2FPIB

Crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
393
structure length
393
Chain Sequence
b'MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 116
structure length 393
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2fpiB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2fpiB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpiB03
1PK8A 4FGRA 4MA0A 2W6OA 3BG5A 2DWCA 4YBZB 4O7VA 2R86A 2FPPA 1CS0A 4O4LF 5JVDF 1M6VA 2X0SA 4DIMA 3PFFA 3U9TA 4O83A 2CNUA 4YAKB 2R82A 2NU9B 5CA0F 3R5FA 2FP4B 4O7RA 2R87A 4YBZA 2YW2A 1JLLA 1I7NA 4O4IF 5J2TF 2NUAB 2YRWA 2R6FA 4YJ2F 2R7MA 3LP8A 4MV6A 4YAKA 2V5AA 4FU0A 4IHJF 5LOVF 1IOVA 2J9GA 5JH7F 2NU9A 2YYAA 3V4SA 2QK4A 1EUCB 1Z2NX 2ZDHA 2NUAA 3RV3A 2CZGA 2R7KA 1AUXA 2GPSA 1EHIA 1KEEA 1C30A 1EUCA 5FNVF 5C8YF 2YZMA 1KC7A 5C1OA 5CAEB 4MV4A 4O86A 4HQ6A 5HV6A 4XYLB 5LP6F 5K2MA 4I4TF 1A48A 4TV8F 5JQGF 2YZNA 2YZLA 3R23A 2HGSA 1C3OA 2PBZA 2R7NA 3KALA 4XYLA 3N8DA 4O7NA 4YB8B 4IZOA 3R9RA 2W6PA 2CSUA 1M0WA 1GSHA 3Q2OA 3ETHA 1B6RA 4O82A 3TINA 2QF7A 3UFXB 4O81A 1Z2PX 2YRXA 2V58A 1AUVA 3KAJA 2W71A 4MAMA 4YB8A 5GONF 1KBLA 4ZI7F 4C5AA 1ULZA 3SE7A 4O7LA 1CQIB 3UFXA 1E4EB 4FE2A 2GLTA 2GPWA 3LWBA 1JLLB 1B6SA 1W93A 3GIDA 4FFLA 5CB4F 3QFFA 1JDEA 1CQIA 1CQJB 3G8DA 1E4EA 2W6ZA 3K3PA 1T36A 4QSHA 1DV1A 4L1KA 2NU8B 1W96A 2R7LA 5D8DA 5CA1F 1SCUB 2P0AA 5H80A 4O84A 3HB9A 1CQJA 2YV2A 1UC8A 5LXTF 1UC9A 5KX5F 4FFPA 3AW8A 1VBGA 4O7ZA 4TUYF 2I87A 2NU8A 4O2AF 1SCUA 3TIGA 3GLKA 2FPIB 4ZHQF 3RUPA 1OI7A 4MV8A 4M9UA 2DIKA 3JRWA 4O4JF 4EGQA 4WBNF 4DLKA 1KJIA 2W70A 2FPIA 5JQWA 2YS7A 3OUZA 4FFRA 2NU6B 2VPQA 2FB9A 2YS6A 3HBLA 1EUDA 3NUAA 2NU7B 3ORQA 4HNTA 1I7LA 3AX6A 5LA6F 4EG0A 1KJ9A 3WNZA 5HBRB 3U9SA 5EZYF 2NU6A 3U54A 3ETJA 5BPHA 2NU7A 2Z04A 3TIIA 2PN1A 2XCLA 1OBDA 5HBRA 4YAJB 2GQSA 1Z2OX 4MV9A 4E4TA 3MWEB 3V4ZA 4O7TA 4C5BA 3N6RA 4MV7A 3K5IA 1EZ1A 1GLVA 3VPBA 4C5CA 4RZQA 2YZGA 4YAJA 1GGOA 4FFOA 4TV9F 2OLSA 3HO8A 3TQTA 3MWEA 2CNVA 1A9XA 2GQRA 1CE8A 2W6MA 2WYOA 2PVPA 1KJ8A 5JVLA 5I47A 2YL2A 1EYZA 1IOWA 4NYEA 2R84A 3E5NA 3VOTA 2VQDA 1VKZA 3VMMA 2R85A 1DV2A 1GSAA 5J2UF 3Q1KA 1KUTA 3TW6A 1KJQA 3R5XA 4EGJA 4FFMA 4WD3A 2XD4A 3KREA 4I55F 4MV1A 5C1PA 1BNCA 2FPGB 4O7WA 4IWXA 4ZQIA 4HNUA 2CQYA 4IWYA 4YJ3F 2FP4A 1M0TA 3U55A 5KKNB 1EUDB 2ZDQA 3DF7A 4O7YA 3I12A 2W6QA 2V59A 4IIJF 4XYMB 2YWVA 2Z02A 2FPGA 3G8CA 3WO1A 5BPFA 4HNVA 2DLNA 2W6NA 1JDBB 1DIKA 2DZDA 4I50F 1JKJB 2IP4A 2I80A 3KAKA 3R5HA 4XYMA 3MJFA 1KJJA 4MA5A 3RFCA 3DMYA 4XX0B 1WR2A 4ZOLF 1BXRA 1JKJA 5DMXA 4ME6A 5CAEA 4Y8VB 2SCUB 3JRXA 2CNQA 2I8CA 4MV3A 3MWDB 4HR7A 2ZDGA 4O7SA 5IYZF 1PX2A 4XX0A 3OUUA 4XZ3B 4O4HF 2YV1A 4Y8VA 2SCUA 1OBGA 3K5HA 2HJWA 3VPDA 4FFNA 1GSOA 3VA7A 3MWDA 3VPCA 3ORRA 3JZIA 2FPPB 2VR1A 4XZ3A 4O2BF 3WO0A 5BMVF 5LYJF 2C00A 3JZFA 3RV4A 1VBHA
chains in the Genus database with same CATH superfamily
