2FPIB

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
393
structure length
393
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 116
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fpiB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fpiB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpiB03
1KJIA 4EGQA 4E4TA 2R82A 2R86A 3JZIA 4O2AF 3GIDA 4QSHA 4O4LF 4FU0A 2DIKA 1CQJB 5JVLA 5CAEB 1JKJB 5LYJF 2CQYA 4O7WA 3NUAA 4Y8VB 2GPWA 1KJ9A 2R7LA 3JRXA 5KX5F 2NU6A 4IWYA 3DF7A 2V5AA 4MV1A 2W6OA 5LA6F 4O82A 2CNVA 1UC9A 4FFLA 5C1PA 4O84A 4O86A 3JZFA 4FFMA 5CAEA 1JKJA 4FFPA 3OUZA 4Y8VA 3K3PA 1EYZA 4YAJB 1A9XA 3ORQA 4I55F 2W71A 3VA7A 1M0TA 2R7KA 4MA0A 2HGSA 3U9SA 4O7VA 4FGRA 4IHJF 4EGJA 1C30A 2FPIB 4MV8A 2R87A 3HO8A 4MV4A 2CSUA 1M6VA 5BPFA 2YV1A 4HNTA 5CA1F 2PBZA 5JQWA 3TINA 3K5HA 4YAJA 5JH7F 3ETJA 2V58A 2R7MA 2VQDA 4ZHQF 3HB9A 2IP4A 4TV8F 2PVPA 5D8DA 3MWEB 2FPIA 4O83A 3AW8A 4IWXA 4HQ6A 1DIKA 3SE7A 2YYAA 3KAKA 3PFFA 4FFOA 4HNUA 1DV1A 4HR7A 3R5HA 1I7LA 4ZOLF 5HBRB 5I47A 3RUPA 1OBGA 1E4EB 2QK4A 3MWEA 4YJ3F 2R7NA 2R84A 1W93A 2YW2A 4FE2A 3WO0A 3WNZA 2YL2A 5HV6A 4DLKA 1T36A 2FB9A 3Q2OA 4O81A 5HBRA 5DMXA 2VR1A 2XCLA 2W6QA 1E4EA 2CNUA 4C5CA 3JRWA 2YV2A 4FFNA 3KAJA 3RV3A 3TIIA 3G8CA 4ME6A 1KC7A 1VBHA 2DLNA 2GLTA 4YB8B 4I4TF 5H80A 3Q1KA 5J2UF 2W6MA 2DZDA 4O7YA 4O7LA 2W6NA 1CQJA 5JQGF 1EUCB 3GLKA 3R5XA 2SCUB 2YWVA 4O7ZA 1JDEA 4YBZB 1GLVA 2FPPB 5J2TF 3LP8A 3QFFA 4YB8A 1EHIA 4MA5A 2I8CA 3VPCA 1BNCA 1EUCA 2SCUA 4ZI7F 4HNVA 1KJQA 4O2BF 4IIJF 2ZDGA 3OUUA 4O7SA 2ZDHA 4YBZA 2FPPA 2FP4B 3VPBA 2Z02A 1ULZA 1B6RA 2R6FA 4O7NA 4C5BA 3K5IA 5CB4F 4YAKB 4XYMB 1KJJA 2NU8B 5KKNB 1I7NA 4O7TA 1Z2OX 4I50F 3TIGA 1A48A 2W70A 2I87A 4MAMA 2WYOA 2FP4A 3RFCA 4ZQIA 3U9TA 4MV6A 4NYEA 2R85A 4L1KA 1BXRA 2YZMA 3N8DA 2X0SA 4YAKA 4XYMA 1OBDA 3TW6A 2OLSA 3ORRA 1CE8A 1KJ8A 2YZGA 3N6RA 2GPSA 1IOVA 3RV4A 3TQTA 2YRWA 2J9GA 4RZQA 2CZGA 3WO1A 3VPDA 3HBLA 1JDBB 4FFRA 3AX6A 1GSAA 3DMYA 1GSHA 4WD3A 3ETHA 5BMVF 1M0WA 2GQSA 2XD4A 5LOVF 2NU6B 3KALA 1IOWA 4DIMA 1C3OA 1CQIB 1KEEA 1AUVA 1Z2PX 3R5FA 3UFXB 2PN1A 1KUTA 2NU7B 5CA0F 2GQRA 5IYZF 3R9RA 2YS6A 3I12A 4MV3A 2FPGB 1CS0A 3VOTA 4WBNF 1CQIA 3R23A 2YZNA 4YJ2F 1UC8A 5K2MA 4O4HF 1PX2A 4M9UA 2W6ZA 2NUAB 3UFXA 1VKZA 5JVDF 2NU7A 2YS7A 2CNQA 5C1OA 2I80A 3MWDB 3KREA 1GGOA 4O4IF 2FPGA 4O7RA 2NU9B 5BPHA 2YZLA 2YRXA 2NUAA 3G8DA 4TUYF 5LP6F 2V59A 1KBLA 3U55A 4EG0A 3MWDA 5GONF 1Z2NX 2P0AA 4XZ3B 4TV9F 1EZ1A 5FNVF 1EUDB 3BG5A 2NU9A 2NU8A 1PK8A 2DWCA 3LWBA 3U54A 1AUXA 1JLLB 2HJWA 4XX0B 4MV9A 2QF7A 4O4JF 5EZYF 2W6PA 1SCUB 1DV2A 1WR2A 4XYLB 1B6SA 4XZ3A 3E5NA 2C00A 3MJFA 3V4SA 5LXTF 1EUDA 4C5AA 1W96A 2ZDQA 1JLLA 5C8YF 4XX0A 3VMMA 2Z04A 1OI7A 1SCUA 4MV7A 4IZOA 4XYLA 1VBGA 2VPQA 3V4ZA 1GSOA
chains in the Genus database with same CATH superfamily
4FFDA 4M8NE 3VZCA 3PB3A 4D9JA 1NN3A 521PA 2C9YA 3FVQA 1RE0A 3M82A 1DFHA 3AERB 1ECJA 5EJ6A 1GLGA 3WGYA 4ER7A 4ED8A 1I0LA 5I5SA 3MCZA 2XAUA 5FPOA 4NU6A 3NEPX 2YNMA 4YAJB 1N2ZA 1VSBA 1RE1A 2O06A 4ALLA 3RRYA 3QTBA 3JASA 1AH2A 1WHTA 2K2WA 3ELUA 2VQSA 3O4IA 3AB8A 3GRZA 3AETA 2HVSA 2E4AA 4JJ4A 5IZ4A 5FA5A 4OBEA 3QF4B 1EINA 1T9GR 2QVBA 3VR5D 3HT5A 4JENA 2IHJA 4QRIA 3ZVMA 1TLLA 4HLNA 1MB3A 1DIKA 5CIYA 1G8HA 2BIFA 1JDPA 2I3DA 5EZYA 7ADHA 1Z5PA 1IBCA 1F2UB 4MB6A 2OO5A 5EXPA 1XRJA 1SWVA 3WL4A 1TL7C 5K0ZA 4JXXA 4F3CA 4JX8A 3RTCA 4OH1A 3DL2A 1AHNA 3V3TA 4BKRA 3G89A 1QP0A 1GJRA 4L8FA 1M7BA 1HGXA 1E0AA 4Z0NA 3TUJC 1C29B 3JRWA 2WDPA 3NP7A 1JA1A 2CFMA 2DUNA 1G9TA 3SSMA 1K5GA 2ZQYA 3SM9A 5CEJA 3ESCA 1YONA 2QYOA 4LF8H 2HRBA 2OXEA 2XTMA 2GK3A 3TK1A 4QOSA 1W30A 3RU2A 1JWBB 4PAWA 1GA4A 4LOAA 4DV4B 4F97A 3NPMA 2J87A 5ALKA 3L7MA 4AU1A 3SEAA 3S40A 2IPXA 1SQFA 1T2UA 1AMOA 1BFKA 2OKGA 4FC6A 1NPDA 2ZB8A 3U9TA 1MJHA 1LBQA 3BE4A 4WBXC 4DMFA 1P3Y1 3RIEA 4HGOA 4NHOA 3KZKA 3JQ7A 1CKMA 3S1SA 5KT6A 3PGMA 1XA0A 3FBWA 4Z2YA 4K03A 3TGPA 3OJOA 2AJTA 1EEHA 5DT9A 2PMEA 2WFAA 4DIKA 3E7PA 1FJXA 2RGWA 2ABWA 1SU8A 3KLOA 4MR8A 1P0CA 3W5HA 1BE8A 3MTBA 4FM9A 2C98A 1VXOA 1U5AA 3LXUX 2REBA 3OZSA 4OQYA 1IOWA 4X84A 1GNVA 1YDHA 4COOA 2Z5VA 2FVXA 3O0TA 1YE3A 1U2ZA 4B17A 3NHRA 4JNKA 4FGUA 4OG2A 1Z18A 3GRFA 1XDUA 4DV1B 4P34A 2RH4A 1RHKA 7YASA 1TRKA 1NR1A 2FN8A 2Q3CA 4DBLE 5L4LA 4AG5A 1Z4OA 5JANA 4OPMA 4Y2HA 3SS7X 4W9RA 1I6MA 3CNNA 1QF7A 4TLMB 3ZNOA 3C8HA 3E22A 1A8HA 4ALNA 3U7QB 5CB4A 2CEAA 2K87A 1NXXA 2GXUA 3LY7A 1R9NA 1Q0PA 1Y9AA 4D0RA 1JT9A 3AUYA 2DBQA 1TD9A 3T3PB 4WZBE 3ZXXA 4GGOA 2VA9A 3RB3A 1P5ZB 3BKWA 5FB3A 3K9NA 4R3NA 1OFHA 4F93B 1T9DA 2HJWA 3H2GA 2DR2A 4YACA 1Q0SA 4H59A 4RKEA 2Z2ZA 7REQA 4PFSA 2M9MA 1ES9A 3GTKA 1ZZEA 4Q8EA 4M89A 1U8UA 2B3TA 1FMJA 2EKLA 4BL5A 3D4BA 4XGNA 5AJWA 3OI7A 4U2FA 3ZHBA 1S3IA 2NNWB 1XTIA 3PC2A 1PZGA 2B1IA 2P68A 3QJ5A 3H97A 5LYJF 3P9PA 1EZZA 5D5HA 3BQ0A 1K86A 3QJGA 4LN1A 3ILSA 4P7KA 1T3TA 1M34B 3HA2A 2GZAA 3U5ZB 4V0ME 3FDFA 2OD9A 5JAMA 1FP6A 2ZE6A 1ZUHA 5LP6B 5HCUA 4QBGB 4QNMA 4Q7QA 4X7PA 1DBPA 1OE0A 5KG7A 4O4IA 1HYEA 3I9FA 1N32B 3EQ2A 3QLUA 3JATB 4BWYA 2W58A 1U7PA 5IULC 2FWMX 1C1YA 2ZUCA 3AWIA 3PHCA 