2FPHX

Cell division protein ylmh from streptococcus pneumoniae
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
165
Chain Sequence
GIYQHFSIEDRPFLDKGMEWIKKVEDSYAPFLTPFINPHQEKLLKILAKTYGLACSSSGEFVSSEYVRVLLYPDYFQPEFSDFEISLQEIVYSNKFEYLTHAKILGTVINQLGIERKLFGDILVDEERAQIMINQQFLLLFQDGLKKIGRIPVSLEERPFTEKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ylmH
publication title Cell division protein ylmH from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Dna binding protein
total genus 44
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2006-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fphX02
3.30.1370.160 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2fphX01
5GAGU 2ADCA 2CPYA 1FXLA 1VQOS 5D78A 2AYMA 2K3KA 1WHVA 3ZZYA 2UP1A 2JVOA 4LMZA 3UCUP 2MMYA 2X1GA 2M8HA 1HD1A 1JMTA 5JVGQ 2KT5A 3CCRS 4IOAQ 3EX7B 3G9CA 2MJNA 2RT3A 3MUMP 2DNQA 2EK1A 3UCGA 3MURP 2LEAA 2FHOB 2DNGA 1M90T 4YOEA 1WEYA 4TU7A 2E5IA 3MUVP 4PKDB 1YTYA 2J0QD 5BJRA 1N8RT 2FC8A 3NNHA 4V19X 4CQ1A 2D9PA 2NZ4A 4FXVA 1IQTA 1PGZA 1FHTA 2MKSA 1X4BA 2M9KA 3BEGB 1SJ3P 2DO0A 1WHYA 3FEYB 3VAGA 2XSFA 2VOOA 2MJUA 2MZJA 1WHXA 4W90B 2M70A 2RRAA 3US5A 1H2TZ 4A8XA 1YJNS 1YJWS 1DRZA 1M1KT 4ZKAA 4CIOA 2KRRA 2LA4A 4LIRA 2N82B 1A7GE 1U6BA 3MD1A 4C0OC 2LEBA 2RU3A 1KQSR 2DHGA 2KXNB 1DZ5A 2DNPA 1X4AA 3MDFA 2CPJA 5IFMA 5LXRA 3CCSS 1KC8T 3CC2S 2MQNA 2MKKA 2CPHA 2VOPA 2OSRA 2RVJA 2K8GA 1UW4A 5CA5A 3PIOQ 3UD3P 1WTBA 1VQ4S 1UP1A 3IWNC 2MQQA 1H2UX 2KU7A 2DNZA 2U1AA 3Q2TC 3BO2A 1G2EA 2BZ2A 1U1RA 2JX2A 4FXWA 1U1LA 2XNQA 5HL7Q 3P3DA 2CQCA 2M0GB 2RRBA 2PEHA 2MY8A 3VALA 2OTJS 1P27B 3CCVS 2CPIA 3SMZA 2HYIB 3S7RA 3JB9k 5GAEU 1K73T 2DGSA 5ITHA 1VQ8S 2DNNA 1WEZA 3DXBA 3P6YC 4WFBQ 2RNEA 1WELA 3CD6S 2MGZB 2MB0B 3HI9A 4OZ0A 2MKIA 2MQLA 2YTCA 4F26A 1N52B 5LSLA 5EN1A 1VC6A 1VC0A 1U1PA 1K8AT 1KOHA 3CTRA 1KOOA 2EVZA 4WFAQ 2ADBA 2MKCA 3NS6A 1X5OA 1Q86T 2KG0A 3OW2R 3G6ES 1R8PA 4EGLA 2HGMA 3CCES 1H2VZ 2DH8A 3UE2A 4LJMA 3BO3A 2VONA 1JJHA 1X4HA 2MKJA 1WF0A 3CC4S 3SDEA 3CCJS 5GAHU 2YH1A 2HGLA 1U2FA 1X5PA 2JWNA 2RS8A 3TYTA 2XS5A 2KM8C 3NMRA 1JJ2R 2DHSA 2KN4A 3DLLQ 2YH0A 2F9JA 4WFNQ 2N7CA 2QA4S 2LMIA 1M5VC 4CH1A 1SJFA 2Q79A 1YIJS 1KD1T 5GADU 1VBYA 2XS7A 1YWXA 4QQBA 5GMKa 1RKJA 2CQDA 1U1OA 2KVIA 1VQ5S 2HVZA 3VAFA 2XS2A 2VODA 3N9UC 2E5HA 1FNXH 3CCQS 1YITS 2AD9A 2I38A 2KM8B 1HL6A 4RU2A 1AUDA 1ZZNA 2AYBA 4UQTA 1M5OC 1X4DA 3UCZP 2LKZA 1H6KX 1XN9A 1HD0A 1OWXA 2N3LA 1D8ZA 2MSTA 3G8TA 2E5GA 1VQ7S 2E5JA 2LXUA 5JVHQ 2DGVA 3UWTA 2DNMA 2MZSA 1OO0B 2DNLA 3NS5A 3TO8A 2OJ3A 2FC9A 1R8HA 2XB2D 3TP2A 2YWKA 3S6EA 4QU7A 4C4WA 2MZTA 1D9AA 2DNKA 2MQPA 2M7SA 2X1BA 3CUNA 3CULA 2KXFA 1FJ7A 2L9WA 1UAWA 2DIUA 2G0CA 2RS2A 3R1LA 1VQ9S 4IOCQ 3H2UB 1WF2A 2AYEA 2ZJQQ 5DDQC 2CQ4A 5LJ3Y 1VBXA 1VBZA 1Q82T 1U6FA 5MLCV 1L3KA 2M8DB 1VQ6S 2L08A 4PR6A 2CQPA 4UY8T 3R1HA 2RUGA 3ULHA 2MQMA 5IM0B 3CCMS 4F02A 3IRWP 2M88A 4WKRA 1S79A 1F9FA 2U2FA 2KXHA 1M5PC 2X1FA 2DNRA 2M4MA 3P5TL 1YJ9S 1YI2S 3CMES 3MD3A 4TU9A 2HGNA 4QPTA 2CPZA 2A3JA 1OIAA 1FT8A 1OPIA 3CXCR 4YUDA 3MI7X 3H2VE 5DETA 4PRFA 1WWHA 1N88A 2DGWA 5GVQA 1Q81T 2ZJPQ 3NNAA 3CCUS 3UD4P 3U1MA 2EK6A 2DH7A 2KYXA 2MYFA 1X5TA 2N3OA 3VAJA 1A9NB 2DISA 2MY7A 3RW7A 1VQKS 1FO1A 2DH9A 3Q2SC 4IO9Q 2V94A 2LA6A 4P6QA 4ED5A 2MSSA 2DITA 2CQGA 2MQOA 3L3CA 2CQ2A 1NO8A 2PE8A 3MOJB 1U1QA 4ERDA 1WG1A 1ZZFA 3BS9A 1M5KC 2F9DA 5LSOA 3VAIA 2MPUA 3I55S 4BS2A 4WF9Q 3B4MA 3G8SA 1U1KA 2OIHA 1VC5A 2CJKA 1VQMS 2MGZA 3CCLS 4C7QA 3RW6A 5H1SV 4WIIA 1WHWA 2DGTA 1QVGR 3ZZZA 1X4FA 2JVRA 2CPDA 2MZQA 1WI8A 3LPYA 3THTA 2LYVA 2LXIA 1FJEB 2L41A 2DB1A 2B0GA 2CPEA 1RK8A 2DIVA 1QM9A 1VQPS 2CQ3A 2J76E 3R27A 4Y00A 5DM7Q 2FY1A 1WI6A 2D9OA 2FPHX 3VF0B 2HZCA 1SJQA 5D77A 2CPXA 1JJ4A 2G4BA 2KHCA 3U1LA 2QFJA 2DGXA 2MKHA 2ERRA 1URNA 5FJ4A 2DO4A 2X1AA 2CQIA 2QEXS 1WEXA 2DNHA 4Z2XA 1W2BR 4CH0S 2WBRA 2O3DA 2J0SD 2XNRA 2F3JA 3J7ZT 2MXYA 2DK2A 2LCWA 2YKAA 3B4DA 1NU4A 1NJIT 3VAMA 1N54B 3S01A 1U1NA 2JRSA 3P49B 2DGUA 3G96A 3EGZA 2NLWA 3CF5Q 2ZJRQ 4QU6A 2CPFA 1K9MT 3CC7S 2MZRA 2I2YA 4U67Q 4J5OA 4TLQA 3G71S 4WCEQ 2GHPA 3CPWR 1B7FA 1UFWA 2RQCA 5IQQA 2OSQA 3THPA 5LJ5Y 2CQHA 2E44A 1ZH5A 3SXLA 4M5DB 3VAKA 5LXYA 1SJRA 2OTLS 3VAHA 1YHQS 1SXLA 3BO4A 2GO9A 2CQBA 2KI2A 2DHXA 1WF1A 1X4EA 2DGQA 3V4MA 1X0FA 1BY9A 2SXLA 4F25A 5CYJA 4W92B 1FJCA 4TU8A 2M2BA 2BOPA 3HHNB 1WG5A 2KG1A 1VQNS 3MUTP 2KH9A 2DNOA 2G1DA 2CQ0A 3SDEB 1QVFR 1DBDA 2M52A 5DDPC 2KRBA 2D3OR 3J7YU 1O0PA 5DM6Q 1DHMA 2RQ4A 2J8AA 1S72S 4OZ1A 1CVJA 1Q7YT 1X4GA 5HO4A 1HA1A 5CXTA 5DDOC 3EGNA 3FEXB 3LQVA 3I56S 2DGOA 2LECA 3G4SS 2LQ5A 2DNYA 3NNCA 3S8SA 2MZ1A 2AYGA 1X4CA 1U1MA 2CQ1A 4IUFA 2DHAA 5DDRC 3MXHP 1PO6A 3K0JA 1WG4A 5IM0A 1SJ4P 4Y0FA 3PIPQ 2MHNA 3CMAS 1P1TA 4YB1P 1X5SA 2KFYA 3D2WA 1VQLS
chains in the Genus database with same CATH superfamily