3BAFA 3VISA 3C2QA 1AKUA 1T3ZA 3EQ2A 4ZVLA 2D0IA 4FNAA 5H4GA 1UL1X 5JARA 1O9HA 2PKRA 2A78A 4AJOA 1XZJA 4I50B 5KT4A 3A9UA 3RUCA 4GMKA 1YZNA 3JARB 2JF0A 5ILQA 4EUFA 5DP2A 1MJ5A 5GJCA 3O8QA 4MCIA 4J6FA 1GG2A 4HWRA 5FLXW 4WOBA 3HOXG 1W0KA 2QD2A 4RNMA 2FJ0A 3MHTA 2VTVA 4RLQA 3VKGA 4MAAA 3I5YA 4XIYA 3OWOA 2R48A 4ZZ1A 1HQCA 3EUWA 5AJVB 2IVFA 3L7KA 2BM9A 4OSOA 4CQMA 1D6SA 2QTLA 5K8IA 3OTHA 3GH3A 5ICCA 2ZWIA 4B47A 2HXSA 5GPBA 3OTIA 3IYLW 2CLIB 2VWPA 1KL7A 1GNRA 1HE2A 4MUYA 2ZWAA 2QUAA 3R6TA 3RUDA 3HBNA 4DCSA 1UQRA 3PGVA 3Q15C 4AUEA 1GA4A 4YLGA 3JAMW 3DPIA 4GICA 2HCFA 1ULZA 4Q3BA 5KYKA 2EAUA 2PUEA 1Y4SA 2KBEA 4Z99A 4K8RB 4CEJB 3GLUA 4IHJA 4Z5XA 4U5XA 2C7RA 3DVSX 4HDKA 1F14A 4QVGA 4PRYA 1ESZA 1W59A 5C1DA 3B53X 3DF9A 4LF4B 2YTZA 2RG7A 3NJ4A 3WK8A 5L4SA 1FP7A 3CH4B 1US8B 1QCYA 1AMNA 4C29A 3K70D 2J5KA 3UH0A 1TJNA 3PN1A 1D2MA 1Q1QA 5KFDA 5ADWA 3TAHA 3WNQA 4ZZ3A 4FLFA 1EGHA 5T3YA 1F4LA 3CVJA 3RU3A 1H5UA 3OQPA 1X7DA 5KYUA 1ONNA 1VPWA 1IDOA 1SC9A 5JQWA 5DGXA 4WY5A 1ZM2A 1V0JA 4EAQA 3CINA 2WMOB 4MQEB 3TOSA 1FBNA 4DYVA 3PQCA 1GNVA 4KPUA 4C3UA 2J5QA 3LT5A 2VHEA 4MYCA 1XNQB 4KO1S 1MG0A 1M74A 1A9ZA 3G8AA 2QX8A 3CLTC 3NQ41 1JQLB 2LP4Y 1ZMBA 1RE0A 5TT1A 1BQ4A 5KT6A 3DXXA 1K5DA 3UJDA 1K27A 3FFBA 4MS4A 3KVVA 3D6UA 2RDMA 1KAEA 3IQZA 3GTKA 2XCIA 4YONB 3WGQA 5K3CA 4JENA 5IG2A 1EB9A 2XRMA 3DOHA 1S0OA 5CX1B 4AK9A 1P7WA 2J6IA 3EA4A 3WP1B 5DM60 2NPOA 4KWIA 1PGPA 4E1AA 4OHUA 2W2PA 4AZVA 2H18A 1M1YA 4F06A 3PPVA 2Y0SA 2I2CA 2J9XB 1NX9A 2Q2UA 3MF4A 2ZBFA 2I5PO 4LDQA 2GILA 3WGZA 4FTWA 3FMGA 5FBWB 3K32A 4NFLA 4R0NA 5KKNB 1BWSA 5FBKA 1O4WA 4QWAA 1KVUA 4CF5A 3NNDA 2SKCA 2A5FA 3T9EA 2D2FA 3L7YA 3L04A 4M0PA 3CIFA 4HUJA 1G6OA 2O5VA 3WIUA 2GEFA 3T35A 3GZTB 5B7NA 4PZAA 1FFXB 4DCVA 2Q5IA 1PJTA 5D5HA 3H2GA 4W5NA 1TU0A 3FBGA 4M55A 1B6GA 2FFQA 3NH6A 4XM1A 4DLVA 3O26A 4Q4JB 2BV3A 2UDPA 2G40A 4LNUA 1V3VA 2QN1A 3A11A 2WSSA 2NN3C 1T4MA 1GOTA 3G1WA 3OUUA 4O4HF 5B2ZA 4UAGA 1DHRA 2AK3A 3GZNA 5GJVC 4ZAGA 3PUHA 4I9UA 3TS1A 3CPHA 3OKFA 1NXOA 3DG9A 3TB6A 4CLEA 3ONDA 5AJYA 4NCHA 3HZZA 2WWGA 3PGJA 1V48A 4RYDA 3FD8A 5JSKA 5KFSA 4R3UC 1QV7A 3DEKA 3SSNA 5ITSA 4RK4A 3R4VA 4JL5A 1KARA 3X0DA 4X24A 4DLZA 2ZSJA 3QELB 3U4MA 2JCSA 3QXSA 3EIUA 3D8HA 4J94A 2PZMA 3RBDA 3DEIA 1YDHA 1HYEA 5DYNA 3QKRB 3RV3A 1N6HA 3VM6A 2Y1WA 5CNKA 4S0XA 4O4HB 1KEEA 2D06A 1VIDA 3L01A 1YDWA 1QHHA 2MR5A 1PQYA 2I4IA 5KJ6A 4S24A 3VC3A 3KAPA 3LULA 3K9LA 1Z5GA 1UM8A 2CL6X 4ANFA 2PGOA 4E4YA 2JS7A 4HMOA 5EIOA 4R2MA 3ROMA 2Q6OA 4JQCA 4G56A 5BRJA 2PJUA 3TINA 1KKLA 2VBFA 3M4JA 1CY8A 1Z15A 5DHSA 4IQ0A 5L95A 3OJ0A 1PSZA 5I5TA 2F1KA 5KFAA 2OD7A 2BMWA 3E1SA 4A5OA 1JLLB 3QLVC 1E1CA 4H59A 1D0IA 4UM8B 3Q7RA 4JYZA 4RYLA 2B4RO 1TO2E 4DV3B 1Y9ZA 3FKSD 4F38A 3RW9A 1H93A 4CEHA 2YHIA 1XK5A 1WW3A 3DEAA 2H5IA 4DY4A 4RO0A 2RMKA 2QJWA 3ZHVA 2JEJA 5CFQA 1I5EA 1NBME 3D9QX 2GFQA 3BE8A 1RC1A 1T0BA 5KOHA 3JR3A 1XEXA 1I3KA 4IJKA 2JK0A 5I4CA 1NBMD 1QR2A 4J4HA 3CNBA 2Z8YA 4EMBA 1OPXA 4DRFA 2AD1A 3TY5A 3PEUA 4O0LA 3NBAA 3B2EA 2AI1A 2YINC 3S27A 1T8YA 2J7KA 3B3QA 1N48A 4HDRB 3NFYA 1P9OA 1IYDA 2G4VA 3GFBA 4RKRA 4HYQA 2XTMA 2PVSA 4BZQA 3TF5A 1UJCA 4KVGA 5TF4A 1Y98A 2NZUG 3DOCA 3EXG1 3F3KA 3W5JA 3QXHA 3PW5A 4N7MA 3JALB 2QP9X 2PUFA 4C5CA 3Q7IA 3PUJA 3D3KA 2VDQB 2DPGA 1UIRA 3I32A 4DNOA 1FTNA 3V7FA 3GYBA 3C14C 4DLAA 5D00A 3WYNA 4XUCA 4QOJA 3VPAA 2ZATA 3SBDA 2ZP1A 1IOWA 3KYDB 1YI1A 4PNZA 4P5EA 2V6GA 4QQ8A 3GFRA 1MTOA 3EGVA 3CEAA 3HEAA 