2FPIB

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 116
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fpiB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fpiB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpiB03
2CSUA 4YJ2F 2YZGA 3OUUA 4M9UA 3ORRA 5CAEA 3UFXA 4IHJF 4O7NA 2FPPB 3U9SA 2I87A 1A9XA 4YAJB 1IOWA 3JZFA 4HQ6A 1VBGA 1Z2OX 4MV3A 5BPFA 2GPWA 3U55A 4TUYF 1KEEA 2YW2A 4XZ3A 3JRXA 1EUDA 4IZOA 1OBGA 2XD4A 3N8DA 1BNCA 2R87A 2FP4B 4FU0A 3QFFA 1GSHA 4HNUA 2VPQA 3JZIA 4I4TF 4I55F 4YB8B 1W96A 5C1OA 4YBZA 1GSOA 4MV7A 2QK4A 2OLSA 4C5AA 2YWVA 3SE7A 3JRWA 3K5HA 1AUVA 1CQIB 2DIKA 3K3PA 5EZYF 1A48A 1JDBB 3RUPA 3GIDA 1KC7A 3Q1KA 5BPHA 2W6OA 1W93A 4XYLA 2I80A 1B6RA 1EZ1A 4MV1A 5KKNB 4EGJA 2YRWA 3TQTA 3K5IA 4O4HF 4O81A 4YJ3F 3RV4A 4ZI7F 2R6FA 3VPDA 5CA1F 3G8DA 1I7NA 5LP6F 2GQSA 4MV4A 4XYMB 2CQYA 1EHIA 4EGQA 4EG0A 3I12A 4TV8F 5JQWA 4FFOA 1JLLB 4O4IF 5JVLA 2V5AA 2GQRA 1E4EB 3R5XA 4Y8VA 4XYMA 3VPBA 3KREA 2ZDHA 5HBRB 5CAEB 5H80A 4HNTA 5BMVF 2FPPA 2R82A 5LYJF 2NU6B 2NU9B 1KJIA 3TIIA 2DWCA 4ME6A 3MJFA 3Q2OA 3TINA 4O2BF 4XZ3B 3ETJA 2W70A 4WD3A 4O7WA 2CNVA 4O83A 3VMMA 4NYEA 1GLVA 3TIGA 2I8CA 2SCUA 5IYZF 4XYLB 2ZDQA 2NUAA 1M6VA 4YAJA 5J2TF 3VA7A 1M0WA 1VKZA 5JH7F 1C30A 3KAKA 2R7MA 5JQGF 4O2AF 4FFLA 2R84A 1GSAA 3HBLA 4E4TA 4O84A 2YRXA 4O86A 1EYZA 1PK8A 2FPGA 3G8CA 3MWDA 2NU8A 4YAKA 3AX6A 5I47A 2W6MA 2WYOA 2YYAA 5J2UF 3DF7A 1AUXA 1UC8A 4MV8A 3HB9A 5DMXA 1CQJB 1VBHA 3LWBA 1Z2PX 2XCLA 1EUCA 1OI7A 3V4SA 4MV6A 4FFRA 4C5CA 4RZQA 2FPIA 1JDEA 1KJQA 4ZQIA 4YB8A 5FNVF 2W6NA 3UFXB 2FPGB 3MWEA 2J9GA 1KBLA 2YV1A 1CQJA 1CQIA 4MV9A 1E4EA 2GLTA 4O7LA 1OBDA 3NUAA 3N6RA 4FFPA 4O4JF 4DLKA 2HJWA 4XX0B 3KALA 3R5HA 2R7LA 4IWXA 5LOVF 4IWYA 5KX5F 5HV6A 4MA5A 2IP4A 2NU6A 5CB4F 5K2MA 1DV2A 3WNZA 2ZDGA 4QSHA 3VPCA 2R85A 3BG5A 4C5BA 5C1PA 2YZNA 1SCUA 5CA0F 4FFNA 3HO8A 4FGRA 2YS7A 2FP4A 3ORQA 4MA0A 4O7SA 1BXRA 1UC9A 2CZGA 3R5FA 2YV2A 3OUZA 1CE8A 1M0TA 4IIJF 1SCUB 1JLLA 2NU9A 3RFCA 4L1KA 1WR2A 4O4LF 4O7TA 3VOTA 4ZHQF 1DV1A 2NU8B 3MWDB 2W6PA 4HR7A 2GPSA 1EUDB 4MAMA 1C3OA 2DZDA 2P0AA 1PX2A 4O7VA 2PVPA 2YL2A 3AW8A 2Z04A 1IOVA 1KJJA 1B6SA 2VR1A 3PFFA 4FE2A 4O7RA 1DIKA 4YBZB 2PN1A 2CNUA 2YS6A 2NUAB 4YAKB 2R7KA 2Z02A 3ETHA 1I7LA 4I50F 5C8YF 3MWEB 4ZOLF 1EUCB 2FB9A 3RV3A 5LA6F 5LXTF 2W71A 1T36A 1CS0A 2W6QA 2X0SA 1JKJA 2DLNA 4O7YA 5D8DA 2SCUB 1ULZA 4O82A 3U54A 3DMYA 5HBRA 2YZLA 2PBZA 5GONF 2NU7A 3U9TA 2NU7B 3LP8A 4TV9F 2VQDA 4Y8VB 1GGOA 2HGSA 4HNVA 1JKJB 1Z2NX 3R9RA 3WO0A 2R7NA 2V58A 4XX0A 1KJ9A 2FPIB 3R23A 3KAJA 2W6ZA 5JVDF 3WO1A 4WBNF 2C00A 2QF7A 2YZMA 2R86A 2V59A 3E5NA 1KJ8A 3V4ZA 4FFMA 3TW6A 4O7ZA 4DIMA 1KUTA 3GLKA 2CNQA
chains in the Genus database with same CATH superfamily
2P4SA 2GQ0A 2JH8A 4MGYR 2BUBA 2O8FB 4YCDA 4YN3A 2ZI3A 2I1QA 1WCYA 4X8LA 9LDBA 3KQUA 1PL0A 3ECAA 4M9UA 1VC2A 1Q91A 3QRWA 4U6PA 1XMPA 2Q6OA 3NETA 3RHFA 4A27A 5IJZA 2NVYA 4KO4S 2QLJA 3WNDA 1T9DA 3T3HA 4JYBA 2XDAA 1DB3A 2PX3A 4ZEOA 2I87A 1EP9A 2I33A 2OP1A 4KQ1A 3P2YA 4BGEA 2PZBA 3EIHA 1U6IA 1WA5A 2K5UA 3JZFA 4HN4B 4I3FA 1SCDA 4N8SA 3VH4A 1Z2OX 2ZBVA 2V97A 3B7GA 4OJQA 2HMAA 4MIOA 5KTMA 1KMHA 3BE5A 3K9FC 3LLVA 2ZCJA 1IRXA 3MT7A 3KVRA 1T4GA 3VISA 2E3JA 2H1CA 2R6JA 2RGAA 3JRXA 1GU7A 2VLIA 3DHYA 3J7AC 2OZEA 1CV2A 3V55A 3S24A 1EUDA 3PNOA 4JYPA 4TWIA 2CVOA 3U2QA 3ISJA 2AJCA 5THQA 3DT9A 1HSZA 2VDJA 4H60A 3ILXA 4P4LA 5A3SA 2ZIUB 3UKOA 2BH9A 3Q72A 4PAWA 5KNBA 1VLJA 1L4MA 1L5QA 3ORYA 1XZBA 4QGSA 1XTKA 3M2PA 1C41A 1EDZA 1PG5A 5E9JA 3CX8A 4GUAA 2WU4A 5ILOA 2Y6UA 1QP0A 4MUJA 4PSVA 4DJJA 1RQRA 2P91A 1V6CA 1PSZA 1V8DA 4JODA 4QUDA 3AO0B 4XOIA 4CKCB 1VZ2A 3HJFA 4ZC1A 4QU0A 4NZMA 2RF4A 1QQ6A 3AJAA 2YWVA 2ZI7A 3NT5A 1XHLA 3FBGA 4Y6LA 2PTGA 4IMIB 2QSYA 1J21A 4HGZA 4UUMA 5AQEA 3VVLA 5TMPA 2OQRA 2ORED 1UBNA 1K7EB 2YTZA 5B1DA 2JCYA 3LSYA 2C97A 1KNXA 1WZ2A 1JPVA 1P19A 2GBCA 2WYVA 3MINB 1FQKA 3ZE1B 3ISTA 4MTLA 3ZUPA 1JI0A 1P0FA 3BHMA 1UKZA 1QVRA 3HJAA 4MVJM 3H5IA 1HYHA 3AERA 1XNRH 1V37A 3EXG2 1MO5A 4QXRA 1H2XA 4TMZA 1UXIA 3A31A 1RJGA 1JG3A 3RR5A 4YRFA 1O58A 1Z36A 2VHUA 2ZTVA 4LHZA 1L9XA 3Q4GA 4MVJG 3I53A 4RLQA 4X6LA 1B14A 3H1GA 1HPLA 1OIWA 1YKFA 2JHCA 2BBTA 1GARA 2CJXA 1N7IA 1C80A 1DLIA 3IOCA 2ERCA 1CJSA 4K0RA 4N5NA 4LYDA 4Z54A 2EX0A 3EFOA 4WLEA 5BORA 4PHHA 3UAXA 3GRUA 1OPXA 4UHBA 3UV3A 4BV8A 4OAPA 1DWOA 4URYR 4DMCA 2XB8A 2C7BA 2XR1A 3EEFA 3PC8C 4ZHQA 4NHOA 5LN1A 3DVSX 4I9HA 2BOVA 3JVUA 5CA1F 4CCSA 1K4YA 1K7SN 2AOWA 2QX6A 1MB3A 2P27A 3TRKA 2D0IA 2VTVA 5LR6A 2GEDA 1DBIA 5F3WB 2Y1WA 2HHFA 3EXIA 1L1RA 2Q4BA 1ZEJA 3FUXA 1R0BA 4W5RA 1JG4A 3DBRB 1SXJC 3JQ7B 4EEXA 2JD1A 1F48A 4BFSA 3KSZO 3QYJA 1TW2A 2BRUC 2VZ0A 3ZVKA 1V4YA 4LZOA 4ZVQA 5KAMA 5CEFA 4OXXA 4PTZA 5BWCA 3THXB 1IULA 1BW9B 2W8BB 5ALPA 3T7EA 4ASUD 5J58A 3OD5A 5I7AA 2J48A 4XVRA 5A6SA 1TZKA 5DNYB 1KVSA 5EWEA 3PBKA 1TKAA 3RFUA 3KXKA 5EA2A 3T7JA 3I4MG 1DRJA 1N92A 1GLNA 3DL4A 4YYEA 1E2EA 4UC0A 3VR4D 3EZFA 1M2EA 5ALOA 4YT5A 2V5AA 1DWPA 2H8KA 2VDOB 4KQXA 5HJ2A 2I6UA 1XMXA 1X87A 2FFBA 2ZE7A 1WVMA 2F1RA 3AR7A 3WIUA 4YMTA 4QECA 