2FPIB

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 116
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fpiB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fpiB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpiB03
3RV3A 2NU8A 3KALA 3TIGA 4DLKA 1OBDA 4O86A 4ZHQF 4ZOLF 4HNVA 2FP4A 4O7YA 4ME6A 4O7NA 4YAJA 4O4IF 1VBHA 2FPPA 3SE7A 3WO0A 3HBLA 4YB8A 4C5CA 4IIJF 4O83A 3K5HA 2YV1A 1EHIA 1Z2NX 2NU9B 1GSAA 4YAJB 2R6FA 5LYJF 4XYLA 4FFOA 4HQ6A 1CQJA 1C3OA 1OBGA 3U9TA 2GPSA 2R7LA 2DIKA 4XX0A 1VKZA 3N6RA 3VMMA 4IWXA 4QSHA 2CNVA 4MV4A 2ZDGA 3BG5A 5DMXA 2Z04A 3HO8A 2NUAA 5D8DA 2YV2A 2W6ZA 2W70A 4O7LA 2R7KA 2GQSA 3WNZA 5JQGF 3TINA 4O7VA 3NUAA 1AUXA 1A9XA 1GLVA 2QF7A 1C30A 4MV8A 3MJFA 2SCUB 3LWBA 4O4HF 3MWEA 4YB8B 3VPCA 2CQYA 4C5AA 4HNUA 4YBZB 1EZ1A 3G8DA 4IHJF 3U54A 2I87A 1W96A 1CS0A 1JLLB 5HBRB 4O82A 3N8DA 2GPWA 4EGJA 3DF7A 3OUUA 5KKNB 2YRWA 1CQIA 3Q2OA 3OUZA 4I50F 4O7SA 1KJ8A 4Y8VB 1DV2A 2XCLA 3QFFA 2FPGB 1KC7A 4YBZA 3R5HA 3HB9A 5IYZF 4IWYA 3AW8A 4O7WA 1DV1A 4FE2A 1M0WA 2I80A 2R87A 2FPIA 1GGOA 2YZGA 4I55F 2FP4B 2YWVA 4YAKA 1W93A 5BPFA 2PBZA 4ZQIA 3TQTA 4NYEA 3VPDA 5I47A 2NU8B 2VR1A 1DIKA 1WR2A 5CAEB 2ZDHA 1EUDB 2CNUA 5C8YF 3E5NA 3R5FA 5HV6A 5HBRA 3RUPA 1PK8A 2XD4A 2NU7B 5FNVF 2CNQA 1PX2A 1B6SA 2GQRA 1CQJB 1M6VA 2DZDA 3MWDB 1EUCB 4FFNA 2DWCA 4XYLB 1IOWA 2YZMA 2FPIB 4YJ3F 1Z2PX 3MWDA 2IP4A 4FU0A 4MV6A 2YW2A 4DIMA 5J2UF 3AX6A 3KREA 4O4JF 2YZLA 5JQWA 1VBGA 4Y8VA 4FFRA 4MV1A 1SCUA 3RFCA 5C1OA 5JVDF 5BPHA 3ORRA 3G8CA 1GSOA 1SCUB 4XX0B 3K3PA 1KJIA 3V4SA 3U9SA 1KJQA 3ORQA 1UC8A 5JH7F 1KUTA 1BNCA 2VPQA 4O7TA 1GSHA 4TUYF 2W6QA 4M9UA 2FPPB 1M0TA 4MV3A 1A48A 2J9GA 3U55A 2YZNA 2ZDQA 4RZQA 2W71A 3VPBA 2R7NA 2GLTA 5K2MA 1E4EA 4I4TF 1CQIB 1KJ9A 5LP6F 5BMVF 2NUAB 5CAEA 5CB4F 5LOVF 1T36A 5LA6F 2I8CA 4MA5A 4C5BA 5EZYF 4XZ3A 2YL2A 2VQDA 4HNTA 2W6MA 5GONF 3UFXA 4YAKB 3JZFA 3GIDA 2OLSA 2V59A 4O84A 4L1KA 4TV9F 1KBLA 2NU9A 1Z2OX 4MAMA 5J2TF 1I7NA 3GLKA 3VOTA 1KEEA 2QK4A 3KAKA 4MA0A 2FPGA 3JRXA 3VA7A 2NU7A 2X0SA 3PFFA 1EUDA 1AUVA 3R23A 4O2BF 4O7ZA 2FB9A 3JZIA 1KJJA 3ETJA 2V5AA 3R5XA 5C1PA 2PN1A 4HR7A 1EYZA 2Z02A 1CE8A 4WBNF 1UC9A 4EGQA 2R86A 3I12A 4XYMA 2R85A 1IOVA 4O81A 3KAJA 2HJWA 2DLNA 2R84A 3WO1A 5CA0F 3MWEB 2CZGA 4XYMB 3R9RA 2SCUA 4MV9A 2R82A 2P0AA 4YJ2F 2V58A 4FFPA 4MV7A 4XZ3B 2YRXA 4O2AF 1OI7A 5H80A 2HGSA 3ETHA 5CA1F 1JKJB 2C00A 2W6PA 2YS6A 1JLLA 1B6RA 1E4EB 2CSUA 4EG0A 4FFMA 2W6NA 1BXRA 2YS7A 4WD3A 5LXTF 5JVLA 3K5IA 1I7LA 4IZOA 4ZI7F 2WYOA 1JDBB 3Q1KA 2PVPA 3V4ZA 4O7RA 1EUCA 5KX5F 3UFXB 3JRWA 4TV8F 2R7MA 3DMYA 4O4LF 3RV4A 4FGRA 3LP8A 2YYAA 1JKJA 4FFLA 2W6OA 3TW6A 2NU6B 3TIIA 1JDEA 4E4TA 2NU6A 1ULZA
chains in the Genus database with same CATH superfamily
3RV3A 4B8WA 5TV2A 1K3FA 1UDAA 1LLQA 3R7LA 3ZQ4A 1LQTA 3PJGA 1ZJ6A 5E6SA 1LTQA 2GN8A 3F6BX 3PT9A 5SYMA 1DKLA 4V0QA 3GLIE 4EBCA 1VE3A 1VSQA 3HCOA 1NBEA 4A3BG 1WKBA 4UCSA 2QSUA 2X5NA 2YHUA 2UYGA 1E4YA 3EGEA 2W43A 2HLNA 2KE5A 3GARA 4YPFA 4LVUA 3VTZA 4C7JA 2XGOA 3TQIA 4OHFA 6YASA 3TOSA 5LMNB 3O4FA 3MFIA 1QLWA 3TRJA 3K0KA 3WAKA 4YLYA 1TU0A 4K6HA 4N03A 5JARA 1E5LA 4ZT6A 2ZBUA 4YREA 2K4MA 4O83A 4CEIA 2CL6X 2IHBA 3ORYA 3Q7SA 4IRXA 4QXPA 2QN6A 5CDHA 2CVFA 1U8UA 1X7YA 1KHTA 2E4XA 3NT2A 2QRVB 3IP5A 3F9CA 1S8FA 2FUG1 4CEHA 4W5RA 4K3UA 4FP9A 1KEKA 4HQ6A 3K0FB 2NZXA 4H1WA 4AO7A 1K5GA 4IXWA 2V7EA 2AFIA 2DAPA 4ZAXA 1J97A 3N0RA 3HU5A 1P18A 1D2EA 2DIKA 2C97A 4OK6A 1WSBA 3DT9A 2RC6A 4Q44A 5KFIA 1GRVA 2VZEA 2H17A 1Z7WA 5E7MA 4KPEC 2I99A 1YBAA 4BNKA 5TIIA 3KQWA 4RDIA 2A9KA 1ZAUA 4ZO6A 3REQA 5CB4B 4WXPA 5JZMA 3AF1A 4BGDA 3QOYA 1RWPA 1TYCA 1N7IA 2D0PB 3AHIA 3I9LA 4MKRA 1NWCA 4L22A 2OOKA 5JNVA 3DDWA 2NGRA 1J39A 4MJXA 4BZXA 5A4FS 4Y3UA 3AY7A 2R62A 3GL9A 3IB3A 2FN9A 1MV8A 1KJZA 1ND6A 3ZE1B 2XB6A 3F2VA 2I2BA 4KE9A 4Y1GA 4EARA 2HWKA 3ZH9B 4NYJQ 4XLLA 3ELYA 1D3AA 3WDKA 2PJRA 3Q0IA 3UMMA 4MS1B 2O3JA 4TKUA 4MRRA 2J46A 3LL7A 4JUBA 4TTQA 5JS2A 1VXOA 1CKNA 4EYOA 3FKSA 4YR7A 3GFBA 2HDKA 2VYFA 4P98A 4JV2A 1M74A 2JCVA 3JATB 4KMOA 3WAGA 1FRNA 2SCUB 3AEKB 4IHJA 4ROSA 4UNSA 1XDZA 4B3RH 1LLDA 1JMVA 3BXXA 3H9GA 2QRJA 4A3GG 4RMJA 4ABYA 3HVRA 3TSCA 2G4CA 4D9IA 4A8JC 2MYNA 1H65A 3OIDA 4UEWA 4CVNA 1F9EA 3UZOA 1OXVA 2WUWE 5HRAA 1C1DB 2H85A 3WL7A 5KT4A 1IY1A 5I8WA 4BWGA 4MTLA 1TJNA 5CEJA 2Q1UA 3U7IA 3HCDA 5AK4A 3ZU6A 1YA6A 1QHIA 3OCJA 1GDTA 5HKBA 3ONFA 4CDGA 4YCJA 2AOXA 1GUDA 3NIBA 4P58A 4RVDA 3W8DA 2P9QA 2O5CA 5EFZA 4HATA 3QVTA 2BM9A 4AG3A 1G4UR 2IDKA 3EF3A 3GJ4A 1JL3A 2Z2IA 4QBGB 4QQKA 1B6GA 2GPWA 1L5LA 2M6LA 3RB8A 4I0WB 1R0YA 1Y1SA 3NTUA 4IDGA 2CHUA 1UJ2A 2ZLBA 4J9QA 4NK5A 4K2AA 1Y8QA 3BMCB 1QHNA 4F9TA 3THXA 3DE3X 4RD3A 5DCLA 4PPGA 1WQ4A 4GOMD 2CVOA 2WU8A 1VIMA 4JFAA 5C31A 4BO8A 2JJ1A 4G5YA 4JS0A 4KLZA 4DV0B 4OUKX 2Q3JA 1RC0A 3DM9B 1GTVA 1ISSA 1H3FA 1R6TA 2C9BA 2YYSA 3ZVKA 4LF5H 4HRAA 3K8YA 3LZDA 2R8HA 3WWHA 3M9OB 1UOOA 3AOEA 4C0JA 4QARA 4YUZA 2IH5A 1GT6A 4C07A 4FIDA 3G89A 2FP3A 2Z0MA 4A2PA 1YWGO 2RIPA 3HB9A 3SNOA 3FSRA 1RM0A 1DHRA 4K6FA 2NYRA 3RT1A 2X1LA 5IBCA 3BXHA 4XGQA 1M0WA 1FQJA 