1AXGA 2PL3A 3Q6IA 1SUPA 1GADO 1Z28A 3DKPA 1YA6A 2VH5R 3IDQA 4W8GA 1R0RE 4CFZA 3NBYB 4RHYA 2P7HA 4LBVA 4GWKA 1O3YA 1BTOA 3KU1A 4JXZA 1DRKA 4AQ7A 3F74A 4NEQA 2AYYA 3RF2A 1I7LA 3RUPA 1P0FA 2FOIA 5CDSA 3KR9A 2PMZA 4M1QA 3KQWA 4C4SA 1PQ4A 3ONEA 4D79A 3IERA 1ABFA 3SKVA 2QAGB 4WXEA 2C5HA 5GADl 1T8TA 2PTHA 3S8MA 2ZB2A 1K4YA 1U8CB 4MKIA 2YJ6A 2IL1A 1TLFA 1MUUA 1PR9A 1ZXXA 4GXNA 4I4TF 3T1OA 5B3KA 3WYAA 3GLKA 2DHDA 4E70A 1XQVA 1IHXA 1XZPA 1FLDA 2EBUA 4MS4B 5PNTA 4RGBA 5ALUA 4PBSA 1I33A 3VTKA 3D7MA 1UT6A 2NZUG 2N0SA 3ZD7A 3OX4A 1HL3A 1EXVA 2F43A 4ED2A 1XDSA 4PZPA 4PQEA 4NK4A 2EP8A 3DFIA 1YNOA 5F3DA 5ECYA 4H1VA 2G08A 4UCQA 1A5AB 4MRMA 3FUXA 2BC9A 2HLDA 4OA5A 4DLLA 3SF0A 1LJUA 1V5FA 3LIIA 1XEAA 2QMYA 2XNDA 3RR5A 4HWOA 4QLAA 2IEIA 5HF6A 4M0EA 1GTZA 3GCGA 3Q8KA 5FA6A 1TQHA 3DBOB 3GELA 1V96A 4IUCS 1PF7E 1P2VA 3TNJA 2Q4EA 1GPUA 4E94A 5DTMA 1J9ZA 2C2RA 3E6AA 1VLMA 3ZCVA 4G8BA 1K7FB 2YBEA 3ZH9B 3RFUA 3UBTA 1YQUA 2O6HA 5I7AA 1VE1A 2VKQA 2HG8A 3ZGXA 2IE8A 1V8DA 1XP8A 1JQ5A 2OAQ1 4CODB 4N6NA 3FW1A 1LY1A 2JFUA 3EFOA 5LMUB 3RFVA 2SHKA 1JSLA 2O7RA 2X8JA 4PZUA 2JFHA 2FDCA 3AI2A 4WKPA 4E2YA 3WS7A 1M2GA 1HFEL 1KO1A 4MPJA 2I80A 1PEKE 4WXPA 2HK8A 2FWRA 1VB5A 2I2CA 1FJGH 3VYUB 2XEDA 4CGZA 3E70C 4DDVA 3EAFA 2R8GA 4Y7CA 2CV0A 5B2EA 1GG9A 2MR5A 4BFCA 2HR1A 1T9CA 5HQJA 2JA6A 5H68A 3E61A 4B7ZA 5CT9A 3NTLA 1RK5A 4O3FA 1IHYA 2ZI7A 1WR2A 3QTLA 4FCCA 1JX6A 2VO1A 1Y1SA 4HWSA 2A35A 1JIKA 1UZLA 2HL6A 3L1VA 1L4HA 2AG6A 4I9UA 3CWCA 4KR0A 2Z6QA 4QBIA 1DXQA 2VPSA 3EMDA 2EG9A 2HT6A 1FRZA 1YFLA 4PFQA 4HBZA 2GERA 3ZZUA 2DYKA 5LB2A 4ACBA 5TEWA 4YJ2B 3ZDRA 4KQFA 4NH4A 4B3DA 1QLHA 3DBHB 3Q98A 4DXAA 1C3EA 3VYTB 5IYZA 2P3OA 2W6OA 4ZYLA 1APBA 4PZ9A 3WLSA 1XHFA 3HWSA 1VJ5A 4R16A 2CV2A 3OTGA 2C4NA 1NATA 2WTEA 1I8TA 4JYAH 3H2JA 4IJMA 2BH2A 1NM5A 1E7SA 3O8RA 4YH1A 1FS5A 4CHGA 2IIBA 5AJVB 3ZG6A 5KNDD 2C3OA 2JFFA 5FBQB 2D3TA 5T4EA 3NJ4A 2OHOA 1VG0B 4X94A 3H6GA 2E1PA 3FB4A 1IY8A 2G9UA 4LZNA 3RC8A 1Y5MA 1R6XA 4A6PA 1E9BA 3MJ4A 1M5RA 4CMBA 4KHPB 2GNPA 1C9KA 1GCAA 1NHGA 2UUCB 5JSZB 3CG0A 3FNIA 3TQQA 3V1TC 4X6YA 5T4FA 2JFYA 3V4FA 1FFXB 3CJRA 1KXZA 4N18A 1I2KA 2CFCA 1JSCA 2H6EA 3EGDB 4BIIA 3KSMA 3OFVA 3E7WA 1LX7A 3COSA 4QPCA 4D9IA 3T7JA 1GZHB 3CKLA 3R77A 3GRAA 4AO7A 2C3MA 3QBDA 2VNIA 2ISCA 3KWJA 3T1TA 4IOJA 2PRJA 5JFGA 3FX2A 3II6X 2SCUB 3DH0A 5IAEA 1BG6A 4N3AA 2Q1WA 4MGKR 2IEZA 3FKIA 4NDZA 1ULTA 4X64H 3O8DA 1DWQA 4Q3OA 1GZ5A 5K3FA 1AGNA 1U7OA 1G98A 1QOZA 5I4CA 1I1LA 5FOVA 2EBWA 2VP3A 2RHOA 2O2DA 3OVMA 1KJJA 1E5DA 2MTBA 1EX1A 2G1AA 3BQMB 4WN9B 2VH1A 1H2FA 5DEIA 5I9TA 1XZNA 3IKMB 3W2GA 1WSWA 1R0LA 2JIOA 1VSUA 4UE2A 5HZGA 4LXHA 3NCTA 1CX9B 2D5BA 1IUNA 3SHTA 3SIXA 5ANRB 2VWPA 4LF7B 4RU9A 4CTOA 5FBWB 4PLGA 1HG1A 2RONA 3FMPB 1TK2A 1AQ6A 3EVBA 2HRQA 3SLKA 2ZS9A 2IIVA 2FFBA 2IEAA 2OC9A 2X7XA 2G09A 5FO1A 3JTEA 2OP0A 5FUVA 1D09A 3WLJA 5C1DA 1ELOA 4RSMA 1O6BA 4YUZA 2JGMA 2B99A 4AJ2A 4BFYA 1Y8AA 1U6IA 1BVRA 2HQ1A 4NKRA 1W35A 2JA7G 3S2YA 3GA5A 3ICOA 1YZTA 3TD9A 5JFTA 3AR8A 2NZ2A 5A6SB 5D51S 4UOEA 5A02A 1GNTA 3MT9A 1JJIA 5HS6A 1U80A 4QQRA 2V7QD 3NHYA 2NU7A 1CVLA 1PG2A 1BMTA 2G25A 1NYQA 1XWIA 3RTDA 5KVAA 2X4GA 4JR1A 4Y9DA 2FX5A 3WK8A 2Z2YA 1LS6A 4EM6A 2C9DA 5HPYB 1VSQA 4BMNA 4PICA 4H17A 3I6BA 1DAPA 3LLUA 2QW1A 1VGVA 5G4KB 1QGYA 2ZUBA 1L5YA 4AIRA 5M04A 5IXSA 1BEEA 4S04A 1WW2A 5H83A 2FLPA 3K1AA 1OC4A 3QFHA 3KBBA 1ACJA 3EEOA 2PYIA 4PY2A 3SR0A 4TQRA 1PL0A 2N9UA 4YC7A 3HBAA 4FGKA 4Q12A 2VK2A 1KHTA 2GQ0A 5IPFA 4MQEB 3O4RA 3D8SA 1JMYA 1T5DX 4KBGA 3TLBA 2ZPAA 5G3YA 5CPBA 1E9VA 1Q7BA 3A6DA 1JIJA 3C5VA 2PMCA 1CW2B 1U1GA 2RKBA 3VDRA 4FFBA 4OEHA 5KYGA 1X1CA 5HZKA 1V48A 3FI9A 1TCCA 2JJ1A 2D8MA 1R9JA 1F2TB 5FWXA 1KQGA 4N0EA 1PR1A 3WX0A 2XYVA 5JJCA 4O86A 4J0IA 1BMDA 1EYZA 1RXYA 2UZ0A 4QUIA 5EQDA 3JQ8A 5DHPA 1DX9A 4LF9B 2FKLA 4IH9A 3I09A 1TJYA 3L1KA 1E2NA 4DV2B 1OQAA 4BTLA 2A1UA 4RE5A 1YL7A 3BZBA 4JB2A 1GGFA 3W2TA 5A4AA 1PRYA 1XLVA 4PYMA 3UUEA 1NASA 2QMQA 1UWCA 4QYXA 5LZ7A 1JDJA 1NP7A 5DHSA 3B3GA 3WWPA 3EC7A 3DEAA 5DNVA 4DQKA 4BV8A 3Q0IA 2Y27A 1PW5A 4FCVA 4PNHA 4C7XA 3KYCB 4AJEA 4OBXA 5C7OO 1M75A 3RWMB 5L9AA 5HKKD 4MCAA 1XEXB 5I9BA 2AR7A 3QXHA 2OK7A 1X0VA 1IULA 3JX9A 5AM4A 1PQWA 1ISFA 1FDOA 3S2UA 5ALMA 4WZBB 5JJKA 2VBCA 3ADCA 3T12A 3FMFA 2EFCB 2C7OA 2VP4A 2A6PA 3ZDCA 2ZZKA 1R10A 4CRWB 1WUIS 3VJLA 4B85A 4GOMD 1O96B 2DKFA 2H2FA 2PRSA 2FPSA 1C41A 4JH0A 5FL3A 1NKSA 3KKZA 3K0AB 3TQ1A 4DQUA 4YCCA 3VU8A 5EPEA 1EHIA 2QR2A 3TSAA 2WQ6A 3RC3A 4YP1A 1QIHA 3K0FB 4C04A 4MUAA 3WWYA 4PGGA 4N5LA 2QJRA 3OZ7A 2IITA 4KBYA 2XCPA 1DBIA 3RD5A 3RIZA 5JH7A 1ZGGA 5IU6A 3HR4A 4O7NA 2OCKA 3EISA 4AKIA 2Q5IA 5HDBB 4Y6RA 3BA9A 1JVBA 1N75A 4F4UA 4KC0A 3FNRA 3N7TA 5CDHA 3BJRA 1KAEA 3U1TA 2HTFA 4XFDA 4NYEA 2R85A 3VNUA 3DL4A 1J99A 2JIZA 2JKYA 5AUPB 1JIQA 2OYRA 4NOJA 2IDMA 2JD2A 1NLZA 2BFBB 2YZ2A 3O4HA 2XGPA 1RWQA 4F56A 2QBYA 1IOVA 2REXB 4HF7A 4HQFA 3DMYA 3NYIA 4DTCA 2UXBB 1S7GA 4RULA 1P16A 1C9DB 3ME5A 1FP4A 1U1DA 2I2AA 3OEEA 1YA8A 4ZIRA 2JEIA 1Z4IA 5ER6A 5KFQA 2BLNA 2EWWA 4BYGA 5KYYA 2ST1A 1R8YA 2X1HA 4N5HX 1T91A 1XFDA 1NYTA 