4G8JA 3WK4A 2O8DA 4JY7A 3WWOA 2H07A 4WPGA 1JEYB 2Q3LA 3TVTA 1RABA 4QEZA 1JWLA 2FPUA 3GRRA 3GTJA 4J0DA 1NIJA 3GD5A 4L50A 3BWDD 1E5QA 4IBOA 1CEEA 3X1KA 4CN9A 2WZQA 4BQFA 3RGZA 1CNFA 4P7BA 3HA7A 2VZ9A 1EWRA 4ENPA 5J5CA 3CPJB 2JFGA 1GZSA 1FP1D 1T9BA 4QZVA 1CVRA 5IHXA 5EZSA 4WCFB 1EVQA 4PO9A 4LRWA 2RGBA 3OO1A 3W2GA 1M8GA 1G4AE 3IUJA 3NC4A 1CXZA 2ATEA 2O2XA 2BFDA 2P9FA 1CJTC 1J5XA 2D7CA 2XAAA 1XZ8A 4IS2A 1CWUA 1Z9BA 1GUDA 5JW6A 3W2FA 1GT91 5BURA 5AVWA 2ZUDA 2JFQA 4UEKA 3PNLA 3H83A 1P3JA 3KM0A 4MULA 3WMGA 2WAXA 1DVRA 1Z74A 3U9TA 1XAIA 4M0DA 1DAHA 4ZV4A 5IJWA 3W7VA 1JSRA 721PA 4P80A 2ID8A 3RRYA 4NEHB 4JJKA 3OZ7A 4BMCA 1JALA 5IJ0A 4BASA 4YMWA 1KVRA 4DRZA 4ZP1A 2M6LA 4RVHA 4GKJH 3IESA 2WKWA 2H54A 2P2LA 2W2QA 5KYXA 2DAAA 2F9LA 3Q8QB 1YA8A 3GLGE 4G36A 1AU9A 4PFQA 1DRVA 3DLBA 5K0SA 4XYBA 1PNOA 3QQ5A 3WLAA 5HKBA 1Z2CA 3A58B 3EF1A 2FN3A 4JU9A 3KB1A 5KG6A 4DPLA 4PPYA 2DR0A 4F5EA 3O1JC 4P3PA 3ROTA 3JAWB 3V4OA 2H00A 4YCBA 2AQ4A 1JSCA 2QSUA 3DWGA 3W34A 4QYXA 4J1TC 4PZUA 1YKSA 2ORYA 5FBVB 1A9TA 3QK7A 1IBMB 1A4IA 3GGJA 3M4IA 3IV9A 4N3AA 4XIFA 3PPYA 5AO9A 1UOQA 2ZE7A 1EESA 5DG9A 1OWMA 1CU1A 1NURA 5CVUA 2WPNA 1N25A 3QBJA 2CLCX 4TMYA 3TYXA 5ILOA 2OGWA 3EHDA 3VPHA 3W8RA 4BY9E 1H9BA 2IPLA 3B2QA 1NJ1A 4R8VA 3KB2A 2VUGA 5BYKA 1OXSC 3QX3A 4Q9KA 3TSOA 1RKXA 4MYHA 3EAFA 4B2PA 2ZR8A 3F1KA 5A71A 5AI4A 5JISA 3KTMA 1DQYA 5CXQA 1T3TA 4FJ1A 5TPWB 4U9IS 3FUTA 4QOGA 2XT6A 2DCUA 3HKDA 2E9SA 3VSDA 1O1YA 3T5PA 3V55A 4Z7QB 4MP3A 3LXMA 4J9QA 3A1WA 3EFBA 3SG0A 4Z53A 4EG0A 5EKXA 2IXAA 2HBQA 4JQZA 3O8OB 4M9QA 1SPXA 3GL9A 3GXOA 1COWD 4MKXA 5CB4A 2CHVA 2XA9A 4R1NA 3T5JA 1F2UB 3ZVKA 2BFEB 3WIOA 3NH9A 3C7DB 3VVBA 3TLGB 4XDZA 4L6AA 4WBXC 2VDWA 4BVAA 5CYFA 3DTVD 5L40A 5KEIA 4ZCPA 1N0HA 5K4AA 3FYUA 1SO8A 2CJYA 1NJ5A 4DLSA 1NSFA 4FT4A 3BXPA 3TB4A 5HIMA 2PEYA 3C0FB 3I8OA 5H4HA 1OQAA 5G3YA 4NS1A 3OZRA 3LUAA 4ZQIA 4B6OA 4JDUA 4A6DA 3R3WA 5F21A 1EFDN 3OI7A 1DL5A 3CUUA 2J6UA 4ND4A 1DIOB 4BCCA 5GONB 1Q6YA 5K0BA 1E3IA 2P6OA 4UE3S 1PF7E 1W19A 3N7UA 2D3WA 5EXSA 1GZ5A 4M4SA 3F7TA 1T2DA 4L76A 3Q8RB 3D1JA 4GQIA 2GBIA 2GZRA 4HVLA 1KY5A 1T9GS 2J09A 4E5MA 1OI2A 2O1SA 1WSBA 2WYHA 1PHRA 3UAYA 3VH2A 3EAQA 2JAQA 1UINA 1NJSA 3UXYA 4WACA 3QBEA 1YL5A 4IICA 1CQXA 1IHPA 2X3UA 2V4QA 2HK6A 3MJVA 2HQOA 1XQ6A 2V3WA 2NOAA 2C00A 4Q44A 1Z37A 3RH0A 4D0SA 1KYVA 3FF4A 3RM3A 2YHAA 2XGQA 1E3SA 4Q7KA 1T9KA 3AFHA 3TQRA 3T7KA 4YAKB 1XZCA 3THOA 3RAPR 2GEVA 1Q74A 3BXEA 3P4UA 4CKZA 1UODA 4YJ2F 2HIVA 4DBVO 4KO8A 5JH7F 4GPTA 1ESEA 1GZ6A 1XN4A 2BLLA 4PV7A 4XOIA 1NLFA 1C7JA 1D4FA 4B2YA 5AOAA 2GEDA 4EB8A 5K3SA 5KFZA 3UJAA 5ESDA 2JC3A 1L8OA 2JLBA 2DPLA 5AXAA 1NN5A 3IB3A 4HOYA 2V5VA 5CT8A 3QEKA 4M1ZA 4DIKA 4UCFA 4TT3A 2PKCA 3Q10A 1JLKA 4OA8A 3LO8A 1U7OA 1IIRA 4YRDA 3HXPA 1P6UA 3TTTA 3U44A 3N43B 4J3NA 2OENG 4ECAA 3CM0A 5HDBB 2J9FB 2FA9A 3WAKA 2WRZA 5K09A 3FCEA 4KH1A 3PXDA 2OCBA 4MIKA 3AM4A 4YJ2B 4XEUA 4QFBA 4GYKA 4D97A 5JH7B 1PX0A 5ALIA 5FD8A 1GTSA 4DMRA 2P6PA 3E3AA 4KW7A 3L5OA 2AFIE 3HYNA 4YUVA 3N9IA 2G3YA 1QAQA 3GLFE 2JCBA 3Q85A 1X74A 4Z51A 2QBYB 1DV1A 2WIDA 1JT2A 3DDSA 1ZWKA 2X1HA 1X7WB 3DE5X 4Q8FA 1Z4QA 1YSCA 3WJAA 4W8OA 4FMCF 