3M8PB 1HIYA 1QSSA 4MKVA 4DLEA 2K3KA 2XWYA 3UCUP 5C24A 2NYIA 1JLCA 3NXZA 4Q2MA 2DY1A 3EUNA 1U6ZA 2Z2YB 5I3UB 1PJ6A 4CCHA 1HBUB 1H7XA 3CW2C 4WP8A 1F5CA 1FXDA 2CJYB 3DOMA 2FIUA 3BF4A 3V4IA 1RA7A 2DO0A 4ENOA 5D4PA 1S03G 3RUBL 4AXIA 2XMKA 1EQ0A 1RWOB 3EXCX 1KQSR 1GEHA 5LXRA 1UVMA 4KH1B 2RAQA 3JQKA 1JLQB 3BQ0A 4P2XA 1S7IA 1LW2B 2JEAI 1FERA 5J1NA 3THVA 4FXWA 3C6UA 2VFTA 3QAEA 2UVUA 5FLXY 3K5PA 1UG8A 2WVBA 3G8QA 2BX6A 1S6OA 5IWAF 2HYIB 4DV6H 4DZ6A 2QLFB 2R9LA 1R27B 3K17A 4OZ0A 2EFGA 2WSCC 4H4KC 1SJ1A 2YX7A 1RLDA 4RNHA 4F3MA 3V5RA 1IKVA 4H4OB 4NLVA 1RWNB 4QMFB 1KBRA 3DHWC 4EGLA 4LVNP 2HFZA 1AZSB 1WOSA 3UE2A 1BXNA 4ELVA 1JJHA 2RILA 3BQ1A 1VI7A 4I2PB 3W65A 4B9UA 1WKKA 2XS5A 4LF5F 4RWXA 4X4TA 1C2PA 1EKRA 1S0OA 1VRUB 1QAXA 1NKEA 1B70B 1YIJS 4LFBH 1YWXA 4RNNA 4RW6A 1P1LA 2HURA 4IRKA 2XS2A 4R5PA 2P2CB 3P5BP 1RT1A 2AQ4A 2D9IA 3G82B 4E98A 2FVSA 3POTA 3QAUA 4N8NA 3UCZP 1RUSA 2BJ1A 3R5DA 2JLGA 4N41A 4NLGA 3KMQA 4DL4A 3AOCA 3QWPA 3BSCA 4DV7H 4DV2H 4C4WA 2EFOA 4DV1F 1FJ7A 2L9WA 3OR1A 1HPZA 2XHCA 4IOCQ 2QC3A 4QJVA 4DR5J 1C1CA 4H4MB 1S0MA 2ZJQQ 4FNIA 3DC2A 3OTEA 5I4MA 1KRPA 4USJC 3DCAA 2AGQA 3IRWP 3PACA 4LF8F 3JYTB 4Y34A 2JHEA 1S97A 4QYZK 3HO1A 5A76A 5JXSA 1VRTA 4NXMH 4X4SA 2DR8A 4BCAA 4LF7J 1SEIA 2ZJPQ 4A8SA 1VK8A 3BBBA 1X4MA 4WE1A 1NPRA 2JEFA 1EHWA 3QSIA 2BJ7A 3PDNA 4CLSA 4A8MP 5AXKA 2I5JB 1WG1A 3DDKA 3I4PA 2BM1A 2OHDA 2V8HA 2KT2A 2ZH4A 3B4MA 3EZ5A 3W8GA 2VD3A 4ED3A 3ZZUA 4DR7F 4K4UA 1JLGB 4ZJLA 2HK3A 2YWWA 1NK9A 5KAKA 4HACB 4P74A 2DCLA 2IIHA 4K4WA 2AT1B 2Z56B 1FK9B 5DM7Q 3R5JB 4WPAA 1JJ4A 2IJFA 3HULA 2WOMB 5KFJA 3T6BA 4ILMA 1HNXJ 1DTQA 1DJ0A 2OPSA 3AH6A 2CRLA 3J80W 3G6XA 1R0AA 2HFUA 5CHCB 1GMWA 3HZEA 1KHMA 4OO1G 2ZJRQ 1FJGF 1HHSA 3CC7S 2ZH9A 3TJAA 3PO4A 4BA2I 5BR8F 1B7FA 2AGPA 1QAIA 1CJUB 4JYAF 2CQHA 3SXLA 5E7OB 2H54B 4ZCKA 3F0NA 1HNIA 3IGVA 3V4MA 2SXLA 2FLLA 3GB0A 5F8IA 2IJRA 1RTHB 4URQU 1MWQA 4O23A 4DG1A 3MUTP 1NKBA 2AZ1A 4I64A 4UUXA 5CD4H 5KT4A 1M1GA 2XY5A 1GQEA 3K5LA 3LQVA 5LM7E 3R6LB 3CJ5A 1S6PB 4UUWA 5ETVA 2ZHAA 4DN9A 2AJ0A 2LQ9A 3CJKA 4U8VA 3GIMA 1LW0B 1S1TB 4EMDA 3M30A 2ADCA 3HFKA 3BGOP 5D78A 3VGUA 5E41A 2M8HA 1RTZA 4PG5A 5HQ8A 3OETA 2YVSA 1OJ4A 1R0BG 2HSEB 3DMJB 4HT7A 2JEBI 4B17A 5E3QA 4Y2IA 2FC8A 4IQXA 1TVRB 1F2GA 4L3KA 4NOHA 1RBAA 1QTMA 4GKKH 4RW7A 3CSKA 2H5EA 4N56A 1MSWD 3JTPA 1ZM9A 2RRAA 2BJ8A 4ER8A 2Z58B 4WANA 4WP3A 1TL3B 2IPOB 2UUBJ 2CPJA 4QYZJ 7FD1A 4UT4A 4EI2A 2Z2MA 2EI5A 3L9ZA 2PI4A 3OR2B 4G1QB 2CPHA 4QW9A 3EE3A 4X64H 3HHEA 2RVJA 2HK2A 2K8GA 2J9EA 2HIQA 4F3QA 5E3AA 2VKZG 4DR2H 4USKA 2GJFA 3RF2A 4OI6A 1Q8LA 2CWFA 2LQ8A 3AD8C 3MCNA 4EBCA 3IAM9 3N6LA 5B0GA 2DCUB 1C0UA 2VF3A 4IH7A 4LF9F 3HSJA 4DZDA 3GR1A 2UXDH 2VQEJ 3PW0A 1RISA 2F7VA 3PRDA 5LOQA 3U1KA 2IM0A 4MIBA 2YTCA 3J7Z5 5LSLA 5IT9W 2I1RA 4ZVSB 5C42A 4NZ0A 2OPRB 4OX8A 3BO3A 3G86A 3J80Y 2PMHA 2HGLA 2YWEA 2AF6A 1RT7B 4M5JA 3BPSP 2XM3A 1L3VA 4J7CA 5F8GA 1P9QC 5AXNA 1RHMB 2ZOGA 1AT1B 1YGYA 2QG9B 2RF2B 1WKLA 1ZYQA 1SV5B 1ITPA 4LF1A 1W2IA 4UQTA 3IAS9 4XAKA 2LKZA 3NGSA 2HWIA 3FGVA 3MFIA 4XPEA 2BE7D 1GMVA 1UWAA 3CE8A 1SC4B 4PYDA 1G3OA 1BQMA 2YWKA 2E5LJ 1D9AA 5E2QA 4DQSA 3GYNA 4CZCA 4B9MA 3KUHA 1EARA 3SEOA 2V8VA 1GT8A 2VC1A 3I4HX 4K5RA 4PCQA 3KK3B 3R5BA 3UOEA 1L3KA 2H1YA 2AGOA 3MMAA 1R3NA 3PFEA 4M5HA 3ZTQA 1YJ9S 1UVLA 2KJWA 1HMVB 1IBLJ 1CBKA 2J9CA 1N5YA 4USTA 4C2MA 3MEGA 3BSAA 2OPVA 2AX0A 2EK6A 4FBUA 4N77A 3GMGA 1IBMH 1KR4A 3FFIB 4QR0A 3IO1A 4B9TA 1D09B 3VAJA 2ZZNA 4NEZA 3T1HJ 4OZLA 3ENWA 2XYHB 4I6WA 4O3PA 1HARA 2V94A 3AHPA 1DQ8A 4DUTA 4OI2A 2BMBA 1PSDA 3ZFVA 1TMJA 4EUVA 5KG3A 1RTDA 3MOJB 3IBWA 3UDCA 4YQWA 3J80U 2OEKA 4C8MA 4RW9B 1DTQB 2OPSB 5KFCA 4BS2A 1NJYA 5BR8H 4IH6A 1HWIA 2ZC4A 2H9ZA 2CJKA 2VG5A 4AUKA 2LU2A 2MGZA 1ZM4A 3KJQB 1J5OA 3DM2A 1RK8A 4X2BA 2A18A 1AN7A 2R7SA 3M6WA 4Y00A 1KP6A 5K8OA 1Q16B 2KDOA 3HFVA 2YKNB 2C3PA 3DXSX 1RT2B 2X1AA 4JI0J 5ETTA 5A8KA 1T9VA 3VAMA 5G0RA 4X84A 4DUZH 4QIGA 2W2NP 2HNDB 2L9DA 1NPPA 4O3RA 3FDSA 2RHQB 3C15B 4B3SH 3CPWR 4LF4J 5IT9Y 4TY8A 2RQCA 2PMZD 4EK2A 1S6UA 3QJPA 5ETMA 1RACB 1XJWB 6AT1B 2FDNA 2KL8A 1YLXA 3GONA 3FAUA 2CQ0A 4MIAA 4NYPA 4M63A 1KWMA 4IKAA 3A3OB 1LV5A 3BB5A 1H74A 2D7SA 5CXTA 2NZCA 3D68A 3EGNA 2DGOA 2LECA 1MG7A 1ZAXA 4DV5J 2A2DA 4H8AA 4FXDA 3GFXA 4N47A 3CDAA 1NK7A 1X5SA 2DPIA 1M1HA 1LNQA 1CJTB 4FVCA 4DUYH 1U24A 1RT5B 3IG1A 3TWZA 3D4JA 4RBTA 3RB4A 1NKCA 4WZQA 1HD1A 3G9CA 3QRRA 4ED7A 4X4RA 4DR5F 3IXQA 1LEOA 2UZAA 9RUBA 1EAYC 3M2VB 3MOZA 5B08A 1JNZB 3K8VA 3Q8SB 3LW5C 1A0OB 2P9CA 1SL2A 2A10A 2AHOB 2C3MA 3BEGB 1YJRA 2XSFA 3JSMA 3UNYA 2R2UA 1SBRA 2ZH7A 4PQUA 3HPOA 4LF7F 4ATNA 4CLYA 3FUYA 1N34J 4DR3J 3SCJE 1XNRJ 3R2CJ 1QAJA 2DVIA 2HBRB 2GVZB 2OMOA 3DLEA 1NXIA 4JI4H 2A1SA 3AOAA 4HDHA 3L7ZC 4B9SA 3HMJG 3KHLA 1G2EA 4ZP8A 1U1RA 2HS0A 5B0DA 4B02A 2KB2A 1V8CA 4KH0B 2MY8A 4J9SA 3LP1A 4HH1A 2NUHA 2M5YA 1T9TA 1ZA1B 3SMZA 3S7RA 4HLBA 4GKJJ 5AXMA 3UQSA 2BYCA 2GHWA 1RWWB 5AJ3J 3OTBA 3LUYA 2J0XA 4CDIA 3V6HA 4DS4A 2ZKTA 3CJRA 2NS1B 4QIVA 1OSDA 2C3YA 3MM9A 2DKOB 5E33A 2ADBA 2ZH3A 3BSNA 1YJTA 1HNXF 4CTAA 3OLBA 2KG0A 3CCES 2QIFA 4JV0A 1WF0A 2YH1A 3J7AK 5ETOA 2ZOFA 3W8PA 2QMXA 4DPTA 2FJVA 2JVZA 3CJSA 1N32J 3HKZD 4DF8A 3OL7A 2LMIA 3PYDA 3H2LA 2ANRA 1KQGB 1EETA 4DN0A 4QBUA 4DPYA 1RKJA 5KFBA 3PW7A 1F5AA 2AD9A 3P96A 2V34A 1AUDA 4KGMA 1ZZNA 1BQNB 3H5XA 2E1CA 1NK0A 4KGKA 2GHVC 1GTEA 3TJ8A 1NH7A 2E5GA 4JV5J 2OEMA 4KHMA 2DNLA 1S57A 3UFCX 1EX8A 5T7LB 3NBPB 2AWZA 3MPUB 3CD5A 4ANCA 1UAWA 1BQXA 3QFWA 