5KWSA 3NVMB 2D4HA 2MSWA 5CAEB 3SC2A 3EPGA 1J6UA 3OE1A 4C0AC 4CMBA 2IYVA 3B2EA 1YXMA 4ZAFA 2HRRA 5BMVF 3GFQA 2CHEA 4QODA 3PUXA 2P1ZA 4BO4A 1CXZA 2VJYA 3CRVA 2R82A 3C45A 3O4IA 1RHMA 2HO4A 2JEZA 3DMNA 3KV1A 2NU9B 1L2ZA 2OO5A 3QVJA 5IYCG 4UBIA 2R8IA 4MKFA 4TQGA 3GLUA 3ZHXA 5JMOA 3TKYA 2OXEA 1VIVA 3QPAA 1QGDA 4J1TA 3KOMA 4E09A 2VF4X 1TMKA 2XVXA 4YR3A 4GVXA 4JLMA 4UMEA 3W1EA 2Y0PA 3PQ2A 5I9NA 3AETA 2FR8A 1FRFS 2JEIA 3A9TA 3F4LA 2H1HA 1V6SA 3UAOA 3UOGA 2W70A 4Q66C 1TVEA 3VX3A 3A11A 4KVGA 3TG2A 1S0MA 3GYGA 4BLOA 3DZGA 2DJ5A 4G4JA 1JECA 4WLOA 5B6JA 2XAUA 1QANA 3CPSA 4NU5A 1ORVA 1PR9A 3BB4A 3K32A 1FYFA 4JI1H 2WSYB 3IQGX 5D00A 1TMOA 2O7NA 3DE2X 1ZC3A 3WGIA 4OVKA 3UQ8A 2QZSA 4D0GA 2RGVA 5DLGA 5DTEA 5KWIA 2WTNA 4K28A 1TVKB 2QUHA 5D87A 3U7HB 3H04A 3E53A 4FYWA 2EHDA 4AUMA 3ZV6A 3IP8A 3FDSA 1F14A 2QOEA 2VH5R 5B2FA 5CNMA 1KR2A 3T7SA 2JGMA 1XFDA 4CKCA 3P8ZA 1KH1A 2CF6A 4MJXA 3IHTA 1KGSA 3D5QA 3MJHA 1I6LA 4MIEA 4ZXFA 2E48A 4RADA 1K4KA 1MX1A 4JMLA 5IP5A 4QFDA 3EVNA 4DWJA 4Z2AA 5JY6A 4WEQA 4OKNA 1A82A 4LCEA 5L1LA 3O92A 1YKSA 3QVGA 5EMMA 4E7PA 1ZD2P 2VPTA 2FW7A 3KJEA 1KAHA 2FVXA 4HEA6 4RAYA 4OXIA 1WCXA 3MS2A 5HFNA 1QYDA 4EFBA 1DC3A 3KJFA 4PZ0A 4FFLA 3V1NA 5K01A 1J5EH 2CYBA 4WN3A 1L1FA 3I9KA 3IAAA 3KOUA 4HFJA 2Z6UA 1G20E 4XARA 5E0OA 3BYZA 2BGGA 2PUWA 1GUYA 4KQFA 1JSCA 1TLLA 1G0OA 3UMCA 3NTUA 1Q0LA 4BFXA 3CZ5A 4PSDA 4X41A 1LLCA 1T2NA 3R3ZA 4MRMB 2WVHA 3KELA 4C30A 1BGXT 1GZHB 1PT5A 1G5IA 4WPGA 1Q12A 1PK9A 5HK9A 2BUAA 4E1VA 2ISQA 3NKVA 2CNWA 4FGSA 4YDRA 5DTRA 3RQIA 3EEOA 5KDDA 2VUHB 4AJ1A 4A23A 1FSFA 1HDRA 3TLXA 5KYNA 1P2DA 4K9QA 2QZZA 1W4BA 1C9KA 3L7LA 3A2KA 1W0KD 2AFIA 2IUEA 2YBDA 4HVCA 4JCCA 2WC1A 4GYKA 3DJFA 3DUWA 1ZESA 2PUTA 2RB4A 2X0EA 4BVEA 2Q1SA 1WBJB 4J7UA 3CVWA 3HNOA 1DRKA 2SNIE 2H06A 4CMKA 1G7RA 2FQXA 5FI3A 5GM1A 3GTPA 1QGAA 1GTRA 1ADGA 4V03A 4FGLA 5T4HA 4WT7A 1DKRA 3P32A 2Y1GA 2WZQA 3CUYA 3E5RA 4KE8A 3LRPA 4YT2A 4US1R 3UBTA 3DBRA 3PXUA 2AMFA 2WKQA 5TPZA 3RHZA 2LIVA 1HX7A 5IHXA 1GKIA 3M6FA 5CXXA 2CGEA 2JCXA 4DIOA 4L6IA 1B00A 4AF6A 4XQGA 4DA8A 3TSCA 2B63G 4P5DA 5E9WA 1WTAA 1K0FA 1VIAA 1VE7A 4M1EA 5LD2C 2JRLA 3NHFA 5I7EA 2HCTA 4B34A 1LY1A 3QLTA 3ZCRA 2ZUUA 4L2IA 1XDDA 2A0XA 4G26A 5KZMB 1LUAA 4PLWA 3HXPA 4AZ0A 1RRVA 2X0NA 1SOWA 4TVOA 4NR0A 1TIBA 3FGNA 2ZJ6A 2O2HA 1KJWA 1H4QA 5A2GA 1H05A 1XZHA 4M99A 4LX8A 2VSFA 3N6RA 4FFPA 1DBRA 4O4HB 5DYTA 1YVRA 5EZYA 1FEZA 4DDWA 2C2KA 4DLKA 2QSUA 4XIFA 3DZHA 4AIIA 1RW4A 4EITA 2R7LA 4OYHA 4I46A 5ALEA 3EH2A 3L1VA 4JNKA 3UTCA 4E6EA 4GU5A 1ZITA 3WADA 1X7ZB 2HREA 4TKVA 4CMFA 4OK6A 2IUUA 2QUJA 2AOUA 4WZBE 3SZ3A 4GZ6A 2C8JA 3SF8A 2YXNA 4DBVO 3WYFA 1TO1E 2J9FB 3GWGA 1VA5A 4I55A 4A73A 2XCIA 2B69A 3D6JA 1IPFA 3QM1A 3KJZA 3MCTA 4LJ9A 4JI4H 5KFAA 3KYHC 1LDYA 4R68A 2ATIA 3G5UA 5E4JA 3RJ0A 5YASA 4U7TB 3UANA 1Y14B 4AMZA 4QG7A 2FMTA 1QNFA 3S4YA 3VBCA 3ZNNA 2WHYA 1P0IA 2AEFA 1IIRA 4YJ3A 3IHWA 2A57A 1BA3A 4D7AA 1NVKA 2Q9AA 2WWHA 3G13A 4FNGA 3PVSA 4CWAA 2CN1A 2EYUA 3GLFE 1MFPA 3CSUA 2G5TA 5M29A 1UJCA 3ORQA 4KZKA 1JG6A 5J59A 1BXRA 4C3VA 4NJMA 1RRGA 2O8BB 2DH6A 3QMPA 4BECA 1K0UA 3PLRA 3NVKI 1JLHA 3W5DA 2PRIA 2BEUA 4BNNA 1UJ4A 3D8HA 3EXIB 1AQ6A 3AZPA 5ALHA 2WHRA 2R5WA 3REOA 2D1QA 2GD1O 3CKYA 3CVYA 1P75A 4C21A 1VTKA 3S28A 4URVR 4KYUA 4UBKA 3B85A 4FI3F 2OILA 1SCUB 4U7GA 2NUTA 4HEHA 1J2RA 3BXOA 2ZGIA 3ZKWA 1YVEI 5EJ7A 1L5FA 4FR2A 4D99A 2DPGA 3CPEA 1S2MA 4FX5A 4JVNA 2JLYA 3IEXA 3LG2A 3IODA 3OETA 2PGXA 2PQ6A 3RU3A 1WNFA 1W25A 5F5XA 4AROA 1OHHD 3SX4A 1N4DA 4AF8A 1OAOC 3C7DB 3L7AA 3R6GA 1IB6A 2P9FA 1AZLA 2A4MA 2QRJA 3BKXA 1NG1A 1UKEA 3F7NA 2CLOB 3OX3A 5EYPA 4PSCA 2NQ2C 1E4YA 2OCXA 4ZVOA 3G68A 5SZJA 5LOVA 2H48A 4O0MA 3R7AA 2B1RA 3O91A 1UINA 3BTVA 2XADA 1XXHE 2FEWB 3PTAA 2AEEA 3NTVA 4YDQA 2A7QA 3RYIA 3MHTA 2PN1A 4KG7A 4NCIA 2GXSA 2ZIXB 3T7RA 3TLBA 2QTVB 2Z02A 1NQWA 4NMLA 5LYYA 3RE1A 5JT1A 2ZU6A 1VQ1A 1JAHA 4RS4A 3OQHA 1G6Q1 3B9PA 1W0JA 2CNBA 2YKGA 4DAAA 3LECA 3T1NA 5CXQA 1DIGA 1FC0A 1W48A 4CVNA 4LFCB 2H1VA 3QLEA 2UVVA 3NRBA 1W5AA 5KKCA 5AUOB 1G2PA 3FYTA 3PEVA 4CM8A 2ODBA 1T10A 2AH5A 2PGDA 1E58A 4O3FA 3ACCA 3BB1A 4HT3B 3MGBA 5BN4B 4AQDA 4YP7A 5LB4A 1M8JA 5FAXA 1D4OA 4IIXA 4RDXA 4CLRA 2TRSB 2C7RA 3U54A 1M6WA 3ABIA 1Y1VA 3V7FA 5C4IA 2QD4A 4GKAA 4XDHA 2XTNA 4HJXA 3MBIA 4P2GA 1EDEA 4B73A 4LFCH 5IXSA 4KBYA 1HFJA 2AUMA 3WA6A 2A5FA 1WQ3A 3NV9A 4IIJA 1N0UA 2QLMA 4PYRA 3OHAA 1V2HE 1UBEA 3IBCA 4KFSA 4C0JA 2KW5A 4M7EA 1WVIA 2B1QA 2ABWA 3FNBA 4HPXB 5IKMA 2XB6A 1QQ7A 4B35A 4FS3A 4LC9A 4NXMH 2WWFA 3H8VA 3ILSA 5IT0A 4HS4A 4K7JA 1ILEA 2OV2A 5EP4A 5GIPE 2X4GA 1J8DA 4EMBA 2FHSA 4RB0A 1YR6A 3JSXA 3ZHYA 5LP1A 4K9DA 1M34A 4C4ZA 3CU5A 1WMBA 2FMHA 3RGZA 3C0FB 2HNAA 2DUWA 2HH9A 2IHBA 4Y98A 1Z7EA 1IVYA 2IY8A 1BYIA 1NUPA 1VPLA 2G63A 2JAXA 3L7YA 2AOUB 2IV2X 3RC7A 4BQEA 5D85A 5JROA 1IYZA 1ZKDA 1I01A 1ZNQO 3NU1A 3WO1A 3OEWA 3DDCA 1MEJA 5A2QW 4DR6H 4A36A 3THYA 3T5JA 4R1UA 2UXCB 1FUEA 4ECUA 5EE0A 3A3YA 1THTA 1S9FA 4NOMA 4QM6A 5DX0A 2DFTA 4AKSA 1KJ8A 3GOHA 1BEEA 1XRSB 5FH9A 4EELA 4CE5A 1T8PA 1C7QA 5KNDA 5KG4A 1Y8QB 5FOVA 3NWBA 4MEBA 