2WUVA 1JEDA 1TVMA 1Y9EA 4RZIA 3RRMA 1RYYA 5KAPA 2GZ3A 4AMYA 4BO8A 4LKRA 3T7SA 3GZJA 4S1TA 4ZYZA 1O95D 1JFSA 3H5WA 5E7IA 2W2VA 2ZBDA 1D5CA 4KX5A 4UHKA 1Z7BA 6CHYA 1QS0A 4QOGA 3A1TA 1KEUA 5KFDA 4BLPA 4F60A 2XOXA 1MP0A 5EMNA 1YZFA 4RIFA 2V6JA 1ND6A 4D3YA 2UDPA 1FSFA 3TRDA 3L6RA 3ELDA 3U54A 1T4DA 2OXCA 4BVBA 2N42A 4B7XA 4O33A 2XGOA 1THMA 1I7DA 3KQSA 2QG9A 4FHZA 2PKQP 3IBFA 4L5CA 3H87A 2I76A 1PR6A 4QW8A 3ZGNA 1I32A 5J5VA 4X1YA 5ECDA 5BSHA 4XH9B 3AKCA 5EIAA 2YYZA 3RARA 1R5OA 2B4TO 5DXFA 4DR4B 2NXJA 3ESRA 1L6RA 3WKAA 1MX5A 1E89A 1ZK4A 2HY7A 2A4KA 1NVTA 1R0XA 4P92A 3Q8PB 2ZAOA 2XB6A 4FFLA 1A4IA 4A2QA 4PINA 5ALIA 1U8ZA 4TKVA 4FR0A 5TJHA 2PSJA 5BYBA 2VK1A 1L9KA 3RU7A 1J97A 1I14A 3BH6A 3GD5A 4WK6A 1GY8A 4HGRA 3Q3CA 1M2NA 5COQA 3ACCA 3IJPA 5DM4A 4J8PA 1EAMA 3G02A 5JQWA 4HX2A 1NVEA 1NR7A 2XEXA 4CMHA 1NN1A 2IOFA 2BUCA 1OWLA 2PMKA 3O4VA 1CZLA 2QSJA 5FOXA 3P27A 1PD1A 2ENWA 2O1WA 3TWOA 1XJ5A 4NMHA 3BWCA 4DZZA 2Z6UA 3C45A 2QTMA 1OHHA 1RYHA 3FJ1A 2Q99A 3C70A 2XB2A 5KOJB 2QK4A 2ZJ4A 4MP3A 4LSMA 2WJVA 1TAHA 4UTRA 2VHVA 3WOVA 4FE2A 4C4OA 4UPVA 3QG1A 5ALWA 2BF7A 4R4JA 3OIYA 3GJ4A 3OJ0A 4WLEA 3J7AK 4R8KA 2WFLB 3MRXA 2QRZA 2OXTA 2XVAA 1FVIA 3RB8A 3CISA 4JLVA 4IIGA 4RKRA 1H9AA 4FZ5A 1WRBA 3V8PA 4PSCA 3VNAA 5J47A 1D7OA 4C6SA 3M3PA 4LYAA 4DABA 1UANA 4MK4A 3N8HA 4BY7G 2PCJA 4MVCA 4PTYA 2IHNA 5J2TF 5AVXA 4CIXA 4V24A 2EJWA 1EFHA 2HU2A 4CEIB 1RQXA 3I8XA 3DGFC 3WAJA 3I9V1 4EUFA 5I5GA 1Z6ZA 4MR7A 3N2GA 1NMSA 1WZEA 4EHBA 3BRSA 3Q5GA 1TVKB 4YQYA 1SUWA 2WMYA 3SZGA 5SZKB 5AKJA 3K16A 5JJIA 4TKLA 3DO5A 5AW6A 2A9FA 5FUBA 3QPVA 5AUQA 3PC8A 1YR3A 3V97A 4H3SA 3EE6A 3N0XA 4NARA 4M4SA 3X2FA 1BWRA 4UTOA 4BWFB 1GGHA 4RAZA 1N0VC 3WGGA 4BAZA 2N46A 4V1CA 5MF6A 4DV5B 5D3ZA 2VOBA 1ZVKA 1QIDA 4ZVNA 5AOAA 3H3VH 4QWAA 3OLZA 4PX3A 3D3KA 1QHGA 3L1JA 4D2IA 1TKBA 1PD0A 1NRJB 4TKUA 2RHGB 4CKEB 4OQXA 1MAUA 2H65A 2QD4A 1TWCA 4Q7LA 1HE4A 4BMYA 1S89A 3ZHRA 2CXNA 4V3BA 4A2WA 3N40P 3M6AA 1GYRA 2GWHA 4EQ5A 5E6UA 4MR9A 3R6DA 5L1KA 4HNRA 5KKAA 4DHWA 2C22A 3UFXA 4ND3A 3FFAA 1UKCA 3HZHA 3UW1A 2CJWB 4WIAA 5J4HA 2J5BA 2P9TA 4FIZA 4YT2A 3UY4A 3HVRA 4AMGA 4HYYA 2HOQA 1YKFA 1NM5C 3FFXA 1OWPA 1Z08A 3UVEA 4JJZA 3OIUA 3IUNA 3N2KA 4QUGA 5AKIA 4BWVA 5KDDA 2Q1TA 1OBOA 3OC6A 1IWOA 1P4JA 3ED1A 4OI2A 4JLKA 2YMPA 4BGDA 4M9XA 1JG7A 1NURA 1AIPA 1LBTA 2VRBA 5E1OA 5AK0A 1JVNA 4ND5A 3ZEIA 2C84A 3M6MD 3EVTA 3QU7A 4Z51A 5GJCA 2R6ZA 4RQTA 1FFWA 4LF6H 4XDHA 4BO6A 1PR0A 2DF8A 3FOWA 4IHQA 3FMGA 3TNYA 3DMPA 4EZBA 3MPUA 3CLSC 2WJWA 4X90A 4NJEA 2OENG 2OWDA 3D6UA 4U9IS 2G5PA 4BE9A 3TLJA 3OT1B 3D4IA 3OT4A 4NXMH 2ZUSA 3ZZ0A 1T1GA 2LZ0A 5K01A 3REQA 3O21A 2DLDA 3M6IA 2VNKA 3THRA 3IBGA 5KFRA 2BGUA 5KT4A 4HEA6 4C22A 3ICCA 2Z5FA 3DUFB 4ZQCB 2FMUA 5IC4A 1RWNA 3O84A 4F6LA 1I3LA 1W581 1RZVA 3R1IA 3AUSA 5KFAA 4CIYA 4R7GA 4CETA 2JGDA 3HUEA 1Z62A 4IQGA 2BMVA 4BXOA 5AJTA 4B81A 2OFOA 5FNVA 3AW8A 3B6ZA 4A2BA 1Y80A 3QG5A 4X1OA 3NHAA 2OA0A 3WWDA 5I7VA 5EJ7A 1N7JA 2AC4A 3H5TA 3MGGA 1H9BA 3M49A 1M34E 3D6JA 1FFAA 3GY0A 5FQOA 2CSXA 1NXPA 2VSXA 1THTA 1M7GA 2IHBA 5JD5A 1M66A 3LULA 2XWJI 2NTVA 4CM5A 3F6CA 5HNEA 5EWLA 4BJ5A 3AXSA 3I4CA 1QHEA 1HNZB 3LL4A 3M9NB 3V5NA 4DM3A 2WT8A 8ATCA 4ECUA 1XMJA 1P2GA 3N3BC 5H5JA 3VC7A 4V0KA 1I51A 1OU4A 3QPBA 4G1UC 2JFVA 5KWIA 1SBYA 2OHFA 2IS1A 1WUHS 3TRHA 1E4FT 1YAJA 4R1MA 1BN7A 4RCNA 1Z6QA 2MYPA 2J4CA 4ZCLA 3L3BA 2JGIA 4MPTA 1U0TA 2QX9A 3OJWA 2IXBA 3QVGB 2A5GA 1GFWA 4LOKA 1DEOA 3GDHA 1DWOA 1QGUA 1DJOA 3I9JA 2R4UA 1WKVA 1LK0A 3BXOA 4KIGA 1U8XX 1A48A 3R9WA 4PNEA 4MO2A 1G8PA 3RHFA 2QL6A 3V6KA 4NC9A 3W5BA 1UBSB 4Q66C 4WA7A 2GA9A 3U80A 5JNLA 2X9NA 5CDFA 2HLDD 5FNZA 2JGAA 4PAMA 1FYEA 2M1ZA 2EQBA 3MYRA 2XNDD 5T7BA 3JALA 4GPBA 2JVJA 4M0UA 2BW0A 4LJ6A 5IDWA 4YCSA 1V43A 5DASA 1U7ZA 3RF6A 3F90A 1DZIA 1C3OA 3UMFA 4HWRA 4MVJA 4PLVA 5JHHB 1SXJA 3DLAA 1TGVA 4H7DA 2BI8A 5K0BA 1WXFA 1B3BA 3V1UA 1RQ7A 2GTHA 5KFVA 4DL7A 1K2VN 2P62A 3HA5A 3AEUA 3IHKA 2NNLD 4UNNA 3KTMA 4TM8A 4F04A 2HU8A 1IBRA 1ZWKA 1M33A 2XIGA 4LXIA 1U9IC 3L82B 3NJ8A 2PQ6A 3FLEA 4LY9A 4AQYH 3OF2A 2WKWA 4EATA 5ICMA 4BEJA 3ETDA 4FN4A 3C7CB 4N3CA 1TA4A 3CEMA 1KK3A 3FIUA 1DFIA 5BV1A 3OOYA 3MWJA 3LZCA 3S1AB 3HOWG 2E1RA 4Q9NA 3QVKA 4ECZA 3MB5A 5DK6A 2X23A 2YN2A 2BY4A 2JFOA 3SU8A 4XYLA 5HIJA 1WBJB 2F4NA 4IDAA 3PUWA 2PGLA 4C4ZA 2CXQA 4DT1A 4EELA 2XYRA 5AVUA 4EYEA 4LEIA 2CBGA 3V7NA 2PH7A 4ER6A 1JUDA 4AN0A 2PLAA 2BDEA 5IWAB 1L4MA 2WJZB 3SQNA 4CHIA 4UVDA 3E03A 3OSUA 2A0XA 4RV4A 2JG3A 1P9RA 3DFZA 1XNHA 5A2QA 3PSAA 1JHOA 2W6JA 1LI4A 1O1YA 3B1JA 1JQLB 4KE8A 3GLTA 1OI2A 2V9ZA 2CXXA 1PR2A 2VBFA 3SC2B 1ZWLA 3WIUA 1MW9X 2LD4A 3ABRB 1KFBB 1Q83A 1DU4A 4CWAA 4JP1A 4LCEA 1Z5VA 2QORA 1JHAA 2WYUA 4GLWA 3LWNA 4B3SB 1K08A 4BNTA 3VO1A 1ONNA 2ID9A 4D42A 2P2SA 3PWZA 3DZJA 4E2XA 1DELA 3KSAC 1Q1BA 3LX5A 1IVSA 1OTYA 2AHOA 2VUMG 3ITKA 3H9JA 3TTSA 5BQOA 4F96A 3OX3A 1VE9A 3ABIA 2ODWA 2JANA 3L8ZA 2MDTA 1U90A 1D3AA 4D7AA 2I3ZA 2VZEA 5JS2A 1NHWA 3IH5A 4EHDA 4X71A 2ZAYA 4KWCA 4ZHSA 3IAEA 5A9SB 2PWBA 1H8HA 4QDJA 1R6AA 3CLSD 2A3RA 3F3SA 1CJCA 1TFRA 2UZAA 3SYTA 4RKFA 3INGA 2YIVX 