5CCLA 5IS2A 2AV5A 1UVJA 3KHGA 4U7CA 4UY8T 4ZHRA 4TNOA 1JNRB 4I7FA 3P5TL 2BJ3A 4LF2A 2W9CB 3TAMA 3OL6A 3AJ1A 3KLIB 3MI7X 4TQSA 2Z8QA 2DR6A 1SB6A 4DV3H 4K8RA 1X9MA 4OYMA 3U1MA 3SIPB 1RGVA 2VPYB 2DISA 1U47A 2VPZB 2ZM6H 1JKHB 5HVHA 2HBQB 3AJ2A 4O0IA 1UJ6A 1E6YA 4DX8H 4RBUA 1ODHA 2UUBF 2YKPA 2GW8A 5LSOA 4OJ3A 4OI3A 5KFNA 1XTZA 2W01A 1X9WA 3W9IA 3GCWP 1S20A 3D7SB 2K1RB 5KG1A 2MZQA 4PWUA 3OFEA 4JI6J 4F67A 2QNDA 2GGPA 3CD7A 3FEZA 4LSNA 4QYRA 3MM6B 2V8GA 1JLBA 2DGXA 1TZ0A 3I96A 4M95A 1HI1A 2VQEF 2WBRA 1WC4A 1NH8A 2XY7A 1OSCA 2R7WA 2IAJA 1RLCL 4PG4A 3EGZA 3DYAA 3FQKA 2N7YA 1SUQB 1S5ZA 3A8JA 2B4PA 3PFOA 1NJZA 1RCOB 5LXYA 2KI2A 4C0BA 2DD8S 4KFBA 3PM9A 1WC1A 1ZM3A 4F25A 5CYJA 3UVJB 1WC6A 1XR6A 3GFZA 3I6PA 4O4GA 3QYYA 1LKZA 5KFTA 2BW7A 4BBYA 3ADAC 1CVJA 2Q1LA 2JC0A 2CTEA 2ZD1A 4DV4J 1RU1A 4M5GA 5F8LA 4IUFA 2MKYA 2QX0A 1LWXA 2VU5A 5DDRC 3I5CA 5KFKA 2IC3A 3TVZA 2GQCA 5GAGU 3C3LA 1VQOS 2AEFA 3RB6A 3PR5B 2E5LF 4ZPWR 3VQTA 2MMYA 1U0SA 3GG0A 4J9OA 1Q8IA 4BWMA 1LWCA 3PG9A 2KT5A 5KFDA 4RNFA 2PQUA 3M2UB 3TI0A 2DNGA 4NPOA 5AXLA 3HXMA 3KWMA 1N0VC 3VVUA 2OI2A 1IBKH 4G6VB 3TZYA 4JP8A 1QLNA 1CS4A 4YN3B 3MM8A 3NNHA 2WTFA 3EGVA 2LU1A 2IA0A 2FMRA 3M8QB 1YRXA 1IBLF 4KHPH 1WHXA 4NCGA 1D9DA 4KKOB 1HW8A 2ALZA 3UDEA 1NUEA 2LA4A 2CZ4A 3ONQA 4OX6A 1A7GE 1HI0P 2VA2A 3T1HF 1EQMA 1VK3A 3QNWB 5EDWA 1U25A 4U9RA 1H3DA 2F4VF 4NZTM 2YPYA 3DI6A 3PIOQ 3IMQJ 2QA2A 2MQQA 3C6TA 1FKPA 2FJAB 2DNZA 5IT0A 1E6VB 1UL3A 4RO0A 2U1AA 2DT9A 5H9EK 3SV3A 4CLKA 1Y0HA 1H72C 4M94A 2M0GB 4CT8A 3ICLA 2XMJA 2YPZA 1P27B 4MT1A 1NK8A 3NG8A 3LP0A 1F9HA 1SC1B 4C98A 1D8YA 1S4FA 1VQ8S 4CLTA 2LDIA 2HNZA 4OHYA 3VKEA 2MQLA 2CXEA 5EN1A 2AJQA 2EVZA 3FBFA 4JI0F 4YP3A 4X4OA 1X5OA 3M32A 5AT1B 4RW4B 4JB8B 1RT3B 3TOQA 3B6BA 3HSZA 2MQ8A 3ZZPA 3R6GB 3GIJA 1TMMA 5HQLA 2RH3A 5JJBA 2QA4S 1HNWH 4LF4F 2ACMA 4WK1A 5HJYA 4Y3CA 2QV6A 1S1WA 1M5HA 4LFAH 3N9UC 2LQJA 1S9EB 2FJDB 3IBCB 3Q8RB 2C2ZB 3MFHA 5F8HA 2JEJA 2UU9H 3O44A 2C3UA 3M9NB 3HVTB 3MPDA 4GO7X 1RWKB 4DV5F 3NWRA 4QU7A 2UVWA 5DLFA 2IRXA 2M7SA 5KG6A 2UUBH 2C2NA 3IBFB 4B3TH 4X4UA 1EP4A 5MLCV 3ET6B 2OPPA 4Z37A 3FMBA 2AEMA 1I94J 4IG3B 1KVIA 1S79A 1REGX 4I2QB 2V9KA 1U02A 3MD3A 1U09A 2CPZA 4HH0A 2W2QP 4PRFA 3QATA 4KO0A 5LMUH 1TUWA 2HHWA 2OMLA 1PILA 3DGPB 1X5TA 4DF4A 2MY7A 3L7UA 1FDAA 3MEEB 3IM8A 1KVJA 2F40A 1DT4A 2CADA 4PUOB 4J9VA 4LF6J 4OI1A 1N34F 4DR3F 2E9ZA 1XNRF 3X3UA 1VRQC 1TV6B 2XZTB 4YB7A 4LIJA 2UXBH 4KV8A 3I55S 4F2SA 3D67A 3ISNC 1VQMS 2D69A 3IFEA 4F4ZA 4LBHA 4DPOA 4Y2KA 1CULA 2LF0A 1WC3A 5KOWA 4I1TA 4DX6A 4ZPDA 5JEAG 2YX4A 3MCMA 1U0HB 1WI6A 4DQRA 1TL7A 4EBDA 4AXJA 4WYWA 4FZVA 2KHCA 5HSPA 4GKJF 2W7PA 2G9OA 2MKHA 4WTYA 1VBIA 5H9EJ 5AJ3F 3HCXA 1M5SA 3IN5A 5KG4A 2NXJA 4KIAA 2BRKA 1HWUA 1BUXA 3HT3A 3RG6A 4PG6A 3Q8QB 3A3PB 1I1GA 4ECSA 1JIHA 5HBMA 3AFGA 4ETXA 4C11B 4PYAA 3DRSA 1FKAF 3G6VA 1K1GA 3VWSA 2UUAJ 4DPXA 4N8OA 1D0EA 1TL5A 1S9GB 3DOLA 1N32F 4USUA 5J1EB 2IM3A 1VGYA 5DDPC 3VQSA 5L1JA 2DHHA 1IBLH 5D6GA 1K0VA 1JLFB 3I0SB 4JI8H 1TL1A 3O6QA 4N5SA 2C28A 2MZ1A 3RBEA 1X4CA 3FC9A 1VIGA 3MXHP 1PO6A 4Y0FA 3Q23A 4JV5F 2ZE2B 4C48A 1XNQH 2RMLA 3L95X 2VL1A 2QRRA 2V4RA 2QL5B 4NRUA 4B8TA 3GR5A 4ICLB 2HVDA 4YOEA 1NMEB 4PKDB 2FTRA 3WZ0A 2CTKA 5BJRA 4CP5A 1KTQA 4ILRA 2W2MP 4NX9A 2D3ZA 1IQTA 4FYWB 1S49A 2R2RA 4ZIVA 1X4BA 1HBMB 3SI8A 1Y9OA 3K59A 1W25A 2OPQB 4DV0H 2M70A 1HQUB 4E0DA 2GVDB 2BJEA 4FYDA 4RNOA 5KG0A 2CTMA 3ETOA 1FI4A 4NLDA 2PA8D 2ZC3A 1DZ5A 3TUJC 2DRAA 1X4AA 1Q79A 1RZMA 3MEDA 3HK2A 1MWZA 1A6LA 2W7AA 3EJMA 1H2UX 1QD1A 2UUCH 3CVKA 1BHNA 3QRPA 4Q8EA 3HP6A 5D0HA 3NKYA 1SC3B 1NEEA 4J9RA 4MH8A 3W64A 4ZDNA 4JI6F 3TAPA 2ZBQA 1R0CB 5ITHA 1GTHA 1QDUB 4JI2J 3Q8VA 4ZK7M 4O44B 4A47A 3CD6S 3U27A 1RCXB 2Z0GA 2QA4G 2OAUA 4ZPCA 1TKXB 4DI6A 4Y28C 1N52B 4M5DA 3R7BB 3FBEA 2CNOB 1RWUA 1KOHA 3ZTPA 3NS6A 1JLAA 3OW2R 4J9LA 2IDLA 3KLEB 1RAAB 2LXFA 3HF5A 3MCOA 5DJBA 1JJ2R 1B4SA 3OXLA 3H4BA 2IYGA 4RUHA 4EYHB 2WONA 5C25B 1VOMA 1SIZA 2CQDA 3OTOH 4K50A 4RU2A 2Y0SD 1M5OC 3QO9B 3QWUA 5CABA 1REVA 1WC5A 4DS5A 1S4EA 1SL0A 4DV4F 2FC9A 3DLGB 4Z7YA 2MQPA 1SPBP 3OD2A 1YJUA 2ASYA 2V0NA 3C2PA 1N34H 4YFUA 3CT9A 4KGVB 3GZ7A 4AD6A 3M1VA 1KN6A 1Y11A 2B6AB 5C0XG 3SCIE 1CJVB 2MQMA 5IM0B 1KLMA 2XTJP 3PRVA 4A8OA 4EU0A 5GMEA 4DV6J 1TK8A 2HGNA 4LFCH 5HROB 2DEIA 3W62A 4EWTA 5J2NA 4CYUB 3NNAA 5KFIA 2HNYA 1RKIA 4WP9A 4IFVA 2YXLA 3KJVB 4AYBD 2OEJA 3HD2A 1FWKA 4IO9Q 1OPZA 5DGAA 4C3KA 3K5OA 2DXDA 3DLBA 5JUMA 5KFGA 4TYAA 1TKTB 2B8PA 1GMUA 4PWWA 2F9DA 4DR4H 1Q7LB 2V2KA 2ZITA 3IWLA 2GO8A 2OIHA 1PYTA 1FKAH 5H1SV 2DGTA 2EFQA 3CJ4A 4LFBJ 1X4FA 2JVRA 7FDRA 1T7PA 5K8NA 2MHEA 2IYIA 4L3NA 4DPWA 4K0KH 3W3SA 1N36H 1C0TA 4FKXA 3M9MB 2VPWB 2WW4A 4Z7CA 3BSOA 3MMBB 1RSCA 2FPHX 2HVEA 3GE9A 1IR2A 3FVYA 1U26A 4LSLA 4J9MA 2XGQA 3ZTSA 1PAEX 4KPCA 3KNGA 4ZVGA 2VJVA 1R8AA 1HI8A 2DNHA 1W2BR 4B3OB 4DV7J 2MXYA 4DV2J 1QE1B 3GP9A 4J9PA 2G1HA 4BHQA 1XR5A 2B4UA 4YB6A 3G96A 1TUVA 3CF5Q 1F2HA 5KFRA 1YJ7A 5KG7A 4EZ6A 4OX9H 3G71S 3N5FA 2MTLA 1LWEA 5IQQA 2VQFH 1JXEA 3VAHA 1T95A 1SCJB 3ZTRA 4CI0B 4KYZA 2UV8A 2F63A 1VQNS 4NXMJ 2XMVA 4DFJA 2RRNA 5A2QU 4NWBA 4QWCA 1UPPA 3RAXA 3J7YU 2XO7A 2Z4PA 