4WBSA 4A6XA 4GLBA 1N8KA 1AS2A 3KT0A 1XRPA 1LPNA 3LUPA 1FTQA 3ILHA 5JAPA 4MJ7A 5K3AA 5BWTA 2JIDA 1ZAUA 1Z5NA 2XYPA 1FP7A 2YIMA 1R8YA 3RSLA 4RF4A 1LVGA 4ARBA 3F3YA 1G6KA 5K0TA 5H3LA 4DR4B 5I01A 4OPMA 1PS8A 3EASA 2IZ7A 3HZRA 1NF3A 1U3GA 3L1IA 2B35A 3MTBA 3WLPA 2RBGA 4JH0A 4XB1A 3RKSA 4KOAA 2ZITA 3IEUA 3OFNA 4R1PA 2ANCA 2FPPB 4NJOA 3ZZTA 3EJ6A 4M38A 3N2KA 2XT0A 3QOWA 2XCTB 1TQDA 4J9LA 3E2IA 1E7MA 1YHYA 2ZSJA 4MYUA 4OQZA 1FPQA 4C4AA 1ECCA 2FA9A 3JVVA 1TYAE 2PBLA 3WDLA 4A8PA 4HI0E 7YASA 1Q1QA 4GGPA 1W44A 1P1FA 1TECE 2JFZA 3OTWA 3EXAA 3FZYA 3HYNA 2C61A 4L27A 4OG2A 4YP6A 4BE4A 5IC4A 3IJEB 5CD9A 4BV9A 3AVWA 1BRTA 2ODNA 2WQ6A 3W1GA 2P3LA 4M76B 4BJ1A 1NVMB 5CT9A 2XD4A 2YBEA 4REQA 2FYTA 2HRQA 1V3QE 1XD2B 3PUJA 1FFGA 4W5QA 1SFRA 4G0VA 4U2FA 1CUIA 5AJUA 3T1HH 2X77A 3TIFA 1JS1X 1GSHA 1T2EA 1QGUA 2CDRA 3E3LA 1Y8AA 3QJGA 1X7WA 4HDKA 4R69A 3UMSA 3EVTA 4CBVA 2XMQA 4LSGA 4BS9A 3ENZA 5FLXW 3WVNA 1IZYA 2R4UA 3INYA 2PUFA 4GQIA 3HVUA 4MVJI 4Q3AA 4DT1B 2BFPA 4JJIA 1NPYA 2IUYA 3N2LA 1UKYA 1L7QA 5KOIA 3LUCA 1VIYA 2W8KA 2J33A 3RT9A 4JGIA 3RIHA 3W0LB 3D0OA 4DVGA 1MIOA 2MJLA 4YRAA 3LTNC 1JYFA 4B4KA 1HT2E 2HCFA 3INNA 4PE5B 3RRMA 4I1VA 1G8YA 4XD7A 5AXCA 4JV5B 3K5HA 2DH5A 3FOCA 3BK1A 3UPTA 2FMKA 1O8BA 1IIBA 2NW6A 2Q41A 3DMTA 1B4DA 3CUEF 4WJZA 4YJ2B 5AI0A 4I81A 3UT6A 4FGZA 3O8QA 4WZ6A 2Y05A 3LCMA 1JG2A 4GKBA 4NHEA 5EFZA 5TDHA 5C80A 4E5SA 1CRLA 4UHEA 1IN8A 1A7AA 1YC2A 3PX2A 1K3UB 3AR5A 1YS6A 5KFOA 3LLUA 4FFVA 5EJ2A 3MLAA 1ZGZA 3V97A 2EXXA 5GADl 1QH8A 2DWPA 1ENOA 4DBLE 1OC2A 4PHGA 2YMQA 2I91A 1MZPA 3MELA 4HWKA 4DL3A 1YHZA 4R1NA 1RRKA 1OWPA 5CG2A 4WKCA 1JXAA 5KOHB 2HJGA 3Q8WA 1L8AA 1SZJG 2JGKA 4QARA 3U17A 3FKJA 5DYNA 5A4MS 3IA7A 3V46A 3GLFB 3SEFA 3PXBA 1K6MA 2WAXA 1ACJA 3F5QA 4P7KA 1D6JA 1LLQA 1U4OA 2JD0A 2R62A 3Q8PB 3LP6A 2YWDA 3OTHA 3GLIE 2GF0A 3CG0A 1DX4A 4WINA 3FGOA 1HETA 2VCHA 1SR8A 4RPLA 3TW8B 1UZMA 1Z2CA 1CUXA 4PM4A 3P7MA 2HRBA 2NO1A 2ZR8A 4LF5H 4M21A 4N6GA 3RV4A 3F5FA 3RBZA 3ICOA 5E25A 2ACKA 3OJEA 4YMHA 2DPIA 4NZYA 2R6FA 2JFWA 2XD9A 4PV7A 4YP1A 1U8AA 3M70A 4DG9A 4PBSA 1V9LA 5CJJA 1D1PA 3OTGA 3AT1A 2X15A 1ZZEA 3LIIA 3VQTA 3EMBA 3I64A 3RKRA 2COUA 4EHHA 2Y2UA 1P6UA 3WK9A 1PU2A 2XWSA 2YY6A 3FDZB 1P31A 3N0XA 4G63A 4I6JA 2XB9A 2D1FA 1V41E 3ETLA 4OK5A 2J59A 3BEOA 3ZD9A 2XCSB 2O0KA 1N5IA 4HTFB 1RYRA 1DJLA 4MAAA 4K40A 3O4RA 5C1IA 2GWHA 3OU6A 4F71A 1XZ8A 4BRZA 2NADA 5I7OA 1MVLA 3HGQA 3ZR4B 2JJ1A 1ODJA 2H0AA 4KSCA 3VU8A 1WD7A 1Y8QA 4I50A 4C6RA 1N8NA 1V9SA 3PGXA 2RHBA 4D46A 3QF7A 4J07A 1X8LA 4RZ2A 3FDJA 3HEBA 1NR1A 4TTQA 3RF2A 5JNWA 4ID9A 3RW9A 3V8EA 5EMNA 1PZHA 1NN3A 3KU1A 3KB1A 4GD3Q 3O4FA 2YJ6A 1WY7A 3DMRA 5IDWA 2P5UA 2CDBA 3IE2A 1GTG1 1AJEA 5TV2A 3VYUB 3AUXA 1ZNYA 3NYIA 1HRKA 2R1VB 1R9TA 2C7OA 1XJ0A 3B51X 3G9UA 4DLSA 3OM8A 3I2FA 3QKUA 4OHMA 3D0KA 4P83A 3VSCA 3GPIA 1BXGA 1ZHFA 3F74A 1DGQA 1N7HA 1B1AA 3QBTA 4XVHA 3UXMA 1KIMA 2WD8A 2NTYC 4Q0MA 3VH3A 4D41A 4AT1A 4E33A 3K0BA 2E4AA 3AWIA 3SJAA 3STHA 1QKKA 3LDAA 5EE5B 1GVHA 1QRDA 1ZFNA 3OZCA 4LBVA 5EINA 5G0TA 3CR7A 5LUAA 3N7AA 4HDNB 3MB8A 1CUGA 2NO5A 5C8YA 4NFSA 3PHCA 4A3SA 1G6OA 3U19A 4V1CA 4DR5H 1SA0B 2V1XA 3K8OE 4NRDA 4O8CA 1ZJ5A 4ZC8A 4KDCA 3RRBA 5DNDA 5TPWA 1C50A 2Y1LA 3C1UA 2XT9A 2JA8G 3RT7A 3NVDA 4ED6A 1N8SA 3QA3E 5HMMA 1XD2A 3EZ2A 3RARA 1MB4A 3HBMA 5JS1A 3Q85A 2RG1A 1J56A 1A69A 2G1KA 3OJLA 4HDRA 1TAHA 1A4RA 4P4SB 4QGBA 4MVJP 2P2NA 3KZVA 3WYAA 1USIA 4F04A 3NOVA 1FA9A 1RJEA 1EB8A 5DHQA 5EIFA 5CFMA 2BTEA 3OSZA 3G7UA 2JI9A 3A2NA 4XTRA 1EWYA 5IYZF 3WWEA 3NHMA 1Y5NA 2YHUA 1GPNA 2NLOA 4QULA 3S1LA 4Q9IA 4UHCA 4A3JG 1D04A 3F78A 4FFDA 1B6TA 5DNWA 4J6EA 4NYJQ 4YAJA 2E2WA 1P0MA 2J6IA 2NO0A 2I29A 3QJYA 3QUBA 2BF7A 4U2EA 4UATA 4Z4HA 4B1FA 3PVXA 3PX7A 2FSVA 3GIPA 1NI5A 3CKKA 4ECVA 3T9BA 2W4MA 1FYEA 5G1OA 1JSRA 4K8OA 4OB8A 3K0FB 2VDQB 1OBHA 4BN0A 4DQLA 3Q11A 2OFFA 1QG0A 2OCDA 1DC7A 3O8NA 4WFQA 1R88A 2BHLA 3OURA 1YS1X 1QIMA 3ZJTA 2EJTA 1RE1A 2GK6A 3IGFA 1MU0A 2X41A 4GZ3A 4PGMA 2GXQA 4TMTA 4GNKA 1JHAA 3RU7A 2J0EA 4CUKA 2IF2A 1K8XB 1MXFA 2BSXA 2YWJA 2BMAA 1CEQA 4V39A 5TS3A 1A97A 3JQAB 1YU6A 2N75A 4BN4A 3ZE6A 4UUPA 1OZGA 2Y93A 3LBYA 4MYRA 2HK8A 4MTEA 2HBRA 2E9SA 3GCZA 4YRCA 1W0JD 1EVQA 1E7QA 1P8AA 3OIGA 3OQBA 1CIPA 4QT4A 4D4IA 5IAOA 3CPHA 4UULA 2G6BA 3AVVA 2HJVA 3E9DA 4EJSA 4G0WA 3OICA 3PHGA 4LMYA 2V7EA 3EEIA 4C87A 1O5IA 2BGLA 3UK6A 2W90A 4B4UA 2WQZA 1E3QA 2HWUA 2WD7A 4LNHA 4CDGA 2B8WA 4MUGA 5KSOA 4GM0A 2I22A 3DF7A 2XLCA 4ZCLA 1GD1O 3MERA 5ALVA 3OAAA 3Q9LA 4RPKA 4TLBA 1L5VA 2BTOA 4AC9A 1GZUA 1DDIA 1OI2A 3PUZA 4MV6A 1SKYB 4G1VA 4UTOA 2FR1A 2X19A 4B3GA 3DQPA 4J3FA 4QUJA 2TS1A 1ISMA 3STYA 3QNMA 2VS1A 3AOEA 1ST3A 2A30A 4L5AA 5EJ8A 3HYSA 4NCAA 4YPVA 4J0DA 2BFDB 4OSPA 2C7GA 1YK0A 3V1KA 2F43A 3FA2A 4AL4A 1GQ2A 3M8KA 1PJ4A 3LKBA 3QHAA 4KLZA 1Z62A 4XPIB 1RTTA 1HNXH 2NTVA 4JP2A 1H5UA 1K4MA 3BZUA 3MTEA 2F6RA 2WKPA 1XD8A 4Y2JA 4F1WA 5B7QA 3NC4A 2Q21A 5BQXA 2IS2A 1D7AA 2GCPA 3BAFA 3B1WA 3M6AA 3R3HA 5EEGA 3SEQA 3ZBUA 1RM4A 3ED5A 4HLUC 3LFTA 5L8VA 4BVGA 1K6EA 1P33A 4J0KA 5JLJA 2KB0A 4IOMA 4NG4A 4UNQA 