3AIIA 4X24A 1A9YA 1D2MA 4J6EA 3DCJA 2AUMA 1PZFA 2IYFA 4L22A 1SY7A 2G5CA 3RW9A 4HAVA 4Q21A 1ZK3A 1FX0B 4BQSA 3H20A 4GZ6A 4ZHQB 4V1CI 2IX3A 4PR3A 1TA0A 1HKHA 4B3CA 2H11A 1GXSA 2DR0A 2YMLA 5CH8A 1B3RA 3OOEA 3L77A 2J6IA 3LCCA 3WDLA 3KKNA 1OTXA 2LTAA 2F1OA 4RHFA 1CR1A 3C3WA 3WLIA 2JRCA 4R6WA 3UGJA 3W4JA 3D3WB 4FLEA 3AR4A 3K2BA 2C2XA 3QBEA 3FYUB 3BTOA 1Z15A 4Z4FA 2D4HA 2ZJAA 2R3SA 3VHQA 5L1IA 3COWA 3KU4A 4O29A 2G4LA 2HBQA 2A30A 2I1WA 4Z4HA 621PA 4TN1A 3WE7A 3GTOA 3DA8A 3T6KA 4XJVA 1Z4LA 1IN8A 3CZPA 1KI6B 1N2CB 3EGEA 2CVFA 4KO3S 4DSAA 1YCHA 2ZQ5A 1OY1A 5C4XG 4A6EA 2XW6A 5FI5A 4RY2A 2C99A 4YMTA 1TJPB 1JDTA 1ZM7A 2BE7A 3VYWA 3PL5A 1H93A 4JV0A 2VTEA 4O8CA 3DLHA 2AH5A 4UNSA 3ZVNA 3NWBA 2WF5A 1JW9B 2ADFA 3A1UA 1W5SA 3PD0A 3ILXA 1IZ8A 4NJMB 3UWPA 2EZ4A 4YCMA 2HNAA 4NV3A 4JQCA 4F91B 3GN2A 3X2SA 5K2MA 2VHEA 3OT5A 3OCCA 4C4PA 4OQQA 4BWGA 4B44A 2AKAB 5D7BA 4XKJA 4LQDA 3IEVA 3LBHA 5A4JA 2CXSA 2GF2A 4Z53A 3QEKA 5AH0A 4RE6A 1RAFA 4E4YA 3J80A 2RJOA 4K0KB 1TCBA 1NL3A 2ZYVX 2LWIA 3P97A 3WLQA 1NNEA 4GPTA 4F92B 3GPLA 5JE8A 4FFVA 4LH7A 2HFJA 4C0LA 2I6XA 3H04A 3QLVC 2DXIA 2C7GA 2B1QA 3AZQA 3SZLA 3B51X 3ITDA 2WUDA 3HHEA 4JJEA 4XWKA 1O7JA 1MGPA 1A71A 1WPRA 2ORWA 3U62A 4DVJA 1V8BA 4EG6A 5IAOA 2A5YB 3B9BA 1WG8A 4ZMRA 1KDVA 3OCUA 4JJIA 4L6IA 2NVOA 2Z56A 3GRKA 2AV6A 2I4OA 3BX1A 4EI7A 3UYKA 3QLTA 1YBFA 2BOVA 2DQSA 5FPRA 3ADDA 1Y1LA 2Q0XA 5E3JA 1R0BA 1JECA 2B7LA 2QN7A 2HJVA 4TGLA 3SG0A 4EDFA 1WXHA 2R8HA 4OQEA 2OUIA 1BH2A 3K4QA 3EA0A 3IQGX 3TLGA 4OI0A 3O4FA 4FFPA 1Q95A 2EQAA 2HBRA 2II6A 3VSAA 2OT3B 4NYJQ 2FSGA 4DY4A 2JJ1D 3BCHA 2IYAA 4OA8A 4R1PA 1X9HA 2WDTA 2VG8A 1E9CA 5F1PA 5F12A 1SEPA 1BE6A 4BNKA 3BIXA 1N2GA 4CLRA 3RADC 1QGZA 4GI7A 5GVRA 4O83A 3ZKWA 4MMXB 1E99A 2N1BA 2NZVG 1RHMA 5M2QA 2O2HA 3HKBB 2J5QA 2EFYA 3LQ4A 2JHGA 4MKRA 4DCCA 4ON9A 1GPNA 2BF4A 4ND1A 4A3CG 3UK7A 4AIIA 1RC1A 2J07A 3RJ0A 5M5BA 3GO4A 3T99A 3ROQA 5FPPA 2XZOA 4LNUA 4DG5A 1KJZA 5CLFA 1OIWA 1E6UA 1N2BA 4L02A 3A26A 3ROTA 2GM5A 1U1EA 3OX1A 2J41A 2ZJ2A 2G9ZA 5LYJA 4I4LA 1CR4A 4IXWA 4QICA 2HGZA 3AUJB 3IP1A 3VI4B 3OA0A 4I55B 1NFRA 2XSZA 4F2PA 1IXYA 2QHXA 1F4LA 3C41J 2AZMA 1V9SA 4ZO8A 4F9GA 5K0NA 2V1UA 1T4CA 1JG6A 4KCGA 1RJPA 4GPAA 1IPEA 4A3DG 3UKJA 3RIGA 4EQ6B 3ASVA 1HDZA 5A03A 3AFIA 3WQRA 1KS9A 2B25A 2HSDA 2A9KA 1C4OA 2H1SA 1ZH2A 2JI6A 5EP1A 4YAKB 2CEKA 1MKYA 1SZDA 1P0PA 1L8LA 3AIMA 4P4SA 4MVJI 2IH5A 3GFTA 5B58C 1T2CA 3CGGA 1IHPA 2YZMA 3AOEC 4DL5A 2QRPA 3ADPA 4HOYA 1ZCZA 4HZUA 4ZD6A 1RC8A 2BELA 4C78A 4G09A 1DFGA 3VYRB 3OECA 1PS0A 1KEZA 5K6AA 2W9CA 3PXAA 3RYFB 4DYHA 3BHNA 3HYNA 4JMPA 3IE0A 4DBZA 3W5VA 4Y1RB 1EB9A 3J81A 3U49A 2D8AA 3I72A 4K9KA 4JSTA 3CWZA 4BNHA 4I4TA 3B9RA 4J9MA 2GFQA 1UP7A 2Q29A 1BS2A 5C32A 2AVDA 2WIGA 4PX2A 3U56A 5REQA 3PXXA 4RHTA 1MXHA 2ONKA 5EZQA 5CBPB 1KPIA 4BMSA 4AJKA 3GT7A 4N8DA 2XDQB 3SCZA 1V95A 2ERXA 1PHRA 3FSGD 1NUTA 4H27A 1WP9A 1GAEO 3B1KA 3R8FA 4TSKA 4OAOA 4BC1A 1GGEA 1KGSA 1SD5A 4FD2A 4LYGA 3NBQA 4ZVTA 1FUIA 3BKXA 3P71T 1DP4A 3IVMA 4JUFA 4EVIA 4ZVLA 1Z2NX 2KBFA 2WE6A 3HYLA 4UAUA 3W2EA 3RIMA 5EJEA 3VNNA 1SCUB 3M9OB 3B1YA 3HB5X 1TVCA 2C00A 2OZVA 2NPFA 4PTLA 2O54A 5TX7A 1N3YA 3IRVA 4PFJA 4XR4A 2EZ8A 3G6XA 1A9SA 1LJ8A 2R8KA 1O5TA 2JIDA 4JBGA 3GJXB 4LZOA 4BP9A 1G2QA 1R0WA 5E6RB 3DMRA 3U1VA 1NTOA 3EZYA 2DIKA 1I1QB 4A4DA 2R62A 1JYFA 3G7UA 1QFYA 3CIFA 2BSAA 1ZW1A 5CVJA 3QVTA 3PJEA 4HRVA 3X3HA 2L82A 2VAXA 1XD2B 1UODA 3LDAA 4IR9A 1C5KA 2P3SA 3PP8A 2O8BA 3S2ZA 3EULA 4G1BA 3NMUF 2J9FB 4W82A 2OECA 4TV9B 1N1EA 1ZNWA 3CSWA 5T3YA 3PZPA 4LF4B 4YMWA 1N6IA 1VMIA 5KINB 2OHJA 4KW7A 2GXAA 4F9FA 2Z4TA 1R5JA 1TIKA 2PXXA 5C44G 2AF3C 5H1YA 2RK3A 1J33A 3IUMA 4IMIB 2NVUB 3A2KA 5B1YA 1HE8B 2P5SA 4QFCA 1QANA 2E3JA 1AGYA 1UL1X 1EP9A 2H51A 5DMXA 2PLNA 3MCTA 2XUFA 3FUVA 5HE8A 3ZY2A 4RL6A 4Y2VA 1LTKA 3NTUA 4I99A 1J90A 3ENNA 2G28A 3P4YA 1YB6A 5DP2A 3IL2A 3VSEA 3L7OA 2E5WA 4XEUA 4B82A 4B47A 5FV7A 2PA3A 4JWKA 1U9YA 1W2GA 3SQLA 3HA3A 1YF3A 3SIPA 1PW7A 1QFMA 4QG3A 4ETNA 4IAJA 3EGXB 1I6LA 4FNMA 5FAKA 3LFTA 2R6AA 5K3WA 2XHEA 2WJYA 3WAGA 1OPRA 1GG5A 2DH5A 1KSGA 1EUCA 3WISA 4PZ0A 1ENYA 2PGXA 1DDIA 3OUUA 4E5SA 5DN9A 2WKRA 4MCJA 5JCJA 3HB0A 2PUWA 1X74A 2Q28A 1GQSA 4HUJA 3DKRA 5ARCA 3RAQA 5A0VA 4HNHA 1Z0IA 1XROA 2BHTA 3GJ5A 2Q8QA 3UAVA 4Y1GA 3NU1A 3AHEA 3DZKA 1CLEA 2R8OA 4B4OA 4ZO4A 3AJ9A 2UYQA 4B4VA 1MIOA 1EJBA 4E5UA 3EG9B 3KVYA 1EEXB 3AVQA 2VA2A 2HA6A 1NVVR 3V8VA 4RTKA 2X0KA 2CXOA 4C9BA 1J9EA 1RRCA 4BRWA 2FZCA 3OE7A 2C2DA 4PAQA 2NU6B 4DR2H 1ML4A 2FDXA 2BTOA 4QGAA 3KUKA 2VTKA 2QDXA 1NAIA 4RQUA 3PF9A 3THYB 3EXEB 1Z5NA 2Q3HA 1Z13A 4Z9FA 4G0QA 3BMQA 2V74B 2VK4A 3VVBA 1ODCA 5IKEA 3GIMA 4GNKA 1RJDA 3JU3A 1GPH1 4E1AA 1JL3A 2YVUA 2PU7A 3UJ7A 2P9YA 2H1LA 3GYGA 1X7ZB 4UUGA 1YDWA 1EVIA 4II3A 3LUHA 4LRSB 5L45A 5F2EA 2V4QA 4FTWA 4LVOA 4HADA 4BMPB 3G8BA 5MN4A 4AYBA 2WNIA 1VL6A 1O9HA 2F55A 4U63A 1B04A 2R8BA 4YR3A 4OX9H 4PZEA 3L0PA 1ZBQA 3THXB 3AXTA 3RYHA 2X2OA 3A6KA 4P0PB 5DK4A 3OOJA 4NX2A 1DDOA 1ZOSA 3K0HA 4AROA 1S2GA 4OFBA 1EFVB 1TUGA 5E0KB 4QUEA 2VWHA 1K66A 3DB1A 4HAZA 1ZZGA 3AT1A 1T4GA 4HHEA 