3I0RB 3IS9A 3M05A 3MWBA 2NPIA 3S1TA 4WIQA 3IC1A 3P8BB 4KPYA 2MHNA 1YBAA 2B7CB 1N33H 5E5NA 3OUYB 2ZH2A 2BE2B 2JFDA 4JI3H 4YMEA 1J27A 2YNHA 2EEYA 2FGCA 4GVBB 4ZN1A 2FJXA 2N4DA 3A8IA 4O3SA 3MUVP 1I94F 3R7SB 3OTDA 1ZPWX 1TTHB 4Y2MA 3ENQA 2JH3A 1FHTA 1K1SA 2FHJA 3FEYB 3DRRB 2P9EA 3O2IA 1VIXA 4C3LA 4CIOA 3ISND 3JAMU 3CO9A 4HVZA 2ASLA 4A8KA 4YR3A 1PCAA 2RU3A 2KXNB 1FRHA 3EZUA 3RB0A 2GMLA 3E3XA 1KC8T 1F6TA 4ZLLA 1WC0A 1K47A 1DTTA 4DPUA 2R8HA 2HQIA 2GFFA 4Y2AA 1S59A 4LF6F 2RDIA 4XDDA 4P7VA 3H0PA 4IDKA 2G8YA 4PXDA 2VJUA 2JX2A 3OFFA 3MAHA 4DSJA 2BVZA 3HHLB 1U7LA 3Q83A 3KDNA 3DOKA 1XERA 1KQFB 2IHR1 4P2FA 1ZOTA 3JB9k 1CJKB 3ILOA 2B9EA 4O3NA 1KLNA 2HQDA 2D41A 2QSWA 3KK1B 1ULRA 4WU2A 4DSFA 1X4NA 4J37A 2IM1A 2MLXA 3A1YG 1RWMB 2V2ZA 2YX1A 1FDNA 4OI0A 2MKJA 1NK6A 1FVQA 4NLUA 1TK5A 4RUCA 3KDGA 2R3VA 3T19A 1U45A 3NCPA 1MMNA 3EXYA 2J6SA 2QMUB 3QIPB 1GFWB 2ZBIA 3RB3A 2UUAF 4ZCMA 2EG2A 3M6UA 1U1OA 3OTCA 2B5JB 5CYQB 1IM4A 4GKKJ 1S1VA 1FNXH 5CAAA 1UA0A 2IRYA 2Y1LB 2HHVA 5D8HB 1KVKA 2YNFA 1KKHA 4OFZA 1IN0A 3TUIC 2N3LA 2L48A 3G8TA 1PAUB 2E5JA 5L9NA 1S1UB 1RHQB 1RWPB 3VV2B 2B43A 3HZGA 2HFVA 3M8ZA 4X64J 1HYSA 5D4OA 5KFUA 3HT0A 4BDPA 2YKMB 4USMA 5I42A 1VJWA 3R9LA 3GCXP 1AYEA 3KKFA 4DR2J 3F44A 3D3CJ 4U7UK 1O6XA 4IG0A 1RAGB 2VV5A 4NZ6A 3OSNA 3MMCA 1YZ7A 2U2FA 1U2CA 2X1FA 4F4KA 2XI2A 1YI2S 4URSA 1D3WA 1T9YA 3D1OA 2UXDJ 5KT7A 3M2RB 3Q8UA 2R8JA 2BUNA 2NXEA 2VG7A 3OLAA 5K14A 4CLFA 1FEEA 3QIDA 2E1MC 3T1YH 3LP2B 2OLWA 3MTKA 2FYXA 3RBXA 1ZTGA 5HMXA 2DITA 3C46A 4ZS6A 3QD7X 5J2QA 2HRYA 2NXUA 2WVDA 1RABB 3WC2A 5DQIA 2V8DA 2GIQA 3I32A 3NY0A 1UEKA 2QTWA 4CNZA 3I5BA 1NK5A 3PKMA 3OSPA 4ID5B 3LPYA 2ZZTA 1RQ0A 1C4AA 2DIVA 4MFBA 2LFVA 3OT9A 5KFFA 3O1LA 5K5MA 2ZFHA 2FY1A 2D9OA 2NUUG 1QJHA 4TQRA 4ECQA 3IM9A 2HAFA 4X62H 2DO4A 2KO1A 4JI2F 3TUPA 1WEXA 3N01A 4CH0S 3W5YA 2J0SD 3J7ZT 4ECRA 1NU4A 3TR5A 2NYHA 3D9BA 3SQGB 3QGGA 4HI2A 1APSA 1J5EH 3AOBA 3DLHA 3JXOA 1O51A 3E2EA 4O3QA 2YNGA 3KJFB 4Q2LA 5LJ5Y 2E44A 3PTWA 2WCXA 1NSKL 1IKXA 1YZ6A 3GIRA 1NJXA 1RTJA 1FJCA 1IJEB 1Q5VA 2WB4A 3HHNB 2KH9A 1I94H 1RA6A 2M52A 1TAUA 1IBMJ 2Z57B 3AD7C 1Q7YT 5A8WB 3ELHA 4WBFA 2ZOMA 2AW0A 3PX0A 1RADB 4YB1P 4F0HA 4IRDA 1HBOA 2XZDB 4OHXA 3ZZYA 2YWHA 2JVOA 4B8CD 1URRA 1CPZA 1MNEA 3EDRB 3CCRS 3MPVA 3MUMP 1BE4A 1JLEB 5FDLA 2G2OA 1TU0B 4EC5A 1Y3JA 3GABA 1MSZA 3W9HA 2VH7A 3C16A 2XO6A 1H73A 4Q44A 4CLWA 2CWXA 3C14A 1JX4A 1SJ3P 4EYIB 4DV6F 2J0WA 2MJUA 2AEJA 6FDRA 4FKYA 4Y2CA 1DRZA 5EWGA 3PCOB 4UW2A 3O5TB 3ITHB 2VICA 2VKRA 4DL2A 4DUZJ 3AT1B 5A0YB 4RW8B 2YBVA 4B3SJ 4YS2A 4DOZA 3IR7B 2ZH1A 3M6VA 3GJRB 3D28A 3CIZA 1VQ4S 3T9ZA 3N28A 4PG8A 4QOTA 2G2ZA 1RT4B 3KUEA 2WK4A 1AXQA 2BE9B 4MYTA 3KDOA 3W63A 2CJBA 5HI7A 4NLRA 4B08A 3CJTA 4LFBF 1GXTA 2UUAH 1MU2A 1S12A 2V2QA 6FD1A 3CCVS 4MIWA 1FE4A 4ED6A 1EB0A 2AJ1A 1KHWA 4NLQA 1FVSA 2LTMA 3RR8A 2WVEA 2W4CA 3HI9A 2JLEA 3MM7A 4C8LA 2D1CA 2B9XA 2VHGA 2HBZB 5CYMA 4U96A 4DUYJ 1V9OA 2HMIB 1OY8A 4DV7F 4DV2F 1IXKA 1TL4A 2PGCA 1UKUA 2XCAA 3CCJS 4WALA 2OKQA 1T0TV 1S6QA 1HQEB 2KM8C 1HNVB 1YX2A 2KN4A 1HW9A 3KG4A 1RJJA 5FLXW 3K89A 4OZNA 2ZH8A 2XS7A 2M3DA 1ROFA 1FWLA 3AQOA 3A4TA 3QLHA 5J2PB 2KVIA 3VAFA 3CCQS 2VG6B 4ECTA 4OV6A 4ITSA 2F65A 3K5MA 4NXMF 4F36A 3EWGA 5HVFA 3TARA 1XN9A 2CA9A 1PG5B 4DFMA 4YEAA 1N6QA 2QA1A 3V6JA 3HHLC 5C5JA 4JI4J 2RJZA 2ZVIA 2MZTA 4P2MA 4J9KA 2BQRA 3CIMA 1QUPA 4QCLA 1N0UA 4JVYA 1LWFA 2PT7G 2FQQB 3QT5A 3QRQA 1VBZA 4EZ9A 1U6FA 5KFEA 2RUGA 3CCMS 1VJQA 5H9FK 1FKOB 4KAIA 4F50A 3W2WA 2JC1A 2VA3A 3RJMB 1FT8A 3CXCR 4KBIA 3SCKE 4FS2A 2HS3A 1NB7A 4MAKA 5D0RA 1UWBA 2RDJA 1WE8A 1IR1A 3C8YA 4JI2H 1RT6A 4IR9A 4ED5A 4Q43A 2P9GA 3GSIA 3TANA 4M5MA 1FCAA 1G4CA 3ZXWA 3LANA 3KLFA 1HBNA 1Y3KA 3KHRA 4CO4A 2BANB 1ZZFA 4P10A 3KK2B 1NLKL 5EX0A 5GAEI 2BL5A 1K0TA 4WU3A 4ZMMA 2VZ9A 4QWBA 4M5LA 2X7IA 1FX4A 4ZVRB 4NI2B 4GMKA 2CG8A 2LXIA 2LYVA 5CQGA 1NXUA 1DFDA 2B0GA 2Y1IA 1IQZA 3OHBA 4OYBA 2IMWP 8RUCA 3R27A 3KJNB 4OD6A 1T03B 2GAHC 5LMNJ 1YVFA 2EBGA 2RKIB 1UEVA 1IKYB 1URNA 2CTJA 8AT1B 3QZ8A 3SYZA 1N54B 4D3GA 2H4YB 2LP4A 1S0NA 4OIXA 4WCEQ 2GHPA 3B78A 3H59A 2CFXA 1B99A 3W61A 3KOAA 3ZNUA 4K4ZA 4TXSA 1GNKA 1YHQS 3AY0A 1P8GA 2O5DA 1BY9A 4W92B 2ZNZA 1ZZIA 4K2XA 5HP1B 2WRMA 3SQOP 3EZOA 4DV3J 2G1DA 1QVFR 3FJ2A 4GKKF 4ELTA 4KGZB 4YHHH 4NA3A 4DSIA 4Q0BA 4H54A 1ICEB 2GAGC 2Y3YA 1UA1A 2ZM6J 3WDOA 3SFGA 2A6OA 1Q5YA 1JXLA 1IUJA 1FNOA 3GLJA 1C1BA 1V3SA 3CCWA 2IM2A 1V3ZA 4X64F 3AXMA 2X1GA 5DT9A 3CMQA 4ZVQB 4I68A 4IOAQ 2PA3A 3TVKA 4DR2F 5RUBA 2DNQA 2W7OA 2LEAA 1SIWB 4FF2A 3MECA 3U02A 1WEYA 5KFMA 2AX1A 4PWDB 4RJVA 4LUBA 5A8RB 4FXVA 3W5XA 3MAAB 1RHRB 3KLHB 3D0HE 2BACA 4KC5A 2UXDF 1N5TA 2YNIB 3K8WA 2JLFA 3NRBA 1S1XB 3SSQA 5U47A 2CNKB 2PFFB 1J2VA 5H9FJ 3DLKB 4IFYA 4X65H 1OS5A 4OJ1A 4DSKA 1S10A 4Q8FA 2O67A 3MM5B 1UJ5A 3BKFA 1L3UA 5CA5A 3UD3P 3DRPA 3E8OA 4ES2A 1S76D 3BZQA 1U8SA 3GILA 1NZAA 4U6PA 4GRSA 2W9BB 4J91A 5FLXU 2NSCA 3D6HB 2HVIA 3IRXB 4GC6A 4C9DA 5IC6B 4R8UA 1GX6A 2PEBA 3P6YC 1VBKA 5HMWA 4E8UA 4OHZA 1GXLA 2V8PA 1MN9A 2J8SA 4CNYA 3T5KA 4W98A 4KR0B 1Y5IB 1FTCA 2MKCA 1X0PA 4BLGA 1FFGB 3G6ES 1R8PA 2CJQA 4NEYA 4ZPAA 4YB5A 2YQRA 5CZVA 1Z2ZA 2YH0A 1UW9A 