3PR3A 3PQCA 4JNCA 3DP7A 3OA2A 3QLUA 1PK7A 3EGOA 4P7GA 3ROQA 3UK6A 3V3TA 2PZMA 1NTRA 3IMGA 3RVKA 2V9ZA 4TSRA 4Y0NA 5KDOA 4G5HA 1VGRA 1L0BA 4CKXA 2OGWA 3LT2A 1PUJA 4M54A 3WFJA 2YWVA 3BRQA 5FJJA 3TVTA 2VK8A 1SG0A 5EIAA 1Y9JA 3VZSA 5JRZA 3PLAE 3AI3A 1FS6A 1XTUA 1FP1D 2MYTA 1T1GA 3IKVA 4KBYA 1HMPA 4MUAA 4NFLA 4A8PA 3ZY4A 4NY1A 2CMGA 3L8FA 1LDBA 4ALLA 5A5VA 4WW0A 4J9PA 1RP1A 1JPUA 2QT9A 2VSFA 2XIJA 1A5SB 1OPXA 2QSJA 3LC0A 3MJ4A 4HQRA 1JRLA 4GVLA 2YNMC 2YNMD 3OD5A 4R2JA 4R3WA 3MJHA 4WNAB 1TWCA 3QXXA 5IP5A 5I5WA 4A0HA 4BXOA 3ILVA 5CFLA 1QRUA 2VP5A 1C1HA 1V1MA 2TSYB 4CQMD 2H9IA 5C8YF 1EG2A 1Y8CA 3G2LA 3V8QA 1WZ2A 3BDVA 3KB6A 3OE4A 1CUBA 2XTMA 3VPHA 3H04A 2RH5A 3QIAA 4EEXA 3OIGA 3ORSA 1Z8NA 1K4YA 1T6XA 3B2QA 1R50A 3CNLA 3T7IA 1EK5A 1YL6A 1Z0DA 1V16A 5LSAA 1C9EA 1OXMA 4L6CA 3JAWA 5FAKA 6ADHA 4DL5A 1Y80A 4Q39A 4CCYB 2C9CA 2HA3A 4TWBA 4BQNA 4F4FA 1NPDA 5FUQA 4C6HA 4KWEA 4YX9A 4Y9RA 1Z16A 2YV4A 1XKQA 4YJFB 1SOVA 1ZO8A 2I76A 3HXOA 5IEJA 2HK6A 2ATCA 5DI9A 3VNUA 1Q1QA 5ITWA 2LZ0A 4ER3A 5KS2A 4Z7QB 3QV1A 5EJ4A 3DV2A 3WVNA 4RZRA 4M1ZA 4DLSA 3AERA 3I1JA 1Z17A 2YY6A 1YVEI 3CUVA 3IUJA 3MJCA 5BQ5A 3V8MA 2YW2A 1QYVA 2BFCB 1B8VA 3L7OA 3W6PA 5CGQB 5JD5A 3PA6A 4C7BA 2FK2A 5JFTA 5TJ9A 4DREA 1SUEA 3MWJA 4HB4A 2YZLA 1Y3FE 1D09A 4GKJH 1F2VA 2JHCA 2WB1E 1NLFA 3IV6A 4A2WA 4XRGA 5CB6A 3HV0A 5DWDA 3VNNA 4AB1A 1HL7A 2YVKA 2CJWA 2QN9A 3DNPA 3TNLA 4PSAA 1DRWA 3GJYA 1GGJA 2C1XA 5E1DA 1UJ5A 3HKCA 2X13A 4R2IA 1SPXA 1WF6A 3UH0A 1D8TA 1PJ3A 2VUTA 1R00A 3FMFA 2QTCA 1QE0A 1VBFA 1IY9A 1XHLA 1KMHA 3M2PA 1LF5A 3CV3A 2VP4A 1ZGGA 2BP7A 5DBIA 5A06A 1WHTA 1IMJA 3B6KA 3OSZA 2P77A 5F51A 4TMWA 3AJDA 2NUTB 3LRXA 3O8RA 1FMJA 3CX4A 4CKEB 4BNMA 3TLKA 2WWRA 3SZOA 4QJ4A 3EARA 3ZNPA 1LS6A 4F4ZA 1Z4LA 4INAA 4OGLA 4JLOA 3ZDEA 1JH9A 1VHLA 1P5ZB 2EV9A 2WR8A 5LVAA 3KHTA 1PX0A 2HIMA 1CZUA 1EIZA 4I8XA 4KW7A 3F6PA 4L5BA 5BUCA 1AD2A 2VDVE 1WB5A 1BNCA 2RCNA 5CFMA 1VECA 1NUTA 4I8DA 1S2GA 1YA8A 3T7SA 1GAJA 4ZDWA 1LSJA 1QIDA 2FPPB 5IJZA 3DTVD 2BDEA 4A16A 3Q3HA 3BC1A 2EFDB 2IEDA 3NB0A 1ORRA 4LOHA 4WESA 2PEYA 3AUUA 2G6BA 3I9OA 3U55A 1CERA 3C87A 4IHQA 3L1JA 1NR1A 4MO2A 2F90A 4TM7A 1J8VA 1I5OA 3STWA 1XD9A 4C06A 1K98A 2L19A 4AIIA 1UZLA 2R7ZA 1XHEA 1Z0KA 2Q6TA 3HXKA 3PXEA 1UWVA 4KLNA 3RGGA 4JOQA 4W6ZA 2Q5FA 1UQTA 2MIIA 3TLMA 1PR0A 4FX5A 1QOPB 5JYCA 3UJ9A 1YCGA 5CMLA 2BGMA 4BX9A 4F46A 3ELWA 3DHEA 3AFIA 3ODPA 3EIQA 1FKAH 5A9SA 2XOEA 4F84A 1BH6A 1BMDA 1VP3A 4U2CA 4CTOA 1G20B 2A9OA 5DHTA 5H5JA 2GVNA 1OYYA 2CFOA 2O2IA 4IL5A 1NUAA 3JQGB 4XXHA 3KU4A 1JR3D 1ODJA 1MO6A 1SO8A 2MCTA 2JI7A 3PIDA 5C3EG 1INLA 2BMAA 1ILWA 1QOZA 1VRCA 1XYYA 3O5AA 4GOND 4WV3A 3RYFB 3ML1A 4EJFA 2ZJZA 4JLVA 4DR3B 4Q24A 5JXWA 4ZN6A 4HZIA 2OE2A 5TGZA 2ID4A 4LOAA 5JC1A 3GQVA 4LY9A 4YR3A 2IPNA 3PXCX 4NCJA 1NE7A 1ZI8A 3A6FA 5ENDA 3R7SA 3T4PA 2JHAA 1YS6A 4A0QA 5I5TA 1OI2A 4XTCS 3GI1A 4D8WA 2XH8A 4ND3A 3S1AB 1RM5A 4LTDA 3VZBA 1EHYA 2ZR7A 3GTPA 4B3CA 1UMDA 5GV7A 3P9XA 4KXWA 1EWQA 5J9FA 1NVFA 4R2LA 1A1VA 2C04A 2ZIWB 1OI3A 2D2XA 4QOFA 4O1HA 4OUDB 5A5DA 4LSMA 1ET0A 1JPJA 4I2VA 2GJSA 4N5DA 2B8JA 1XRMA 2ZVPX 3W8NA 2HQ1A 2ATIA 4LDAA 5C51B 1YZHA 1H2XA 1X87A 1KRHA 1VTKA 3FNFA 3IE0A 5BSFA 1VZ3A 4HADA 4H7JA 1TC1A 3FGNA 1QG2A 4HY3A 4TKUB 3U61B 3KTAA 5BR7A 2FPGA 2J5BA 4EYQA 4AQ7A 3OPVA 4P80A 4C7VA 4ECEA 2QSZA 5B3LA 1YVPA 5IYDG 1SCIA 2O4CA 4L5CA 5KTKA 1Q1AA 3WSTA 1LPBB 4JVOA 4LF7H 2IYFA 2DPYA 4EATA 3B1FA 4REOA 5C1IA 3HZRA 4Y2RA 1O57A 4NJMB 2E4AA 2OV2A 4ZARA 2VKTA 4M9CA 1E9FA 1L4MA 2XZDA 2IPOA 5I9TA 3S1LA 4MUGA 4WK0B 1UBRS 4MQ5A 3RWBA 3RFUA 2ZYDA 1YE3A 4YIHA 4DT1A 3WRXC 3R5XA 5C1PA 4KGXA 1ZZGA 4B47A 2WU0A 3HUTA 4RHUA 2O57A 4GGPA 4UHFA 5G1NA 2PUEA 2EIXA 1Z08A 4Y6PA 1UCFA 5EIWA 5T8KA 2C5EA 2JKYA 1XQXA 3SHFA 1DUVG 2LDBA 5GMOA 3EPIA 1BS1A 1T8SA 3BZBA 3GPDG 3W8EA 4AM8A 1ADJA 1V43A 2POQX 3G5LA 2ZVQX 2LCQA 4JLNA 5ALDA 1NY6A 2C5GA 5YASA 1OGIA 4PSKA 1Z4JA 4GG1A 3U7GA 1XZGA 3PD7A 2VDLB 3NTOA 3AP1A 3L0OA 4UHCA 1RZRA 1XV5A 4TLLB 5B37A 5ABPA 4CEIB 3VH4A 2E37A 2IHZA 3DFZA 1QHYA 1S4QA 1RHJA 1L7EA 2JFZA 2ZS9A 2P2LA 3I6QA 4V0LA 3KVVA 4BMZA 4HX5A 2VH5R 3MWEB 4XWYA 5AM1A 3RH0A 1T1EA 5LWHA 4QU9A 1WXEA 4Q93A 1ZHHA 5I7VA 1MEJA 2JFHA 2Q9CA 4RZIA 5IBPA 1TKBA 3DBIA 4TT3D 4YDQA 1F12A 1FFAA 1DX4A 1WXDA 2MSKA 3AKDA 3HKBA 1I94B 1PLJA 2B1GA 4ED6A 2GSWA 4RANA 1G5IA 5GVSA 2ZM6B 3MMNA 1T25A 3WADA 5L9AA 4JB3A 1ARZA 4GX2A 4HEA6 1A7KA 3ZK9A 3NHUA 4QYTA 3ZEIA 2ISSD 5ITZA 5KQPA 2ZQZA 4RIIA 2EJ0A 4U7FA 3U37A 2QAGA 2WTMA 3ICOA 4NLGA 4GL4A 1U9IC 2RDJA 4YHHH 3B5JA 3CPSA 1VJGA 3IP1A 2IOFK 1FNDA 2Y1WA 4A3FG 1QFZA 1XKXA 3KU1A 3M6VA 2AJDA 3H1TA 4DLUA 3X2SA 1QC5A 4EKEA 2HDOA 5E4YA 5DWQA 1ZA1A 3OMXA 1E4EB 3VDQA 2CSXA 1RYSA 3EAFA 3RU3A 3GLFE 3FCEA 2RJOA 2UYOA 1JXOA 1LV8A 2EGHA 2VTKA 4F3RA 3GMIA 2P27A 3SKXA 2NXEA 1N3YA 2YS7A 4IXNA 1T2EA 4CM3A 1TPZA 2EHJA 3NFYA 4BAUA 2O1EA 4BTLA 4RZ2A 2NVUB 2XEDA 5AXAA 4DKXA 3FR8A 2B1RA 3BB4A 1VBMA 2ZBGA 4MVJP 1AMUA 3LMLA 4F3TA 1YRQA 1YDMA 1B8OA 3BCSA 3DKIA 3DVAB 4IHJB 3JTEA 4AKIA 4O7RA 4UPDA 3OM8A 4LPSA 5IS2A 2OZEA 5ICEA 3AVVA 4DNPA 2IZ6A 