1KKLA 3DPSA 5C8YF 3NW9A 1BS9A 2QP4A 4P1ZA 3B6KA 2QN1A 3QNMA 5AVSA 1CRZA 2ZUUA 3L41A 2F6RA 4MUGA 3C74A 5TARA 3MOIA 5AKZA 4DA4A 2WMDA 1FBNA 1BYIA 2GUGA 5A04A 5KVQA 3RC2A 2DSTA 2XA1A 3EDYA 3TQFA 2BKAA 4KNWA 1Y9ZA 4ED3A 1GN9A 1O95C 1PT6A 1CFZA 3TRFA 5CT4A 4OMCA 2WJ4A 1PZEA 4O3MA 4RNDB 4JXKA 2O2SA 2G04A 3I4LA 2R6JA 1YVEI 1A1VA 1RBZA 2R1TB 3LQYA 4HXGA 4XB1A 4XUEA 2ZTUA 3WGOA 1N9GA 1NT4A 3IV6A 3A58B 3X1DA 4MUBA 3NHLA 2GPYA 2XT0A 1LPBB 4R0VA 1Z0SA 1VAJA 3TSWA 3PX2A 1R0YA 5AVYA 1CUZA 2UYYA 4G63A 5EHZA 4GC5A 4E2ZA 3FPKA 4FR5A 4RHCA 3P9YA 4F4ZA 3I3SR 1H0SA 3TMKA 3MJEA 2P0YA 1DO2A 1NXSA 5JC1A 1CDZA 1KI1A 3T1YH 1BCSA 3NOOA 5BW6B 3IUJA 4GMHA 1NQXA 3A1NA 4MHSA 5DHFA 4NVRA 4KMOA 2ZATA 5JZVA 1UXHA 3D8TA 3HB1A 1IBKB 3W7VA 4XDZA 3KQNA 1WKCA 1RZUA 4FI3C 2O0KA 3L93A 1FDSA 3FZQA 2D5CA 2OQIA 3U7RA 5ED4A 2HNKA 1EXMA 1BDBA 4F4WA 3GGSA 3DFMA 5B1DA 2HREA 3DGEC 5ITZA 4IHJB 2QL9A 2FU5C 4R0MA 5AOCA 4MQ6A 1DOAA 1GLVA 3QFFA 1UP6A 3AHJA 4E33A 4M1EA 2WTFA 4UCRA 2BHSA 3JQRA 2BMDA 2OHIA 4GOJA 1JALA 3WNCA 4FHCA 1EFPB 2JLUA 4RA6A 3HJGA 2YNMC 5BNIA 3DZDA 4IJWA 1RHJA 2G4VA 5KKNB 5EMKA 2C4UA 3DOHA 4F5YA 3WB9A 4UDYX 1AY0A 5BVHA 1XELA 4TSFD 4A0SA 2EGUA 4XYMA 2FTKE 3UMRA 1GKLA 2E87A 1AKRA 4PHHA 3NV9A 3AKEA 4RAOA 1XMQH 1K1QA 3N53A 4OK6A 2I4RA 1BEUB 1LBSA 5KG0A 1L1RA 3NKVA 1QHYA 1L8QA 1BGVA 2XB8A 1LPNA 1KFKB 3EH2A 1C3VA 1CDDA 2OO5C 3VSBA 2XD4A 1FNCA 3CZ5A 2NVXA 5I7HA 1FU7A 4M0LA 4BEVA 1HYQA 5LBIA 2GB4A 1FYFA 4P4LA 3UJDA 2LKCA 3BT7A 1JXLA 4BLWA 3NH9A 1H6CA 2VYCA 1KJNA 3A6FA 3BGVA 4N0QA 3WGZA 2O2YA 1ZN9A 2COUA 3HCAA 4OFZA 1IN7A 4MVJD 4OQPA 2A92A 3AL3A 5KTSA 1SXJD 1JQEA 5F2KA 4WFIA 3GGOA 4KO4S 2GYYA 2FPLA 3UENA 1N2JA 3IOCA 3DV0A 1T1RA 1U31A 2WM9B 3T1QA 2W42A 4PXSA 3RYCB 1ZI8A 3S68A 2F62A 3STXA 3PICA 4DL6A 1X70A 5P21A 4TYQA 4W9MC 4FEYA 5CCDA 3C4VA 4AKSA 2WHRA 2ZUVA 3W1WA 2UAGA 2JA7A 2D06A 3OEYA 3LWBA 4DNQA 5JAHA 4FD3A 3ZV4A 3HJNA 2ECPA 1PNTA 2CYBA 4XCVA 2P9EA 4U7TB 3BFPA 1K5DA 3IBSA 5GMOA 2BM8A 3QOFA 1SBQA 3BIWA 2RIRA 1GNLA 5IXJA 4JFAA 1J2UA 4ZT3A 1IWPB 2VATA 2G63A 3T0FA 3RJTA 3GBVA 3KQMA 3MXOA 1ETUA 1XTTA 2QLJA 5D1NA 3LWDA 4PHTA 3IXQA 4NFYA 3I2GA 3NXSA 4O2AF 1YQDA 1X19A 3P2YA 3DXZA 1E2MA 2WZCA 4BLOA 5ALLA 1S3FA 4I9NA 3ZDZB 2FN9A 4U7JA 3L8MA 4DWJA 3M3HA 3K3PA 4TUYB 1CDOA 3ZV3A 1LC0A 1VHLA 2Q45A 2W6ID 3EVZA 1DPFA 1AK2A 1GTG1 1PT8A 1XQ9A 4Y6LA 1QCZA 5I6DA 3CR8A 5CDUA 2W6JD 3WYEA 3H4IA 2SBTA 5GINE 2GAFA 3CQZA 3U3JA 3DM5A 2H0QA 4H3HB 5T6MA 3W5AA 3GH3A 1GTSA 4JJ7A 3LQRA 4PZCA 2C2ZA 2B8EA 1ZJWA 2J5XA 3KYDA 2HUNA 4EKEA 3BAZA 2UUOA 5BWVA 3RLFA 3K6RA 5EIFA 5FPYA 2QRVB 1Q92A 2FEOA 1KAOA 1CCWA 1V7QA 4AECA 1KYWA 3H2YA 2GN6A 4GXRA 3LOPA 1JR3E 1M2VA 2CCKA 5LQRA 2QVXX 5AJUA 4WZAB 3JYPA 2FZVA 1A9QA 1NW5A 4AVYA 5F7JA 1Q84A 3IESA 4LFCB 4HNQA 4V0RA 4UM9D 2ID4A 2Z9BA 5E6SA 2R6R1 4OHCA 1W49A 4M8LA 3KLBA 4U2BA 3VJMA 2ZJYA 4HPWA 4TXMA 3GUVA 3Q15C 1JPNA 1KF0A 3GGPA 2HW8A 1WTAA 3MQ4A 4UVHA 3EOBI 1R0CA 5JXIA 1RPTA 4B34A 1UBTS 4FZRA 2R8IA 4CR6A 1CG6A 4U39A 4D6XA 9ATCA 5E2AA 4LJKA 4Q9JA 5ALDA 3WRVA 4K3VA 1M6HA 5DYTA 5AXAA 5KOHB 4NQZA 1IPFA 4ZI7F 3NUGA 4QJIA 3AJRA 4TS4A 3LGAA 1OX6A 2PX2A 4ROTA 3MNFA 3M5DA 5CGZA 2FWNA 4JX9A 2LPMA 4MEBA 2PWYA 5FXMA 3NUZA 4M7EA 2GYUA 3BWVA 4KQKA 2PJRA 2AQ8A 1FDVA 2FP4A 4Q19A 4JXJA 3QLUC 4EARA 3MRSA 4MV6A 5IKOA 4R2HA 3DP7A 4IUDS 4CKYA 1M8KA 3F1LA 1TJNA 3BH0A 2J3HA 2HF9A 2VZ0A 2UUAH 1Y5RA 4QUDA 5IWCA 2FEXA 3CT6A 2F3PA 4RZQA 3WO1A 3HI4A 5LDDC 2YWHA 5DTIA 4KPUA 1VJGA 2ZGVA 4ZAZA 4U1RA 3OFKA 4JBXA 4IQ4A 3TXAA 5B4TA 3NOVA 4PC6A 1QOPB 4EO4A 3TOVA 4DIMA 1KEEA 1BKDR 2A88A 3GRYA 4J1SA 1XOIA 1Q6ZA 1S0UA 4DW8A 4ARZB 2BQRA 4O2LA 2XYQA 5JNWA 3SEZA 3OETA 4J76A 5J2TA 3A4LA 2Q6TA 1YZVA 3BMNA 1YH3A 1P6UA 2HHCA 3DDSA 2NT4A 1LZKA 3X1ZA 2D2XA 3P20A 4MYRA 2NTYC 4MUEA 2PLWA 5L7WA 1I4LD 3IO5A 5BPHA 1U98A 2B78A 4KH0A 2YNMD 4MW1A 1V6AA 3PQ4A 2ZM5A 2CE2X 4CQMA 1N2CE 1XTRA 3UKOA 5LLTA 3COJA 1FVHA 3V1MA 3BG5A 4QE3A 4QBHA 3HH8A 3PITA 2Z95A 1L4YA 1ADCA 2XUAA 2RBGA 3TGWA 4D26A 2Q8NA 2QUKA 4C0SA 4R9NA 4RQAA 2DTEA 4DQXA 3IQHX 2O19A 3W2FA 3AUXA 5DQIA 4ZOAA 2OCIA 3O6VA 1ULAA 3V00A 4OP1A 3HMQA 1PS8A 2IYUA 4A5SA 3VBCA 2FPMA 3PV0A 2GNOA 3LMLA 2B30A 4XM1A 3N7UA 3RSSA 3HWWA 4YTEA 3K0CA 2BM1A 1NRXA 4CL8A 2H17A 3CB2A 1H2EA 2XBLA 1W48A 2ON6A 2QE6A 5IBQA 5FUMA 2VZ9A 4QOEA 4K6OA 4L5YA 2V7VA 4BX3A 1ONSA 1YOVA 5DEOA 2GI4A 2J6UA 4BP3A 4LMBA 3PT5A 2ZVDA 3E0QA 3PX3A 4FGRA 1J1ZA 2UYHA 3TRKA 1NWCA 5AT1A 3I1YA 4DL4A 1I1OA 1VPDA 4AO6A 3NFYA 3V34A 2J3LA 3ZDDA 1E8DA 2ZRHA 4GRDA 2WLTA 2WIKA 2VJAA 4HEQA 2FSSA 1X3SA 1NNSA 2AOUA 1OYYA 1YS6A 4RHUA 2WD7B 5FX2A 1MA3A 2QXYA 4FEEA 1EUQA 1M8GA 2EKZA 3ICEA 4HGQA 4ARUA 3DAOA 3D7KA 4HMQA 4MVJH 5K1ZA 4YJ3F 4KFUA 3MTQA 2Y76A 2WABA 2J1LA 4L3WA 3ABQB 3H11A 1J7KA 4MVJP 1ECGA 3BQNB 2HTEA 2PY6A 3B7GA 1AX9A 1XZEA 2RGRA 3K05A 4RPIA 1EK6A 2W2MA 4ME6A 1S4QA 1KBZA 1PLKA 2MMGA 5I9NA 1KNXA 2VJMB 2HV9A 3LLVA 4L8VA 1NMYA 1KJYA 2GLTA 1UBMS 1SPXA 2F8LA 4MKXA 1GYQA 2NZXA 4OI1A 1UK9A 2HT1A 4YI3A 4JLUA 2QRGA 1V4VA 4O7ZA 1X80A 2X0JA 5JNTA 3H5RA 1SD2A 2CLFB 3H8SA 3L0YA 3UV3A 5CD9A 