4OCHA 3BYRA 1ELOA 1IBKJ 1M5VC 2NR0A 4CO5A 3IA0A 1Z4UA 4FYYB 4QQBA 3UI3A 5HLFB 1M0SA 2AJ4A 3AAWB 4KHPJ 1O8BA 3VZHA 2B4OA 3MPWA 5C7PA 2GQ2A 3B8HA 3AB4B 2K7JA 3FBBA 1RTIB 1IBMF 2POKA 1O5JA 1TKZB 2LXUA 4H4KA 2DGVA 4UOHA 4OX7A 1IKWB 1DLOB 2JDJA 3W2VA 2RD5C 4JI5H 2IDEA 3R1LA 5KFXA 1HNZH 2VBWA 3G87A 3T5JA 4DR6H 3GJQB 3R1HA 3ULHA 4NXNJ 2EWHA 3LAMA 4M1KA 5J2MB 4B9VA 1F9EB 2KXHA 4USHA 4FJSA 2ATLA 2FLPA 5C24B 3H2VE 3V81A 1JLCB 1ZZKA 1WWHA 1SKWA 5D0GA 5B0EA 5GVQA 2DBBA 4AQYH 1Q1KA 3FZBA 1R7IA 2MYFA 4ECZA 4FBTA 3Q2SC 2ZBRA 4LRFA 3V6DA 4WZMA 4R25A 3DOMB 3V4IB 4DUZF 4ANEA 2HH3A 1XMOH 4X4NA 4B3SF 5D3GA 1W7WA 1HNWJ 4O4RA 2E9TA 4C7QA 1QVGR 3WBZA 1SH3A 4CO1A 2IVYA 2XWXA 4LFAJ 4CLUA 4O3OA 1TKDA 2Y8WA 5IOLA 4E2FB 5KG2A 5M2PA 2UU9J 4B9NA 2G4BA 2UXCH 1EIYB 2C42A 2ERRA 1LXNA 3C6UB 4Z2XA 2FUG9 1RB0A 3AQPA 2F3JA 2GX8A 3MEKA 3CDBA 1U1NA 1WVNA 1MROA 5GADI 2PI5A 3H5YA 3NMAA 3NGUA 4B3TJ 2MZRA 3T6JA 4U67Q 4DUYF 4J5OA 4DFPA 5LL6b 5F0WA 4U7UD 3UN5A 3NL0A 1UFWA 4CM2A 1MLAA 2ZZMA 3Q22A 2ZDPA 3K2YA 3LGNA 2COLA 3H5SA 3GYXB 4G1PA 3UD5A 2VBYA 3EDQB 2HHTA 2O1PA 2ILYA 1IKVB 2ZEJA 2ATCB 1TQLA 1WG5A 5L39A 3HHLD 5LMUJ 1P9YA 2ALYB 1R8BA 5A6PA 1R89A 1SI9A 2P6SA 2XSJA 3W7BA 3BKTA 2HHHH 4D3HA 3NNCA 2BQ3A 1TUGB 2YY3A 3BGRA 4ILLA 1FRKA 5ETPA 1I6JA 4RW6B 1SJ4P 2FVPA 2F8HA 4M8LA 4R5PB 4ZVTB 3D2WA 2XG8A 1RT1B 2UXBJ 4ES1A 1Q0NA 2UP1A 4JI4F 3POTB 3EGWB 4JVHA 2OD6A 3EM1A 1NDKA 2EK1A 3OXFA 4K7QA 3UCGA 3V6KA 4DU7A 1T3OA 4M5IA 3SBMA 1T05A 3NGTA 1YTYA 3G6YA 1K1QA 4AL7A 4RPFA 4X4VA 3GTYX 2H48B 3OR1B 3BGFA 1HPZB 1PGZA 2PIIA 1C1CB 2M9KA 3QSYB 3LWMA 1SH0A 3US5A 2HS4A 3CJ8A 4ZKAA 2LVWA 4LIRA 1U6BA 3MD1A 4DEZA 1WSVA 4ETZA 4NMLA 1VRTB 4WFYA 3CCSS 4G3IA 3FMWA 2MQNA 1AROP 3EVMA 4F3OA 1RP5A 3OVBA 3E01A 1WTBA 3OSSD 4WE1B 4RUAA 4DL5A 2BZ2A 4FP9A 1B7YB 2QO3A 2CJAA 4WTOB 4LIWA 3NP5A 2OTJS 4OJGA 4AFFA 1ZBTA 3IP0A 5ADZA 4JI8J 3HJFA 4LBIA 3DU6A 2NPFA 2DTJA 3ISZA 1ZS6A 3WIVA 3OL8A 3MR3A 3UW1A 1D9FA 3Q8PB 3L4BC 4B3RH 4I6AA 2HPUA 2D3UA 2HQFA 3D1HA 1XNQJ 1VIHA 2ZHBA 4IR1A 3OVSA 1OQ6A 3SDEA 4DL7A 5GAHU 3BJYA 3TYTA 4EFAC 3NMRA 4ECYA 4OMFG 2V4JA 3VZIA 4Q5VA 1TFWA 2CWKA 4CLPA 1R0AB 3RGIA 1SJFA 2Q79A 4B3MH 2ANNA 1PKUA 3CJ2A 2IFXA 5HQMA 2B3TB 4DLGA 2VFSA 3PW2A 4DV0J 4U95A 3M8PA 4DV3F 2Z2ZA 3UDVA 1OWXA 1HNIB 1VLYA 5DS7A 4CM0A 4FF4A 3BBCA 5KFPA 1R8HA 4DG1B 2ZM6F 5IC4B 5KFWA 3ENVA 5I3UA 2XGPA 2K3IA 1HBUA 2X1BA 2QN6B 4ED0A 2DXEA 4FF3A 1VQ9S 2UUCJ 3MF5A 1QSLA 2JOQA 5B0FA 4PR6A 3CJKB 4UF4A 5D4LA 2M88A 3J81Y 4AM3A 3RAMA 2LDYA 4HR2A 2RE1A 3PEHA 3I0PA 3M30B 4IOBA 9ATCB 2LRRA 3MTJA 2GIRA 3N79A 3BN7A 2A3JA 1UCNA 3QMQA 2XY6A 4K5SA 3V2UC 1UTAA 2KTQA 1X8DA 1JLQA 5EGYA 3AB2B 3HHKA 1V6HA 1LW2A 3PY8A 3TX0A 1UEUA 1WTFA 2O01C 3IR5B 1HWKA 2QL7B 3M9OB 1F0XA 4HTJA 2PE8A 2PDAA 4RW7B 3VAIA 1XRHA 3BM7A 1H38A 4CO0A 1YKWA 2VBXA 1L3TA 4NLWA 5HANA 2QLJB 4WIIA 1WHWA 4NYOA 3ZZZA 4ZP6A 4RL1A 3CNQP 3OTOJ 3WX4A 5GAGI 4H4OA 4RKUC 4DSLA 3DDNA 1HR0H 1AZSA 2GCFA 1FWPA 1XK8A 3O3LA 1LFPA 2RDDA 4I2PA 4CO3A 1U8WA 2ABYA 3PX6A 1DTJA 1VRUA 2BJ9A 3DHXA 1QTNB 1C0UB 1BC6A 3TAQA 3GV8B 4L75A 4LSZB 1S0VA 1OYEA 4F4YA 3PO5A 4IFDG 1YQHA 4DDFA 2MDAA 4ZPTR 3G82A 5IT9U 2ZWPA 3A3NB 2HAIA 7AT1B 4R0JA 4LVOP 2M2BA 2DRDA 5C42B 4LFCJ 1IBKF 2CPMA 2FJWA 2ZDOA 4I4BA 3KG0A 5DM6Q 4PEOA 4ECWA 4KHPF 3PX4A 3I56S 2R7RA 4H4MA 1YK9A 2LQ5A 1U1MA 3AA9A 2CDRB 1WG4A 1XEZA 3JYTA 5B7WA 2MEWA 4Q7AA 3T5HA 3T41A 3EPGA 4DR4J 2UVVA 1FXLA 3J7AN 2AYMA 3WIUA 3OXGA 1JJCB 1X0AA 4A8WA 5T41A 1ACMB 2VDHA 2FB0A 2JA9A 2FHOB 5HMZA 4K0KJ 2C22A 1N36J 1BQMB 1IWGA 1NDPA 3O8WA 2XMMA 4NXNF 4V19X 3MGJA 2CTFA 5EWEA 3CDEA 2I5JA 1WHYA 3FSXA 1FRLA 4NLOA 2R7OA 2HQGA 3MMAB 4C0OC 3FNNA 2NXCA 1Q95G 5LMNH 2C2RA 1JLGA 4UOFA 4OX9J 4HACA 1N5YB 2HWTA 5IZHA 2MKKA 1N48A 3MEGB 2V5HG 2VQFJ 1UW4A 1FK9A 1UP1A 4ZCIA 3Q2TC 2IVMA 1GXUA 2Y3MA 1HNWF 4ES3A 3QT6A 2E1AA 2WOMA 3SFUA 3H90A 3F73A 1AW0A 2QL9B 2E3UA 1RTDB 2L3MA 3CGIA 2EXUA 4LFAF 4RLEA 1K73T 3DXBA 2VG5B 2RNEA 1WELA 2MGZB 1XQIA 1CJUA 1ZETA 1CSJA 1RE1B 2UU9F 1J5OB 3DM2B 3FCVA 1U1PA 1N33J 3C66A 3D66A 4AE5A 3UN2A 2HLUA 2LEPA 2BRLA 5DQGA 1RTHA 4DCJB 2HGMA 4JI3J 4CRJA 1HWLA 5GMDA 4NLTA 3LH2S 4IQMA 4ED2A 1U2FA 4ZOSA 4B3TF 4K4XA 2F9JA 1WORA 5A8KB 1KFDA 1FRXA 1S6PA 4CH1A 5G0RB 2GS8A 2HHUA 2ROGA 1BGXT 1LFWA 2NXNA 5BXIA 1LW0A 3I9V9 1S1TA 2E5HA 4FDFA 2J9DA 4TY8B 4UOCA 3PYEA 2KKHA 5LMUF 5EUHA 1RAHB 2RHSB 3HSDA 1D1UA 4PQAA 2D3O1 2EKYA 4TKTA 2R8IA 1S9FA 5E3PA 2PN6A 3DMJA 1N4LA 1RI7A 4OZJA 2QFIA 4FNHA 2KXFA 1TVRA 4ZLJA 2UXBF 2AYEA 3UO0A 2CQ4A 1ZAWA 3P4UB 1VQ6S 3TRGA 5KFHA 2CQPA 2YQ1A 4XTTA 2WZ1A 1TL3A 4F0KA 2IMOA 3D3BJ 2DR9A 3IG1B 3SB1A 3DN9A 4WYLA 2K1HA 1R31A 3BREA 3OR2A 4G1QA 1Q81T 5EHHA 3CCUS 3CDWA 4HHJA 3IGNA 1F5BA 2KYXA 1FO1A 4NBQA 5A6WA 2W8KA 4BC9A 2CKWA 1SQGA 4GC7A 3W1YC 3JSMB 3KDKA 4P71A 3UN3A 2GNKA 4PQUB 3JSYA 2R8KA 2DR7A 4X4QA 4WF9Q 1VC5A 2JE6I 1KDNA 3NOGA 5D15A 2D74B 1WACA 4HHHA 4ECUA 4I0WA 2PD1A 3THTA 3FCWA 3EYZA 1JQGA 2FVQA 2Z30B 2DB1A 3DNCA 4QW8A 2KHDA 5DG8A 3DLEB 5CCMA 1Q78A 5ETLA 4NL5A 3FZ2A 2AXYA 3GWCA 1VR6A 2CQ3A 3H25A 2OPRA 3B82A 2F4FA 5D77A 2CPXA 4ZJQA 3R3TA 4KT0C 1TELA 3VHQA 2FFMA 1NB2A 4JI8F 4ZCLA 1RT7A 