9SA 1JLGA 3EUNA 3CJ0A 1RKIA 3SCJE 3M05A 2K3KA 1S7HA 4H4OB 2FHMA 4B3SF 1T3OA 4FF2A 1IJEB 2J76E 2R7OA 2HNYB 2HZCA 3T5HA 2F9JA 4C8ZA 5MLCV 3J7Z5 1NK9A 3QAEA 5C24A 2WOMB 2NPFA 4IFVB 3DFEA 5GADI 4ZVFA 3MR5A 4OFZA 3MMAA 3GV5B 2EI5A 4NLQA 4HKQA 3RRHA 4KR0B 3DRXA 3M2VA 1HMVA 3N79A 4B02A 4EZ9A 4I4BA 4TQSA 5HQ8A 1VMBA 1X4EA 3CCES 1S6OA 5KG0A 1NJIT 1R31A 4B3OB 1HNZF 1VGYA 1TKXA 4C3LA 2NS1B 3ZFVA 1K8AT 1EETB 2CQ1A 3AQOA 2HWHA 4DV3H 1NJWA 2CJAA 4FZVA 1XR6A 1Y3KA 3C6UA 2EFNA 3KYLA 1KHVA 4DV6H 5HMWA 3B82A 1ZAWA 3U02A 1JLQB 4HL9A 2HNDA 4OX9F 2M3DA 2KM8C 4HYKA 2ZE2A 3CDUA 4MFBB 2ZHAA 2XMTA 1HHTP 4DV0F 3FEZA 4JI8F 5I42A 4XDCA 5K5MA 3DDKA 2J9CA 3TR5A 1FNMA 5KT5A 2ZH3A 5B0DA 2E7XA 3QO9B 1JKHB 1VQKS 4G6VB 3PX6A 4BS2A 1HBOB 2W24A 5KFOA 2NUHA 1IM4A 1U4BA 3W7BA 4C8NA 3NGKA 5KG2A 4DUYF 1H3DA 3V4MA 3H4BA 2HHUA 5HROB 4UW2A 1LXNA 1U1RA 1FK9A 4R0JA 5DJBA 2GNKA 3GABA 3THPA 1RT3A 2GGPB 2DNYA 4KHMA 3IGVA 4PG5A 1H7WA 3DLGA 5LL6d 2DNKA 3IR7B 3N4WA 3KNGA 1IBLH 3MAHA 4Y34A 1YITS 4AL7A 3LWMA