2RB4A 5LZ8A 1RWWA 2AL7A 1JFRA 3O73A 3E3OA 1R64A 4BMDA 1BRTA 2XBMA 1AKNA 3CNEA 5KVCA 3MB8A 1TVEA 1L5RA 2BFDB 3AB7A 3KJEA 4M76B 3IILA 2O4UX 1T0PA 3F2VA 3FVWA 2C20A 3C8DA 3EQZA 2VF2A 5DJ5A 1H6AA 1IC6A 1WXWA 1ZSNA 2UVWA 4BV3A 4I0WB 1Y3IA 3T1HH 2I7CA 4KQGA 3R0XA 2FY8A 1WVGA 2Q9AA 4AF7A 4OHOA 1ZBDA 3FOCA 3NB0A 1JHQA 4EB6B 1VM6A 2YVAA 4ZAYA 2CLKB 1I3QA 2O57A 3U0VA 1LI7A 4H0CA 2JARA 1RMTA 1X7YB 4EFMA 2R96A 1HPLA 2Q0SA 3GYBA 1Z73A 1JF8A 4URHA 3NS7A 3AFMA 1EVKA 5TPWB 1J56A 1KU0A 5JQGB 5CG2A 3EVFA 3A27A 2WTBA 4GMFA 1VYVA 4DWOA 3X44A 2BBWA 1CQIB 1OLXB 3VHRA 5CEFA 3UQ8A 4O4HB 4QWBA 1EVEA 5KIAA 2C2YA 2ZB3A 1KYIA 3UHOA 3OQ1A 4AURA 2BV3A 2IXAA 3WL8A 4IF6A 1PDVA 3RVNA 4IFIA 1ORVA 5DM60 1M8PA 3GFQA 1IZZA 3KO8A 4E32A 1PX2A 4HQ0A 4D1YA 2AK3A 4F5EA 1THZA 1J00A 1JPJA 3DTVB 3U4AA 2FEMA 2I0FA 4JJGA 3ZK7A 2R2AA 1RQLA 1NFFA 2HN9A 4WLVA 1K4MA 1X86B 2GEBA 3UOAB 4RK1A 4IGAA 4MIYA 4XCQA 4X41A 4D44A 1RK6A 3O0DA 3PXDA 3V4OA 4F4XA 3IP6A 1UXGA 1WLYA 3G82C 4LDNA 2PQ0A 4LSZA 3C5EA 3KWLA 2ZBVA 1VECA 2ONZA 4IGIA 3OIFA 1U8TA 4KLCA 3EPPA 3TLMA 1J23A 1YHZA 5LXTA 4LVUA 2FUG1 2JS7A 1PGOA 2ZXEA 1OT3A 4AZTA 4N48A 2MWMA 4JI2B 3DOOA 2IZOA 5CA0B 4RJTA 3QPDA 2LDBA 3CKYA 4CUKA 5FA8A 1XHEA 1DG3A 3TR6A 1GU1A 3L6DA 3QY0A 3ZY6A 2Z2IA 3WA6A 4MW6A 1KO7A 1KJ9A 3M7IA 4C06A 1KZYC 4BX8A 4MV1A 1FBTA 4OGFA 5EQFA 2D3WA 3ZLUA 3CX7A 3MHTA 3GA0A 3T5MA 3GCZA 3LQSA 4QDZA 1U9ZA 3BSWA 3FFTA 4FYVA 1LDYA 2P4SA 5G53C 4TLEA 3HY4A 3O3NB 3TINA 2QB5A 1B2RA 5J23A 2GLXA 1BKYA 3JPWA 4XI9A 1R4AA 2R7ZA 3H8WA 4A3MG 5FTLA 5IBCA 4N7MA 2B5WA 2ZWMA 5JEEA 1LFAA 2GFHA 4LNHA 2CZCA 3UXHA 4DR7B 5CX1A 2OVBA 1TWGA 3NHZA 1JE0A 1HSZA 1LNQA 2BKVA 4ZO6A 3UXEA 5DLYA 4AQDA 4BMVA 1ODJA 2OKCA 1CKOA 2FLWA 1K7YA 4R3WA 3IBTA 3D7NA 4JCCA 1I2BA 1Z2AA 4F5ZA 5I7RA 4RTOA 5KFFA 4XGRA 2G1KA 1OB5A 1QC5B 2W6QA 2GTIA 2IGBA 1NJ2A 1F8UA 2FMKA 4PXAA 4ZDWA 4HDSB 3WR5A 2I99A 5EE3A 1UJ4A 2UVPB 4L8YA 1UAGA 4R98A 1HDYA 1WCMG 4LYDA 1CEEA 3JS5A 1KAGA 4H08A 1D2AA 4EL5A 4BO2A 1QO9A 3VU3A 4WXHA 1TT5B 1O6GA 4B3MH 1J0CA 1T4BA 4XVUA 2OILA 2O8CB 5CRIA 5K3EA 2QMUA 1I3CA 2FK2A 2XDYA 4X65H 2BM0A 2NV0A 1OLUB 3HYSA 2P27A 8AT1A 1KDZA 4Q47A 4NU0A 4OHVA 5JYDA 5I8PA 1ODTC 3BRWA 4RKWA 1U3DA 3LX4A 3JQAB 4YXFA 5G1OA 3B3JA 3L5OA 3OICA 2I87A 1GZVA 2HA4A 3P1JA 1QGOA 3HKEB 3LHSA 1ABBA 3L2PA 2NVWA 3USCS 3A1CA 2JL1A 2TMDA 3ASZA 3UJNA 4PBRA 3C6MA 4P83A 5HIIA 2QAJA 1WETA 2YFKA 2PQMA 1U3FA 2XE8A 1NG1A 4GS5A 1VMEA 1R15A 3H18A 2ARKA 2QD5A 4EVRA 3KSBC 3KUDA 4BNDA 1ORIA 4QHTA 4MTCA 2DPYA 3W1VA 4RUAA 5B53A 3S2GA 4FZJA 3AILA 5BWNA 3EXFA 4YLYA 3DFFA 2QVGA 4YONB 3GK3A 4IH1A 3KK0A 5EHXA 2FW8A 2RK4A 3F1KA 4UTXA 2NXWA 3KOZA 3OE7D 5C3EG 3Q10A 1MX3A 1XKTA 4ZRNA 4U6QA 1TKAA 2JI8A 5U4XA 1IEWA 4L5IA 2HRCA 2XF8A 3C48A 1DG9A 3NYWA 2O05A 2WICA 4PEVA 1S3SA 3PA8A 4ZOEA 1N33H 4J0GA 4RA9B 3H2KA 4RW0A 3MSXA 4RCZA 4F3YA 1KDRA 2APJA 1LK7A 3O5AA 4LX0A 2WWVD 3AM4A 1JFFB 5DAAA 1AOXA 1IB0A 4Y9TA 1DZ3A 3SE0A 1PK8A 5JALA 3TCNA 2I7VA 3O9MA 1DV2A 4J0MA 4BNIA 2BEUB 1LPMA 1WY7A 3H5LA 4H35A 4N5MA 3WIVA 3RSCA 3MCAA 3PW2A 1XNQH 2PJZA 1B8PA 1PKEA 2YHBA 4EA9A 2OOKA 1BDHA 4RLSA 2R92A 2V4RA 3HP1A 3PFIA 4WNCA 4ALMA 3I01M 1KJIA 4O3RA 1I2AA 5ECWA 3DHYA 4GOXA 2EZ9A 4NZPA 3KQVA 2VHTA 1X38A 3BGOS 5FWDA 5TQJA 4FYMA 3A6GA 2FOLA 4YCJA 3FM9A 2JC3A 5TS2A 1P7YA 1S6YA 4ZO7A 3BJMA 5H3LA 2PKYX 3ECAA 3GFRA 1ZIDA 4PS0A 1E60A 4Y8VA 4ZVKA 1C9YA 1U4OA 3KOMA 4B31A 3RVRA 5GWXA 1A2QA 2ZYUX 1OX4B 3MJCA 3HNRA 3L0ZA 4QWWA 2WB1E 3JWEA 3QE3A 1GL6A 1VG9B 3BDAA 1ZA2A 4XWGA 3NDPA 1GHTA 4B79A 3GNQA 3QZ8A 4BB0A 3WQSB 1S03G 1NBOA 2EHJA 4CDNA 1WU8A 4EYGA 4QYIB 4HDQB 2WIAA 3CC8A 3ZY5A 1WIWA 2VI5A 2VEDA 1NE7A 4G0OA 1BCRA 4YJHA 1XVLA 3PEUA 3IPXA 2X4IA 1TU4A 3NIFB 1E0KA 3D6HA 4YMLA 1UT8A 4EB8A 1JQKA 1KMIY 1P5RA 3WVNA 1IPHA 3DNFA 4ZP1A 4XPZA 3R3SA 1O57A 4KI7A 2O2EA 1QX3A 4ND4A 3B70A 2YVQA 5B3JA 2FE4A 4ECWA 1Y6JA 4PLWA 2DFDA 3IPYA 2VUMA 3CEBA 3GL9A 1RQ2A 1FFSA 2WSSA 3GLRA 5HUJA 3OF5A 2AT1A 1Z29A 4RJ2A 4MQFB 2B92A 3Q7SA 3M5PA 1WTCA 3CVUA 4W7SA 1NMQA 3BCUA 5LQJA 1ZMTA 2B9VA 2JLCA 3T4PA 3DT6A 1C8BA 2DX7A 3FPSA 4PYJA 3TCXB 1EUYA 3Q0TA 3B1FA 1G0OA 4YLGA 1ML3A 2VXBA 5KOIA 4TS1A 1CUSA 1T25A 3RAPR 1QVWA 1HYBA 2WAOA 2MYNA 4AX8A 2C9CA 2CBZA 1S96A 4XM0A 4UMDA 3KTOA 2PSHA 2YFYA 4Q3BA 3FYHA 1DIOB 4HFJA 1GZ7A 4RPGA 3ZIUA 3IODA 3T3IA 3UK1A 1P5FA 1M76A 3P0EA 3UH0A 4UHCA 2X0DA 5AESA 2OFWA 2B98A 4OHWA 3HVJA 4JROA 4PG6A 1TNDA 3HWX1 3B13B 2Q6OA 3PPVA 4PCUA 4QO8A 4KQJA 5ALGA 1G8JA 1MB0A 2XNCA 3AHGA 1QJCA 3RK4A 3LUDA 4Y67A 4ND8B 1MGOA 3Q8SB 1S3GA 3GT0A 1GLNA 4CMKA 4H1UA 3LX6A 3ICVA 5KJ6A 1IEVA 2NUPA 1HTTA 3LKZA 1RPJA 1AS3A 1BD3A 3K0CC 3G49A 5CM8B 2IRWA 1GNRA 1Z6TA 3AJAA 4B3JA 2P79A 1WZ2A 3CEAA 1ZGJA 1T26A 2QUJA 3EZ2A 3H4VA 5H70A 1COWA 3DNPA 3FGZA 1XQ1A 2ZUWA 3C7DB 4E1BA 4A0FA 1ZK1A 2V8OA 3L4SO 2Y4NA 4URYR 3TOZA 2IHKA 4DIBA 2X2PA 3CMCO 3VTAA 1DEXA 3GTPA 1QSGA 3F3KA 2WSIA 4XVQA 3A6JA 1B6SA 4NQRA 4ZANA 2GLUA 3FLBA 1EUDA 1L7EA 4JOSA 5DFAA 3PNOA 1AZTA 1J8YF 4GQBA 3PC8C 3SZ3A 4GDMA 3I73A 2REQA 2AI2A 1QZTA 3OU6A 4B3XA 1HUQA 1QYDA 1TZJA 4HVLA 1ZUNA 4TOIA 