1B0VA 2K7KA 4XPCA 1XMQH 1H98A 4OYOA 2BM0A 4QR1A 3LP1B 2FZCB 2C2EA 1AFIA 4J9NA 2V68A 2RF2A 5THWA 1XNQF 1SV5A 4HT5A 4TYBA 4QIFA 4XK8C 5L1KA 3THPA 2EBEA 3DKDA 3D0IE 3MM9B 3BN4A 4ZVOB 4PPDA 2CQBA 3BGLA 4OYIA 3BDPA 1JWWA 5J1PA 4CTAB 2E29A 3NGDA 2XMTA 3J81j 2KG1A 2HIYA 4NXNH 4NASA 1T9WA 4RBVA 3M4XA 1DHMA 2J8AA 3T1YJ 4BC7A 1GX5A 2EFPA 1HA1A 4DV0F 1NCLA 3KK3A 2F8MA 2Y0BB 1EETB 3QGHA 3TX8A 5KFYA 1IWAA 2QT7A 1PYSB 1HMVA 5IT4A 1U48A 3MR5A 2J6UA 2I0XA 4ANDA 5F3ZA 2N4CA 2G0JA 3L7OA 2BEFA 4WXWA 5KT2A 5JVGQ 2E9RX 3EX7B 2MJNA 2RQMA 2UUCF 3FFIA 3C19A 4TU7A 4UZCA 2MLZA 3F41A 5M2UA 1NPKA 4BWJA 2I9SA 4CQ1A 5BYRA 4XO0A 5L38A 4X62J 3GKUA 4RW9A 3CJ3A 2V9WA 1BWEA 4A8XA 5HMYA 2HG4A 1RAFB 2QJ3A 3QT7A 4ZHRB 1MMDA 4I7FB 4C3MA 2IBKA 3DU5A 2QLXA 1J5EJ 1MW7A 3MDFA 3TAMB 3BPDA 2ACYA 2W1BA 1VDHA 1FDDA 2OSRA 3MR7A 4IH5A 4JI7J 2KU7A 5G4DA 1VMBA 3UNGC 2YKNA 4I67A 1RT2A 3FBCA 5KOXA 2CQCA 1E6YB 3I5AA 3MR6A 5L46A 4JOUA 5LL6d 3OTOF 5GAEU 2HNDA 4RNMA 3C15A 3WC0A 3R2DJ 2QMWA 4X66J 1FNMA 2MB0B 1N5QA 1P6TA 4AIMA 1F60B 1CG2A 2GGPB 4KHRA 3CTRA 4LSNB 3VTIA 2G13A 4V19J 5DO2A 2W4PA 4JV1A 3OQ2A 4LJMA 4O0NA 1JLBB 2JWNA 2RS8A 5K9FA 2BV3A 1C4CA 2DHSA 2ZHOA 2LQBA 1VLOA 3UR3C 2ZWOA 2IAJB 2GQQA 4QIEA 1WDTA 3I82A 5IWAH 3DYAB 1RDRA 2HLTA 1CJTA 4LFCF 4DL6A 3TA1A 1RT5A 4NA2A 2FJEB 4KFBB 4QWEA 3QJJA 3UWTA 1OO0B 3NS5A 2OJ3A 1JK9B 4O4GB 1EJ7L 3M2VA 4DQPA 3CUNA 4P2SA 2ZD1B 2CNNB 4LF5H 4DR4F 3FSYA 3A8KA 3ILLA 1Q82T 3RAQA 2Y8YA 2XLKA 3HHDA 1KEKA 3LAKA 4F02A 4WKRA 2IC3B 1Y00A 4Y65A 4CH7A 4KRWA 4K0KF 1N36F 1N5VA 3VGTA 2VUGA 5MAOA 1OPIA 2GVZA 3HX9A 4K2JA 5DETA 1LWCB 1N88A 4RU9A 2V2VA 2ZUAA 4G1IA 4ZLNA 2VKCA 3WQPA 2E7XA 1KONA 3RW7A 2ASDA 1CS4B 3MM8B 4Q45A 3PJXA 4DV1H 4NYZA 2B9WA 1U1QA 4NA1A 3ZZTA 2EFVA 3J7YI 4NCGB 5KT3A 5IQ6A 2MPUA 4OX9F 3PKYA 1VHIA 2VFUA 5DRKA 2VQFF 4P52A 1PJ5A 4LF8H 3QT8A 3NWGA 3I87A 1WHRA 2CPEA 3BR9A 3DI6B 1SQFA 5DLGA 3SSRA 3C6TB 1FKPB 1SJQA 2Q6CA 2WW8A 3R5AA 3NGKA 2QFJA 4OZ2A 2H5IB 2FHMA 3SSSA 2ZH5A 3KLGA 2KFZA 1UPMB 2PFDA 4WJBA 3TQ1A 5DQHA 2I8EA 1ZA2B 2BA9A 2PY9A 3LP0B 1N33F 4QU6A 2DYAA 1K9MT 1Q8KA 2BR0A 2QGFB 1T94A 2HNZB 2E66A 4NLXA 4DX7A 1PC4A 2AZ3A 4JI3F 1BQNA 4OLOA 3ZC4A 4DR7H 1CC7A 2BKPA 2XZWA 5AE3A 3GSDA 3M32B 1KNZA 2E7VA 3OFHA 3QPIA 1NDLA 5T7LA 3NBPA 2KRBA 3Q8YA 2RQ4A 2XMAA 5HO4A 2AKWB 2DY9A 2XEXA 4NLYA 5F3TA 3ILJA 1S1WB 2F4VJ 3J7A1 2DHAA 2BXJA 3HKWA 3OPKA 2E7WA 2XMWA 3PYFA 3PIPQ 1P1TA 3AODA 1FJGH 2FLOA 3ZZ0A 2W9CA 2CPYA 3DGVA 3M8RA 4F8RA 3KLIA 5D0EA 3OJUA 3H8YA 4JYAH 4CT9A 1JMTA 2PSZA 2B7BB 1U4BA 3BYPA 3U1NA 4USWA 3MR2A 2E5IA 5KFSA 4F4AA 1JKHA 1GMWD 2NZ4A 4TN2A 2GZOA 1EP4B 2HKEA 2OPPB 4C8NA 1YJNS 1UJ4A 3D6MB 2KRRA 5HVGA 2N82B 3KG1A 3HDSA 3LWLA 2K1RA 4YR2A 5IFMA 3HM9A 1EZZB 3CC2S 2XMUA 3MCSA 4KO0B 1CQNA 2CJXB 5F8NA 2CPQA 2BBEA 4TLRA 4DQQA 4A46A 3MM6A 1R6YA 2F5GA 2HHSA 2GA7A 1U1LA 1VIOA 3VALA 1PBAA 5KTQA 2WBMA 4GO5X 2ROEA 4YHHJ 2KT3A 4KV8B 3IR6B 2DNNA 3CB4A 1SUQA 2E1RA 1RAIB 3UR0A 2HQCA 2B4VA 2WSEC 3Q0AA 1RAOA 1VC6A 1CULB 1NAQA 1TK0A 2FGOA 3UVJA 1I51B 1LQ9A 2RSQA 1TL7B 2IVFB 3CC4S 2MJHA 3GV5B 1X5PA 4MTPA 3DRYA 3K57A 1RXOB 1T8EA 2C2OB 1VFJA 1FD8A 1KD1T 5GADU 4ED4A 1LK7A 3KXDA 1R6VA 5GMKa 4LF9H 5T14A 5HBMB 2VODA 2FLNA 5CH7B 2W25A 4L72B 1WSRA 3DRSB 2XLJA 2XQCA 4HDGA 1NJWA 4CLLA 5L1IA 2YQ0A 1D8ZA 4P7TA 3T1YF 3D6TB 1VQ7S 4DXLA 4AT1B 3DOLB 4M5KA 3M2UA 2MZSA 4X65J 2UVRA 1PJ7A 3TP2A 3RU0A 3PJWA 3LALA 2DNKA 3FRZA 2HFOA 1VQSA 4L73A 2G0CA 1WUUA 1TL1B 2VFRA 3M8QA 3P45B 3OVAA 4NE9C 3N6NA 4KKOA 3BGUA 5EX3A 4N76A 1F9FA 2M4MA 2UV8G 4TU9A 1UVNA 1OIAA 1PBUA 4YUDA 3FCHA 2X06A 2DGWA 2ZKUA 5K8PA 2Z0SA 3UD4P 3LF0A 4ZIWA 1EC6A 1Z2LA 4C97A 3W66A 4X62F 1E6VA 4QPXA 3D6FB 2LA6A 1ZM2A 2CQ2A 2R2SA 1QY7A 1J5EF 2X3DA 4OZ3A 3KLGB 3PR4A 3Q86A 1RHKB 1U1KA 2NSBA 2R2TA 4JI7F 3RW6A 2GJIA 1FX2A 5AE1A 1DARA 4FF1A 1V5VA 3MEDB 3T9NA 1QM9A 3GPAA 3ETMA 4RW4A 2J76E 2IA6A 2HZCA 2XULA 1RT3A 1V3RA 5F9NA 4JI1J 1NHKL 3R5GA 3LPEA 4S0MA 4X66F 1FEHA 3N4WA 2XCPA 3TW0A 2R7TA 2HHXA 1NSAA 4LR8A 3KMSA 4JI5J 2UUTA 2BDPA 2CPFA 3E51A 2CTLA 1HNZJ 1S9EA 4HTIA 3L09A 4DR6J 2CAJA 1OQ3A 4A8QA 4M5DB 3VAKA 2OD4A 1SJRA 2OTLS 1OYDA 4ECXA 1W26A 4CO2A 2Q3PA 2DGQA 1JLAB 4ZVFA 3HVTA 4DSEA 4F2RA 4AQYJ 2C3OA 3HVWA 1XR7A 2DGRA 1N56A 1G7CB 1RAJA 2EPIA 5DZ7A 4YDXA 2CQ1A 3I31A 3ET6A 2WONB 5IV3A 4CLZA 2QLWA 4OYZA 4IG3A 1RYRA 1XMOJ 5ETQA 2GJ2A 4I2QA 1X7VA 4YY3J 4NLSA 4C8YA 2QE5A 1REVB 3A13A 4LRBA 1BLUA 1F1BB 2RT3A 4LRCA 4DL3A 2AU0A 3DGPA 3N0VA 5FD1A 3MEEA 3W9JA 1AB8A 4ZPBA 3VGSA 4PUOA 1KHVA 2ZNYA 2UXCJ 2VOOA 3M1VB 4WKYA 1TV6A 4OYWA 2C2MB 4ZVEA 1KLMB 5DG7A 3PHEA 4ALZA 4NMXA 1S7HA 1RU2A 3WHIA 3ZNJ1 2HRTA 5J2NB 4KB7A 2HNYB 4PXCA 3IWNC 2F8EX 4IFVB 1U0HA 3K58A 4C8ZA 3QQCD 4DR5H 3PV8A 5SZTA 1VHFA 2OPUA 3R7NB 2IY5B 2CNLB 2VPXB 3JTOA 2XYGB 1SC6A 4USIA 2CPIA 3Q89A 1B0TA 1MN7A 4UZBA 1WDDA 1WEZA 1HLWA 4K4YA 2HHHJ 4C11A 4LF7H 1TP7A 2MKIA 1DY3A 4TY9A 4F26A 4OQJA 5EWFA 5ETKA 3PRBA 1C0TB 1FESA 1S9GA 4WFAQ 2EG1A 2VIHA 1QAYA 3CO0P 5J1EA 1H2VZ 3NGRA 1X4HA 4LSLB 4OHVA 4RR5A 1FXRA 2ROPA 2PMWA 1JLFA 3I0SA 1UFKA 4OL8A 4Y6IA 4MMOA 2R7XA 4E9JA 1VBYA 2Q6BA 4PAAA 5KFOA 3N5BA 1VQ5S 3DLJA 3PXGa 1ZTTA 5B0CA 