4X1IB 5KFSA 4PGGA 2PRYA 3GN1A 4G0VA 5JI3E 1K4KA 4EO7A 2AX4A 3TI7A 4CM6A 4O59O 4H1TA 1RADA 2J0UA 3NRCA 4J3FA 4LYEA 4P81A 1SVNA 2R1TB 1FLAA 3W05A 1DXHA 5C3MA 1ONSA 2REBA 4TS9A 3TMYA 2P2SA 4EHHA 1Y6JA 4IJQA 1ODLA 4BYGA 4YRIA 4XJXA 3MS4A 4LVNA 4WASA 5ESDA 3OLWA 2C82A 4Y1FA 3KFLA 2IUFA 3RC2A 4D97A 4DV6H 1A7JA 1L1QA 3D8TA 3CM0A 1QHHB 3FY4A 3LA8A 3F3SA 3KEQA 5C4IA 3R0JA 2JLXA 5AUPB 3MWGA 3OOYA 4HXGA 4WCDA 4PNHA 1E79A 3GELA 3HN2A 3CLSD 3CLSC 3GAAA 4YJ3B 3DMRA 5EINA 1FTYA 5CB4A 2IT1A 1U8TA 1KSHA 2ODBA 3ZCQA 1GPUA 4LA4A 3PSAA 1F7UA 3OEHD 4L0QA 3TSWA 1VIVA 2HYDA 1JG2A 2NACA 3JD3A 1CYDA 3M3HA 4JJZA 4O2AA 3RVBA 4DLKA 3S70A 4YASA 2X3FA 2AI3A 3ZWMA 3ZWNA 1B33N 1JSLA 2QVBA 3PC8C 5H16A 2G72A 2OCPA 1T2DA 1UEJA 4EVQA 1N56A 1W1IA 4PLWA 3SNHA 1CY4A 3RF7A 3U4IA 1RCUA 1Y8AA 2YXEA 3LDUA 4GRAA 2W0MA 3HKZE 4H7FA 5CFRA 2OORA 2J3JA 2JHPA 4DPMA 1OYVA 3E18A 1OOEA 3ZUPA 5GOZA 2YWCA 3U4QA 5F4BA 3LCVB 4XR4A 3K15A 2VPWA 3P1JA 4C5CA 2HM7A 4UCXA 4CKBA 1NPYA 1OX4A 1Z74A 1TK9A 1D2AA 2DFKB 2NU9B 1XAGA 2ZQ5A 4Y18A 4BKRA 4K9SA 4B2IA 4GXRA 3C3XA 3QOFA 4P4LA 1Q84A 1GA4A 2J9YB 4WXHA 3T7DA 3VFDA 5IULC 1XD2B 2BTOA 3ZE8A 4EG1A 1KMIY 1U0HC 2PX6A 4KITB 2GPSA 1CY8A 3B6MA 1Y1TA 2X7HA 2ASEA 4O8CA 1VKZA 2Q3EA 3NKVA 2CMHA 2AZ4A 3VMMA 3KTFA 3BBPA 4Y2YA 2H0QA 5FTMA 2EL7A 2OV3A 1UBEA 3QBEA 2YNMA 2JHFA 2JKVA 4GPEA 2IOHA 5DCUA 3C5VA 1E6CA 3A05A 3KOUA 3PGJA 3BE6A 3FHJA 1FB5A 3A8TA 2BEJA 5DMXA 2P69A 4AKHA 2Q46A 5JAPA 2R8KA 2IUTA 2VJLA 3D4NA 4KUHA 4CQLA 1T0HB 3A4TA 4O33A 1TCBA 1TMGE 2EP7A 3K0HA 3RSLA 3U3OA 1WMDA 4LV6A 2VQ3A 1GG5A 1ZJJA 3I0ZA 2XITA 5DPMA 3U4HA 1B0ZA 1TOAA 2OTCA 2P9GA 1HH4A 5FYDA 2IYOA 3WGGA 3A6PC 1V5EA 4C0WA 3HVIA 1U7OA 5E3JA 3BKXA 3PNMA 4F1KA 4Z49A 3O8LA 5D3ZA 4ZRNA 4V0SA 4YALA 2KS6A 2JNWA 3L8ZA 2HHHH 1GILA 4AMVA 3WGMA 1CC1S 1JB9A 4MZXA 1X7ZA 4DLTA 1PS0A 1A82A 3E3MA 1R4NB 4AF8A 1DBVO 2IW1A 2QVCA 3BIWA 3EIWA 3FVQA 3AK4A 1OTXA 3R6GA 2Q9UA 1CXZA 1NHWA 3RYIB 1XO1A 1TT5B 2PYZA 2PLAA 4QG7A 5AKYA 1OX4B 1UINA 2K2WA 3D8RA 3T7RA 4A3CG 3K9GA 4I6EA 1V51A 1N75A 3KEMA 4XM0A 3U1VA 1COWD 2CQYA 4ECSA 1HEYA 3DPUA 4O3SA 1GQRA 4FBLA 4PY2A 4YXWD 2R8ZA 4ZYUA 5C32A 2R8BA 2X4GA 3E15A 4PRZA 2V1XA 4PLCA 3Q7QA 1UAGA 4L27A 5DXFA 3F47A 3TEKA 3VH3A 4PWQA 1QYXA 4RTMA 4G5SA 4PLTA 3U54A 2HXGA 4HEA1 1K6MA 3PCRB 3V1UA 1LBHA 3QXGA 4RSHA 1TJPB 2NXCA 2ERYA 4ETSA 2H4YA 2Y93A 3CB4A 1SCDA 1KI2A 1MEOA 2O03A 1OAAA 2QUBA 2EKZA 3W5AA 4GC9A 3G2PA 4MUKA 1Y4SA 1NQUA 2BSAA 2XVYA 2WHYA 3U7JA 4DJ5X 4P5EA 2O14A 2W93A 4MW5A 1N33H 2B78A 3WMEA 2I3BA 4P1ZA 2NSDA 4L5AA 4M0EA 2VJQA 3NEAA 4QIWA 1QFJA 3V8NA 4MJ3A 4U7CA 3CFYA 3M6MD 4IF6A 4PWYA 4F4DA 2G0AA 2PX0A 1QPZA 5CA1B 1E8NA 4LVOA 4KAAA 1XJCA 5K3DA 2I0FA 2EJVA 4O7SA 1KDOA 1NXSA 3CZ4A 2JLAA 5B2FA 1XNRB 2EJ2A 3NU1A 1M1YB 4EITA 1HQKA 2B5WA 3EZNA 2R93A 1IL0A 3LIPA 4BO5A 2PUAA 4IDNA 2HA5A 3PEFA 4D4MA 5KWSA 2C3PA 1KVUA 1MTZA 2MINB 4K6NA 4HAYA 3KXPA 2R1UA 4XE5A 3SI7A 3KD2A 2AGVA 3H5NA 5I48A 4KE8A 4L4ZA 3UIEA 5KU1A 1MH1A 5AVQA 2TMKA 2GASA 3AEQB 2VA9A 3K9WA 5CR9A 4KIJA 4GPBA 4V2UA 4B0PA 3CUWA 4S3MA 4B3TB 1UBSB 2XYRA 4S1OA 3IMCA 1YZYA 1NYRA 3AEUA 2WAXA 1H85A 3AR7A 3CJTA 1XTRA 3OPMA 3EYAA 1J33A 4KZPA 3ZXYA 1PR4A 4FB4A 1EXDA 1F60A 1XQ1A 3UBTA 4WLEA 5IJ0A 5IF9A 1FU8A 3IMKA 4RM2A 1EKVA 2XR1A 2FPOA 3G88A 1VJCA 2J45A 3J80W 3VOBA 4EQ6A 5KX5A 3KYBA 2FWIA 5BPFA 1P1IA 1QO0A 4IGAA 5DWVA 3K70D 2JEZA 3A4VA 4QPNA 3K70C 4LF5B 4ZQIA 1E7WA 4HGNA 2JFNA 2PT7A 2YKGA 3NDBB 3WLSA 2V54A 1YGPA 2IYSA 5DOZA 1RRGA 3RRJA 1LLUA 1HDIA 3DT8A 3NAZA 4RSRA 5KFVA 3MMZA 4WX2B 3BJMA 2UUPA 4DV4H 2CCJA 3E7FA 5BQOA 3TZLA 3VO8A 5JZVA 1W35A 1OV6A 3JD1A 4NCAA 1KWKA 2GM4A 3FNGA 3EHEA 3D8BA 4FMPA 1WUHS 4IFEA 1YFZA 4QLAA 2FE4A 2R8EA 2WBLC 3LQ4A 4DWJA 3NOVA 5ARBA 3E5NA 2JAOA 2ZJTA 2M1XA 1F8FA 2FHPA 3FMGA 3GMTA 1IBKH 4IIVA 4JGBA 4LHSA 3Q3EA 4BMVA 3ETDA 4GZLA 5ITSA 5JAUA 2VCHA 3FYHA 1OFUX 4DZZA 4JLJA 3F8NA 3HKZA 5CH5A 1OGYA 3TECE 1M2VA 3FOEC 3DLCA 3QTLA 4IIBA 3NC4A 1UKBA 3O7MA 2Z2YA 3ZWVA 3AJRA 4QC2A 2XF8A 4II2A 1A3CA 4BNZA 4DXDA 1FMFA 2CDRA 2RKOA 1UM9B 1V71A 1M1UA 4Z0HO 1AZWA 3P2MA 2YWDA 4B5KA 2RGXA 3EIFA 2H1WA 4GYKA 2ZJAA 9GPBA 2ZITA 4G37A 5HMLA 1PD1A 5C5JA 1ONBA 4IICA 1HDXA 1IOWA 4PXAA 4K8RB 4IVPA 3UMCA 4MWZA 2BN4A 2IUUA 2NVUA 1HFKA 2W00A 3DBLB 5EZ6B 2AG5A 4O8ZA 1KDRA 4MO9A 3JWGA 5ICCA 3R0QA 5KZMB 4RA9A 1FC0A 1Y5IA 2MSLA 5G02A 1AS0A 3H3JA 2BOVA 1CP3A 1M6YA 2JEIA 1SC6A 3D8HA 4GI3A 4O4JF 1SNYA 3KSRA 4QBTA 4CT0A 4Z3OA 3G9UA 3GMDA 5T3YA 4U3JA 5K03A 1YB5A 2QOEA 3V2GA 2GGSA 2M2IA 2NQTA 1C50A 1U9JA 4S24A 5IBRA 4E1AA 1T4MA 3OHAA 3LUFA 3GCGA 3I5AA 3GVHA 4P5PA 5A9TA 1SKMA 4C6RA 4PZZA 5KOYA 3FI0A 1IPHA 4JQOA 1EGMB 4YRGA 5KYUA 3DEHA 2PUWA 4F50A 4ECZA 3HKDA 5TC4A 1VCIA 4RVNA 2HCTA 2WAQE 5E95A 5BPHA 5I7RA 3VO1A 4PAWA 1BW9B 2GK3A 5FPRA 1Q6YA 3A6ZA 3SBDA 3G8CA 1T8RA 4OQFA 2BI8A 3HO1A 2GRJA 1MW8X 5J1TB 1JZSA 3HG7A 3FFXA 4W9NC 5CM2Z 4TQSA 4B6JA 3NS7A 1KK2A 1SEIA 3G1TA 4WK4B 1E9CA 2CXQA 5K3SA 1OE0A 1VPEA 2EF0A 3UATA 3X1YA 2CE7A 4ZK2A 1M2NA 3MTDA 3T7KA 5KC8A 5LQJA 3GK3A 2P1DA 4COOA 1Q0UA 3ORQA 1KFBB 2FMKA 