3DTGA 1J99A 5EIBD 2H1FA 5JE8A 3HKBA 3MMXA 5AVZA 2HKIA 1QFSA 3QOFA 3T5GA 3ZIAD 4KHZA 5AFSA 1YRLA 2CHQA 3K2QA 5JW6A 1V5EA 1HDZA 1WSDA 4A26A 1QG6A 1AF4A 1BN7A 1HT1E 2EZTA 2FI1A 5D3MA 5B30A 5DRYA 2P9TA 3ADPA 4CE6A 1NQAO 4L73A 5HRCA 4MMXB 2RGRA 1Q83A 2E4VA 3EOZA 4LYYA 2PH3A 5HILA 4A6EA 1C9MA 4BNKA 5LOVF 2XGOA 2CL0X 2A4KA 2OENG 2TMKA 1NYTA 3NBYC 1A8PA 4JP1A 4K3UA 4AB1A 1BX0A 4DN6A 1HNZB 2RCNA 4JLAA 2NUBA 1G7TA 2X0IA 4Q12A 2WRZA 4XD7D 5JZVA 5MF6A 2I3GA 3OEHA 4QJIA 4A93G 5K99A 5K2MA 4JXJA 2FPRA 2FRVA 2BGUA 1ZM3A 1YDWA 1XEAA 1RQ2A 1QJCA 2IHZA 2J9ZB 5DSZA 4M1OA 3R1IA 3ZE0B 4ROSA 5KNCA 4PNPA 2R85A 4QJBA 2W98A 2DR2A 1NR7A 1SY7A 5IJ0A 2IEAA 2PVSA 4JR0A 1MVOA 1WPRA 1YB6A 3PDWA 2CCGA 3NR2A 1TJ3A 4OHXA 4Y6SA 3T1HB 4DXAA 2MCTA 1BFDA 3EZXA 5I7VA 1Y34E 2P4UA 5ARCA 2JVKA 1RAIA 3TG8A 4F72A 3BIFA 3TRIA 1OX4B 3HK2A 1FQOA 1K92A 3NGLA 4RIEA 4D3YA 1XALA 1N1MA 5KFNA 1IM2A 2ZJ2A 1Y6QA 1LDEA 2GYYA 2IBTA 3IVGA 4N48A 5A0VA 3T5CA 4RHYA 2CZGA 4C76A 2PCLA 2OE2A 3P2KA 1C81A 1PG0A 2VIIA 2RKBA 3JU3A 3SXUB 1TYBE 1XAIA 1X2EA 2I6GA 3FNFA 3K16A 3R2JA 3QVKA 4IJUA 5EMKA 3PXGA 2VYVA 1IM5A 2IEDA 4FEYA 3WRWA 3L4SO 2J67A 3BKWA 3M1IA 3WP1B 5IS2A 3NATA 4KLRA 1ZN2A 2PS0A 3EDMA 2CHUA 1N2JA 1TTPB 5IJXA 3TNJA 2V9ZA 2V6IA 1B93A 1XVIA 3IJPA 3VYVA 1CZNA 4H0FA 4DMHA 1GDHA 4QJ5A 2X22A 5C51B 4IO1A 1PFQA 3LW7A 5BUCA 4FHEA 1WWKA 3MWDB 3RRFA 3GCGA 1G3UA 1ADFA 2GF9A 3DLIA 2AG8A 2PKQO 3K0CA 2IVFA 5H0IA 3OD1A 4CYMA 2CYAA 1UC5B 4JENA 1IOLA 3DUFA 1ZUD1 3PUYA 1I33A 1N0HA 3HA3A 4ZA2A 1ISPA 1CUBA 4GF5A 1KP3A 2W8ZA 4DR1H 2EBFX 2P0AA 4RCVA 3C24A 5FDFA 5JO0A 1E5DA 1FFYA 4NENA 2Q5LA 3E7FA 5D51S 5TGDA 4Y2TA 4IDCA 1JNXX 3OZEA 5CHYA 1BAPA 3KEGA 3DOCA 1ECBA 4GKKH 2QP9X 3OZFA 1VLMA 4KIFA 1DBVO 4UTNA 5HZKA 1RXWA 2Z04A 3IS3A 4ZK2A 3E7WA 3N8GA 4HLUA 1EK6A 4RPIA 1A98A 5KNCH 3FMOB 4ETIA 2VP4A 3FCOA 1BWQA 2Y0BA 1ZHHA 3SZMA 4PG7A 4AJLA 3HNRA 2OWOA 5DGIA 1NQVA 3GJRA 4FJ1A 3WQBA 1C0EA 4KDFA 5AM4A 3G2MA 3GW8A 4KQJA 2BZ0A 2P2CA 4ZOBA 4BP3A 3KLPX 4CPDA 1RAFA 4BXOA 4OHZA 3T4PA 1V1MB 1N3YA 4FHFA 3EGWA 4F3KA 2EERA 3BA8A 1IK6A 3U0GA 1Z5OA 4R5HA 4UAUA 2A7XA 4PLZA 4QBHA 1R0RE 3NHSA 4M8LA 5DCLA 4BLPA 3U61B 2XCPA 1KQFA 5A4KA 2GZRA 4C03A 4N5HX 3G2KA 2ZETA 2CLFB 1PBNA 2AR0A 2Q5HA 2D0DA 3PV0A 1W36D 1CUUA 2F43B 1VGQA 3K5PA 2TECE 1BH2A 3AVOA 3DMYA 3E84A 3VX4A 4FYXA 1KNQA 1USUA 2OFXA 2RGNC 3QWHA 3HV2A 4LSMA 2IV7A 3ZIDA 5H5JA 4RENA 2GRUA 2QLBA 2HU2A 1G63A 2FX2A 2ZJZA 1RAGA 3AF3A 4Q1BA 4RTRA 4BNWA 2RGNA 3E8XA 2NU7A 4W9NA 4RA6A 3U9TA 1YL6A 2GAOA 2K4MA 2FEAA 2X23A 4HX9A 2FQ1A 4TV9F 1AGYA 4BNUA 2FX5A 1NKVA 1NT4A 3OCJA 2GR9A 2QR3A 5I5XA 2VDPB 2ECKA 4OHBA 4GOKA 4DQDA 4DV1B 2HF9A 3B13B 1ZS9A 5FBHA 4TVKA 3CR3C 1QGED 1HDIA 1OWLA 1P45A 2WSMA 3AP1A 3JVEA 4JQYA 5I3ZA 4QWBA 1VJ1A 2R7NA 2OHOA 3W7AA 3HXQA 1YR9A 3MPUA 2YJGA 1ET0A 4PQYA 2JLQA 1T5TA 4IGEA 2DWOA 2RGUA 2WJ4A 5FPOA 2Q2QA 4RO0A 4Y2XA 1V26A 3UFBA 4DSUA 4N18A 3TF5A 4DA7A 3IT3A 3JD2A 2CJFA 1Q0SA 2A2ZA 4IM7A 3PT9A 1K97A 1JHYA 1SCBA 4ZZ0A 1ZRHA 2IPNA 2V9PA 3H05A 1DGSA 1HY3A 3SKXA 4A8JC 5FULA 4UJ3A 4BBRG 3UC9A 2DPMA 3VUFA 2BJVA 1I3LA 2HXGA 2W2QA 3FWHA 5JDCC 5FXMA 3U7RA 4BP1A 4CG1A 2JGJA 5C46F 1G1AA 1OVMA 3KVVA 3M4ZA 3TMKA 1JEYB 4FFMA 3TW6A 2Z9CA 2B78A 1JQ3A 1JR3A 2AXQA 1Z0FA 2GLUA 4JGGA 4LX0A 1RPZA 1YCDA 3IBYA 3LC1O 1BDBA 3LCRA 4F4FA 3N6VA 4I3GA 5DHTA 1E32A 1K8YB 1O8CA 5IX8A 1HM5A 1WR8A 2A67A 5HSGA 2RK3A 2JF0A 2HA3A 4O1IA 3VI4B 4WHXA 1TU3A 1C4WA 2XDQB 1BG6A 3SJ7A 4BNIA 4ZJUA 1E1QA 4C4OA 2D2XA 2OY0A 2ZPAA 2HF7A 2II6A 6Q21A 4K6HA 1ZI8A 2VQFH 1F4PA 2AFHB 2IK8A 3BTUA 3K72B 3J81A 2QX4A 2CFIA 2ZANA 1U90A 3P9IA 3S68A 3K9NA 5LSAA 3G2QA 1E3LA 4JS0A 1MB0A 2ILVA 4L7QA 4KR0A 4POAA 3C3AA 4AJOA 5GVSA 1D5CA 2IHKA 2IGTA 1N2OA 2FU5C 1KVRA 3DKPA 1M2FA 3JTMA 3ORFA 1NVBA 1I24A 4JHXA 1SCQA 3D1LA 3IAM6 4WASA 3NTQA 4YJKA 1PLLA 4MV3A 3TCKA 3FPFA 2V7QD 1UMBA 4XUDA 3PDIA 5HTKA 5KNDH 2PUJA 1GO2A 2BMDA 1I36A 3M1AA 1G21E 4LMPA 1I2ZA 4ZVNA 2JASA 4YALA 2AE1A 2GHTA 2FMFA 3V4RA 5FLMG 1KGDA 1RADA 2PZMA 4CCAA 4EUEA 4EX7A 7ADHA 1L4UA 1VJDA 4H6XA 1ZGCA 2AJ8A 1GTZA 2H1SA 1M3SA 2G7MC 1VRVA 5F23A 1W8IA 5BWOA 4OMCA 2RHWA 3FB4A 4NENB 2ZG6A 3BACA 4AY6A 4QHSA 3BL6A 1KO8A 3OBIA 4JX8A 4ISBA 5FORA 4QHTA 5KX5A 4K6OA 3R9KA 1HNWH 4J75A 1J5EB 1PUJA 1WMEA 2Q99A 1SU6A 4BTLA 1NHGA 5DBEX 2REQA 1W49A 1FRQA 1Z73A 1BD4A 3JQ7A 4CM1A 3O1IC 3CHYA 4H17A 2H6EA 1VLZA 1H2EA 4POOA 4ARVA 2QK4A 3CKLA 3I04M 4L51A 1ABFA 3A1SA 4JJGA 2HLDD 4K1XA 4QOJA 3WBBA 2O3JA 4OXNA 1WUJS 3CT4A 3IT0A 4HH1A 3KKPA 4WE3A 4Y2UA 5DFAA 3TBHA 4ITRC 4WKGA 1T91A 1HDYA 1MAHA 2E6KA 3DE1X 1PT6A 1LTHR 1OC4A 4R1QA 1CKNB 4URHA 1EFUA 1OX4A 3BJZA 1KYWA 4CM5A 4FCWA 1AKYA 2I6TA 4Y9TA 3O8OB 4EG6A 3GTLA 4OYYA 1PWZA 2CKMA 2C42A 1JQDA 4L5JA 4AJJA 4PNHA 2HWXA 5BSEA 3TQ1A 4UMVA 5H16A 3B52X 3ER9A 5I5GA 1HFEL 3WL4A 1MW9X 2A3RA 2Z2KA 2ZWAA 3AERB 2XF8A 4PX3A 1OX6A 2HQSA 1GAQA 2VAMA 4NEQA 3UW1A 1OTHA 1SXJA 4CMEA 2R0QC 1DKPA 1ETUA 4M9QA 4BFZA 4QWAA 3D8SA 1MHPA 2V7TA 4JY7A 1WY5A 3SMQA 8MHTA 1V8FA 1XP8A 3FVQA 3GROA 2BHNA 2LP4Y 3EIOA 4GI7A 4I9FA 2YU9A 4QFCA 4BMYA 5KJ6A 