3I2GA 1UM9B 5DBGA 4QPJC 1E0JA 1UCFA 1PR2A 2O2JA 5KFLA 5FPTA 2RARA 5DBHX 3BSSA 3FIUA 1HDGO 1LQTA 5D85A 1TXGA 3TLBA 4BEBA 4O2BB 4ALKA 3F6RA 1LWOA 2C84A 1VSUA 4G5XA 5EQTA 4C4OA 4N54A 1E99A 3SLKA 3SD7A 1I2DA 1YVRA 4AICA 1PJ2A 1P1KA 3M6XA 1N75A 1TW3A 3MJTA 2D3TA 4ZCMA 1VMAA 2AN3A 3CZQA 3LLSA 3BXXA 5A3JA 1MX5A 4FMCB 2BQRA 3HVJA 5JXJA 4QBHA 5F3WB 2COUA 5EWEA 1DLIA 2FZKA 3FLBA 3JYPA 2GKGA 1H8HA 1JIQA 3QUBA 4TL7A 4R8RA 4LW8A 4Q3EA 2JJ1A 4KR0A 2Q6IA 2Z4RA 2PMDA 2F3SA 3OPXA 3Q88A 3WK9A 2ZJ5A 4EPVA 2Q2OA 5E6UA 3UHPA 2VQEB 2O2SA 5TQ0B 4LVCA 4ED8A 5FL7D 4JLPA 3WLKX 4HDMA 1MLDA 2G5TA 3MLAA 3FGZA 4JUCA 1QXSA 2FSFA 2QSYA 2Y05A 3IKVA 4QNNA 1ENYA 3MTDA 1K7YA 3IQXA 3SHFA 3K9HA 3E18A 1O7JA 4KLRA 1HTBA 1PFGA 3D4IA 5EKSA 3CLTD 2HF8A 4V02A 2KB0A 2QL5A 2BGNA 3OOWA 4WN9B 1GA6A 2NVWA 3DR3A 4YJGB 4QJ4A 1XD2A 3PPXA 2AKAB 3X2SA 3FDZA 4JOCA 5CLFA 3LGAA 4ME6A 1ZMTA 2GLXA 1X70A 3GNSA 4TYWA 2EQBA 1KEZA 1OZGA 1EWVA 3LGSA 2PBLA 3DZ8A 2IOQA 1BIFA 3EUEA 2BKUA 2D2VA 2FPRA 621PA 3P2MA 4ZEXA 4EHNA 2HFKA 5ABPA 3AY3A 3DAPA 1F8UA 3LL7A 5FO0A 5ALFA 2JI9A 3ISJA 3L2PA 3V9AA 2PTHA 3IIIA 4UMEA 1JDJA 1LLDA 4I1SA 2R1VA 5JZBA 1LS6A 2A58A 4NPCA 3HKBB 4P54A 1ULUA 2I2WA 2O0HA 2G7ZA 2SKEA 4ZAZA 3IC5A 2GCPA 1FMJA 4W4TA 2IYFA 3ZDYB 2VRCA 2QZ9A 2I3GA 3AOGA 2WKSA 3I76A 3QX9A 3RPEA 4TKZA 5IAEA 4K28A 3MWMA 2YYAA 1I3QA 1UP6A 1V8ZA 5NLLA 3DQQA 2PE5A 1QE5A 3EOBI 4PX2A 4Q00A 2REXB 1WTCA 3L5KA 3RQSA 3U09A 5ER9A 1ZA2A 3JD4A 3MCAA 2WVJA 4IDEA 4X85A 3E3OA 3NEAA 1PYGA 3IDQA 2VXYA 4P98A 1XTZA 3WRVA 4ZCLA 3DYVA 4BTVA 2DKNA 3AHHA 4XRRA 3OVMA 5G1PA 4UBNA 4D9EA 3CXRA 2YOFA 1IY9A 4BUCA 3T3OA 2I8LA 3ERCA 2W58A 4PYRA 3KFVA 3DD1A 1CNMA 3WRXC 4UCXA 2HSDA 4WJLA 1I5RA 1YZVA 1P9NA 1BKYA 4EJMA 3ZTWA 4UTRA 4M76B 5IC4A 2FRDC 4O0MA 4US2R 4OXYA 2ERXA 3DR5A 2Q5EA 3KSRA 3TNLA 1N34B 4GGOA 1NSYA 2V7QD 4WEQA 1RM4A 2VHQA 5THQA 2OPBA 3P1JA 3TLAA 1YULA 1X3SA 4XQGA 2GD1O 3ILYA 1VL8A 2JJ2A 4JV5B 4BS9A 5C35A 2J9RA 5HDQA 4OLHA 3O90A 4PQEA 5FOXA 3BZBA 1E77A 2JIMA 1SCNE 4R2LA 5HJ2A 2GHTA 2Q5HA 4G5GA 1YOVA 1Y37A 5KFUA 5F7ZA 1CUAA 3B6IA 3GCDA 5KFKA 2VDRB 5THKA 1DO2A 3ZHBA 1M2JA 1T91A 4Z1OA 2IZZA 2OAGA 4CW7A 5ULLA 5KFQA 5BWMA 1IK4A 1O0CA 4Q6WA 1XHFA 3GMIA 2ZBUA 2ECOA 3ZG6A 2YFHA 4Q48A 1QX3A 4UCSA 1EVZA 4CDGA 1RWMA 1E66A 4O4IB 5B6JA 1K4MA 1D07A 1JR3E 3D2CA 1ONSA 2F8TA 2FCRA 3EEQA 3KLNA 1Q57A 1OXVA 4MHOA 5JY6A 3IMEA 3PKJA 5G0WA 1GKIA 4DG8A 1BDHA 1RLOA 3N75A 3LQ1A 3BREA 4FJ2A 2H65A 1YACA 1NXSA 2WUDA 4KDRA 5ERGB 1BJRE 2VL7A 1Q1NA 4LF8H 1GDTA 4K26A 1BW9B 1B42A 1BEEA 3FM9A 4UPDA 1WBJB 4KXXA 1HORA 2WOOA 1IUKA 5C1PA 4QW9A 3U13A 2DY1A 3ZPXA 1FIUA 3TY9A 3ZDQA 4UZFA 4EEZA 1LI5A 2WAQE 5K0LA 4X45A 3VHXB 3BTOA 2W7OA 1P5RA 1L4KA 2JIDA 3O31A 3AJEA 3JQBC 1T5TA 2OG1A 5KYNA 2HPZA 4Q12A 4B80A 3Q7EA 4BNTA 1D1SA 2HBYA 4YLYA 1DBVO 3A2KA 4F04A 4FBLA 1OWPA 3HO1A 3DMYA 1JRLA 2R11A 4UHHA 2R8HA 1PZEA 2XCSB 4M6WA 1OX4A 4BO3A 4PYLA 3U3DA 1B8VA 2IQ5A 4LHYA 3WGLA 4E0BA 4HTFA 1GN9A 2YV1A 3CH6A 4UMDA 3PFBA 2PX4A 4PSVA 1P7PA 3QI7A 4ACBA 5TNXA 4OQFA 4PZCA 5JRJA 1WZ2A 1AF7A 4PBRA 5TJHA 5IFKA 2VQSA 5JCOC 4CTJA 3PX7A 2PQ2A 2I4MA 4FCTA 1JP7A 1TKCA 3CNNA 4N0PA 1ZWLA 