3FPJA 4AY5A 4U5QA 4MH0R 3KL2A 3QFSA 3ABOB 1ZKMA 5D5QA 2JLQA 3NHZA 5GJVC 1MRSA 2F9FA 2CJPA 3HB0A 4IIGA 2OHXA 3A2MA 3DFIA 1Y1VA 1O96B 3DQQA 2HR1A 3GFTA 9ABPA 3PLNA 1EKPA 1AXRA 5DP2A 3I9V6 4E7OA 2GXSA 2RHRA 5C52B 2J32A 3G6XA 3QMMA 1SOWA 2VPYA 4ZJYA 1FNNA 3AM4A 1X1RA 5KYYB 4ESOA 3NWOA 1R4MA 5FT9A 1WDMA 4HDQB 1LFAA 4IIYA 8ADHA 3LI2A 2HRCA 4LC0A 4I4TF 3KJXA 1KJ9A 5EEGA 1WR8A 3H2HA 1KZ4A 1NVTA 3GDWA 5DLDA 4BTVA 1RFLA 1TRHA 1JDTA 3K9NA 2FEKA 3R3UA 4G01B 4ZJZA 3GJ6A 2WM3A 3LDFA 4B85A 1PYOA 4K28A 1U99A 2NT3A 1T8UA 4KGDA 5CLGA 4LDZA 2G06A 5FNVA 2JLRA 1V41E 2UYYA 1KU6A 4HZUA 4IKEA 4OQXA 4PF1A 1XDSA 5BW8A 2VXOA 4BUZA 1G20A 1OXXK 1LKZA 4PGHA 4H18A 2C4UA 4Z4GA 1IHOA 1KS9A 4TTVA 2VQDA 1GUYA 2BEWA 1TMYA 2OFWA 3H17A 4CIBA 4UNRA 4ZAZA 3CVUA 3PR2B 3WRVA 4GMXA 2CWDA 2B98A 5IVIA 1ECJA 1ZH0A 1JXQA 2FEAA 3SQWA 3UAZA 4KH0A 5JDIA 1M1ZA 4IMIB 2IIPA 5DTRA 1G66A 3IA7A 5A6SA 4ZQBA 5JG7A 5LFAA 5IVHA 2KJQA 4D3ZA 2OHIA 4WUVA 3C97A 4LIPD 4RZXA 1OLXA 1GEEA 1M83A 1RNLA 2CXRA 3PXUA 4OAOA 4M83A 4DQUA 2A84A 4RSGA 3EEFA 4BB5A 3VOTA 1QVRA 3C70A 2A1UA 2B2NA 3HU2A 5K0BA 4OSPA 1U2GC 4JEHA 4MUHA 1XU7A 4AG5A 2OO5C 3UTDA 3VX3A 4EZBA 3DMGA 1ODCA 3UMVA 4RB2C 3E2MA 2J85A 1NXQA 2EZ4A 2B4AA 3FLBA 4TN5A 1TDJA 3DMDA 1ZGCA 3D8NA 3KWLA 1SUBA 4HGRA 4MIOA 3RM3A 3LKBA 4GBJA 3W2IA 4JLSA 1QIGA 2V45A 3INYA 4RK7A 4M8SA 3SE0A 3PFFA 1LJLA 4ETMA 4CKEA 1YTLA 2O8DA 4YAOA 4W1SA 1XPRA 1W6RA 4AY2A 1CQXA 2I29A 3RTGA 4LZJA 3IEXA 4CMDA 3G6YA 4F5EA 1WXXA 4V0OA 3RS8A 3E70C 2JLWA 3JZIA 4DJJA 1OWOA 3D6HA 2NYVA 1GLNA 4C3ZA 3LC2O 1KJJA 3OCUA 4D3SA 5IANA 3O1HB 1RXEA 2Q49A 1F8UA 2V5AA 2IGBA 4OU5A 4P53A 5GINE 1IATA 3PGXA 4HDSB 5E6RA 3DFKA 1C1XB 2OZLB 4TTAA 3UGQA 3IPCA 1ZMBA 5COQA 3V4FA 1G21A 1CVIA 4WHMA 2B7CA 4NZNA 4KLAA 4EGQA 5G41A 5TPZD 2ZSDA 4DRZA 3W79A 2IZ7A 2ZTLA 3KQNA 2ERXA 4TWIA 2IXTA 1IOVA 1WEKA 1P0MA 3CUKA 3KHHA 1Q74A 3GMSA 3N2LA 5IVDA 1Q6ZA 1L4GA 2ZJ4A 2FDXA 4PBCA 1SXHA 3KSBC 4I1OA 1M2WA 3AESA 1UBHS 3H7IA 1IBLB 2A14A 3Q4GA 5JCJD 4B3FX 1KXZA 1R1DA 5HOEA 3WSWA 1FX1A 2HF9A 1QLHA 2O7SA 1W59A 1PYGA 1ZI9A 3MT7A 4QWCA 4ZVSA 1XMPA 3KKEA 1R4AA 4Q1CA 5HF5A 3WGYA 5F1OA 4X66B 3G1UA 1UK7A 4F4IA 1JLHA 2ACVA 3R7NA 4CF5A 5FWYA 3ZE2B 1GQQA 2B0CA 4DA9A 5EWFA 2COEA 2R751 4TL7A 5L3SA 3T61A 4G1MB 4AMZA 3SIXA 1IUNA 3CVWA 4CU5A 1O77A 3FPKA 4BV3A 1R5NA 4XZ3B 2FQXA 2BPOA 3UAVA 3T9FA 3EWSA 5HM6A 1ZAYA 2YRXA 4ZAWA 1QIKA 3HMKA 3K8OE 3MG9A 4IGEA 5EWEA 2B34A 2QRZA 3WHPA 1W85A 2P6NA 2VFAA 4CI0B 1KAOA 1JB1A 1QFMA 1G2IA 3LWNA 2V03A 4H08A 2H5IA 1L4LA 2QHXA 1A50B 3NHAA 4TS3A 4YRSA 3HCFA 4Z4IA 3DLHA 4B4WA 4D99A 3KE9A 3OTGA 3KXLA 2D00A 1OFGA 3LM8A 1XTPA 3JWPA 3O2JA 1AGPA 3SEZA 4DE5A 5JSHA 5CX1A 1DNPA 3LLMA 1KI6A 5DBOA 2CSUA 5LL6P 1F8GA 5HG0A 5DNAA 4QTUB 4LQLA 4KDFA 2YHIA 4RHTA 5PNTA 5HUJA 5LXTF 2ZRLA 3BL6A 2FQQA 3AERB 4JBGA 4RKFA 4EA7A 5AD1A 3PZPA 3A1VA 1YB1A 2QTAA 4HLNA 2AG0A 1LV7A 1VJDA 4OPMA 2BLNA 4ZI7F 1J0EA 2BW0A 2GEKA 2PGOA 2Y0DA 1G2PA 3A1EA 3CX7A 3V4ZA 4J43A 4BLRA 3TUJC 1SPBS 4YJFA 3VPSA 1EX1A 1MO5A 3W5OA 3AWDA 1J49A 4M7PA 1GGHA 4EFMA 3ROZA 1BTOA 1UK6A 5G0SA 1N5JA 1NVUQ 3FBWA 5DYYA 4GMFA 3FOZA 3EFBA 1OC4A 2JGNA 5G3YA 1Z63A 4QLBA 3K73O 2B8EA 2UXCB 2AXQA 4XCQA 4JCCA 3F5DA 4OA5A 3LP8A 1O75A 1IOZA 2PSEA 3OKPA 3ZIDA 3N0TA 4P0QB 1DUSA 1G7CA 4MCJA 1T5OA 4TWRA 3AYZB 4OHZA 5EE9A 2B7LA 1L6IA 1GU1A 3GROA 5B6PA 4TM8A 2WB2A 3PC7A 1VJRA 3RIMA 4Z4FA 2QUAA 4BXOB 4PRKA 2FH5B 1IJFA 4OHRA 5IAJA 3NG1A 3UGTA 3W8FA 3ZGOA 4GOOD 4P33A 5FWDA 2Z4RA 3S5UA 2QM8A 1K4MA 4LXTA 3GZ4A 4YAFA 4I8IA 3COVA 1H05A 4M98A 3I62A 4CPDA 2B4QA 2GD2A 2Y68A 1U31A 1EM8A 4NAUA 4CTMA 1XL1A 1ND5A 1PDWA 2PKXA 3BGIA 2NVYA 4JI8H 1EHCA 1OHHA 3KJQA 3L04A 3AUJB 2VZLA 4MVCA 3CKYA 1S2NA 1KTVA 5BR8H 4M3NA 5BSHA 1J7JA 3BQNB 3BXEA 3GIQA 1PT6A 2GTHA 3TG8A 3B9BA 2FSHA 3P9SA 3BJIC 4FCWA 4N8EA 4QDOA 3BF7A 5P21A 2IW3A 4G4JA 4CC6A 2XYHA 4O7NA 1ZNXA 2COUA 1NMZA 1VBHA 4IO0A 4ZT3A 1EKFA 2GPJA 3H4BA 3M83A 5JD6A 5JW6A 1Y6RA 2A1UB 5KB3A 5IZCC 2VHXA 5JUWA 3VYTB 3H97A 4NXNB 2AZDA 3HJNA 2A5YB 5DMHA 3KZCA 3SFTA 2XXAA 3H05A 3WLIA 5KPDA 2K5UA 2AQ8A 1W5SA 3EG9B 4GI1A 1WCMA 4PNPA 1VKHA 2XCQA 3LGAA 4LYGA 2RGAA 2VRNA 4JHXA 4MP6A 3BMOA 4BQPA 3V48A 2GBPA 1U4NA 1VKJA 4WY2A 1NW6A 2QPAA 1J22A 2WWFA 4GZ5A 4J4TA 1SHZA 4KU4A 4PYIA 3O4JA 4LC9A 5I5XA 2WSMA 1LVGA 3F4BA 3K4HA 2EZTA 5KG4A 1CJTC 1TX4B 1QK4A 2R7LA 2CJXA 1ZIPA 2EJBA 2R60A 3QPAA 4XX0A 5HIMA 1T29A 1QO9A 4CTNA 1ZUNA 2HCJB 2NSHA 4P3NA 4TZTA 1S9FA 3U26A 3O73A 1C8BA 3DE6X 5JU6A 4C89A 3HA7A 2B9VA 2QPTA 1M34E 1P4HA 4FR2A 4HMOA 1ZOLA 2ZTHA 4NCKA 5E8RA 4YJ2A 2YHSA 4DAAA 1R8XA 2YV2A 3U0VA 1Z0FA 2WDPA 1JFLA 3MIIA 1JG4A 2BFEB 3LIIA 4LRYA 4NNOA 3W5VA 5ITVA 1E9DA 3ZXSA 3BB3A 4H9GA 3UJAA 2ZR0A 5AJYA 4IS3A 3JSAA 4E4RA 1UH5A 4YAGA 4XIFA 2I2FA 3UENA 2J08A 3PFWO 1OWMA 2Z9BA 3W7VA 2FMFA 4QM6A 1I4WA 4HWKA 4QYXA 4QJ3A 4F6CA 2WWGA 3LKVA 1E6LA 4BRWA 5F3WB 5JNWA 4FYVA 3GCZA 3ZGLA 2EQAA 2ZYWX 3EOZA 4KMMA 3EPJA 3T7TA 3GVIA 4DS3A 4CEHB 1ULUA 3EJWA 3WJ2A 2QRVA 5CEEA 2IK8A 2JJMA 4D4GA 2BEVB 3OLCX 4E14A 1LPPA 2AHOA 1YVDA 2F3RA 4PC1A 4BVEA 1DDOA 1P7VA 