4JIGA 2PWAA 4ACAA 3MMNA 4QTZA 3LVRE 4IV0A 1B0ZA 3E3OA 4G24A 2A8YA 2IZ5A 1FU7A 1HXHA 3NHYA 4HRXA 2F8SA 5JRZA 2VO1A 4U00A 1ZINA 1YWGO 3VZSA 3A6PC 3HBFA 3OF5A 3VPDA 4F9EA 2BGIA 3EXFB 3GEMA 1B16A 2RDJA 1TM2A 2JI4A 3H17A 3LZDA 1WLYA 2EATA 3P26A 4WI1A 2OK7A 3RAQA 3OZBA 3T5MA 1R4ZA 3LT2A 4PQGA 1WXWA 4KPYA 16PKA 5AVYA 3RVDA 2GQSA 4D3SA 3GRYA 4PBTA 5JMWA 5K0CA 1TI7A 1N0IA 1YR8A 2LKCA 1I4LD 1OA1A 2CLDX 3BE4A 3Q6MA 1N3BA 5ETJA 1GNRA 2CVHA 2IX3A 2B4QA 1OLXA 1G7CA 3CF4G 1IH8A 3DOUA 5C8DA 3OSPA 3ZV5A 1G60A 3KQQA 4P5EA 5IM4F 3U4HA 4E21A 1IBMH 4C0HA 3PSHA 2OEPA 4MYCA 3VC7A 1JPNA 4XUGB 3ZTYA 2O5CA 1LCIA 2B5VA 3AZOA 3IMFA 3OY2A 3HKDB 3ONDA 4FFOA 4MWTA 2EZUA 1L6IA 1UDWA 1K7XB 3I2GA 4JBWA 3UYKA 1BJKA 1FFCA 1KEPA 1N3LA 1TA9A 4ECSA 3R3WA 3PUWA 4U2DA 3CF4A 3MQ4A 3F1LA 5AM3A 4C4YA 9ATCA 2AG0A 1JHOA 1QRSA 1GPKA 5FQOA 4BMVA 1WDKA 3OE5A 1YZQA 3KV3O 3FPLA 3NAGA 5EXSA 4LGMA 1Z17A 1YOVB 2COJA 1GTVA 1CU1A 1Y1LA 1BQ3A 2A0YA 1F8FA 3EC2A 4KC0A 1O1YA 1DC8A 3AH8A 4ALLA 4FXPA 1GN9A 5DLYA 4EF4A 5KQSA 1U28A 1T24A 1QYIA 2Q2WA 1UJBA 3M6VA 3N7TA 4Q1EA 3G2IA 3MSXA 4E14A 5BW5A 1AVTA 1Y3HA 4E2XA 3KHTA 1WETA 1PZEA 3EMVA 2CLMB 3LLCA 3G6XA 3VZCA 2OA0A 2W8LA 2PMZE 2H9IA 5JO9A 1QV6A 1CUAA 2BGMA 3UMJA 4QWEA 4KODA 1WXFA 2LTAA 4KB5A 2PWBA 4RH0A 5F2KA 2PAAA 1Z4OA 4CDNA 5JCPA 2C4NA 4JWKA 1EAMA 3HKZA 4MUNA 4UPEA 3SC4A 2HU8A 5BWBA 1FYVA 4KX5A 1KYQA 1MZBA 4BFUA 4AYWA 4CIYA 2Q6LA 3JTEA 4ABTA 4D9FA 4TMYA 1QX3A 3U7FB 5J9FA 4YO7A 3JALA 5FIUA 3S2UA 2YYYA 2OAEA 1I2CA 5LJLA 3CUKA 3PEYA 1E4FT 3FJOA 2RGCA 2WTAA 2P8SA 4AO7A 3VNUA 2ERXA 3I4CA 4ZOEA 4TXJA 3V1UA 1ZIXA 3HCFA 3IBGA 1P1RA 4C2MA 3MAJA 4WVLA 4BB0A 1I4OA 3K09A 3ADDA 3DT8A 3AV3A 2LUOA 3EG9B 1J5PA 3JQ9C 1UJ2A 3JD3A 2J0VA 2C2WA 2A9QA 2WSSD 3G5MA 3GRVA 3H18A 4J2HA 3W5BA 1VHLA 4Q44A 3AFOA 4IHAA 5E1DA 1EXNA 1LGYA 1SUPA 1P9RA 4TWBA 3D7LA 5BNTA 4IZ6A 1QIEA 2Q0QA 3L0BA 1KI6B 2AJTA 3S40A 4PTLA 3LDHA 3OIDA 1ORRA 4O3NA 1BCSA 1M66A 5K03A 4EVIA 3D6NB 1CY2A 1D3AA 1IB0A 1BMQA 1YK1A 2ILTA 4Q4CA 3AC0A 4WY8A 5AKZA 3ZV7A 4BP9A 5JC8A 4O02B 1P1IA 2EWMA 3EQ6A 5FOUA 5H4HA 4F6CA 3W5VA 2MDTA 3OZVA 1VSTA 1EFHA 4H1UA 3RJ9A 3MR5A 3GLQA 3WGTA 3D4NA 4DHWA 2QE6A 1GLGA 4DV2B 2C8LA 4B3TH 5LQUA 1VKHA 2UDPA 4KQMA 4WKPA 5K0JA 5FUXA 3X1XA 4K6FA 2HMWA 4JI7H 3JQ9A 2ICAA 3L4EA 2FQQA 2MINB 2P2LA 3I6BA 3X1YA 5FWYA 5K8LA 3P2IA 3TXXA 1U28C 4LC0A 3PJFA 1XLUA 1KVTA 2BDUA 3V1YA 3QMMA 2WOJA 3U7QA 4MKHA 2EV9A 4IS2A 3SYRA 4J29A 2IRWA 3QEBZ 1YBMA 3O3MB 3KE9A 3SQDA 3VYSB 1FDRA 2X8BA 4LF8B 3HDHA 4M86A 1DWUA 4S2EA 1N6PA 1JWLA 3GGDA 4QTTB 1K66A 1TK9A 4JJKA 4PGAA 5DMXA 3LWBA 1CERA 2FW8A 2WIJA 3IAXA 2OZLA 4LZLA 1SBHA 1SVMA 4OFWA 5LZ8A 4ZO8A 2YCBA 2VI5A 1SN7A 3PPVA 3NDPA 4C5CA 1FMLA 1XSEA 2D1RA 1ODSA 4RZQA 4FDMA 3FTCA 1E0SA 3CCCA 4I8XA 4MSUA 4LVNA 1U1GA 4BB6A 2ZSFA 4B3CA 3G0DA 2IODA 4PN3A 5CE8A 5LBTA 2R8YA 4B3JA 1EE1A 1KI4A 4I3HA 5CVJA 2OM2A 1LU9A 3EA5A 1YQDA 1QAOA 3N8IA 4B48A 1NQOA 2WLSA 3G79A 1C30B 2IXAA 2AD5A 1KBLA 5JFOA 2F3PA 3RRYA 1KQPA 3PQ8A 1RHUA 3NO4A 3R0QA 4AG5A 3GMDA 3CZ9A 1N2XA 2Q1UA 1LLDA 5BWUA 1JNYA 4R1LA 3KJXA 4H15A 2WSBA 3O8OA 4BTEA 4HLCA 2J87A 4YRNA 1U1IA 2IHTA 3C70A 5IAEA 1M2VB 3AFGA 2GLTA 1A5TA 1E77A 2IXDA 3TQFA 2ZS8A 5T6BA 1CS0B 5JQGA 1QG2A 1KVUA 3GDWA 1C0IA 3T7TA 5IP9G 2BQRA 3S6JA 1N33B 1PR4A 3PJDA 1S8FA 4TMKA 3S5JA 1BIFA 4KAJA 3MOGA 5KFFA 2NXWA 2FSIA 1MA0A 2H3EA 2VJDA 3HB7A 4J0GA 3W5SA 3WB9A 1WMDA 4B33A 4EPVA 1JHMA 1J2UA 3KKMA 3DG9A 3EH1A 1KQNA 4BVLA 1P9LA 4CMEC 5JZMA 1YS7A 1WCMA 2ZK7A 3KQWA 4IDHA 4UFPA 4DJDC 4H6WA 3L0DA 4TWAA 1FQWA 1G55A 5LDGA 4C3OB 2QM3A 2EKLA 2GPTA 3BD9A 3DSRA 2ZDGA 1CR6A 2JRCA 1SZCA 4WLNA 3B36A 1FMTA 3PUIA 1IHUA 5AKYA 4QDKA 1KOGA 2CUKA 2FZEA 4BHTA 3OFSA 3IX7A 3VGJA 2I62A 3QFCA 4QT0A 3WGNA 3ZWCA 2FMIA 5FEUA 1NN1A 3UHOA 3CEHA 1PNRA 1HT3A 5EWLA 4U7WA 1TK3A 4KO8A 5HF9A 4EGAA 1Y8CA 2OM6A 2C9CA 2PKQP 2WR8A 4I6EA 5KTKA 2VDVE 4L75A 1WXEA 4JYMA 3A2LA 1KEZA 5EZ6B 2PKXA 5HUHA 4YRTA 1VIDA 1L5HB 3AQ4A 3KTDA 2P35A 3CNNA 1JEAA 4JVLA 1NSTA 3H86A 4JBGA 3ANYB 1X1BA 2MR5A 1USVA 2OHHA 3A04A 3MN1A 5EEHA 2ZATA 4CM8B 1P4GA 1BOFA 2Q1XA 1LLFA 4KW7A 4PC2A 1M6HA 3EPJA 2RHLA 5EIBC 4Z0PA 2OD7A 3NDBB 2K2WA 1SULA 4LHVA 1ISIA 2BEUB 2Q0HA 2DUMA 4M89A 5KYUA 1H2YA 1H3NA 2Q62A 5K3OA 1KFBB 1O87A 3HKCA 3VTAA 1U1DA 1V8PA 2DT5A 3AY3A 5L51A 1KA9H 2NZ8A 4HBZA 4WQMA 1KT8A 4CKYA 1A50B 4OI2A 4CR7A 5JDCA 3N58A 1JALA 1MV8A 2BZ1A 4PEVA 4MUEA 4PO1A 4H1WA 2O1EA 3WYNA 2XB2A 5A03A 2EL9A 4YRZA 2ODAA 2YCHA 2GBLA 4QO8A 1C1DA 1UAGA 4ZHQF 4COKA 4Q19A 3BH7A 5JNTA 1UMDA 3AR2A 4E88A 2JFPA 3GLHE 4HNQA 1SXJD 1Q15A 3G9QA 2NO4A 3AUFA 3BQNB 4F3RA 1QNLA 1NC1A 3KTMA 4UCVA 1W94A 2X5KO 1HEYA 3ET4A 4BEVA 3QEKA 4O4JA 2ZUFA 2OZVA 3HJTA 4DJFC 4B85A 4PFJA 2H4ZA 4RKEA 2YL2A 2G1AA 4UCFA 3MT8A 1ZK4A 2GOYA 3HOWG 2KM1A 2RG7A 5DM2A 5IM4A 2QP3A 3FVRA 1Z7BA 1ST2A 1KJYA 2B1JA 2QAJA 5A71A 4YBZB 1FFXB 2VUUA 2ENUA 4ROTA 5GM2A 2AKEA 2UVRA 3WIBA 4BX2A 3K70D 4MLDA 4S1TA 1NNEA 4U8GA 4EYIB 3B48A 4JCOA 3T4UA 5C8YF 5AI5A 3V42A 2WILA 2D1TA 4IRDA 2E4YA 2B4YA 3O1JC 1NDHA 3K0EA 3T1YB 1A0GA 5ER9A 1ISRA 