3TD9A 5E2AA 4Q01A 3HU1A 4AECA 4P2BA 5BN1A 2WUGA 2GAFA 2VAVA 4F3RA 2WBLC 3KDPA 2VDLB 1JJ7A 3FNIA 4DA9A 1KDYA 2EG5A 4TSRA 2ILVA 1A76A 2WYWA 4QXOA 4LBZA 1W36B 2FSIA 2SNIE 3R75A 3HFGA 1VQ1A 3RWOA 1WZIA 1EFTA 2NUAA 3IBTA 2AMVA 1QS0A 3BRWA 3KJIA 1ULHA 4AZ3A 4G4IA 1QG0A 5SZKB 4RADA 1CY7A 2Z56A 1XFAA 3RROA 3B7GA 1HDEA 2ZANA 1FSFA 3GZ4A 3KHHA 4ZDJA 3ASVA 5K01A 5FI1B 4WLFA 3JZDA 1KJYA 4QAJA 4GPBA 4KQXA 5KNBA 4I2VA 2PL1A 1IB0A 5AYVA 4O1HA 4E51A 4XB1A 3EB9A 4HXFB 4WFJA 3UOGA 3H8WA 1X80B 3E22B 4KYVA 4ZREA 1VIYA 2PG3A 4CCSA 2WUWE 1KYZA 3FTCA 1ZD8A 3LC2O 5EP3A 3LFTA 2NYRA 3AG6A 3T61A 3IBGA 3THWB 5JAQA 2YHBA 1HF3A 4JMPA 3RSLA 1RKBA 2AXNA 3N2EA 3DE7X 4TYMA 3JQ9C 1KRHA 2Q99A 1TEXA 3IP8A 1Y1KE 1XROA 1HOTA 4R5MA 1NF2A 1YCDA 2OBMA 5H8WA 1V25A 2JFOA 5DT9A 2QMHA 3WGOA 3EYAA 3EY9A 2QAJA 1G1MA 2P1RA 3U4IA 4Y9TA 1U4OA 5HK9A 1E61A 3IG0A 4RPCA 3I9FA 3T1VA 1ESNA 4UM9D 3ACCA 3GLVA 4LJLA 3T7RA 3ZN2A 4D0GA 2PWBA 3S3TA 1PR5A 5CXXA 2GVDC 2AN4A 1ZN7A 3FUUA 4XWAA 1HNWB 3ASUA 2CNLA 2ZKIA 5I6DA 3WRYC 1X7XA 3N7AA 1G98A 2BBOA 2NM0A 4TMXA 2W6ID 4QWBA 3AI3A 4INOA 2NU6B 3HU5A 5U4XA 2CKMA 4EVQA 5CDGA 1OIVA 4DR7B 4R71A 1K68A 3RG8A 3INYA 4A3DG 1L5MA 3RSSA 2X0JA 2HHHB 5LYYA 3VJRA 1N3IA 3KQWA 2O7NA 5JD4A 2XE8A 1DS6A 2I66A 1PL0A 3ZE9A 4OP1A 4ZICA 1KRXA 3E2MA 1O8CA 1PUJA 1ZN8A 4J91A 2P5TB 2YV5A 5H68A 3WWIA 1M54A 3WL7A 2IDJA 4XRGA 1XJQA 4RGQA 521PA 2TS1A 3TJMA 3WHLA 4X84A 4LOHA 5BN4A 5F12A 4QFMA 3FF1A 1EE1A 1MKYA 3QFRA 3AF4A 1NMXA 4EGFA 1Y81A 4RZHA 1RDFA 1B33N 3E58A 4NOLA 2GZ1A 2I54A 3KREA 2DULA 4KV9A 4HFMA 1B8UA 3CWZA 3EVFA 4IWXA 3OQOA 1D2HA 4PIPA 4ZGGA 3ZD6A 4BLPA 4X20A 2RI0A 3GTGA 4OHBA 4IIJF 1EUYA 1NVBA 4TLCA 2AC2A 1XTUA 3AGPA 2XE6A 3DTGA 1Z16A 2G04A 2GF9A 4C21A 4MA5A 1O58A 2JFHA 1YR7A 4IV8A 1M1ZA 4OV6B 2XMDA 1D5WA 3T1NA 2RCNA 2HDWA 4GOOD 1XDNA 1UMCB 2XCQA 2C8JA 5HKAA 1MVOA 4X6LA 3GGSA 5F5LA 4DL2A 2H0RA 3L40A 4YUWA 3L1IA 1A88A 1ILWA 1ZAUA 4A8JB 4P08A 1BDBA 4BP1A 4IIJB 3BK2A 4F85A 4QEDA 3ND7A 1CYEA 5DISC 1T34A 1BTOA 1EVYA 2G8NA 3BYZA 1V6AA 2F64A 2OR3A 2WF5A 2QMZA 2WTFA 3ZDEA 1U04A 3T9CA 3IEUA 2V7EA 4KN8A 5HA5A 4GZ5A 4AG5A 5G4KA 1V11B 3GLGB 5E1OA 3V4SA 2EFDB 5CGZA 4AZTA 2D1FA 4OB7A 4JKOA 5E3JA 1NNLA 2NT4A 1SK8A 5DYIA 3RSFA 3I4LA 3H1AA 5DHRA 3MR5A 2XLCA 5F3RA 2DSNA 5IDVA 5IUJC 4QQNA 4ZVTA 1NTRA 2HA6A 5I4BA 2F1RA 4B8YA 4RD2A 4A8PA 3I83A 4QICA 4KGVA 1NKSA 3H5NA 1EPUA 1PEKE 1II8B 3BEOA 4AY2A 1WO8A 3P4XA 3TXXA 3HBJA 3AM3A 3V1MA 2XSZA 2I34A 1UOEA 1K8ZB 4Y6SA 4K9OA 3T4XA 3VR5H 3L6CA 2C4VA 1NM5C 2IC5A 3NHUA 4A0FA 3FNGA 2PCJA 3RAFC 2ZVQX 3JW8A 4QBTA 4B34A 3CO5A 5AHXA 5IBRA 3UFXA 5C8DA 3VKHA 1GR1A 3RIXA 1O5TA 3O4HA 5C5CA 1EZ4A 3TZHA 1NRWA 4MI1A 4WOJA 2GBGA 1YHNA 1CZLA 4CLOA 1T36A 1YQTA 1B0UA 2Q8QA 5LN1A 4M36A 1SCUB 2IZ0A 3NIDB 3QGMA 2JGJA 1ZOLA 4QOSA 1CFZA 2EKQA 5IP9G 3W1GA 1IN6A 1G7RA 2Z6UA 4OHYA 5H82A 5IDWA 5LP6A 4D99A 2I65A 3FCUB 2UYOA 4ZT3A 3TEFA 3LUGA 4QASA 4MS3A 5GV8A 3G1UA 1P1HA 4KIUA 3L7NA 4F5YA 1MGOA 1WCIA 1C8LA 2V9PA 2R8OA 3TCKA 1G60A 3ZDAA 4GE3A 1B0AA 1P91A 4XX1A 3MJEA 2CSXA 3QLUA 3WIDA 4W5HA 3F71A 4PLZA 4LGVA 3WHKA 3WNCA 4DV4B 2V6JA 3ISVA 3RSQA 2XCOA 2Z09A 3ECCA 1TJYA 5EOVA 