1R9TA 1KZ7B 2EL9A 5GY7A 2A35A 4EUEA 3PKIA 4U2KA 4OQDA 1QU2A 4MGEA 1K66A 1IHPA 2VJPA 4DMCA 3R1IA 5B4UA 3ICVA 1BN7A 1PZHA 4DL9A 1DZ3A 1EFHA 1WE2A 1J00A 4M1WA 3BQ1A 3D7SA 4J2TA 1HNXH 3D0RA 2X76A 3TTXA 4IHJF 4IZHA 1G21E 3FD8A 1ICEA 4AWXA 3U3DA 1XQYA 1XZPA 4JI7H 1AS2A 1HX7A 1E2DA 1FBTA 1HFJA 4B8ZA 2QQGA 4MPRA 3B52X 4ZCPA 3QQ5A 3SF8A 2FLNA 4HBGA 4BOYA 4DA0A 4DJEC 4XUEA 4OK3A 2AYZA 3L6CA 4OXYA 1JX4A 3RG8A 4HNAB 1GPWB 1JE1A 2FY8A 3P27A 3BPSA 4JGIA 1N7GA 5KKNB 2HCBA 2FSGA 2XDYA 5L3RA 5KYUB 4WSOA 4PLHA 3T7EA 1UAAA 3H2KA 2WJGA 4TS1A 2QY6A 4YFYA 4Q8FA 3SXUB 3G2HA 5KYWA 1ZL0A 4FB5A 1N6KA 2IYRA 2D8MA 3B8EA 3LW7A 2MHCA 2E5LH 4U9UA 3I8OA 3GAMA 3JWEA 3P45A 3H5OA 4H6PA 4D8TA 1LK5A 2X5KO 2FWRA 2EJCA 5IUJC 2OP1A 3DW3X 3GLIB 4PQYA 4B33A 1HZZA 1RLTA 2EFHB 3ND6A 1P75A 1CS4C 3JW8A 3VJLA 4LJ6A 5E25A 4JYPA 2UXDB 1CLUA 4RDHA 1DC8A 3IDFA 4JVSB 1DJPA 1JQKA 2FPIA 2XNCA 4E5YA 2IH2A 3IC5A 5AI6A 1E98A 2BJHA 4V03A 5DISB 3FKIA 4UU8A 4MDFA 1JE0A 4CMEC 3WYCA 1LB1B 2ZU6A 3PNVA 4E51A 2OC4A 4G1FA 4DLNA 4RTRA 1WUKS 4QT4A 4DIFA 1LZKA 3UA3A 5MN5A 3TBFA 3DEJA 1UKEA 2D7CA 1EG7A 2OMEA 3E61A 3TLXA 3JS5A 4N7JA 4KR2A 1DBWA 3WIUA 2JGMA 3K8QA 4LMRA 1ZN2A 4EHLA 1VKNA 1M7JA 1ACJA 1A4IA 1I4EB 2XYQA 2X42A 2ZB4A 4XJVA 4D26A 1CUWA 3HWSA 3I09A 2ASLA 2RHBA 5ALZA 3AVYA 3ITEA 2R6AA 5IF3A 1EFTA 1AKYA 1XRRA 3UJCA 1U04A 3ETCA 2QTTA 4WNYA 3UMYA 4IEFB 3KUCA 1E60A 4MCAA 5KFHA 3H5AA 2PWYA 3OG9A 4TLEA 4YRQA 3T5LA 1QM5A 4MSUA 3AU8A 5DH9A 1A1SA 3SC3A 5FPYA 2O0KA 4EA6A 4PSVA 4U9HS 2OHGA 3RU9A 4A10A 3QSYA 1PK8A 2D2IA 2DUMA 2J9FA 2X9LA 4TWJA 5CIQA 1NBMA 3IOBA 4I3FA 2HH9A 5KQSA 4FS1A 2BAGA 3H0KA 3L0BA 3M70A 3SZGA 2C7QA 2VAPA 2C78A 2CFRA 4EPRA 4ZEOA 1JHUA 3OX2A 4J9MA 4LJAA 1CUYA 3E0XA 1T1IA 3PJEA 1YKSA 5KX5B 2P2CA 4FFNA 1EFKA 3HOWG 3OM9A 4AYBA 1C3JA 2O2JA 4INJA 5IJ0B 2Q5QA 1NE2A 4ZZIA 1SKAA 3L2PA 1II8B 2V3VA 1G17A 4DLBA 3EIXA 4LTMA 1ZN7A 4YJ3F 2VF4X 4ECRA 2ZSIA 5EE0A 3NYWA 4PG8A 1NY5A 3ZDQA 3NVKI 4JI3H 4DV3H 4OV6B 1QGZA 2RGBA 4CKWB 3AHJA 3GZJA 2ZEJA 4QUJA 1MABA 2WABA 1GL7A 3OZRA 3LP5A 4PCVA 3MT0A 4Y2XA 3GIPA 3IODA 3IOYA 2ABWA 3U48A 3BMNA 2BI4A 1R2QA 1RWWA 2HNAA 1MIOA 2DFNA 2Q99A 4R2MA 3UOGA 5I3ZA 1UZAA 4Y2JA 3R7WA 1M1YA 5LZ5A 4EYIB 1R0ZA 2UKDA 4Q66C 3KJZA 3OY7A 3SM3A 3I8SA 3SIPA 5A1TA 1LH0A 2YW9A 4QO7A 2M6KA 4E32A 4WLNA 4OLBA 4AL4A 3RUIA 3EE6A 4M76B 3EZ7A 3Q87B 3ZPXA 1GD1O 3GDFA 1D4ZA 3HXQA 2VHQA 4FYPA 1HWYA 2GZRA 4MPDA 4YH1A 5AVYA 3C6MA 1YMUA 3TTYA 1UADA 3PVSA 4XEUA 1Q7GA 2WDZA 1ML3A 2XKKA 3CEPB 1WP9A 2IS4A 5CT6A 5D01A 4CLDA 4Q4LA 5T57A 1G60A 1PGQA 2MU1A 4HAXA 1JAYA 8LDHA 2GZDA 1H2YA 3GAZA 4QGAA 1A2BA 3R7WB 1MHTA 4A8TA 2FZLA 1BEZA 3NYIA 1WCMG 2UVWA 4FXPA 4RV5A 3C45A 3LBFA 2ZIZA 2XYGA 3BMNB 5LL6b 4WKNA 1W5EA 2A0WA 2ACWA 5KJFA 2E3JA 1IQRA 1GZHB 2WIJA 1HL3A 1MABB 2H92A 2QGFA 3SD7A 4X65H 4D9MA 5FWNA 4KV9A 2CV1A 5JH7F 5EPEA 4MB6A 4XJSA 2OO7A 1TYBE 5IDYA 5JSUA 5JXGA 3G13A 4QWWA 2IHYA 5TX7A 3NTXA 3OD1A 4PE5B 1JIQA 3NETA 4GNRA 2OCAA 1V0JA 4XDGA 5ALJA 2XNJA 4C3OB 1XUOA 4Z3KA 1CRWG 1H4TA 2MR5A 1HLGA 1CVRA 1XZHA 2YZNA 1DELA 4MPPA 4CM7A 4A3MG 1KNQA 1OJLA 3CCCA 4IW3B 4ER6A 1BDIA 3MHTA 3IELA 5SY6A 2O5RA 1QE5A 1ZUIA 3PZBA 4JXXA 1DKNA 2VDPB 5H70A 5K8VA 4TRJA 1P1RA 2H4ZA 1D2HA 4L2IA 1CQIB 5IK2D 3RSCA 1JIUA 1TO1E 1E9VA 1SHJA 4GT1A 4O1MA 3N05A 3WMXA 4RJJA 3FX2A 3NDRA 2QAJA 3Q7EA 3CO0S 5SYNA 1F0KA 4F6RB 4AJNA 2WA2A 2BTEA 4TV9B 3HVHA 3BA8A 3ND9A 4EJSB 4F5DA 1AVTA 1XQWA 4BUJA 1X0XA 4QWBA 2MWMA 1V45E 3TOZA 4HSEA 1IBRA 3B2NA 3EK2A 5FLYA 3P5SA 1MIHA 2JKZA 2ZVDA 1DARA 4RFSB 5CBPB 4PSDA 3K1AB 3KVNA 2P75A 4NICA 2HQSA 3DDZX 2WJWA 3IVCA 1X7XA 4HFMA 4MQ6A 4DGSA 3N7TA 1PR3A 5E9QA 1JNXX 4G97A 2PMDA 4TWZA 1I1QB 1AURA 1Y1VG 3BQ2A 3PXXA 5HA5A 4QXQA 1T3GA 3SHWA 3UFXA 3G0DA 5IKEA 2QM3A 1H9CA 4EB8A 4WZBE 3EDQA 4ONEA 5AW0A 4M88A 4GP7A 3LCRA 3F0TA 2V59A 1YS4A 4FDUA 2OCLA 4QFBA 1UP7A 2E6UX 2NU9A 3FRIA 4PYJA 4RAYA 1E62A 2ZUUA 4MR7B 3G9QA 1EWKA 4PZLA 2C9DA 4MAMA 1RAHA 4LGMA 4RH3A 5AOAA 3U0BA 1I7NA 3OOSA 2GJ8A 2EWWA 5HZGA 2HHCA 2GWHA 3I42A 2GEVA 3ND7A 3E5MA 2PSSA 1Z6PA 3ELDA 4IVNA 2RH8A 2HU8A 2XGSA 2YFYA 2B9EA 2YRFA 4N3GA 2ZGIA 3QWBA 3RSQA 2HIAA 1WJGA 1TQHA 1IRIA 1X2BA 3EEBA 4JU8A 2VHZA 4KWTA 1O5OA 4NOMA 4OO3A 2D2VA 4DDUA 4BO6A 3TPCA 3VA7A 3W3AH 4NBSA 1O4VA 5IUNC 2CZQA 1Y5RA 2V96A 1NBMD 2D5AA 2NXJA 3N2KB 5DX1A 3ZIUA 2BJVA 4US0R 4H3KB 3OIFA 5KFAA 2BMFA 4QYIA 4DM7A 3N0WA 4RCNA 4RZUA 1NXOA 4FDVA 4IR7A 3R23A 4KMSA 3S0JA 2QLFA 2V7PA 2D62A 4V1CB 1JR6A 1UMKA 1ZM9A 1AKRA 2C99A 1GTSA 1SIWA 1WDLA 4TQUS 3HI6A 1YQEA 4CMCA 1HURA 2XIGA 4KE7A 1APBA 1YB4A 1TL7C 1NNLA 4GWLA 4M8KA 4RHFA 4XDYA 4LFCH 5A9RA 3G68A 3AI1A 1AHNA 2VDUE 3C4VA 5EYPB 4QECA 4ND2A 1D2MA 1CVLA 2ZJ5A 1XPOA 2B8NA 4QNRA 2HV9A 5IPFA 1UMCA 2KLBA 4OXNA 3MTJA 1QGED 3CKLA 2ALZA 3IQEA 3KJFA 1XG5A 1J90A 3OZXA 5KYTA 3C3PA 1P1JA 4PQRA 1H2RS 4U5XA 4YAUA 1GAXA 2ZFUA 1E1KA 1JEOA 1KXJA 3AGPA 2HPAA 2PRSA 2Q50A 1WVIA 3GGJA 4XYMA 3UWOA 1FL9A 4KHZA 2Z98A 4JD5A 3O91A 5FTKA 4XLTA 3FRJA 2R84A 3E3LA 4LBVA 2AX3A 4RVSA 5DHSA 1SKYE 4CL0A 5T6MA 5FPOA 5K0ZA 2V9WA 2BEVA 3IH5A 