3NDBB 3DE6X 2AQ4A 4WESA 2VUTA 3CMMA 3JQFA 3LPMA 4KPEC 3DF9A 4JI5B 3G0HA 2EU8A 1Y63A 2IV2X 2GK4A 2CE7A 1A9XA 3E9DA 2C9ZA 1E64A 4J2TA 4AP9A 3DZHA 4V39A 3KJFA 4BZPA 4WVLA 5BN1A 1ZUD1 1D0IA 1BVYF 1MEOA 2PO7A 3TMAA 2P2LA 2VQDA 2LE0A 4YMIA 1CBUA 4NAHA 3HU1A 2SKDA 4YA6A 4R1TA 2PAFA 4A8JB 4HLQB 1GZUA 4MS1B 5EJ5A 4FBGA 4G1CA 3ROXA 2YYAA 2DU8A 1YCDA 2IBMA 1E2BA 5FR2A 4KFRA 1U2GA 2LP4Y 3L05A 5EVCA 4A0QA 1U8EA 5CNIA 1VSTA 4QOIA 3O92A 5DHRA 3SQOA 2BFOA 1PT9A 3OAAA 1ZSYA 1E1QA 1EK0A 1V3QE 2JIZD 2PD3A 4QJ5A 2IGTA 2JK0A 3PQDA 5TMEA 2EZUA 1HDEA 3GPIA 5EP3A 1MU0A 1WCIB 2ZE5A 3CFYA 2EX0A 1SRRA 4DAEA 2F59A 4AC9A 1W9MA 3O83A 4N6GA 4NAUA 1SBCA 3OEED 3KJHA 3GBSA 1ZA1A 5AW3A 1XDDA 1SXHA 2YWBA 1II9A 1K4KA 2C5SA 4HNVA 3ZHOA 3GLIB 2GBFA 4OKIA 4B3RB 2GOYA 4QEKA 3WQHA 2WYIA 3QSYA 3E35A 4WZAE 1V16B 1E79A 1UEXC 3L06A 2EL9A 3DDHA 5KT3A 5D5PA 2HSGA 3TW4A 4MVXA 1LF0A 1DQYA 4NYIR 3A2MA 1OBVA 1AK1A 2H2IA 1QK3A 3PFGA 3F7NA 5H0IA 2TMYA 1L5KA 3BXXA 3I6QA 3GJ7A 1U3VA 5IZCA 3KEFA 2JNWA 3SNOA 4QUHA 3SX2A 1GKKA 3HJTA 2HUPA 2POCA 4YR2A 3UK2A 4R1UA 1Y6QA 3RUHA 4CHTA 4K46A 4XD2A 5CLHA 1FS4A 2C8VA 4GPD1 4NV0A 2COGA 2XKJE 5KCMA 4UVIA 3E3NA 4V0OA 1B8NA 2PSSA 3HP4A 4KXYA 4OXNA 4BLSA 1P2DA 1UBHS 1L7PA 1EPUA 1WABA 3SEQA 4A9AA 4RJLA 4UCOA 4PU0A 2C5LA 3RNOA 2DPXA 4YYEA 3GLVA 1PBNA 2G8NA 4RK6A 2VDMB 1HEIA 5DHAA 3ISTA 2BFEB 5CDTA 1Y4DE 3ORFA 4TMZA 1XZQA 4QD3A 3GIWA 2NOAA 4N0MA 3DE3X 1ACLA 4LC9A 1ZD9A 2H0RA 4F4CA 3BWEA 1OBFO 2ZI9A 4AF6A 1WB4A 4XZ3B 1XVTA 5I45A 4PC3A 1RU3A 1VLVA 3MJVA 4GLFA 1GV1A 1C0KA 1LLFA 1EJ2A 1VMAA 2Z1DA 3EB9A 1LSJA 5K4HA 1VE5A 3AKZA 4M9CA 1PG5A 4C2BA 3LRPA 1MTZA 1RI3A 1A4RA 1TQ2A 1P6QA 3ZDEA 3A3OA 3AC0A 1XYGA 2VDWA 4F4FA 3DP9A 4C7JA 3ENWA 3U4QA 1OHHD 1A72A 2XX3A 1XNRB 5I5TA 4AYXA 1E8MA 4RH1A 4EL0A 3TTXA 1XB2A 1ISHA 4L2IB 3UZUA 4AWBA 5LBUA 2FQQA 3FSJX 4NJOA 2BBOA 4BVFA 1U8AA 3WLPA 4CFYA 4KSBA 1Y4ZA 1UXOA 1A2KC 4N8SA 3HDVA 1C7RA 2KSQA 1ZISA 4FOLA 1GZ6A 1T94A 4RPCA 4U7PB 4AAYA 1SXJC 4YDQA 2HIAA 1BW9B 1ZESA 5FJ8G 4U3JA 5JBIA 2R7AA 2ZYAA 4JYZA 5CK5A 2KJQA 2WOOA 2H59A 3WLKX 1MLDA 1A4XA 3U9LA 3IKJA 4XAQA 3V3KA 3QV1A 4ER3A 4QJFA 3K9CA 1CETA 2RH9B 1FYDA 4JC8A 4C7VA 3DVAA 4RGYA 3MPOA 4KQ9A 3HKZA 4BO0A 1I3OA 4W7IA 3OZIA 4HNUA 2XWPA 3M83A 3D1JA 3GT4A 3KQKA 5EYPA 5LPNA 1ID1A 4NMXB 3TMYA 4K1LA 5C8YA 4MEAA 1C3JA 2EJCA 3KOUA 4PG8A 1NUQA 4D25A 2OZEA 1CERA 3L92A 3R41A 4TVKA 1V39A 1JR2A 1X7XB 3D8UA 4DR3B 2PGAA 5A4IS 4GI2A 4EY8A 4KLRA 3KZVA 5I5UA 4HH3C 1XA3A 4FOTA 1E6KA 1TQDA 2KW5A 3NC0C 4KITB 1Y6RA 1XR3A 3GP5A 4U8HA 4IMRA 2OCGA 1SQ6A 3PBKA 3L6EA 3AJEA 3BERA 4ECRA 1E3DA 1XCMA 3C3XA 4MS3A 2HA5A 2C9BA 1DKNA 4QU5A 1U0JA 3V1NA 1UMCB 4BYMA 3HKDA 3NIGB 3PHIA 2B0JA 4B3BA 3IMEA 4PQFA 5CB0A 1XTSA 1C4KA 2O2ZA 4UFNA 5KYTA 4G25A 4JI6B 4BTVA 1UMBB 2H4XA 3WK9A 1W76A 4DG8A 4V0SA 2UUBH 3VNSA 2HFKA 3PR2B 1M8JA 4RANA 1USKA 5LQAA 1TZ2A 4Z7NB 3AUFA 4WE3A 4N5IX 1SBTA 2YXNA 5IMBA 3OQBA 4EVQA 1QFZA 1YB4A 3U60B 5JHGB 4IOKA 2E5FA 1KZGB 3QHPA 5BN3A 2ZPTX 4BBSG 1O8BA 2XCRB 1CVIA 3MRVA 1UK7A 4IHKA 1XCLA 2L2QA 3HLYA 4XUGB 1OVGA 4PIVA 2EQ5A 4WZZA 2V97A 3GQCA 4RXMA 3G88A 4FYJA 1RYBA 5HEKA 4U4AA 3ETCA 4YRQA 4PAOA 1E7MA 2VZ8A 4DJ5X 2E2IA 3D4NA 1E9SA 3RPEA 2CCGA 1JX4A 3N0WA 4KU4A 2R4TA 5EI5A 5EUCA 3ND6A 3ZQ6A 1P80A 1V1MB 1AO3A 4P3YA 1PWEA 4CEHB 2R25B 5B1IA 4O7RA 1HDGO 4BMOB 1F8YA 4IGKA 3PD1A 1US8B 2WT9A 4N7JA 3VGPA 1PSDA 3MYYA 5BQPA 4D5EA 4A2AA 4G0UA 5FULA 1FZTA 1Y1QA 2IK8A 5HKLA 4AW9A 3GQBB 4RVGA 1CUUA 2EW1A 3BDVA 3G1TA 4G0ZA 4LFBH 3S8EA 1Z0DA 2HIMA 4MQ5A 3WK5A 3RSOA 2AN9A 3MN1A 3SOZA 5A3RA 3ZV5A 3KG2A 4U7FA 1QYWA 3KT3A 4GKJB 4MW4A 2JLAA 2J6CA 2ID7A 1UP4A 5BOSB 4KNVA 1P0QA 4DR6H 1LW7A 3T0IA 1ZW6A 3VV2A 2NSHA 3ZN2A 3GJRA 4BN4A 2Q46A 1UF9A 3H65A 2VH2A 4HGPA 2QTWB 4I5IA 1M1NA 1FUYB 2A0YA 1J0AA 3W6UA 4Y3UA 3KB6A 3I2KA 5EFOA 1DHTA 3KAQA 4GSLA 5LKRA 1VG8A 5FLXW 4F72A 1GUZA 4KODA 4IQFA 3KSZO 1WXXA 2DFNA 4KDFA 4R0NA 3BFVA 1XEWY 3HY3A 4Z9BA 3PQ7A 5B3JC 3QEAZ 5F9FA 3AL2A 1C80A 5MFPA 4YP3A 3P9SA 4HNTA 4CW7A 1HDOA 1S2OA 3ESDA 3JAWB 4LGVA 5BXQC 3P9XA 4P80A 1KZ6A 5DGTA 3ZWYA 2LCQA 2XZPA 4H1HA 2BE9A 5HUHA 2ZYSA 4ZCRA 4NXNH 4FE3A 5ICCA 3MTAA 1AKWA 4HDNA 4RK7A 1YZUA 1I94B 4HG2A 3O1JC 5EWJA 2ZRGA 5DBIA 2Z9CA 4NBVA 1R3UA 5BYKA 2PANA 1D03A 3M81A 2E4VA 3OHSX 1XVUA 1N8KA 3EUFA 1QE0A 4QODA 5K0CA 4UM5A 3H8VA 3BHJA 3HXOA 1B76A 2NWQA 2O8DB 1IBSA 2XE7A 5CTJA 1OZAA 1GFSA 2DRIA 1A5ZA 2F2TA 4JUDX 3PVXA 3ANLA 4GWGA 3TE7A 2UXDH 4EBBA 5JUMA 4NNJA 4ML3A 1EDEA 2R44A 1KDPA 2W4MA 2R79A 4JBHA 4IR7A 4CCYA 3NYRA 4W5OA 4EFLA 1EH5A 5A5FA 3CN7A 2E49A 2UU9H 1PJAA 3VX3A 2ZSEA 3QVXA 2EAUA 3R74A 3QEMA 4I4IA 1UXKA 4YAGA 5JO0A 1KORA 1CIJA 1IB6A 3AFGA 3EH1A 4NZNA 5DPMA 3GG2A 3O95A 3TF5A 1VJRA 4R6XA 3QVWA 3BRWD 3OY2A 4QQNA 4KG7A 4ECEA 1L4UA 3ZVKA 2OFFA 4QJBA 1HMYA 4C4XA 3NT2A 2XUDA 4OHBA 3TQTA 1Z16A 2DT5A 3H17A 2P67A 3QY9A 2JLWA 3AESA 2H54A 3Q1LA 1VG1A 2YWJA 3DMGA 2D7DA 1UJMA 3U16A 2GDZA 3FAZA 4JEUA 4G1VA 1JV2B 5AVVA 3HTXA 1MHPA 3V8MA 4E07A 3HKCA 4AMUA 4XQGA 4GLJA 4JCOA 2HCTA 3JW8A 3S24A 5DB4A 1G2IA 1XU4A 5IS2A 4O2RA 1P0IA 3EQ6A 