3AUTA 3ZGYA 1OLXA 1J9GA 3EWNA 3GQVA 4DILA 4RJKA 3LI2A 4M1SA 1QQ7A 4AY6A 4HFRA 4KIFA 2XZLA 4R8UB 3ICEA 5DHFA 2WTEA 2ATCA 2X3YA 3IAXA 1XA3A 3TR5A 4P4GA 3T0GA 5AKLA 4DDTA 1A2BA 2LBPA 5DM70 3LCVB 4DUZB 4XLZA 2JIOA 4R1UA 1XVAA 2V45A 2PAFA 5F5NA 4PNEA 3HWWA 3BQMB 3FB1A 5B53A 2QIOA 2QQEA 2P9JA 2RDIA 3SX2A 2FMTA 2XWSA 2JLYA 3DAYA 4GM1A 3OM0A 3N2GB 4EQZA 2DZDA 1B3RA 1R5OA 2L69A 1NT4A 1PJ3A 1HV8A 3EAGA 3TKYA 4EI7A 4RANA 1YASA 4IDQA 4NAUA 3KJFA 4DMGA 1W5BA 4XD7A 2ID4A 1T9AA 2OD2A 1E1QD 2VYNA 3W1EA 1SU7A 1VJ5A 2DVMA 1LD3A 5BOSB 3JRXA 1C5KA 3LCJA 1VFNA 5JPIA 4F12A 2PS9A 2P4QA 5I7VA 1FL9A 5ES3A 5EXTA 1QUFA 1FFAA 1SB9A 4BOYA 4Q3CA 1ZH4A 5IDYA 3HOZG 1HTWA 1J5EB 3NWJA 3ZYZA 1HR0B 2CUKA 1TJ3A 5D7NA 1OAOC 2VFAA 2WFLA 2QLNA 3GV7B 2P6RA 1IEWA 1J8QA 1P8LA 3V7UA 1JDPA 1K7SN 4GR4A 3IEKA 4I4NA 4DR1H 2OORA 1YIOA 4X65H 3L18A 5KG5A 1HTTA 4X3CA 1D4OA 3IPRA 3LDFA 1JJFA 3ZU5A 4KUHA 5AW7A 1WBBA 1FEZA 4GE0A 1Z28A 1GVNB 4TLDA 3RF6A 4IFIA 1ZETA 1SOUA 3GYGA 5KQMA 5E7QA 4IF4A 2IYZA 4J7CA 4FHFA 1HFWA 4RD1A 1CY2A 5IVKA 2B1JA 1F7UA 2NSYA 4E1VA 4BMZA 5B30A 2GZHA 5IXSA 4NICA 2Q4DA 2WAAA 2AFIB 5IANA 3WG9A 1QKKA 4ZMSA 2O9JA 1VXRA 2UZAA 3S68A 3R20A 1ZL2A 3GLFB 3ZGXA 3UJ8A 1WPQA 4QUGA 4N9QA 1TCCA 1UFQA 1NRIA 5MN4A 2C7OA 2AI2A 3NC0B 4DA8A 1UJ4A 2IF0A 1E4EA 3KZKA 4HVCA 4JK3A 1TFRA 4X66H 4K40A 3PUWA 2HL6A 3Q2IA 2QJRA 2PWYA 2ADMA 3T8YA 3AVOA 3NP9A 3TL3A 4GMHA 4QTTB 3IUQA 1AZWA 4O3SA 5JLAA 4BNDA 3C1OA 3HUEA 2G25A 2WF7A 1CD5A 3B3JA 4EJ0A 1PL7A 1AO0A 5KMGA 3F5FA 2Z95A 1UXHA 3QKSB 4H16A 3TZKA 3PGMA 5DFAA 1M73E 3HA3A 3T6KA 3KKEA 3PVCA 4DTCA 2NZJA 4ENRA 4TOIA 3VPSA 4B6EA 2IZ7A 2OXTA 4RVUA 4EF6A 3ICQB 1BCSB 1E3LA 4PN3A 4JNCA 1YB4A 2DERA 3IV7A 3V6HA 2A1HA 1M7HA 4C14A 4C2UA 1WD7A 4H4EA 3NASA 1OREA 1AS0A 1UBFA 2OGSA 2ZFUA 4KN5A 1OFTA 2PCLA 4JIMA 5DLPA 3KD2A 3I2JA 4DHEA 1JW9B 5C52B 2DU8A 1A9XB 4BLOA 2IHBA 3MMZA 1NFQA 1JXLA 2EJCA 3HO8A 1M2OA 4WZBA 4L6CA 1Y0BA 2YJ5A 4JH0A 4YO7A 3V33A 3KUDA 4JLAA 4EM6A 3MGGA 1AE1A 1E2PA 3HM2A 4CGYA 1M7JA 2A0WA 4ZZIA 4BZXA 2PXCA 4I1UA 1PL6A 1KUTA 3LKZA 3A6DA 4BN0A 5HXAA 4Q47A 5DX1A 5H3CA 4MV1A 2QP3A 4RCYA 2B8EA 3OOJA 3PW4A 3DLAA 4OXNA 4ERXA 1M0TA 5AJZA 5LZ4A 3H5AA 3LP6A 1P1FA 2OSBA 3T1HB 1QIIA 2C88A 4DQNA 5AXBA 2JH8A 3KXLA 5CJPA 1I8TA 1HYHA 4MW2A 1TAGA 1FJHA 4RPKA 1RLMA 1ZOIA 5A4KA 2LUOA 3H1PA 1ZJZA 1QOPB 1AMUA 1SGWA 2QX6A 5A62A 4H7FA 3IE2A 3IR5A 1CEYA 2VS1A 2XNJA 3BHJA 1GNPA 1VM6A 2BFFA 4B75A 1KXJA 3PQDA 3R8FA 1UBUS 4D4GA 4ZO8A 4FEAA 4L95C 1AXGA 2GCOB 3TGWA 3BABA 4GW3A 5KFRA 1I4WA 1AQIA 4R2HA 4ALLA 3BMOB 2R8JA 1P74A 1K6JA 2WABA 5CLIA 1MIOA 3Q5EA 4R51A 1TEHA 1GQQA 1QQ5A 2C95A 1QU3A 1XIVA 3A7DA 5BQXA 1E1NA 1P77A 3RVQA 1C0IA 3GT0A 3W8DA 1CEQA 2BM8A 1Q22A 4CV1A 3MMNA 3UKJA 2AF3C 3CC8A 3IXLA 4I4CA 4MVJF 4ZOEA 4LC1A 1P0IA 2AEJA 3CF2A 2VYCA 2X13A 4LN1A 3M9LA 5CLJA 2YNMC 1AF4A 1OW3B 2WLTA 3ONWA 3SPXA 2Z43A 1CQWA 4DANA 4XQ0A 2NVOA 2QROA 1N33H 2ZRFA 4DZTA 4P38A 5EEGA 2O7QA 3CKKA 2IYLD 1I24A 2YJTD 1VI6A 2RGDA 4Z3KA 3ZS9A 1YIAA 1FB5A 2R1UA 4J0KA 1I6WA 5ALGA 5IUNC 4ARZA 4DL3A 5I7HA 1D4AA 4FKZA 3REOA 4DR4H 4ZTBA 3UY4A 2FW1A 4G86A 4NE7A 2BTQB 4DAAA 1Q11A 3QG5A 4YJHA 4FX5A 