3KKLA 1FW8A 2OILA 4J94A 4WBSA 4XRRA 3V8EA 1JQLB 4NI5A 1DX6A 2FWAA 4DDTA 1P2SA 1U2PA 5K3WA 2QMYA 2DHRA 1NW7A 1R3UA 3BA6A 1EXMA 1RCFA 4RH1A 3RB4A 5ULLA 3EFOA 3R3JA 2BBOA 3AUSA 4LE1A 4UBKA 3RJZA 4QEZA 3LUCA 2QX8A 1HYEA 4KSYA 4ECAA 7GPBA 1IBCA 1Z0ZA 1U1DA 2OWEA 3MVEA 1YRLA 1WSAA 5KSOA 4LCBA 2W2MA 2DSNA 2H2WA 1MZBA 3A1CA 4LDJA 3HJCA 4WGGA 1OR8A 1NXXA 3MB8A 5IJWA 4OFXA 1O54A 4BGUA 1DKQA 2BT4A 2HDNB 1PZFA 3D6JA 1YJ8A 3ZV7A 3MPUA 4EMTA 1J8YF 3GJTA 2K87A 4D81A 3KDAA 4IJUA 5AIAA 2OWOA 1PS9A 1ZD3A 3LWZA 4PN3A 1DRJA 4ED8A 2HLDD 1X7GA 2ST1A 3DL0A 4NQZA 5EHGA 3ZWYA 1RXYA 5B3KA 5JAMA 1V37A 1POXA 3KHUA 2C77A 4GL2A 4EF5A 1Y5LA 2OXFA 2XUAA 3KS9A 3NAQA 2WKRA 1JR3E 5IYZB 5JMOA 4IVRA 4Q16A 1YQDA 1UXHA 3NHWA 3GLQA 4HFJA 1I7LA 4BV8A 3A9TA 5K0TA 4IR9A 5DLEA 1P5JA 1KQPA 3PLRA 2FEMA 5HFNA 4JI6B 3KAPA 3W4KA 1MB4A 2WIKA 4FSXA 4NE7A 4Q7EA 2O1WA 2OO5A 4RA6A 4R51A 3K6JA 1AKWA 1R0KA 3ZWAA 4ECVA 2F3UA 2PT6A 4M8IA 4NQRA 3UB2A 4F93B 4C05A 4CU2A 2IQ5A 4HAWA 3SC6A 1AV6A 5K01A 2WE7A 3FCOA 3SS7X 5KNLA 1X3SA 3ZV4A 3TF5A 1JEYA 1EK0A 1T1SA 1U4OA 4A3IG 3LPLA 3K2IA 5TE9A 2MT9A 1NMXA 3MA0A 4XR9A 2BY4A 3WJ1A 1R8JA 4D8YA 1P6UA 2B20A 3UOAB 3MOGA 1AM4D 1NVDA 3Q85A 4H60A 2GN2A 4P3YA 4ZP1A 1PV4A 3FZEA 3L93A 1Y8RA 1DC5A 3ILHA 1JJIA 2NADA 4PC6A 1EJ6A 3CJQA 3SS9X 3WOHA 2OB2A 1USWA 5HP4A 2XWJI 5DF1A 2GD1O 3V42A 1U3DA 4CR8A 2O8CA 2XNSA 4AS2A 3CR7A 1V4BA 1NQVA 2KWIA 3LYHA 5EERA 1OX6A 5AXDA 1YFLA 1Y1KE 1W46A 4GFDA 2I6TA 4JL8A 4RSMA 5LA6A 3S2GA 5KHLB 3GTLA 1G8PA 3ENVA 2NU8A 3V33A 3RJ0A 3IP7A 2R8RA 3TZ6A 3WYFA 5LDHA 2C94A 4POOA 3DCJA 1SJ9A 4IV0A 1YJAA 4LWQA 3E1SA 3HJTA 3MFHA 4ZHQF 3WLJA 3PHBE 4OB8A 2UZ4A 4MDYA 2AFHE 2GA9A 4QJIA 2FP4A 2LVBA 1P60A 5HVNA 3KTAB 2HJSA 5L7TA 4TVKA 2QI9F 3OZ7A 3QY0A 1QE3A 1TECE 1CUJA 4BNNA 1TQ6A 2GDJA 3DVSX 4YRFA 4DG8A 4YMWA 4WGFA 3RU2A 3BKWA 4DV5H 1DEKA 2FDCA 3KKOA 2D5CA 3F3KA 3HY4A 3OIUA 4JI7B 2YVUA 4JP2A 1GSAA 3SSMA 2Q21A 2WJHA 3F5MA 5T4BA 4R9NA 4PHTA 3PDWA 3SI8A 4B09A 2LUOA 2H9YA 5FPTA 4MIEA 4JB0A 4FFOA 2CMFA 1KVSA 2LKCA 1M2GA 4HNSA 4JT4A 1Y6GA 3W5IA 1U0RA 2HMYB 4BNDB 3OX1A 1MH9A 2GEDA 2OFOA 2O6HA 5A4DA 5B55A 3UUGA 1IN5A 3FDIA 4HDAA 4BO9A 4KN8A 4L5JA 2GNPA 5EZQA 4KQFA 5KBYA 2E0IA 1KI6B 2BFMA 4OKSA 4MNTA 4JLUA 1V1RB 2G76A 3KP1A 1Z38A 4C4OA 3U7HB 1IWBB 2PCJA 4EPTA 3EXIA 3D54D 1Z36A 3JQ8A 3ZZNA 3WGIA 5CB8A 4FDLA 1TKAA 4KPUA 4XIYA 4Z0TA 5K0JA 5E9JA 1X80B 1JP7A 4NESA 2F48A 2DHCA 3HYCA 1RWMA 1OFHA 2QL9A 3I9FA 3KHKA 4DLAA 9ATCA 3CZ9A 1GN9A 1JJAA 4N4AA 4KXMA 2I8LA 1EWYA 1MD9A 3AVWA 3RGXA 3W5HA 2IPLA 5JWRA 5AW6A 2Z57A 1DIBA 1SFOA 1FRQA 4IG9A 1WCV1 4J0GA 4K46A 2LTAA 4QQ8A 3MF4A 4Y6RA 2QNRA 2B92A 3EEOA 2JA5G 1HPLA 2I7VA 5FRDA 3B38A 2OG1A 3MUNA 3BD7A 3E9DA 2IPAB 4H0CA 2BKXA 1BYIA 1UBMS 1KYXA 1UM8A 2FOIA 2HIVA 2QF7A 2G9ZA 2PUGA 1VL6A 2J6UA 5KFYA 5J63A 3IOEA 4HYYA 3DOJA 3HZZA 3LWBA 2CXPA 4QXMA 1IY0A 1OWPA 2DM6A 2UAGA 3TW0A 3SKYA 2NVOA 1HDYA 4BB0A 2IITA 4DCSA 7REQB 1H8HA 2VZ9A 4HPXB 2VBFA 3G85A 3PPVA 2JC3A 4PNEA 1A9QA 2FQ1A 2QSYA 3GP5A 4HK4A 2CB9A 5IAAA 1QCZA 3FRHA 4C88A 1D7OA 1UBNA 1AQNA 2HRQA 4PZ9A 5B7QA 4AURA 5I9IA 1OMOA 2XUDA 1N1MA 3CJRA 4L9WA 4QATA 2DQSA 1MC4A 1B8UA 5DKFA 1JEEA 3NM4A 3GLFB 1B8PA 1HI9A 3EDRA 3L5OA 3COJA 2J33A 4YP5A 1E5VA 2VHTA 1A96A 1H2HA 3FE2A 3HSYA 2PNFA 3HZOA 3IT1A 3HM9A 2O0MA 3N8DA 2CNWD 3PNPA 2OV1A 2IX3A 1PR5A 3I2GA 5JPDA 3SHOA 1I0IA 3ZWOA 1ZH4A 4N0MA 3PNQA 4YCBA 4KGVA 4TMFA 1NF8A 4QRDA 5F33A 5CFPA 1L3BA 2WE6A 4OHCA 3UW3A 2YRWA 1EEXB 4D44A 5KQLA 4ER0A 4KIWA 4HYKA 2OSVA 1WD5A 2DR2A 2PYIA 4CMGA 1J5XA 2FF7A 3KEFA 2VQFH 4BNTA 1R0WA 2UYCA 2PX2A 4Y8VB 3GGCA 2F4VH 2AK3A 3NOQA 4C78A 1OB2A 1XRNA 1ZMTA 2Q4TA 1DV2A 1I4DD 5AHOA 3TQRA 3OTHA 3WLLA 1UBCA 1ULHA 4X54A 5D1OA 2Q3LA 2IYEA 2WKPA 2YMPA 1LWNA 1I14A 2ZROA 2XGJA 1FPQA 1DOHA 1IAQA 2TRSB 3EC1A 3AKZA 1UPUA 1EK6A 1XZFA 3HUUA 4OIMA 5IYZF 5JHGB 3HVUA 4CFYA 1F14A 1KH3A 3GXBA 4P7KA 5F78A 4RETA 4WI1A 2C96A 3TEJA 5FR1A 2FXIA 1L5KA 2CKZB 4UVDA 3TCNA 4X8OA 4B5LA 4CM8A 2CYCA 5JEEA 1SKBA 4DV2H 4WKBA 2GDZA 3ZCUA 4COKA 1ODIA 2HWYA 2ZJBA 1LLCA 3ZN2A 4RE6A 3PI7A 3NEYA 1DDIA 2W2OA 1VSVA 3W1VA 4YUAA 5IC6A 3IQFA 3NLLA 2PBZA 4ITVA 3SX2A 2AL7A 1D0SA 2FWPA 3P0HA 3OPYA 1VLJA 4CM9A 2VJKA 2HA7A 4N39A 3X44A 1EVYA 1Z5PA 3CX3A 1HFWA 4F2WA 1OC2A 5TS3A 4CGZA 1H0HA 3T15A 3FA2A 4EEQA 2PS9A 4JEIA 4FR0A 1IZZA 3QQMA 1NUPA 3GJ7A 4BP3A 2FFBA 4MMYB 5FNVB 1B41A 3S2ZA 3K31A 2XNDA 1LC3A 5CAEB 3HTXA 3DBOB 1MJGA 2XQGA 1A5TA 4FKZA 4P0TA 4R0MA 1QYIA 4UD6A 1I2BA 5THQA 1JHDA 1WNTA 4LHVA 2P2GA 3MLEA 3T1HB 2BDTA 2WSSD 2H6EA 5DHUA 1EEHA 2Q28A 5BN5A 3OJLA 2CNQA 3HCAA 1PK9A 4IQ0A 4ZO4A 1KJWA 4HYQA 2CUZA 5KYYA 5DXJA 4BP9A 1Z4KA 4ARZB 3GLHB 3OEED 5IKXA 2E87A 4TTSA 2M9MA 2OESA 1XPUA 2DWCA 2OD9A 1KPHA 1WAMA 4KUGA 4O4LA 2WF9A 2G88A 4UUNA 5TARA 4PO3X 3C39A 4GX5A 2H5LA 1SY7A 3U3KA 1BU8A 2R8YA 1JJFA 2BEUA 2C84A 2VJYA 4LXGA 1YZ3A 2YN0A 1Z34A 1KAQA 2BIFA 3I5MA 1D2GA 3O1JC 1LX6A 3V7NA 1UPCA 4O4HA 1PVDA 1Z5UA 3A04A 4ZOEA 5E0KB 3RT9A 2O07A 3FCUB 2FR1A 5AK0A 5FKJA 2HMVA 3UAYA 1MAHA 2MOKA 3A1NA 1C2TA 4BVFA 4GDMA 3RS5A 2ZJ7A 4GE0A 