2BGNA 1OCEA 1OXUA 5JASA 3RQSA 5KG1A 1F12A 3KHLA 2UVPA 1NW5A 3G17A 4WFIA 2DABA 2DQYA 2QTGA 3LLSA 4EQ6A 5AKEA 5GOZA 1DKOA 4H4EA 5D1OA 4FI3C 2GZ2A 3OMLA 4KMMA 1K8QA 1BRMA 2B2XA 2HK6A 2X4IA 3EQZA 5HBRA 3AW9A 3UCXA 2DHDA 3WYGA 1ODLA 5G40A 2OFWA 3RJ5A 1BEUB 1SC9A 3E3NA 3HCWA 3UNXA 4QPDA 2JFHA 4HK4A 5SZKB 4D9BA 4LYJA 3RUDA 5LQDA 4MNTA 2B8EA 3M9XA 4W5WA 4ED9A 4OGFA 4EARA 4H16A 4HRAA 2ZRQA 4JI4B 4L7VA 1J7KA 5AKIA 3NBZC 1CVRA 3C6QA 2OBXA 4OJYA 3LP8A 1G0NA 2CXPA 3ZQUA 2BFAA 3MXTA 4P22A 1J0EA 1TVCA 1U5AA 3BMQA 3VPXA 3T12A 1JJBA 4R2JA 1MB9A 1K1SA 1U7ZA 4DZTA 4MGIR 2YCLA 5ALTA 2IZ1A 5EOVA 3H1FA 1W29A 3ML1A 3TAXA 1UZNA 1EM8A 2QG4A 1L4BA 2YJTD 1H1DA 1QHXA 3Q7IA 2XXAA 1E1CB 2DTEA 1B7GO 4L3VA 3F9CA 4LWZA 4IJWA 1YL5A 4KRFA 2GGSA 4L5IA 2I9KA 2R79A 1WMSA 1I2BA 2PRYA 4B3DA 5KFDA 4J9RA 3Q98A 3D2AA 3VSDA 4ESEA 1PG2A 3FCXA 3HRHA 2HMTA 4GYJA 3WNCA 2FK2A 4AY5A 4BLUA 2BC9A 2EKQA 1P29A 3TZQA 3BAAA 1OMOA 4J7CA 2PD6A 1KP2A 3KOXA 4PX9A 4TLMB 4E70A 4R40A 3MBKA 3MCUA 1IRIA 2H11A 4ZQBA 3E5NA 5KKAA 1XCOA 2B30A 1F2UB 2HDHA 1U11A 2WU1A 1JDPA 1RLUA 3W3AD 5CFQA 1RBYA 1E0KA 2UXDH 4PBRA 4TXMA 2FAXA 3O9VA 1I14A 3H1EA 4A3LG 4MYDA 2YXEA 4O4LB 1DQRA 1THMA 3E9NA 1TFUA 1Y6RA 1HMYA 2BEWA 2O3QA 2WUGA 3DOHA 3QEOA 1P44A 5CCEA 1WZNA 1YB7A 2EGHA 2NWQA 3CWQA 3PYLA 3PKIA 4GMGA 4NLLA 4EIWA 4LPSA 1XLWA 3JQCA 4DKJA 3VJRA 4CKXA 2RHHA 1U4SA 4DA0A 3E5HA 5CIYA 4UM9D 1QR2A 4OK3A 5KTRA 4ND2A 3E18A 3UK2A 4OHKA 4RV4A 5LIPA 3CB4A 3V3TA 1SHTX 2JCGA 2IEIA 2ZKLA 4WCFC 1SURA 1MGPA 4XFKA 5SZHB 4QKQA 4JBIA 1RZRA 4LVUA 2HMSA 2D3WA 1JE0A 1GPAA 4KWIA 1NPDA 2WA2A 2V03A 4NXNH 4PO9A 1E3DA 4RDIA 2H7VA 3PNPA 3UAWA 4OMFG 3ZY3A 2OO5C 1TYEB 3ETDA 4HQ6A 1X7DA 2DG2A 1FDVA 2OBMA 1U7HA 3VR6D 3MIIA 1Y9ZA 2C5AA 3BVPA 4NZOA 2FN7A 1BGWA 1NTRA 1DEXA 3C3JA 3KXLA 2YW2A 1HNWB 2ZIVB 3KJIA 4BNZA 5C18A 1UH5A 3OECA 3NHJA 4UE2A 4MKXA 1R12A 3HU5A 2H9YA 4KIGA 2NAPA 4N65A 3TZEA 4MO2A 4HPJB 1EXDA 4RZRA 4OFZA 2I4LA 1BDIA 4G41A 1UWCA 4RXTA 2XB4A 3ZWAA 3IQEA 3C85A 3C48A 1NMXA 4TRNA 1NF2A 3GPBA 1P2GA 3GMSA 4CF5A 1GT6A 5LU8A 2OYSA 1XKQA 3QF4B 1WRBA 3UMVA 2Y77A 4H0NA 3RROA 4NBTA 4KJZA 3ZDFA 3LQ2A 1RYSA 4M1KA 3DS8A 2A5GA 3GTQA 3ROZA 3PC7A 3QIVA 4RGQA 4C78A 4CM3A 4K0KB 4EVRA 3ZZ1A 5EWMB 1F3LA 2WTMA 4JLBA 2BP7A 3LKZA 3GAMA 1M1XB 4X8MA 1KO7A 4ODIA 1V6AA 4ZPXA 5EHNA 2ESRA 2DXIA 3JYLA 1H23A 1CY7A 1GXSB 1HQKA 1R0XA 2PGOA 3DBIA 3ONEA 3PDHA 4O4IB 1QFJA 1CUEA 2ADFA 3LE8A 3P96A 4E12A 2H1OA 3G0OA 4D0LB 1U3VA 2RBKA 1JDBB 1H6AA 4G5QA 1L0BA 4BY7G 1T5HX 2LDBA 3JATA 3UWSA 4XWYA 1IJBA 3Q3VA 1PR3A 5DEOA 1YCFA 3HKCB 1UDAA 4L9WA 3B9BA 4RQUA 3N0WA 1O94D 2Y71A 4B9EA 3A0RB 2RK4A 1Y5RA 3DFFA 3DWIA 4O2RA 4S1OA 2CCJA 4L72A 2V8OA 1MB2A 1RQ7A 4UCSA 3K2IA 5GPBA 3UA4A 4DCPA 4F4WA 3WLAA 4PYLA 4RDHA 4Z0HO 3HO6A 4L08A 5ALXA 2AG5A 4EI8A 3AKDA 2VAXA 3I6IA 1YBAA 4R9NA 1II8B 2EX1A 4B6EA 1TM7E 3R6TA 4PYQA 3TKLA 2BW0A 2X3UA 2GX6A 3KLBA 4MRMA 4EFNA 4FB5A 4AP6A 1FJXA 1QCDA 5H9WA 4KQ9A 2DLDA 3FPGA 1E2MA 4OH7A 1KY5A 4KXFB 3E1GA 5GV8A 2O57A 3IESA 2HAEA 4NESA 1YZNA 2HVRA 5DJ5A 1RMQA 1UOEA 4EGQA 2NNLD 3Q7PA 1TQ6A 2J3QA 2PKRA 1ZCJA 4HZGA 5KNDD 1E8MA 2MSEB 3GJYA 3NS7A 1XEWY 4QW9A 2PFSA 2WYUA 4OYLA 4U2GA 4BFTA 1K63A 4OI0A 2YN0A 4QQFA 4GLWA 2ZB7A 1EZZA 3A26A 4HGOA 4BE9A 5KQLA 2WTXA 1VFNA 3OJWA 1WKBA 4Q4JA 3BREA 3Q9NA 1Y42X 1NY6A 1IBSA 1U1FA 1Z6AA 2GZHA 3ZCTA 4I9UA 2W7OA 1BFUA 4NX2A 3L82B 5CYPA 4G3IA 1XRLA 5HDQA 4GZ5A 5MHTA 4B2LA 4O4LA 1CRQA 3BXGA 2FSSA 2PS3A 3GUCA 3HYTA 3OY7A 4QTXA 1E61A 2PM8A 2WKWA 1CQZA 1V8OA 3P5BA 4JP5A 4JVSB 4L76A 4Z49A 2G5PA 2AI1A 4D4LA 3O8LA 4L3WA 1WQ4A 4OQXA 5K6AA 3O95A 5B36A 1UP7A 4RD1A 3UZUA 2O59A 1NMZA 1A8HA 1Q2XA 1KKLA 2WWRA 3SHTA 5HKKD 5IPFA 2ZYRA 1S03G 2PU5A 4FEGA 4B4OA 3COPA 4Y7DA 4WK2B 3MAAC 4O29A 2AC4A 1U0EA 2Q3HA 2W4QA 3QX7A 3SC3A 1PGPA 1V95A 1HYBA 4DV0B 1MW8X 1DHTA 2X0RA 2BE7A 4Z3OA 2C94A 3OIVA 3T3MB 3KK0A 4JT4A 1TAEA 5LYJF 4MITA 2JAHA 4EI7A 3H4MA 3NHUA 4DSAA 3PFGA 4IFTA 2J41A 1KJIA 1E1DA 2AQKA 1DJOA 2ZI9A 3TIIA 1AIPA 3RC1A 3NBZB 4I5IA 3HLKA 4HNSA 5JOQA 5LDHA 3DCNA 2BSQA 1MA3A 1Y1TA 3G6KA 2YQZA 3AF6A 1ULHA 3ICCA 1SPXA 3DB1A 4Q37A 4C2TA 5T3YA 1TYDE 4F2HA 2FSVC 2RJNA 5CEJA 4ANFA 1ESMA 1LV8A 4BMZA 4M1TA 1MF7A 2GYUA 1W2HA 4N7JA 4O2BB 2A6PA 3CONA 3NHZA 3SYNA 3VU3A 4Y9RA 4U0JA 1E1KA 3O94A 3QFRA 3ETCA 4IMJB 1VKNA 4MRRA 2FJ0A 1PQPA 3DHVA 5JYEA 3A2MA 2P41A 1F0PA 1COWD 5CVCA 4NFYA 4A2QA 1T9GS 1ETHA 4F6RB 1RYBA 3RB8A 3TIGA 3O93A 4RJTA 5K0GA 1K5PA 5J2TB 1JHVA 4PQRA 5ECGC 3TW0A 2HLPA 2JLRA 3C7KA 3G5TA 1O97C 3SSOA 3T0GA 3WWOA 1CQWA 4EEKA 3M34A 4DYDA 1DTSA 4UU7A 3WGOA 5KOJB 4HUTA 3K6SA 4RJKA 3MUOA 3R0XA 5EZ5A 2XGJA 4LXTA 3LPCA 2P5YA 2JEYA 1D0SA 3C5WP 3CRZA 4QRIA 4D9JA 2DFLA 5F98A 4K6CA 2J30A 1G4AE 2PGJA 2HCRA 1XN4A 3I8SA 4LV8B 4MS1B 1JBQA 2I66A 4O1MA 4PS1A 4BUJA 1BHSA 1M1NB 2J3JA 2WK1A 4IR1A 4QUEA 4Z0NA 3HSSA 2WUDA 3RFTA 5NULA 2QXYA 5SYAA 3OHBA 1GKYA 5KG3A 1LFAA 1SXIA 1T0PA 3I1IA 3BSWA 3NB0A 4HP8A 5J1TB 2ZCVA 4HNAA 4JXZA 1WUYA 3ANLA 1LF5A 3LVQE 4HATA 4X65H 5FHRA 4EZBA 3D6MA 1GR1A 4MPJA 3LHDA 4GG1A 1UWLA 1I8TA 2ATCA 3EFHA 2ZWMA 