2ZE2A 2PC6A 2I38A 4FPIA 1FTRA 1LWEB 5HN0A 3GFHA 3PNIA 3IWXA 2EKNA 2C1EB 4MK8A 3DFEA 1YDLA 4ICLA 2CYYA 3BH7B 3TO8A 1SKUB 4QZVB 1HNXH 2R42A 4ZLPA 2DJWA 3LA0A 3IS9B 1FF2A 1S77D 3TEGA 2DIUA 3GIKA 2JEGA 1HBMA 2AMCB 2AJ2A 5DDQC 2OPQA 1XMBA 1HQUA 3Q24A 4PDBA 1HWJA 2GVDA 4JI7H 2FY8A 3ZO7A 5ETNA 3CMES 1L3SA 2HH2A 4GVLA 2NQPA 4MJKA 4FVMA 1ZZJA 2DR5A 3HFZB 1SH2A 1EKSA 3BBFA 2CWHA 2V63A 2RU9A 2Y1RI 2L9NA 2YNHB 1UETA 1DAXA 4C6AA 3TZZA 4B3RJ 2N3OA 4OYPA 4LT6A 1QUVA 3RZAA 4X66H 2MSSA 1PYOB 2DEJA 2HVHA 1T9UA 1H7WA 3PYGA 3ILIA 2VASA 3MAQA 2V6AA 3GU0A 4O44A 3CCLS 4YDDB 4B3MJ 3NAHA 4OLPA 1DQAA 1TKXA 1KQKA 4YR0A 1JXVA 4C8OA 3H42A 3QBCA 4JBCA 1GAOA 5FIIA 5CD4A 1DTTB 4NZ7A 3RR7A 2VBZA 2GV1A 1GH8A 3OV7A 3GG1A 3T5LA 4IDKB 2J7WA 3KLEA 3KTQA 3SV4A 1YBTA 4YHHF 5LT5A 5HAOA 3VVTA 3U7JA 2XNRA 2DK2A 2LCWA 3DOKB 2YKAA 3B4DA 2DGUA 5C25A 5CZXA 1NNDA 3M8WA 4U8YA 2I2YA 2O4CA 1B3TA 3KLVA 2OSQA 4K4VA 3QO9A 8ATCB 1ZH5A 3JQJA 1Z1ZA 2C2DA 1CC8A 2YWFA 1ZTWA 3DLGA 4MK9A 1WOOA 5K20B 1DBDA 1NDCA 1O0PA 2OH2A 4OZ1A 3B54A 1X4GA 1XIQA 2CZ9A 5DDOC 2P8IA 3FEXB 3VGVA 2VQEH 2B6AA 1Y10A 2IBOA 1CJVA 4KQZA 4ZVHA 3K0JA 2CZVC 5IM0A 4P73A 2OFHX 1S1VB 1QSYA 2K06A 3CCZA 4L6V3 4X65F 3NAIA 2HWHA 5KT6A 2RUSA 2ZQEA 4OYXA 5ETRA 5HROA 2YNFB 1B64A 3PEJA 3F56A 4FPRA 4CYUA 1XC9A 3KUGA 3BR8A 2UUWA 3MURP 3KJVA 2KZZA 1RHJB 1Z2IA 2CVEA 2PT0A 4DBQA 4ED1A 3QJLA 1HYSB 5I42B 2BW2A 1HR0J 1TKTA 2MKSA 3VAGA 5ETSA 4IG0B 3CD0A 2DRBA 3QFHA 3NEKA 3MMCB 1RAEB 2W2OP 3CDUA 5C2GA 2H3EB 3OBIA 2BOAA 3SZ2A 3VR1A 4ZP9A 4I6YA 2VG7B 2E5LH 1NZ8A 5E3CA 5K14B 1OMSA 1WD6A 3MMBA 3ZTOA 1Y4ZB 1VYAA 3BO2A 2EFNA 1X31C 2WVFA 2VDIA 3W5ZA 5J2QB 2XNQA 5HL7Q 1H0HB 4B3OA 2LTLA 1QE1A 4HYKA 4FS1A 3PVXA 2X51A 4DQIA 1WTJA 5SUHA 3LO3A 3GYGA 4MYUA 5I3QA 2LLZA 4PXEA 1CEZA 3JTNA 1R43A 4NCAA 4L76A 2ZH6A 3RBZA 5IXUA 4JI1F 2J9DE 4ZA1A 4KTQA 3T1HH 4MFBB 2WHOA 2NREA 3AA8A 4ED8A 2FZKB 2F4VH 2DH8A 4JI5F 3I0RA 4V1Ak 1G6BA 1NK4A 1HNZF 4RZRA 5A2QW 4DR6F 3CWJA 1F3VA 4KJIA 5DG9A 2ZUGA 1AA1B 4AL5A 1KFSA 2YNGB 3OUYA 2AYBA 4NRTA 2BE2A 3R8YA 1U2RA 2QSFA 1X4DA 4AQYF 3OHAA 4DR1J 1IKXB 4ZJOA 1RTJB 4LR7A 4GVBA 4JI0H 3BQ2A 2XB2D 1UMJA 3S6EA 1IR0A 2HZAA 4FJUA 5BYSA 1NBEB 4R0EA 2W8LA 1XMOF 2RS2A 3AD9C 2P2RA 4YY3F 3DRRA 5HATA 5LJ3Y 4LF4H 5B0BA 2OP5A 4F4WA 2M8DB 4LRAA 2V67A 1B0PA 4C0HA 4UQGA 3NCRA 4MKAA 3V69A 1HBOB 3JAMW 2B9YA 3UDLA 4DFKA 2A1BA 4QPTA 2JJ4D 2J6TA 3D1QA 4CWBA 4J90A 2UXCF 1FRJA 2FD2A 3EICA 5FDLB 1VQKS 1UVIA 1BWVA 1BD6A 3MMJA 2JNJA 4QR2A 4DV5H 3C16B 3W60A 1VS3A 3HHLA 3LGMA 2JZXA 3C14B 4K4TA 2C2KB 4ERDA 1FA0A 2VFVA 3HVAA 1S99A 1CJKA 1OY9A 2FZGB 1UZDA 1HFEL 1UZHA 1FE0A 2Q43A 3PHTA 3KK1A 3PJ9A 2FHKA 2L41A 2QLBB 3CJQA 3TZWA 1VISA 4ECVA 3OJSA 2M8WA 3HVRA 2KZMA 4J9UE 1KSPA 3U1LA 3CJ0A 5JMNA 3ENAA 2QEXS 4OZ5A 2HHHF 2O3DA 2KVQE 1ZAVA 3PZPA 3TVYA 2XHWA 1MU2B 4ZVUB 3S01A 1I6UA 3QIPA 1I3OB 4DR3H 1XNRH 2NLWA 1F3FA 5CYQA 2B5JA 4K59A 2BABA 4TLQA 4WXOA 3FRYA 4W4MA 3MM7B 3TA0A 2GC8A 5CYMB 4F04B 1V5IB 3BO4A 1HHTP 3GJTB 3GQCA 3OL9A 1CLFA 1WF1A 4PZVA 4QWAA 2GMHA 3BKUA 2BOPA 1S1UA 1IVZA 1K44A 2OUGA 1RYSA 1T9XA 3K5NA 5A2QY 1WNEA 1S6QB 5K36G 2YKMA 5KFQA 4GKJH 3H7HB 2P5VA 4UTGA 1G1XA 5L8RC 3G4SS 4ELUA 3S8SA 2AYGA 2K2PA 2A6MA 3QLHB 3JSBA 3NCQA 2W9AA 2AP6A 4LMZA 2BA0A 3M2RA 3OFGA 3RRHA 2V69A 3NCVA 1Y5NB 1N6QB 4UY85 3HLUA 2JZ5A 2HZVA 4KY3A 3LP2A 1IJFB 1N32H 1X9ZA 2J0QD 1NSPA 2HBYB 1N8RT 1TUAA 2DXFA 1TFYA 3JS9A 3JQMA 4KSEB 5GAHI 1LWFB 4W90B 1YJWS 3JAMY 1XMQJ 2AJFE 2KJVA 3M7VA 1UVKA 4JI1H 1KTVA 4B3RF 2DHGA 2EC0A 2JSXA 2Y9HA 4JV5H 3RRGA 2A2CA 4ID5A 3W2WB 2XI3A 1J5KA 2YWGA 1FRMA 4LRDA 3EMTA 1NHUA 3D54A 2W24A 1UWBB 4I56A 1RT6B 2J7UA 5F8JA 4OJHA 3KLFB 1HBNB 4B3MF 3M8SA 5F9LA 4EEYA 3SQGA 5IV4A 1LK5A 3KFWX 3A12A 2HFNA 1I5OB 2YKOA 3WX8A 2HHPA 3JSRA 2CDQA 4WFBQ 5KG5A 3HJVA 2VB6A 3QZ7A 2V50A 5F0UA 1Q86T 1SQEA 3GJSB 3QGIA 1XBWA 2VONA 2B51A 4LBPA 1R8CA 1X60A 5F41A 4USVA 5LSRA 2FVCA 4YY3H 5A8WA 4WFNQ 4WWSA 1YRUA 2CIMA 4J9QA 4JI6H 2HVZA 4DCOB 4BA1I 1YITS 2KM8B 1AUSL 3FSIA 2M6QA 3TUZC 1HD0A 2MSTA 2ASJA 1HQ2A 3AXKA 1MMLA 5JVHQ 2DNMA 1JLEA 3RRKA 1SKRA 1N5SA 2GIFA 2R8GA 2I6WA 1NM2A 4Q0BB 2B56A 1WF2A 4LR9A 2IRUA 4RUBA 4OV1A 2CVIA 4LQ9A 2GMJA 4P72A 2L08A 5BYQA 2YQ3A 3ITHA 2O66A 4DCPB 4DU8A 2DNRA 1C1BB 1YSJA 5A0YA 4RW8A 1HR0F 4EBEA 1T11A 3CCTA 2CG4A 2DH7A 3MECB 1LOUA 1A9NB 2HHQA 4DV4H 4PG7A 4HI1A 1RT4A 3LGHA 2HFSA 2CQGA 3L7PA 3EVWA 2HW3A 3M8YA 4IYQA 1PQXA 3BS9A 3I9ZA 4P75A 2RQKA 3G8SA 3J81W 2A0FB 5KT5A 1U49A 4WFZA 2CPDA 2FVRA 3FQLA 5IWAJ 4IFYB 1YJVA 4P9SA 3EPIA 4JV2A 1RBOB 1S48A 4PPZA 5KFVA 3GFYA 2QZ8A 1WOPA 1VQPS 2HMIA 1X9SA 2KFNA 3DRPB 3VF0B 2W2PP 2PO4A 1IM6A 3K7RA 5FJ4A 1HQEA 1BMQB 2E1PA 2CQIA 1HNVA 4FYXB 4FN5A 3MHYA 5HK4A 2FJBB 1Q53A 2XC9A 4R8UB 4RX6A 3PW4A 1YBUA 4PXBA 3BDEA 2Y1JA 2JEIA 4LF5J 5J2PA 2HRUA 5E0OA 3AJDA 2Q66A 2VG6A 2JFKA 3TEHB 4NLPA 4B9LA 4DJBA 1NHVA 3MZIA 2WVCA 4A8FA 4KE5A 5D4NA 4ID8A 1X4EA 1RBLA 3CEDA 1X0FA 2R7QA 3D0GE 1NRKA 1CQMA 5I3PA 3FK4A 2H5JB 3KHHA 4URGA 1FDBA 4ZP7A 1TR0A 2WAQD 5DGBA 3X1LB 4DV1J 4DR1F 5LMNF 2XLIA 3CMAS 3AEVB 1VQLS 3TJ9A 1IBCB 1FKOA 3FKBA 1WHVA 2IJNA 1Q4RA 2RB7A 4LF8J 4EO6A 2HEKA 4DL0C 2B8QA 