1WEHA 2QQ0A 2Z8YM 3BD8A 4FI3C 4LWOA 3V8BA 8ABPA 3TL3A 3AG6A 3B13B 3F7OA 4HWTA 3W6UA 3IBYA 4DCOA 5K6RA 2RHCA 2ZSAA 3I45A 5KG6A 4C21A 2MSDB 2FMIA 4EY8A 4KX3A 4L08A 2ZRBA 1XRSB 1DOZA 3LLSA 1AS3A 2F8LA 4KQJA 1S5PA 2FAXA 2HREA 2QJTA 3IV9A 5FTJA 4Q3CA 1KOGA 2C59A 3NALA 4BFSA 3EQ9A 3AYHB 2ID9A 1G2QA 2CJFA 2VZ0A 1OZGA 5CW2A 1TQDA 2O8CB 4LF7B 1Y1LA 3EGVA 3OUTA 1THGA 3MAAC 1GSOA 2V4QA 5CNKA 1ID8A 4KQHA 1P33A 4DHWA 5WRFA 2W8LA 1DFHA 1ECLA 1I2CA 3NUQA 4JJ8A 2K7FA 2I8AA 1U7XA 2VH2A 1B16A 3F3YA 3QHAA 4KRXA 4RCVA 1US8B 3F98A 3L02A 5BR4A 3U6BA 2F43A 2J59A 5EJ7A 5HKKD 4TYWA 4DR6B 1QYWA 2ZATA 3I6MA 2RHWA 2XXJA 2H1HA 4RBNA 3SOZA 1JFFA 3T3PB 5ANRB 5EWMA 1M1NB 2BDUA 5K4GA 4NNPA 2RHOA 3U16A 3DMFA 3MD0A 4R0VA 4EVIA 1QJ4A 2YVLA 2Q3BA 4L57A 3O1IC 1L4NA 3H42B 3WLHA 2R92G 1KZ6A 3UA4A 2CD7A 5KT3A 5J2UA 3CT4A 4I4TB 5TQ2B 1NJ5A 3F90A 4KWIA 1HNZB 2CLOB 1NYLA 5DTMA 4YUYA 2UVUA 1ZNQO 2ODEA 4RZQA 1LGYA 1NDHA 2QR2A 5DXAA 3RIYA 4PGMA 4DYDA 1CKNB 3EEQA 2PU5A 3N8HA 1LVHA 1GN8A 1K2WA 1ZLYA 3KQTA 4H7PA 4FE7A 4I5FA 1SC1A 5IARA 5K2MA 1GM5A 5C8XA 3N1UA 2GEBA 3KFVA 2B30A 2EJ3A 3TPFA 4WHXA 1NW8A 2PKWA 3A3KA 5LM3A 3B85A 4JUFA 2H2HA 3ZHBA 2CF6A 3AVUA 2MTBA 5FXMA 2YMMA 4Q3EA 4PO1A 1K5HA 3GG2A 1EESA 1CW2B 2PO7A 1RMQA 3AIKA 4XA8A 1D2RA 3ZHTA 2V0CA 3KWFA 2FE1A 1D04A 1TWGA 3V8VA 3NHBA 1UANA 1TLTA 3F6EX 4MIKA 4BMSA 1M6EX 4C0LA 3DUFB 1KT8A 2O4UX 2GA8A 3QU7A 5D1NA 3FYUC 2AK2A 4NV0A 2IYWA 2C98A 5HTKA 3RF2A 1T3LA 1N2HA 1MQ9A 4N0QA 4LFBB 1HT1E 5G0UA 1ST2A 3K0EA 1PNQA 5KOJB 2O2EA 4D1YA 1ZX1A 4UZEA 5FUVA 1L5QA 4AAYA 4FWBA 1B26A 3DV9A 3ZW9A 1B2LA 3OF3A 5KT7A 3RYHB 1W88A 2CFMA 1SELA 3BWCA 2J9XB 1Q7CA 2FEWB 3M5DA 2D4AA 2WQ6A 4OLJA 3GLRA 3E5RA 3QE0A 4O4JB 1N48A 1Z2OX 2AYYA 4OL9A 3I61A 2RKBA 4AJLA 1RRCA 5KNDH 3PQEA 3E8XA 2Z58A 5D85A 2GETA 4B31A 2YQ5A 3NZEA 1ZGZA 1ZXBA 3A1UA 4OQNA 4R69A 2CMDA 4JFRA 3SVLA 1NMSA 3AEQA 2OKCA 2QK4A 3E9EA 2GHQA 5DW0A 3CNHA 3GTOA 2X8WA 2MINA 3LUPA 4HRVA 3U7QB 4I7HA 1Q3HA 1RW4A 1RC1A 1LI7A 2GQ0A 2COGA 1EVJA 2EQBA 2HK7A 1FFGA 2MSEB 2YU9A 1DWPA 1Z06A 1KR5A 1BYUA 1ZK0A 2QVZX 2Q1TA 4NFSA 3OQIB 3IKTA 2D2FA 1A5AB 2W58A 3WZMA 1EP3B 1UMCB 4QG3A 1O6FA 5E6SB 3WWEA 1Y9ZA 5I5SA 2EKPA 2FEOA 2QMUA 4QBKA 5IBQA 5B1EA 1GGEA 1J0AA 2WJJA 1PYDA 3PP8A 2JEOA 1N6HA 2VBGA 1T5DX 2JLSA 1FTSA 5JMWA 2FB9A 1G63A 1WCIB 3C6QA 2P5UA 5ETJA 1QKIA 3GF4A 1RLJA 3LAWA 2O8FA 4Q1AA 5C4GB 2AMYA 1FBNA 1GARA 1P6XA 1YXMA 1JZQA 4BJ3A 3U19A 2Z9DA 4N7RA 4O29A 3IEMA 1JLMA 3FNBA 1NATA 4P0PB 2C8LA 4U7HA 3ZX5A 2J6IA 1K6XA 3OT5A 4IMJB 5SY4A 1U1IA 1UFKA 4PCLA 2RMKA 3K09C 2Y0BA 4NONA 1B1AA 4A1OA 1HTBA 3FKQA 4WMLA 1D1PA 1ZJ4A 3AO0B 1KEPA 3NVAA 5JSYA 4UEOA 3EASA 3SEAA 1G8SA 1GKYA 1GFWA 2GO7A 2ZUFA 2I3ZA 4HTAA 4RZSA 1AMNA 3TY8A 3WL4A 1RS0A 2PJZA 4P4SA 4B32A 3PW4A 2JI9A 3EC7A 1ZW1A 1D6JA 3PUKA 5M3BA 1FE8A 3LBNA 4RE5A 3MTEA 5EWJA 4CV1A 4F04A 2Q8PA 2IYXA 1EB9A 4AYXA 3RARA 3T1VA 2L42A 4V02A 2D1QA 3VISA 4GO1A 4Q6BA 1GRCA 2ZBRA 4CW7A 2XT6A 1GTJ1 4ZIRB 3R9RA 2PXAA 5CCDA 4JX8A 4MQFA 4RWZA 4FYHA 4D9HA 2XAAA 1B0PA 4AJEA 4EH1A 5HJ2A 4WACA 1DXOA 2HXYA 4JAVC 1TYEB 2PT5A 1J24A 1XZBA 2C4HA 3LG2A 1TUGA 4KVAA 4Q7KA 4TXMA 4GUAA 4CQJA 3L8DA 4RWEA 2XQVA 1L2ZA 2G67A 3VR5A 4BE7B 4ED0A 3O3MB 1H6BA 4EWLA 3BAFA 2UZ1B 5MFPA 4YBRA 3F6RA 3HDQA 3CUTA 1VBNA 4PYRA 2YMLA 5CK4A 1XKTA 1WW2A 3QUAA 4FS2A 5H81A 5UKDA 1O9BA 2XGPA 4IFTA 4BTEA 4XQ9A 1USIA 4BFVA 3KHRA 3RHFA 1AN7A 3WDSA 4E7PA 1OI7A 3ZCTA 3C1OA 2OZKA 1JXAA 4W99A 4YJKA 3QBDA 4W8OA 4ZAFA 3E3AA 1MX1A 2I2WA 3GLGA 2PUVA 1CRLA 4WE3A 3TW7A 1EDOA 3M3DA 4D3FA 3P2OA 1L7PA 4MKXA 5I5VA 1KAMA 1OTHA 1E1QD 2I22A 3TW4A 3USES 5CA1F 1N2BA 2AFHA 3C3DA 1JLLA 3G2JA 3P9IA 1S8NA 2IIQA 4O2BA 4I1PA 3GEBA 1BMQA 3EZYA 2HJ9A 2WICA 2UXDH 1IE3A 1XBTA 3HADA 3E5HA 3P32A 4DEYA 4IAJA 1QDUA 3TJZA 4X7RA 3G0CA 2VWGA 4NMHA 3KT3A 4KIUA 4Q9IA 4I50A 4ILEA 2IKSA 5JVDB 3VSEA 4EG5A 3LC1O 2R8JA 3OU7A 4JB8A 4RW0A 4Z9YA 3KYDB 3FYUA 1RVDA 4F56A 3VUFA 3K5IA 1HE8B 4A0GA 2JIOA 1SCJA 1K8XB 1E2GA 4D46A 3NGDA 1T9GS 4OK5A 4JELA 1GZUA 3D6UA 3BAAA 1MJFA 4IMPA 3OFNA 4TLBA 3ND8A 2J0QA 4BCBA 5BWCA 1GQSA 4C9BA 4MXDA 2OCGA 1UZUA 3KUUA 3CGWA 3TAUA 2J5XA 4QEDA 3DR3A 5B6IA 2PH1A 4YUWA 5BNIA 1LNSA 3IUPA 1IHXA 5DAAA 4MPTA 1U5BB 2DPMA 3QHQA 1ABBA 1KTAA 3K1TA 5K7SA 1X77A 1I6UA 2O1SA 5HGJA 1N7JA 2C92A 5HKAA 2YJTD 1SVOA 4CIVA 3QXJA 1SGWA 5ALTA 2GD0A 3OCZA 4W8HA 3CZ5A 4QGGA 5IT5A 3JASB 1X1AA 1ZN9A 2P3QA 4NCHA 2C2YA 2OL4A 3U3ZA 3PCTA 2BBWA 4RLQA 1VAJA 3I23A 4B3TH 3C3WA 1XK7A 4D43A 5AHRA 4S1VA 4TKLA 3ZHCA 4TTJA 2ZB7A 3GEEA 5JALA 2IDJA 3ZLUA 4O08A 1P5HA 3L49A 3Q8SB 4GC5A 4I3HA 1JAHA 1JI0A 2ZRMA 2Z6VA 2W2LD 3BWDD 4BPBA 1QZTA 3KQKA 3S8EA 4DSAA 3WC4A 5FJ8G 4EFKA 2GR9A 3M2TA 4ILKA 4U39A 4DPLA 2XCSB 4AJ1A 4DYHA 3IBGA 4O86A 3KG2A 3QVSA 5A05A 3LHIA 2AQKA 4IYJA 2DY0A 4ANFA 4F9FA 4LF4B 2WTNA 4BKPA 2XOKA 1U2EA 1S01A 5AOVA 3U4CA 3PHJA 4Q37A 2DKNA 2ZYAA 3H5TA 4BWFB 2NTNA 2ADFA 3LD9A 1JQJC 1X86B 1Z25A 2CDCA 2PVSA 4O2RA 3ADBA 1H94A 4IDHA 4X84A 1S10A 4EZEA 4J0FA 1NVXQ 2CNLA 3MR5A 2JZNA 4GXNA 4YV0A 2IV7A 1YE8A 3K5HA 4MA4A 1N8KA 1GYPA 3H11B 