3I73A 1EVKA 1U2GC 1P8LA 1EFTA 1GRVA 1XV5A 1NZFA 4QU5A 4GR9A 4JJEA 3TZ6A 4O84A 1XCPA 1X1QA 3F49S 2G83A 2VTBB 1VYTA 4ND5A 4F0JA 4DXHA 2WM3A 4UEQA 1KOLA 1F7VA 3QH4A 4D92A 1RLJA 1RXSA 3DB2A 3CNLA 4S35A 4CMIB 2ZYIA 2UYHA 3BWVA 4C6TB 5KFRA 4B6FA 5JJKA 2XQKA 1L7EA 2JGLA 1NATA 2O2IA 1GAWA 3VNBA 2DE0X 1NSYA 2P9YA 1LPMA 2H2GA 2MIIA 3HN7A 4AJHA 4UQPA 1L4HA 1H4TA 2VHZA 2E4ZA 1M10A 1NV8A 1NUHA 1GCGA 3HB9A 1KZ1A 2N46A 3OX4A 4V0OA 1J7JA 4MUMA 5C8VA 4MINA 4EQ5A 5AJVB 4F1KA 4R8LA 3VSAA 4BAGA 1QZZA 1ZOLA 2W2PA 2AQIA 4XAQA 3T6KA 3ZU5A 5CBPA 1UXKA 4YJGB 3QKWA 1B0UA 2VJLA 2WHQA 4L15A 2V7PA 2VPWA 4NBKA 3OJCA 4QELA 2WB2A 1HL7A 3NVAA 4F2PA 1E92A 2GEUA 5CVVA 3F8NA 4F60A 4ZI5A 4CKWB 1ESCA 4A15A 2XCAA 2VHXA 3K7EA 2HVQA 1Y98A 2DHRA 1ZI9A 1EQAA 1Q2UA 4DKXA 1NW8A 4AX4A 4LVCA 1NXWA 4OM7A 2XNHA 1LW7A 2IX9A 2Q4EA 3QSYA 4OKIA 1C9JA 4G0YA 2XEDA 1TTHA 5E7QA 1A4XA 1GXSA 3WWHA 2QYHA 3ORSA 2ZSBA 4O63O 1L7PA 1ONNA 1R6BX 1O9GA 1NMQA 2J09A 2HYIC 1EP2B 4MS4A 2D7DA 1TEHA 3DZ8A 2CCKA 3UV6A 4DSNA 1QH9A 3A25A 5BN4A 4FMBB 5JZSA 4LRTB 1U65A 2A5YB 2VP5A 3V8VA 5K09A 1MIHA 4D8TA 2RGGA 4O4JF 4FHDA 1HKUA 1PP4A 3BWEA 3D4OA 2BI4A 4FQ8A 4PAMA 1TLTA 2ZM6B 4GGOA 1E7SA 1H4VB 4GM4A 4KMOA 4G8DA 4X9XA 1CJCA 3W1WA 3CQZA 1CKEA 5EDWA 5C1DA 2GILA 4JLVA 5KX5F 5AHWA 1I7DA 3IVRA 1AKRA 4ZCTA 3ZQ4A 1CUDA 2PIAA 4E51A 1RXUA 3LYAA 3LV8A 5ULLA 3RLIA 4RVSA 2ZT6A 3WNZA 1S1CA 3IVCA 1KAQA 1SOAA 4P84A 4WOBA 4BLWA 4QSHA 3LX4A 2BH2A 4H3HB 1QFMA 3CZRA 2EKDA 3WC4A 2BFFB 2D13A 5CT8A 2V7UA 3AGQA 5DVZA 5F5LA 1O08A 4H3KB 2WMDA 1X7XA 1YBHA 3IRUA 1I5OA 1Z6ZA 1SCUA 2OBYA 4XR9A 2W2LD 5AKLA 1YQXA 3C3MA 3DGFC 4ZXPA 5IJ0B 3IDZA 4DCVA 4OQFA 3WQQA 2BFBB 3D1JA 5FRDA 3GLVA 4H9GA 2BTQB 2NSDA 2HHHH 3FXAA 5CH8A 2L0XA 4JB0A 4NBRA 4B6OA 2FP4A 5CB6A 1T8TA 1GADO 3E9MA 3FI9A 1SRRA 1TA8A 4NP6A 3TLJA 2NSLA 3G2LA 3L7NA 4UW9A 4O7SA 4MPRA 5BRJA 4S12A 1R8JA 2NP6A 2VSOA 3TX2A 1FUYB 4D0SA 1TC1A 4N9QA 4EUKA 3Q7TA 4P36A 4AX8A 4II2A 3ZDAA 5IC5A 2P9EA 2VXCA 2FMUA 3PHLA 3JAMW 3BZBA 3KVNA 4P08A 4X3OA 2W57A 1UXHA 4L6AA 3V4OA 4B6RA 2H57A 2VDMB 4HZUA 3VFDA 3QP9A 5JJ5A 5SICE 3UENA 4IX9A 4LDQA 3KT8A 3WB2A 1WP9A 4ETMA 2X7HA 1G3IA 3DH0A 3UGTA 2Q9CA 4DFDA 4QC2A 1XDBA 4JV1A 3HDGA 1QHNA 2L42A 2Q5EA 2W00A 4L9SA 2EBUA 1TX4B 1JLMA 4O4LF 3CUVA 3DDSA 1AMOA 2C3MA 3B38A 1O0SA 1Q1EA 4PO3X 1K89A 2W6JD 4ZYLA 1T3SA 1IEXA 2KQUA 4L9RA 4KNVA 1U0HC 3GEGA 1DC5A 2CFCA 4EUNA 4MAMA 2FXVA 4RPGA 3UWMA 2NTJA 2DZDA 4H27A 5H83A 4EFMA 5DXJA 5EWGA 2PWZA 2YOHA 3U26A 4O7VA 1DAPA 2H52A 3KVYA 1JUDA 2WOOA 1VE3A 3DFMA 4TMXA 1ACMA 3AKCA 4WFJA 5G41A 3RVNA 5KU7A 4JL8A 2Q6TA 1SCJA 4DCSA 5GGYA 4DQVA 4J6FA 4II3A 4F92B 1LV7A 3WE7A 1G8JA 4U0KA 4Q4DA 3CQ9A 4E1AA 3QA9A 3CVUA 3T5LA 4N7BA 3OTIA 1R4MB 1MPTA 3CGGA 2FWBA 3LBHA 3ZPXA 1J39A 1H0HA 1U2DC 2AL7A 3LF2A 3RFVA 3H5LA 4UBOA 4O5AA 4RZUA 2AKAB 4X61A 4O2BA 5TY0A 1DJPA 3QW2A 1TEVA 4UNIA 5FI0B 5FOTA 5LA6F 3DKKA 1D2NA 3ZS8A 1PV2A 5B7GA 4WKBA 3MINA 3ZWVA 4BO9A 1KH2A 1JDBC 2OESA 4JI6H 2YR0A 4DMUB 1V3TA 4S1WA 2A9OA 4MJ3A 1TM3E 3JV7A 1N56A 4M0LA 1YZLA 3I62A 4LXYA 4ISCA 4RH1A 2VH2A 4A0GA 2L2QA 1XJQA 4TRJA 2CUZA 3DWGA 1O3YA 1ZIYA 4DLWA 4P6VF 1Y6GA 1UBRS 2J6SA 1Z5PA 4DY4A 2EJ2A 1SU7A 4MO9A 1QO0D 1A5AB 1P39A 4RC9A 5EKXA 3INTA 1NU8A 5B3JA 5IM5A 4AVYA 3AB7A 1FSPA 1Z83A 2C7QA 2UZ0A 2BF4A 3EOBI 1DAFA 4R3NA 3SLKA 3MTDA 4KREA 3D8UA 2XDYA 2NU7B 1FS6A 3NORA 1LRLA 1H2WA 4WUVA 2G77B 4TSFD 3IQFA 3LY8A 4ARAA 4IJ5A 5D86A 1CY1A 3AJ8A 1W6UA 2DERA 5H59A 1KVQA 3LC7O 4WKNA 3KHGA 1D0VA 1E8NA 4W9MC 2JATA 1J2EA 1Q95A 1L1EA 3GNSA 3K96A 2EOAA 1J1IA 4FJ0A 5JCXA 4HNVA 1RPAA 1PL7A 3RYTC 1TD9A 3GBPA 2V6FA 2ACEA 4XJXA 1U8YA 2AYZA 4F4HA 1TZBA 2LE0A 3ZLTA 3OZSA 2AMYA 2R8KA 2Y4OA 4LDPA 5EGNA 4GC5A 3RAXA 1OB5A 1Z6QA 2E7ZA 1NVUQ 2JB9A 4TTAA 2FPIB 3TLAA 3R23A 3E82A 4CGZA 3A1CA 3ZCVA 4FSXA 2QRLA 1NUQA 4LI0A 4FOTA 3IUNA 2BI8A 4OATA 4FONA 2CLHB 2ZKIA 2AZ4A 4CMDA 4OX9H 3ESBA 4I5FA 1P4HA 4CT5A 3EISA 3S5UA 3D7SA 3WV5A 4ZD6A 3N2YA 4KQEA 1XJCA 2HWYA 5IC6A 1NVGA 1GGHA 1ORIA 1HLPA 1NUUA 3IG0A 1QC5B 2WJ3A 2YDXA 4GOLD 4U5XA 1X80B 2F3UA 4PZ8A 4UEKA 5ALKA 5DH9A 2O0MA 3SIRA 3T3PB 4WJLA 3AEQB 1NYLA 3S3TA 4EFLA 3AVYA 2PBRA 3GC6A 2XWBF 4R01A 4MV5A 3TOVA 4WK4B 2DHCA 1AS0A 4QOHA 1ZW1A 2OBNA 4YP0A 3DFUA 1NBOA 3LXRA 4ASUA 3ZDDA 1B2LA 2POQX 2YZGA 3NX4A 5LMUB 3VNVA 1SYXB 1ZCZA 5CNKA 2XZLA 1N2HA 5HR5A 3D3KA 4TQUS 1LPPA 4HZUB 4A8HA 2WZBA 1XU4A 1FDUA 2PFGA 2WYIA 3TEFA 5JEDA 3U9SA 4HB3A 5A9SA 4P0TA 4Y9DA 3WFJA 4FDUA 1U2RA 1QIIA 4TMFA 3WHIA 5JUMA 1VMKA 4BX9A 2IYUA 4IDBA 3WBKA 5IKOA 1ODTC 3M4XA 1FNNA 4KU4A 2VNIA 3F73A 3TLGA 5HUQA 4JIMA 1TF5A 4TN5A 3D2BA 5HQJA 5JNVA 2VNHA 1UMBB 3PUHA 3KQSA 4LJSA 3VH2A 2DBYA 3BABA 2ZRAA 4C05A 3BFJA 4IILA 3BIWA 2QVYX 5IJ9A 1P60A 2ZRMA 3U4CA 1OYOA 5JZBA 5BWXA 1M8FA 1NW6A 3TY9A 4G4GA 2ETXA 2ZJ3A 4Q93A 2PEZA 5D1NA 4QG3A 2WJPA 3O4VA 4PCUA 5IWCA 5I5SA 2IU4A 1EWTA 1T6YA 1LBSA 3OE4A 3BSYA 4IEFB 5E8JA 5E7MA 4TLCA 3VM6A 3ZHQA 1K7FB 3O4JA 4NDZA 3W6NA 4M4SA 1GKUB 1CBUA 3DTVD 2WMYA 2XKAA 5CVUA 3JYPA 1NJSA 1DAEA 3F90A 2VDRB 3DHNA 3KPVA 1E7WA 5UKDA 1EWRA 1X7GA 