3OM9A 4TXNA 3DBLA 1T4CA 5IJZA 1J70A 5EGSA 2GRUA 6REQB 5CLQA 3OMWA 3G6KA 1DUSA 3K1TA 2W4QA 4BQRA 3M6MD 1Z3CA 4ZZ0A 2KI5A 4EFLA 1U7ZA 5LIPA 3B1YA 2X76A 2QX4A 4BUJA 1EBUA 3ZLBA 1T15A 1E64A 4CG0A 5JE8A 1WXFA 3VZCA 4YDQA 4QDKA 4OYRA 3FUCA 4PQGA 1TZKA 1O4VA 5IC5A 4L9AA 3AF5A 3QH4A 2XDQA 1QIGA 1MPXA 2JAPA 1D7AA 1VDZA 2QZSA 2RH4A 3DHNA 5BWRA 1ZGBA 4PZ8A 4ZU6X 1KI4A 5JWOA 2WIBA 3RG2A 4QUEA 4HLNA 6AT1A 3KOYA 1JYEA 5AM0A 1Q7TA 4Q1DA 3M5PA 5D84A 1V8BA 1TLFA 4NCKA 3PUZA 5JC1A 2RKOA 3FPFA 2FB9A 3ZU4A 1H4SA 1AY0A 6ABPA 1PR1A 4IM7A 4Y2VA 2EW8A 4LQLA 4HH4A 4OUDB 3TZLA 3KOXA 5EZYF 4BQIA 2AFHA 3ROPA 5KTRA 2PXHA 2XQIA 3BCUA 3N0WA 5CCEA 4AJJA 3K20A 4U2GA 2JA6G 1A9QA 1WXEA 1AKVA 4JR2A 5K3OA 1V4NA 2CV0A 1BSVA 5BNFA 3NI2A 5LCXA 3AUJB 5I3CA 3EQ9A 2JFVA 5EN4A 4MQ4A 5BYJA 1SG0A 3N5CA 4I5IA 4CF4A 2QD4A 4P35A 5GVSA 3CGGA 3ZHOA 1OBHA 3UT5B 4LRYA 5J40A 4XVQA 3L4BC 4RWZA 1I3OA 2B8WA 1TPZA 3WSWA 5ECGC 4PU0A 1Z62A 3S1AA 5EZYB 3SDZA 2QE7A 4PZEA 1W4ZA 3EFHA 2RGVA 4LF5H 4J9SA 2Z1DA 5SZJA 1EK2A 5EKTA 4CQJA 3ZJUA 4Q3KA 1D2GA 5K0GA 1TUBA 1PBNA 3GFVA 4UAVA 5KTYA 2YX1A 1UKCA 5KOJA 5HR5A 3RC9A 4Y2YA 2XGGA 1KMQA 5JSQA 3IT1A 4MMYB 5EE9A 3UZUA 3M4ZA 1MXHA 1RZRD 1L2TA 3FPSA 3U7EB 3LDGA 4XR4A 3CW9A 2AMLA 5L1LA 2QG6A 2YDXA 1MZVA 3VFDA 1NF8A 3V1UA 1LNSA 3MBIA 3RYCA 1M0SA 1RWNA 4DLUA 2IZ6A 3RI3A 4HRYA 3U48A 2V98A 2FV8A 4EKGA 3VNRA 2X2PA 5I9NA 1XDWA 3H99A 1FTGA 4MR7A 3PRYA 2ZE5A 3I1JA 1X7HA 4QO7A 4BNXA 3CRW1 4F11A 1V2HE 2J6CA 4O33A 5LZ9A 1Y8QB 3PXAA 3G2NA 3HJRA 1LX6A 1T5SA 3V1YA 2ZW9A 5CVTA 3WFZA 3ZCPA 4ZJUA 3L84A 2EJTA 1QFZA 4LXYA 1UBNA 3WKCA 2ID7A 4D9NA 4FBGA 3NAZA 3B2NA 1EQAA 2FVYA 1WMBA 1FVOA 3TVDA 2UV8A 3Q0TA 2VK2A 1UQUA 1XNRH 1JDSA 5CDTA 3DEFA 4FU0A 1I1NA 2H7XA 3SAJA 1Y4UA 1ODFA 2YRFA 2OSVA 821PA 5FPYA 3OICA 3G89A 4HAOA 1PZFA 1EWYA 3L0SA 3FCAA 4X8LA 3GT7A 3R5SA 3FOWA 1RP1A 1AN0A 4IVQA 3C8DA 4Y2RA 4BYGA 2FLKA 4QXMA 2GX6A 2OILA 4TQAA 1E6LA 2XKJE 2CKDA 1H66A 4I3HA 1BE0A 1O8BA 3FX2A 4DL9A 4B7XA 3KDAA 4PYNA 4FDMA 4DEYA 1AVTA 1KMNA 1R88A 3IOYA 2R4QA 2DTEA 3TX6A 2H1VA 1TYAE 4K9SA 1S8OA 3AKEA 4KR7A 2I2XB 4U63A 2E6UX 3LDAA 3DMRA 3GQBB 5EWMA 4REQB 2UUAH 4ZJZA 5GONF 4X00A 6NULA 4CL3A 4CR7A 2PZJA 3TR6A 1OFIA 4ND8B 1EWKA 3LLUA 1G8KA 4JI1H 3ZKWA 3LCUA 4MHSA 3AUYA 1NP3A 1FQJA 4FS2A 4BV8A 1KXZA 4WVFA 2XYGA 3PQ7A 1QAMA 2C54A 1GILA 4HYTA 3HL0A 3PE3A 1BROA 4KH0A 1FJGB 4WZZA 3GT4A 1HG0A 1W5SA 5DXJA 1U4SA 1NG9A 3RUFA 1TVKA 2B9EA 4YHHH 2HT1A 4HGYA 4YX9A 2HIMA 5JSZA 3ZIDA 2H92A 3OHSX 3OZUA 2YY7A 4WBNF 4DLKA 2JD0A 3LTNC 1EGQA 2O1EA 5K3FA 3PJRA 2DBQA 1AX9A 3O84A 1I30A 4D4KA 2CYBA 3IS3A 3NM6B 2ZWVA 3KYIB 5EHQA 2R9VA 3PYLA 1E0AA 1ABBA 3BIWA 3K35A 4EA7A 1M2WA 2M32A 2WZDA 3PA8A 1ENPA 2JA8G 2ZJOA 1I2CA 2H85A 1NXQA 4NBRA 3SC3A 5JANA 3ZWVA 4JMLA 1RWOA 4YMVA 2C5GA 4U6QA 3EIQA 4EFNA 5EWGA 4S05A 3NT5A 5CK4A 5DLYA 5JAIA 4MDYA 1KYQA 2GNAA 2CY0A 3GF4A 2OB1A 3THSA 2QYTA 2D62A 4CC5A 3ONVA 4E09A 4NPHA 3WGKA 1CKMA 2KW5A 4WBNB 4NYEA 2NIPA 3A6FA 1UPUA 4FYJA 4PS0A 4B3IA 1WOMA 5IWAH 2Q3JA 1Q12A 4EENA 2FOLA 4QQRA 4NBTA 3Q1KA 2QRVB 5KJCA 5KVAA 4C1NA 5IXJA 1E2JA 3IR7A 4I4IA 4YXWA 2ZQYA 4M1TA 2CXPA 4ZEOA 1DC5A 3PNQA 1QC5A 