4J9VA 1M8JA 3KE8A 4REQA 5FORA 3T7JA 2DBRA 2DWPA 1W0JA 2H1LA 1FTGA 3N3BC 4IY1A 2R6FA 3DQPA 3ON5A 4NU5A 4QDJA 8OHMA 3R3VA 3EUEA 4JNKA 5E3IA 3TDMA 2MDTA 1R74A 2PQ6A 3LGXA 5CM9C 3TRFA 4CJXA 2W7PA 4TKMA 1QNFA 4WK6A 1K8YB 1YZTA 1V96A 4LAFA 1NNUA 3ZV3A 3NC0C 2AN5A 3TNJA 5AI4A 1NC3A 3A26A 5TB5A 1I30A 4YY3H 1Y5NA 5EYPA 2PMFA 1QGUA 3JALB 1RR6A 1QAOA 2R0QC 3PCXA 1SUIA 2Y1FA 3TR0A 4Y7CA 4KZKA 1XTQA 1TAHA 1R64A 4MI1A 2PUHA 2XJ4A 2QE6A 3UT5A 4RDXA 1IG0A 4LH6A 3T5HA 2R6CA 2V7VA 3RKSA 4D9EA 3FLMA 2IODA 1RHUA 2WA1A 4ZV9A 1PTJC 2R00A 1RYRA 1Y1RA 2QXYA 3A3YA 3IDZA 4MW1A 3R7DA 1BCRB 3EIOA 5AVRA 2ZT6A 2Y0EA 4FSHA 1SUDA 3UWPA 5FR9A 1CZNA 3P9CA 3U4AA 2PGXA 3EVGA 4C7OB 4QOEA 5EJGA 1HBJA 2NSJA 1I2ZA 1TLFA 1UKZA 4BB9A 3IIEA 3OZWA 3WKDA 2DFPA 3WNZA 3OEEA 4EYSA 5HUHA 3BGOS 2I9PA 4LJYA 1ESCA 1W76A 1ZJWA 3KOOA 2VK1A 4BATA 3MYRA 1FIUA 1U7DA 1NULA 4WECA 4DR1B 3HYTA 1JN0A 3A2KA 1T1RA 1U3TA 4NYIQ 5JS6A 4M89A 3MWEA 3NIWA 3WHKA 4BV2A 1IN1A 5AW9A 5HTOA 1Q0SA 1L7XA 3PICA 3FBTA 3PHHA 2C8JA 3NWJA 3KZMA 3L7YA 3R3WA 4LTNA 4PYQA 4YEDA 4YP9A 3NORA 5KWJA 1KQGA 1CFJA 3O94A 3WXMA 4MQUA 5ALQA 3Q2IA 2UVPB 2XMSA 4NNJA 3JPWA 4JVMA 1NRJB 1RRVA 3C98A 4X91A 1K1SA 1D5CA 1ZMRA 4JI0B 4NLLA 3S99A 1VE5A 1MPXA 3BTUA 4CM9D 3JQAA 3ZY5A 1JVNA 3EPGA 1PFKA 2A3RA 3PQ6A 2ZUEA 3A6JA 3RIXA 4A3LG 1BCRA 1PJQA 1YKFA 2DRIA 3TS1A 2XB9A 2B5OA 4TSKA 3WLMA 4DAOA 4ECWA 1EBFA 1RPNA 1N2EA 1E1CB 2GKGA 4AJKA 5LMUB 3RSZA 2Z2XA 2Q2QA 4JT2A 2WPDA 4Z0NA 1YL5A 5TF0A 1GCIA 4C6TA 2IU6A 4LRWA 1QFYA 2JIBA 3OUZA 4BVJA 2VAVA 1XDUA 4EI9A 3KHGA 4EUSA 4QXOA 4HQNA 5IABA 2Y0SA 4PPNA 5COAA 1REQA 1W47A 3EQ7A 3KT6A 1LW7A 1BGVA 1U8EA 1QXSA 3GGDA 3KKNA 3PNLA 4OM7A 2H1FA 1GXSB 4RMNA 1E2UA 5B1HA 1KEZA 5H8WA 5EWLA 2W4IA 1XVTA 4BFTA 2HF8A 4BO0A 1G7RA 5JJCA 4CTKA 3THYB 2O5EA 2FPGB 5BORA 3OC6A 3G59A 1XVAA 1QAMA 4G4GA 1TCCA 1A4XA 3AFNA 3FPSA 4W5HA 5H7XA 4D3YA 1T4GA 5B12A 2W6IA 4EJMA 4O7WA 1X42A 3X1DA 4YMHA 1F2DA 2I80A 3FW1A 3G9XA 1RLIA 2OV6A 3FETA 4RPJA 2XIQA 2RC5A 1YZQA 3Q7IA 3VYRB 3KCNA 4IDFA 3PX3A 2DKFA 3IS3A 4XH9B 4DMUB 1DRKA 1I8TA 4AMGA 2D7JA 2YWFA 1BXRB 3DV0A 4CUZA 1QYRA 4CHTA 2BCEA 1W73A 2V7WA 2QTFA 1QHSA 1QS0A 1N2CE 1GCOA 3V1MA 3VYWA 3ZU5A 5IX8A 3U6KA 3R9XB 5I47A 3FVRA 2PX4A 2VUHB 3QIVA 5LDGA 4QUDA 3T3DA 3U9LA 4D42A 3WB2A 2GHTA 4JJEA 2I67A 5FBKA 5IT4A 1Z15A 2Q5IA 3G7SA 2JASA 3IHKA 1B0AA 1T91A 2Q5EA 3COYA 3FPLA 4LDQA 5KNDD 2JJ1D 1ENPA 1GDHA 2QQ5A 1KSJA 2CNUA 3DAYA 3Q10A 5TR9A 4BNIA 1GAEO 1NUSA 1Q2XA 3K0CA 1SXJA 2PKQO 4GR9A 4UOQA 3B9PA 4Q0MA 4NC9A 1VDMA 2C31A 1XMQH 2CCGA 3NRBA 3UK7A 3DKPA 5F1PA 2I91A 1A71A 3BJYA 4M37A 3GPCA 5A03A 3NCTA 1Q0RA 4YDHB 3P97A 2W4QA 2CXOA 2GQRA 4H4EA 1GNLA 5JSZA 2FX2A 4E22A 5KFWA 3P8ZA 4MP8A 4KQKA 3NOOA 4YMLA 2UUCB 2JJQA 5I7FA 1V3VA 1Y14B 2O3TA 1RD4A 2GPAA 1IDOA 3AI7A 3NV9A 4RB1A 4F4YA 1EE2A 4Q4HB 4U0KA 5KOIA 3DGFC 4FMCF 3Q98A 5EKUA 4Z5XA 1TTPB 5EUMA 3HNOA 3O9MA 5BY2A 2BMVA 1S8OA 1E3LA 4QUKA 3UQYS 1UZNA 1UT5A 4Q9LA 3TB6A 4R9VA 4FS8A 4XW2A 1U2RA 1XNQB 4BEWA 3KREA 3FWKA 5DN6D 2ZGVA 1W29A 3HJUA 4QGFA 4JYCA 4RKYA 2P79A 2J9FB 1P29A 4JY7A 3QJYA 2WKQA 4AZ0A 1OZHA 4MRMA 2X5RA 1OLUB 2O3QA 5LBIA 2JBAA 4HDRB 4X64B 3TE6A 3RVDA 4DR1H 1W5BA 1I6KA 2FEPA 4MI9A 1QTQA 1P74A 5C1OA 5FPPA 1JAXA 1U0SY 4R7TA 2XUOA 3JQAD 3WZLA 1QF9A 1BXZA 2WWXA 3IIJA 4RU1A 5EJFA 5T6BA 5AVUA 1NX9A 2IS2A 1WMFA 2PANA 2NAPA 3N86A 2EKLA 4ETWA 4RVFA 3O4IA 5BRJA 1BG6A 5A4JA 2B4YA 2JA6A 4NJEA 4W5OA 5IWAH 4QYMA 3MAJA 5KFTA 2OECA 2QX7A 1FFEA 4G81A 3GUCA 5K51A 1VJ5A 3DFUA 2E2IA 1O95D 1O95C 2ZWIA 1ZWLA 4K2HA 5GZ6A 5HMMA 4CLOB 4MQFB 2NAFA 1M8GA 5IT0A 4OGGA 3K1JA 4EG4A 2DBVO 3ZYCA 5GIOE 2XVXA 3QX7A 4WWHA 4P93A 1UC8A 3BN3A 4OBWA 4OJTA 1EFDN 2VSQA 3DBRA 3WIEA 4YAWA 2JGDB 2A9JA 4TUYF 2H7YA 3KSZO 4ZA2A 5GJWC 2FV8A 3UXHA 5B36A 1FP7A 2BR3A 1YGYA 3AZOA 5BUZA 4C14A 4ESVA 1Q21A 3ZUGA 5CFNA 2YFKA 2CBGA 4ZCIA 3KQYA 4BNUA 4PYNA 3A9SA 1HR0H 4FONA 1GG9A 2FVYA 2XMZA 3EGXB 4NEHB 3L9XA 1Z18A 4M2LA 3BWVA 1QGYA 4TUYB 4NBLA 4NOKA 2Q2VA 4JLWA 1P2VA 4KBGA 1XB2A 3GOHA 3RBVA 5KYWB 4FMDF 2A59A 2FLKA 1V16B 3GJRA 5LQSA 3RHZA 3CF0A 4KMRA 4JZYA 2C3OA 2REQB 1DS6A 1N4AA 4KO1S 4ZCSA 2DULA 3JVEA 4YMIA 3ZJ4A 4HRYA 4NMWA 5LWQA 2HIHA 5DRYA 2OZVA 2H29A 5JSKA 4UTXA 4DA4A 1V1MB 2BLLA 3OQOA 4PLZA 3BD9A 4DNXA 4GSKA 4N49A 1W85B 1UXGA 3R74A 4AZVA 4DV7B 3V6JA 3A9WA 4CQMB 5BXQC 5DG9A 4UE3S 4WNAA 4BQEA 2Q3FA 4WKOA 3HPRA 2XBLA 2AF4C 5IC5A 5I4KA 1VLMA 4PG4A 4UCUA 1XAJA 3I1IA 4TLCA 4G5OA 1HM5A 4CMAA 1PGPA 4B3GA 2W6MA 1MX3A 4J76A 2CFCA 3IXQA 2R2AA 3M4ZA 4PS1A 1GRNA 3P9KA 2ERCA 4M1OA 4ETIA 4QZVA 5LMZA 2IY8A 1YC5A 3A36A 4YAKB 1U9YA 3R3SA 3WNBA 2WFLB 4XQEA 2Q2NA 3QKWA 3JZFA 3GIDA 1LLFA 4WZ6A 5A7HA 1ZISA 4ECUA 1ZEMA 1NVEA 2INGX 3DXZA 3E9MA 4V2IA 3K1YA 1F4LA 1OZ0A 5EEHA 1OREA 1I1NA 1O1YA 2Q0QA 3WB0A 4EY4A 3QMPA 4HS4A 1G9TA 1JJVA 3RYHA 3DZJA 3GCXA 1EDBA 5DHFA 421PA 4KIGA 2RHMA 2QYHA 2QR3A 5KFCA 2PYDA 3AF3A 3Q11A 4H7HA 4II3A 4N0EA 2I66A 3EFHA 5IKPA 5KOJA 4CZ2A 1O0BA 1L5VA 2QGZA 3HDVA 1IBKB 2ASDA 1FOEB 2ZCUA 2H48A 3W4JA 2VPIA 4N6NA 2PE5A 4BRZA 1QZ3A 2G4VA 5BV1A 3RTCA 1U9CA