4MPTA 2IEZA 5TGZA 4BNMA 1X0VA 3EIFA 2VJKA 5F77A 4YQEA 5TPWB 5IKEA 1HOXA 5KYXA 2PX5A 2IOYA 5F1YA 1EX6A 2ET6A 5BV7A 4D3FA 4ZT7A 1AQUA 4R6WA 2CXNA 1W581 4CR6A 3BFPA 2JIBA 2QRGA 2ZSKA 4FW9A 3SQNA 1YJQA 2O2GA 1J0DA 5BW4A 2QV7A 3A1VA 3I01M 4XM1A 5EZYF 3MLEA 4L85A 3VKFA 2DP4E 3DL2A 5TJHA 4LE1A 1R6TA 1HE4A 3L1JA 3TW4A 1A4UA 5DEIA 5FFFA 5DI3B 3I0NA 2O54A 1IN6A 1KWGA 2BYTA 3U3OA 2C9MA 2XKBA 2I65A 5I5UA 1GUZA 4GP9A 1RVDA 2PUBA 4RHTA 2XOKD 4ZYZA 1SU4A 5C4MA 1YRYE 4D8VA 1MJGA 1I1HA 4PHFA 1SHUX 2WWIA 1A7KA 1P5RA 1E94E 3TL2A 4LF9B 2O2SA 2FJZA 1T8UA 3CIOA 5E3HA 1PTKA 4A5OA 3BQ0A 1I13A 3DGEC 3N6XA 3UW3A 3KJGA 1HBJA 5C7OO 2JFQA 1UUFA 2M6SA 1RWVA 4IGFA 4FN5A 2OQ2A 1RWXA 2N47A 1Y8RA 3T7CA 1Q0ZA 1DKUA 1NFQA 3QEMA 3QFSA 4Z7QB 5BV8A 3ZHVA 5BSKA 3L4JA 3K5IA 4MDYA 2C9ZA 2Z2XA 3PEFA 4KN9S 3VNNA 4Z4QA 2OORC 2OLEA 1B74A 4KWCA 2VG8A 2N3ZA 4LCJA 5BN1A 2DETA 1FU8A 5DGHA 2M6RA 2CV2A 5FR2A 2FX3A 3JQAA 5CNIA 1T36B 5ALMA 2WFLA 4YV0A 5ITSA 5LP6F 3E8MA 1R6AA 4UCXA 4R0VA 2DUNA 1MUUA 4O3SA 3CLTC 5AM0A 2ZPTX 5KCZA 3ZU6A 4DY6A 1WSCA 3AEKA 3H7AA 4DL9A 3NM4A 2PZ8A 1Z82A 3JSNA 4NARA 4RK0A 4PVDA 4RIIA 5FR1A 2DPJA 2ZB3A 3U4QA 4QJ3A 4FEEA 3CCFA 4P54A 5F4ZA 3FSGA 1O9HA 1NVAA 2C35B 1V96A 2FZVA 1WU8A 2RHCA 4P3PA 4MB0A 5CH5A 3B89A 4JJ7A 5ILGA 3HHEA 3H11B 3IJRA 4J90A 3ELDA 3KETA 3KX2A 1KPHA 3GD7A 3ZD8A 3K30A 2XPCA 5L3RA 1U8ZA 3GJQA 4RWZA 4X6XA 3TO5A 1A1SA 1FZTA 1CUJA 2HA0A 2UYOA 3MMSA 1V1RB 4OB6A 3ER6A 1J2YA 4GT1A 4A3CG 1QVAA 4YFYA 2FETA 2LXNA 1E4EB 1E9SA 4PZYA 1WDMA 2HXSA 1U7PA 1YAJA 5DOZA 4PPQA 5J2UB 3M82A 3P94A 2JI8A 2FFQA 4D5EA 1DDGA 5BQPA 2VAWA 1B1CA 3H2YA 4JSRA 2GK7A 5FI5A 3RNLA 2P1DA 5E95A 1S7CA 4YROA 3RAJA 4BVAA 4I4LA 1R15A 2JK1A 3UJ8A 3GEIA 1W4AA 1XDZA 1AHNA 3PCXA 4HDRB 4TKVB 3PFKA 1FNCA 3VDXA 4E13A 1N5MA 4MUKA 4TTTS 4ZEMA 1P3Y1 3DFKA 4DMGA 2GCEA 1VJGA 1Y89A 1R1DA 4U7FA 3QPVA 2Y9MB 3IV9A 5I48A 3P0EA 5C5IA 4ZVUA 5DLFA 5SYNA 1SUAA 1JR2A 3GBVA 5FPQA 1CULC 2BEKA 3U7QB 1ZVQA 4QYIA 1RJPA 3RGXA 3OZGA 4P80A 1H0SA 5FT9A 1YT5A 2JCVA 1E89A 2R4QA 5DYWA 3SM9A 1HORA 1VBMA 2B25A 2VH1A 5B37A 1UBKS 5DM60 4WD3A 3DUFB 4O3RA 3AY7A 4PLPA 1JTVA 4X65B 3KYIB 1W2WB 4G36A 4L8VA 4W1PA 2XTZA 3W06A 3RU2A 4JI2H 2O20A 1VMIA 3KKLA 2P9HA 3HP1A 4MDHA 2GRAA 3B5EA 3LUFA 3PNLA 1TL7C 1WU7A 1ABEA 2EFDB 1E0AA 2AVNA 2GEBA 3X1KA 1WRVA 1E2DA 1ENYA 2E5WA 2SCUA 3G6VA 1J0CA 2Z1DA 3OOYA 3TQHA 5K8CA 2ZDQA 3EPLA 2QKYA 1F8YA 2C5BA 5FOQA 2ATEA 3ZDCA 1IZ8A 4RB1A 1S9HA 2AW3A 4TGLA 5F12A 3FHCB 4UZEA 2PS1A 1OFUX 4MI6A 3VA7A 2JZCA 4QVKA 1Z38A 1QTQA 3SVLA 2A5DA 1C30A 3V4LA 3ZS9A 1YDHA 5FUBA 5CA0B 1PAUA 4LKRA 5BN5B 2VHYA 2JIQA 2MT9A 3TB4A 4G2TA 1RYYA 3O26A 3DAFA 3ITDA 3ESRA 4CN9A 2H7CA 1QLWA 3G8YA 3NOXA 5FBKA 4JUBA 1PE0A 3DTYA 1VMEA 4AYTA 1JIKA 1X9HA 2P9GA 2IYYA 4TKUA 5TJ9A 1JR3D 2GXUA 3OX2A 3QYAA 5LJIA 1CHDA 4HBGA 4KNWA 1U0NA 1T0JB 3HC7A 1PR2A 2H00A 1YE3A 3HB1A 1D2AA 3LQRA 4C7BA 2HV9A 1PJSA 3LHIA 1H22A 3GFVA 2UUOA 5EKTA 4PLCA 1X2BA 2PH7A 2PZFA 7GPBA 1UJ6A 1JJAA 1XZLA 3OLQA 4XDZA 1RYDA 3VDRA 1XWIA 2WA1A 4RTPA 4D9CA 4YCNA 4DV6B 1GTMA 3TE6A 4IF6A 3FMAA 1DAIA 3Q0TA 4UPVA 2O8DA 1V8ZA 3GDFA 4L74A 2FWNA 2R751 2WJWA 2O06A 2FZ5A 2BHSA 3MWDA 2H8GA 2YV4A 4WUTA 5AW2A 5M7EA 1YZVA 4F4YA 1AGNA 2GDJA 3JQEA 2V98A 2OK8A 3O3CA 4QXPA 4W7IA 5H1YA 4ENSA 1BDHA 1ZUIA 4UAVA 3GRFA 5FL3A 1FU4A 4XGIA 1F38A 5KYTA 4N8EA 5E1BA 1DOZA 3LY9A 2DEUA 4Z4GA 3EEQA 4CN8A 2QJRA 1IXZA 4OQQA 3LTEA 3D59A 4WNYA 4CT0A 2VSNA 2ZRPA 2Z4SA 1QF7A 3AYXB 4KGVA 4IMRA 2C88A 2GSWA 2XQFA 3L8EA 1VKRA 2R8ZA 1I2LA 1L5HA 4IY1A 1X7HA 3JZMA 3L01A 3L93A 2GAJA 4IHJA 4RSGA 4N41A 3A6LA 4DLPA 3JAWA 4AKEA 5A2QA 2JK0A 2EP8A 2EZ8A 2RC5A 2W5UA 3QZ8A 4RDCA 4BGIA 1AK2A 4PICA 1QHFA 1V39A 3SS7X 3MWEA 2HIVA 3CLHA 1W2GA 4Q4AB 1XZQA 3IPYA 1UQRA 1V5FA 1XOIA 1GYPA 2E4UA 2VEOA 3L6EA 3MMPA 3QJ5A 4YWJA 2HGZA 1YU9A 2A92A 5A6SB 4BMNA 5FPKA 1QQBA 1ULUA 1NVXQ 1G8FA 1P1HA 4MV9A 2D5BA 2RHDA 1U2EA 1E4EA 1VPEA 3AJEA 2X58A 1LJ8A 1RLMA 3L6DA 4YY3B 3NEPX 1KTAA 1J24A 4M9XA 2PL9A 4EHAA 1WH2A 4X64H 3HVRA 1IY2A 1XMOH 1BWSA 1U2DA 1A2BA 1HFWA 1WEKA 4N40A 2AN3A 2W2KB 4DL7A 3DKIA 5F3RA 4V0SA 3UK7A 3PLAE 1LRJA 2O2ZA 2PRZA 3E03A 4FP9A 4XX0B 1JDNA 3SYMA 3KALA 4QYXA 3PNKA 1DJMA 3PR4A 3PCTA 4NNPA 1XNGA 3LUKA 4CKEA 3MG9A 5DLEA 5E3JA 4EABA 3VKUA 3Q8MA 5JADA 4XIIA 4MA5A 3GFSA 2ZAIA 1BMDA 3PRKE 3A6DA 4CL2A 3NEAA 4PZEA 1XGKA 3W9UA 5CB4F 3J81W 1OOEA 4KLCA 3UEOA 4YJFA 5HE8A 4BV2A 4HG2A 4WGGA 3WLMA 1ZOPA 5DBFA 2R6R1 3L8GA 1UEJA 1KO4A 1NRXA 1YD7A 1FUIA 1PNOA 2GNOA 4C5BA 1NI4B 2ONZA 2AR7A 2JA7G 2VKQA 2EU8A 3FKSD 2NZXA 3GJ4A 1P4SA 1M7BA 2F1IA 2FHPA 2XYQA 4Q45A 1TQ8A 2YWHA 3KZCA 5J4YA 1M2GA 1T3ZA 1VL6A 2BJWA 5BVHA 1V7ZA 1M7GA 5AVRA 5A6VA 3Q87B 3AIMA 3IURA 5D84A 2IOFK 3IVMA 1WZIA 1ULTA 3HDTA 4X1OA 3SQXA 2CB9A 5C5CA 5CA1B 4MA0A 3GLGA 1K68A 3LKVA 1M1YA 4HYKA 1UT8A 3MA0A 3SNOA 2VWHA 4QUAA 1SVOA 2QTZA 2YV2A 4FUTA 2Q29A 2Q1TA 2GK4A 4JOSA 4N4AA 1ZZGA 1KHTA 1V11B 5CD1A 1JU9A 4B43A 1NONA 1BWRA 3ZY2A 5D2CA 4UNRA 6REQA 1HE2A 5JXHA 1GUAA 3M7IA 4J1QA 1KTIA 5AOAA 2YY5A 4FGJA 3RC8A 4FC7A 4DLZA 5EJ9A 4TV9A 4CIAA 2IMWP