2HQ3A 2R7UA 1T02A 1M90T 5M2RA 3M6XA 3BV8A 3MPYA 4UOGA 3NLCA 4I69A 1YG0A 1VQYA 3W2VB 2D9PA 1V9NA 1FFSB 2BANA 2MZJA 3KK2A 1H2TZ 5K8MA 1M1KT 2LEBA 2R7VA 2DNPA 4NI2A 1HKAA 3V81B 3HD1A 2VOPA 4DR7J 2ILZA 1T03A 3RBDA 4QWDA 2RKIA 4KGXB 4DMZA 1IKYA 1L5UA 2YKQA 3V6DB 1JB0C 2J7KA 3P3DA 3RYLA 2RRBA 2PEHA 4IRCA 2H51B 4PABA 5D3GB 5C2CA 5L1LA 2DGSA 1LXJA 2OO4A 1OY6A 4OYAA 2XBPA 3NS7B 1Y5LB 4G08A 4MKYA 2BQUA 4HKQA 1AFJA 4XDCA 1VC0A 1K8AT 1PIEA 1YRTA 1FJGJ 1KOOA 3D5MA 4F4XA 5BR8J 2MLYA 5HP1A 1WKJA 1Y7PA 3TNVA 4JYAJ 4EO8A 4X4PA 4LF6H 2FHJD 4F7VA 1ZPVA 3DLLQ 3UPFA 2N7CA 1FRIA 3N6MA 3R5CA 2F1FA 4N7TA 1MROB 3H20A 5HJXA 2OGUA 1HL6A 4HL9A 2BKOA 4MK7A 3BH6B 1RHUB 5KFZA 1H6KX 2X3GA 3KYLA 4OI4A 4M5NA 2CUYA 2BJDA 4RWWA 1FD2A 2EW9A 3KNAA 3SCLE 4PWDA 2NN6G 3T1AA 4L74A 3CULA 3T3FA 5A8RA 3MAAA 4LQ3A 2XSJB 4AL6A 4IO1A 3KLHA 2ZBPA 3A8EA 5E3RA 2Z2LA 4NZRM 3H2UB 1VBXA 2CJ9A 2YNIA 3BGRB 3RTVA 2ZVSA 5F8MA 3J81U 1S1XA 1M5PC 3GV7B 3DLKA 3GR0A 3H5UA 3MM5A 1TAQA 1RWVB 4DHVA 2OELA 4F0MA 1T05B 2DH9A 4DWIA 4P6QA 2APOA 2VC0A 3G2XA 1XMQF 3TA2A 3TZXA 1SKSA 3GIIA 2MQOA 3L3CA 1HHQA 2W9BA 1NO8A 3PW5A 1RWXB 1GK8A 2XYPB 3IRXA 4G65A 1M5KC 3H98A 4HEA9 2KYZA 3ZZOA 4A48A 4DX5A 3NOCA 4WFXA 2J5AA 2JL9A 3R97A 1WI8A 4OHWA 1FJEB 1WJ9A 4LF9J 2OFGX 1MWYA 4XIUA 2WB1D 3ZZRA 4JUZA 2W4DA 2ZBCA 2EC2A 3E01B 5B09A 1DURA 2P6TA 1NSQA 1VCTA 2R4FA 3VCDA 2RIJA 3DDIA 4A4JA 3EVOA 1NJIT 3P49B 2JRSA 4DR1H 1UFLA 4ZITA 4LREA 2AIRB 3TQEA 1KS2A 5KFAA 5HLFA 1DQ9A 2G2YA 4QIWD 3LOUA 2NCKL 3QGPA 2QYCA 1Q8BA 1RTIA 5B0AA 3H4DA 1J4WA 1SXLA 4FYVB 5DZ6A 2GO9A 2DHXA 4TVAB 1TKZA 1XWLA 2WSFC 5L9XA 4TU8A 2H65B 2BKNA 2QYGA 2H4WB 4WK3A 4C8KA 4K4SA 1T3NA 2DNOA 1SVDA 3SDEB 1IKWA 1DLOA 2D3OR 3H40A 4MKBA 4ZVPB 4ZPVR 1S72S 2DPJA 2V4JB 4A8YA 1SL1A 3DRXA 5KFLA 2DNYA 5AE2A 4NCBA 4HHUA 1PC5A 3EZJA 2G0IA 5J2MA 1FFWB 3HSGA 3LTOA 4ZN3A 2V4QA 2KFYA
chains in the Genus database with same CATH topology
4I2QA 1X7VA 2XG8A 1RT1B 3M8PB 1QSSA 4DLEA 4NLSA 2K3KA 4ES1A 2UP1A 2XWYA 4JI4F 3POTB 3EGWB 4C8YA 2RMLA 2QE5A 3L95X 5C24A 2NYIA 3UCUP 2VL1A 2QRRA 2V4RA 1JLCA 1REVB 4NRUA 1BLUA 4Q2MA 2OD6A 2RT3A 4DL3A 3GR5A 2AU0A 2EK1A 3OXFA 4ICLB 3UCGA 3V6KA 3DGPA 3N0VA 5FD1A 4YOEA 3EUNA 1T3OA 1U6ZA 1T05A 4PKDB 5I3UB 1YTYA 2FTRA 3MEEA 3WZ0A 1K1QA 5BJRA 3G6YA 1HBUB 1H7XA 4AL7A 4CCHA 1KTQA 1F5CA 4ILRA 4X4VA 1FXDA 4NX9A 2D3ZA 3OR1B 3BGFA 4ZPBA 1HPZB 1IQTA 1S49A 2R2RA 3DOMA 2FIUA 2PIIA 1PGZA 4PUOA 3BF4A 3V4IA 1C1CB 1KHVA 1X4BA 2M9KA 1RA7A 2ZNYA 1HBMB 2DO0A 3SI8A 3M1VB 5D4PA 2VOOA 1S03G 1Y9OA 3K59A 4WKYA 1W25A 2OPQB 4AXIA 4DV0H 1TV6A 2XMKA 3LWMA 2M70A 1HQUB 1SH0A 3US5A 2HS4A 4E0DA 4ZVEA 4ZKAA 1KLMB 2BJEA 4FYDA 4RNOA 5KG0A 5DG7A 2LVWA 3ETOA 3PHEA 4LIRA 1U6BA 3MD1A 4DEZA 4NLDA 4ALZA 2PA8D 2ZC3A 3EXCX 1KQSR 1DZ5A 3TUJC 2DRAA 1X4AA 4ETZA 1Q79A 4NMLA 1S7HA 1VRTB 4WFYA 5LXRA 3CCSS 1UVMA 4G3IA 3FMWA 3MEDA 2MQNA 3HK2A 1AROP 1MWZA 5J2NB 1A6LA 4F3OA 1RP5A 3OVBA 2W7AA 4KB7A 2HNYB 1JLQB 4PXCA 3BQ0A 3E01A 3IWNC 1WTBA 2F8EX 4IFVB 1H2UX 3K58A 4C8ZA 1LW2B 2UUCH 4DR5H 3OSSD 3CVKA 3PV8A 4WE1B 4RUAA 4Q8EA 5SZTA 4DL5A 1FERA 2BZ2A 1VHFA 5J1NA 4FP9A 3THVA 4FXWA 3C6UA 2QO3A 2VFTA 3HP6A 3QAEA 3NKYA 2UVUA 1NEEA 5FLXY 4J9RA 2CJAA 2VPXB 3K5PA 4LIWA 3G8QA 3JTOA 3NP5A 1S6OA 2OTJS 4OJGA 4AFFA 1SC6A 1ZBTA 4MH8A 5IWAF 4USIA 2CPIA 4ZDNA 2HYIB 4JI6F 3TAPA 4DV6H 1B0TA 5ADZA 5ITHA 1GTHA 3HJFA 3DU6A 2NPFA 2DTJA 1WEZA 3ISZA 4K4YA 4ZK7M 3T1YH 3OL8A 2R9LA 3MR3A 4O44B 4A47A 3CD6S 3UW1A 1R27B 4C11A 3U27A 4LF7H 4OZ0A 1D9FA 2EFGA 3Q8PB 1TP7A 2Z0GA 2WSCC 2MKIA 2QA4G 4H4KC 2OAUA 4TY9A 1TKXB 4ZPCA 4Y28C 4F26A 4OQJA 1N52B 4M5DA 5EWFA 4B3RH 1SJ1A 2YX7A 4I6AA 3PRBA 2HPUA 4RNHA 4F3MA 1RWUA 1C0TB 2D3UA 3V5RA 1FESA 3D1HA 1S9GA 1KOHA 4WFAQ 1IKVA 3NS6A 4H4OB 4NLVA 2ZHBA 4IR1A 2EG1A 1JLAA 3OVSA 3DHWC 3OW2R 1QAYA 4EGLA 5J1EA 4J9LA 4LVNP 1H2VZ 2HFZA 3UE2A 4ELVA 1JJHA 1OQ6A 1X4HA 3KLEB 2RILA 4LSLB 3SDEA 3BQ1A 4DL7A 1VI7A 4OHVA 5GAHU 4I2PB 2LXFA 3HF5A 4B9UA 3BJYA 5DJBA 3TYTA 2XS5A 1FXRA 4LF5F 4RWXA 4EFAC 3NMRA 1JJ2R 2ROPA 4ECYA 4X4TA 4OMFG 1C2PA 2V4JA 1JLFA 3I0SA 3VZIA 4Q5VA 1TFWA 3OXLA 3H4BA 1S0OA 1VRUB 4OL8A 1R0AB 4Y6IA 1QAXA 4MMOA 2R7XA 1NKEA 2IYGA 1SJFA 2Q79A 4E9JA 1YIJS 4B3MH 4RUHA 4EYHB 2WONA 5C25B 3CJ2A 2IFXA 1VOMA 1YWXA 1VBYA 4LFBH 2Q6BA 5KFOA 4RNNA 1SIZA 2B3TB 2CQDA 1P1LA 3N5BA 4RW6A 1VQ5S 3DLJA 4IRKA 3PXGa 2XS2A 3OTOH 4DLGA 2VFSA 1ZTTA 5B0CA 4R5PA 2ZE2A 3PW2A 2PC6A 4K50A 2I38A 4RU2A 1RT1A 3M8PA 2AQ4A 2D9IA 2Y0SD 1FTRA 1LWEB 5HN0A 4E98A 2FVSA 1M5OC 3QO9B 3GFHA 4DV3F 3PNIA 3POTA 3IWXA 3QAUA 4N8NA 3UCZP 3QWUA 1OWXA 1REVA 1HNIB 1VLYA 4MK8A 4DS5A 5DS7A 3R5DA 3DFEA 2JLGA 4N41A 4FF4A 1SL0A 4ICLA 2CYYA 3TO8A 4DV4F 4NLGA 4QZVB 5KFPA 2FC9A 3DLGB 3KMQA 4DL4A 1R8HA 1HNXH 4DG1B 3QWPA 3BSCA 2ZM6F 5KFWA 4DV7H 4ZLPA 3ENVA 4DV2H 5I3UA 2DJWA 4C4WA 2EFOA 2MQPA 2XGPA 2K3IA 1HBUA 2X1BA 4DV1F 4ED0A 1YJUA 2ASYA 2V0NA 1FJ7A 2L9WA 3IS9B 1FF2A 3OR1A 1S77D 3C2PA 1HPZA 4FF3A 1N34H 2DIUA 4YFUA 1VQ9S 3GIKA 4IOCQ 4QJVA 1C1CA 2JEGA 3CT9A 1HBMA 3MF5A 3GZ7A 4H4MB 1QSLA 3M1VA 1S0MA 1KN6A 2ZJQQ 2B6AB 4FNIA 5DDQC 2OPQA 2JOQA 3DC2A 3OTEA 1XMBA 1HQUA 5I4MA 3Q24A 5B0FA 3SCIE 4PDBA