2QWXA 3PD7A 4JQSA 3OQMA 3EUAA 3KEQA 4W5JA 4I8DA 4TQAA 1S2NA 3VZQA 3R3HA 4RTLA 4ZI7A 4A3BG 2RG1A 5I9LA 4JP5A 3AW9A 2H85A 4LHXA 2ROQA 1QTIA 1C2TA 2PQ2A 1FFGA 3PDJA 3B2EA 6AT1A 4BJ6A 4EAQA 2V59A 3OLVA 4B35A 1SM4A 2ONJA 4BAUA 4EMUA 2BQUA 3N75A 1JAZA 3MFIA 4FFSA 4DADA 1AKTA 3W34A 3RYIB 5BYJA 2M6SA 2H48A 2R1VB 4GPEA 4WHMA 4BUJA 1D2RA 4WK0B 2R8EA 5IDYA 2ZYRA 3ECCA 4YAUA 5K99A 1GCGA 2Q9BA 1E7YA 3LQFA 1WB5A 5K6AC 3QX3A 1OD6A 4CKXA 3ZE6A 3Q40A 4OU5A 4G24A 5EMHA 1DEKA 4RPLA 1VJ1A 2X4LA 2Y1LA 2CNVA 4ZKEA 3FCUB 2IBSA 3PC6A 1H8HD 3IAAA 4CIBA 3A9SA 3FWKA 4RJKA 2H63A 2V3VA 4CCAA 5E4TA 1Z7GA 1SHUX 4MO9A 3IHLA 2HMVA 1Z83A 3NBXX 3ZBUA 1J4AA 3K4HA 1TJ4A 5LDHA 2FPIB 2OZKA 2HWKA 3PLNA 4W8OA 2WSMA 4O4JB 4UQPA 1HO3A 3HB9A 4WN3A 4R83A 4LQLA 1ESCA 5KREA 3SQMA 3R24A 4ALIA 1G21A 1NKVA 1I5RA 2I3BA 2C4VA 1K75A 5D3QA 4WNIA 2ADOA 1P19A 2ZJ5A 2BFFB 4F6RB 3A6PC 3J7AC 1OWMA 2W2XA 4RMJA 4FQ7A 3NTQA 1QHNA 4H4CA 4Q82A 2X5RA 4HGNA 4BUZA 1JJ7A 1FY2A 2ASEA 1PGJA 4XD7A 2QRHA 3C3YA 4Y9SA 3GDEA 3VOSA 4UBIA 4AJLA 5DP1A 3ANSA 3KPJA 3VKVA 1TU3A 2XCIA 4L8GA 2BEVA 1DEHA 3KAJA 2R5WA 3RIXA 5G0UA 4CLHA 3RBEA 2OV3A 2FETA 3ICQB 1J5PA 2OFPA 2G83A 3KDSE 2Y6UA 3DXXA 4BGEA 4L16A 2X7HA 3ZIAA 1GRNA 2FVYA 3DE1X 2B6NA 1O5IA 3LPCA 1XK5A 2J4FA 3GIPA 1JG4A 3UC9A 5DCYA 2JATA 2J5KA 2X42A 1TAQA 1PCXA 2X8AA 1Z2DA 4RKYA 5TQ0A 2NO0A 2Z2XA 4BAGA 2OTCA 3T38A 3CSSA 3OIDA 2ANCA 2WSSD 5F1KA 1KAMA 5EG5A 4ZOLB 4U9HS 4QVKA 3QELB 4BKPA 2XXAA 4HEA1 2VKTA 1VI5A 5KFHA 3LT2A 4KVAA 1NJFA 1TIPA 1ICIA 5T6BA 3QU2A 3TBKA 1I1MA 1KIAA 4Y2PA 1RHUA 1IAQA 1ODSA 3GU3A 5KQRA 1R88A 3LBAA 4YJ3A 3NR2A 3AEKB 2BGWA 5I4IA 3N6RA 3ZWMA 5TR9A 3NDJA 5HR5A 4ZZIA 2PZ8A 3H5AA 4YUXA 1W0KA 5IEJA 2H1HA 2CNKA 1M0WA 1XDNA 2PT9A 3GJYA 3DHVA 3S8YA 3UTDA 1JQ3A 2QTHA 3U26A 5F9HA 1OB2A 3OLQA 3ND9A 3PKIA 3DEKA 3NHUA 1NF9A 4C2TA 3R5JA 2BR4A 2E89A 4BEWA 4IDQA 2X0RA 2A1HA 4UEOA 1J6UA 1PG0A 3GN1A 4ENPA 3W4KA 4EYOA 3LJKA 3SZRA 3FNBA 3HJRA 4YWJA 3F2IA 4YAOA 1UIMA 2VQ3A 1ZVQA 3BGDA 4DUZB 4M7WA 5J5AA 2HHJA 1JKFA 3PC3A 3PHGA 4P3NA 3PQ8A 2H92A 3R7NA 5IP9G 5L3RA 1GT91 3KZNA 2YZLA 3UGQA 2C3YA 1GO3E 1E77A 3QPCA 2W8ZA 3EDCA 5E7MA 3VAAA 2QP9X 5AVKA 1GKIA 3R40A 2Z8YA 2PZGA 2NU8A 4X91A 1E1DA 4KH1A 1COWD 3WQBA 1Z3IX 2XGSA 3ENZA 1G7TA 2MINB 2WRZA 2B9EA 4DLVA 1F7VA 1CDEA 1YZYA 1SUIA 1X77A 2EFHB 4DR5H 5EE9A 1VLJA 4ARCA 4BP1A 2VHQA 2Y4RA 1OKKA 3A4IA 4LMRA 1U7WA 3IAFA 4UPDA 2AEMA 2DPGA 3N43B 4BMCA 2JGEA 4UKDA 4YMSA 2CLIB 4L8WB 1NU6A 5MFZA 6REQA 3A37A 2AK2A 2FPKA 4RJIA 5KKCA 3IB3A 4ER5A 3E4DA 2C0QA 4Q0MA 3N0RA 4GEKA 3KHSA 1SUBA 2CDCA 4DDWA 1A04A 1UC9A 4O84A 2JJ2A 1V1RA 5B37A 1HDIA 3PW0A 3IGFA 2XSZD 1CYDA 2QN9A 1KR5A 2CF6A 2AGOA 2VQ6A 3HO8A 4N76A 1M6VA 3FLMA 3NKLA 1U3UA 2PBZA 3A6LA 4XSGA 2W2QA 5C5CA 4D45A 5FBHA 4EZEA 2Y93A 4GP6A 5LZ9A 5JZMA 3AR2A 1IJEA 1VLHA 2R68A 3JTMA 2YQZA 4TMFA 5KHOC 4G86A 5K0FA 1EP2B 3V8BA 2OV4A 4DA0A 1KOGA 4B0PA 3V2HA 2QVYX 3IP8A 3Q7QA 1K9SA 3QGMA 4PLPA 3THOA 4RYLA 4Q3CA 3ZZ1A 4C0HA 4C88A 4B3TH 3EEIA 4KZKA 2WAQA 4UJ5A 1VIMA 4RCYA 1IRXA 1QFJA 3BORA 1POXA 5FPTA 2QEQA 2CY0A 3IEIA 2PSFA 4L0MA 3KIPA 1AM4D 1JQAA 3L46A 1CUYA 3OH8A 2DPMA 1E1QD 1GM5A 2ET6A 4DCPA 1E4OA 3OEHA 3OTOB 1T1IA 3ZV6A 1T5SA 4XWOA 1RWPA 4PRYA 1EIZA 4X5OA 1HRDA 4HNGA 1XF1A 3WRWA 3OIGA 3REFA 4DARA 1MABA 1I4EB 2V8BA 4ZYYA 4MWTA 5IDVA 4U6SA 4WFJA 1CZNA 4D3SA 1XN1A 4HCJA 4H6XA 5LL6P 1CXZA 1UM9B 3GAMA 4MQBA 1JLHA 4OHKA 3ROGA 5JYCA 5A5VA 1FZQA 1PJLA 3I53A 2PXHA 3FPCA 4CMCA 3CS3A 3K5IA 1JTVA 5DNAA 3HU5A 2HHHH 2I5PO 2YOHA 3GP8A 3WFZA 4J0QA 2BGRA 3WYCA 2D7CA 3RANA 3SYMA 4G0MA 4RMHA 2X9QA 5FTKA 3CF4G 1Z6AA 2VJDA 1E79D 4E31A 4FMDF 4R2IA 5DH9A 2DAAA 1XKQA 4O6VA 2JIPA 3EIWA 2AC2A 3GC6A 3HOZG 4KLNA 2HF8A 2YWRA 2ZWAA 3SBXA 2V0GA 5JXHA 3UT6A 3W6NA 1LLCA 2OO7A 1B16A 2O4CA 3OSZA 1JPUA 3PNPA 3BE6A 3GLIE 4LGCA 5ERGB 3QEOA 4FOOA 4BGUA 2QUHA 4TTPA 1PAUA 4H0NA 4LC0A 4O3QA 3EASA 2ECOA 1U9CA 1O9BA 4TPKA 4RX1A 2DT8A 4MGIR 1Z25A 4N0DA 3TW8B 4E3WA 4ZQBA 1YBVA 2L19A 4DRFA 3PTLA 1G5RA 3CUKA 1LU9A 4ILEA 3WMFA 5IJ0A 2FPGA 2WHEA 2F4VB 3ZCUA 1CRPA 4UCSA 1XO1A 1CEYA 1BJKA 1IY9A 3I0NA 1YE8A 1MEEA 3FUWA 4UEWA 2VPWA 3RS5A 1EWKA 2ZSBA 4RK4A 3V8EA 3RSHA 3WI7A 4Q7KA 4X7BA 5HFAA 3OUTA 3AVWA 2ZTVA 1ZR2A 4M6WA 3WGQA 4AKTA 3T1NA 1EM6A 2FHPA 4Y98A 3I1FA 1TC2A 5FEMA 5BMVB 5AK3A 4XOUA 4C14A 4C43A 2GO1A 4RVNA 3R9IA 3VM6A 1Y6GA 4HKTA 4DLRA 3T5AA 4RF5A 3KFXA 5TY0A 3P0FA 1QAMA 1ZKMA 3IPRA 4JP2A 1UBOS 1GL7A 4DN6A 6ADHA 5L1LA 4UHDA 4BFWA 3U44B 1WV0A 2P5TB 3OPMA 1FSPA 5D7NA 1BHJA 5AK5A 1K1SA 2X3UA 3GWGA 1TO1E 3BACA 1NPTO 1REQA 4L4SA 2AKYA 4JI1H 5AW9A 1K7CA 3E9CA 1W59A 3R4CA 1LRJA 5G1PA 4YCDA 1VIYA 5JECA 5FI3A 1RABA 2OESA 3F6YA 1F12A 2XV1A 3D7RA 3PR1A 2CXHA 3SF8A 3DTYA 3G2NA 4FLMA 4YRDA 4Z8YA 4YV7A 3BFJA 2GKOA 1N2EA 4DMKA 3HOYG 3OO1A 3Q4GA 4D3XA 5KYXA 3JD0A 3HXLA 3GIKA 5IHXA 1Z36A 2V3CC 4URXR 2C31A 4ZALA 5JCJD 1Q7RA 2Z3WA 1ECBA 2GJ4A 5MGNA 3P45A 3VC2A 1SO8A 3PGKA 7AT1A 1QYRA 2QGZA 4YJFB 4ISCA 1SWWA 5DNWA 1B23P 4LQ4A 5B1EA 4LZWA 2FWPA 2JHAA 1VPEA 1TM4E 1RXCA 4M7RA 1CJKC 1KQFA 3WL6A 1RRFA 5CH5A 1YE5A 3BHIA