4QWEA 2YXEA 1XN1A 4J9NA 4QECA 5EFOA 5K51A 5BWNA 4UU7A 4E13A 3STYA 4G81A 1E4YA 1A4RA 2BHNA 3G8CA 1S0UA 4TS1A 3QZ7A 4AF7A 3BSYA 3C7TA 1H4VB 4HLUA 1L7RA 1HNZH 3QHQA 4LF7B 5A6SB 4MEAA 4U39A 4DV1B 2JFZA 3D8NA 2XB8A 1QYRA 1S3GA 1L1QA 2XQJA 3U2QA 1ZIDA 2QTVA 4QGSA 1JKJA 5JO0A 1DJMA 2ODAA 2ZE8A 2XOKD 3A4TA 4FWTA 1NKTA 3P8ZA 2GEBA 1S4MA 3GJQA 1U8TA 4V2UA 5ENZA 2WHPB 4UCQA 4P4SB 1SQ6A 3DOUA 3Q6NA 4JR1A 3KOOA 2VQ6A 4RLFA 4FYYA 1X2EA 3QV1A 2TYSB 4O2BF 1RLJA 5KNDA 1B04A 3L02A 3VX4A 1RACA 3VH1A 1DE0A 4MQFA 4YCSA 1AZTA 1H6CA 5FAXA 3GU3A 3UN1A 5BWBA 4W5TA 1UBSB 5IX8A 3F4KA 3VR4D 3DXYA 3TQQA 4E22A 2WKQA 1Z0DA 5DLFA 4ICIA 1FA9A 4KTVE 3CU5A 3EMDA 1FQWA 4I1RA 4HX2A 4FZ3A 5ANRB 2WICA 2YQ4A 5M5BA 3VKFA 4MA4A 1DFIA 3CH7A 1EUCA 4DJ5X 1BH6A 1Y1VG 1N2BA 3I34X 4R31A 3PC7A 5L7WA 1E3TA 4KI0A 3VI4B 5L7YA 1FUIA 4A8HA 5EUBA 1Z08A 3KEOA 4A9AA 1T2UA 5JCJD 4HLCA 2QTAA 5DBIA 4EH1A 2JDID 5C5DA 2ZTSA 1NP7A 4UQOA 5JD6A 3SF8A 1AKTA 3NYRA 3ZV3A 4S1TA 4QDUA 1QHNA 1WCYA 2W71A 4LYHA 4R2IA 5BYBA 3M4XA 3OM1A 2G70A 3ZK7A 2O8FB 1GAQA 4ZAVA 1WHTA 3BS4A 1KDZA 3PDJA 2Y71A 1X14A 4B6JA 4LJKA 2PZBA 4R3WA 2G5PA 4BIMA 4KWCA 4IR7A 1EFVA 4BEJA 3W5DA 1KAHA 2ZI5A 3FJ1A 3Q4GA 1OH5A 3CYFA 4J49A 2PO7A 3PNVA 3B1FA 4AQYB 1GM5A 2ZJZA 1ECBA 4UVIA 5DKFA 3JPYA 3I9OA 1SU4A 3J7TA 3JQAB 5AWFC 5HNEA 4M0EA 4DPMA 2C2ZA 5FTNA 5DB4A 3EZYA 3I1FA 1YR1A 3OECA 3JRWA 1JJAA 4LNHA 3EHEA 1DU4A 4IMIB 2BUAA 4IIUA 1GEGA 1ULTA 5ECYA 5TE9A 4RA6B 2C4MA 3JQEA 5A05A 3GI1A 1DUVG 3F6SA 5FOQA 2GN8A 1T4BA 4S12A 5F3DA 1UBHS 5BV0A 1P5FA 1QSGA 4FS3A 2X0FA 3EXAA 1V95A 2D2EA 1CJCA 2OKGA 2B3DA 3CRRA 4BFVA 1HEUA 2E87A 3T5TA 1DFHA 4IAJA 3VYRB 4ZKDA 1P4GA 1JPNA 3ZUGA 1CE8B 1USUA 2WNHA 1N92A 1RRMA 3B85A 1L2ZA 2JLCA 4PC7A 4JWTA 3WK6A 2ABJA 4M60A 1AHHA 2CNVA 2J3JA 1W88A 5JBIA 2YMQA 1T8TA 1JPUA 4M38A 1OKKD 5F1YA 3M1YA 4DB4A 3FFAA 3DS8A 2XYRA 1TCVA 5DTMA 5JMOA 2IIPA 4F0JA 5AH0A 2ZSEA 3GMTA 3WWJA 2Q4BA 1QO0D 4GZLA 3W5AA 2PA3A 3H4BA 2GEKA 3OQ1A 3SEAA 3JVIA 3FOEC 2RHBA 1P2BA 1YFZA 2A59A 2Z3WA 1GAXA 1WF3A 1YK0A 4DARA 2GM3A 2YVUA 1K9SA 5JASA 5ITZA 2W6NA 1JDBB 1DAOA 4PONA 4UAJA 3NV7A 3RF2A 1ORIA 1UMDA 2RCYA 4XYMA 5G1OA 3I4MG 3SVZA 4EEQA 2RGNA 1VHJA 4NABA 4GG1A 4PWZA 3ZJ5A 2CNQA 3KZMA 3R6DA 5SZIA 5F64A 2PGJA 4OD0A 2IKSA 2WU4A 3PO3G 3HGTA 3EPPA 5KO2A 4ER5A 1KR2A 2XYHA 4CUKA 3F9RA 1JG6A 4MNTA 2G08A 2ZIFA 3L8FA 3K70B 2F1JA 2JAHA 4RFSA 4GWLA 3ITKA 3G0CA 4MGZR 4B40A 4CIDA 1CF4A 3OPYB 3DM5A 2IYXA 3U4AA 4NBLA 3SC4A 4P33A 2W8LA 4FGWA 4O4IF 3H1FA 5K03A 1YBMA 4YJFB 4IFBA 1YB5A 4JB0A 1R5NA 3KOUA 3M0EA 1EFKA 3HYTA 1UDRA 1MH1A 2J3LA 4K8OA 3RTBA 5D3MA 4Q43A 3GFTA 3TX2A 2CUNA 2B83A 2J3MA 3V5NA 1JHOA 3U1VA 3GTMA 1YRLA 2B2XA 1QF6A 5JNLA 1UDWA 3OWHA 5EIFA 4CTNA 1PJ4A 4GLBA 3IXQA 4EVIA 2VPXA 1Z4PX 2VYFA 5SYAA 3D7KA 3V2GA 4M0CA 3HJBA 1VJ1A 4B4OA 4O7NA 4TMKA 4M53A 3LBFA 3OA2A 2G4LA 1FC0A 3Q2OA 4CCAA 4WX2B 1F06A 1MFZA 5IKXA 2GWHA 3JSAA 4UNIA 4BKQA 4V1CA 1O6CA 2GVNA 4NZ9A 3TI7A 3WRWA 3I2YX 3ZI0A 3MQ4A 3WLOA 4XQEA 4RCZA 2BE9A 4NBKA 2OEPA 4A15A 2YNMD 3ZDDA 4BNHA 3LTEA 3FMPB 1PQUA 2OZKA 3C3JA 2DOKA 3STHA 4K9DA 1IJKA 5CA1F 2ZZKA 3W4JA 1SZPA 2X8BA 5KHLB 5EP1A 3PEFA 2QN8A 1KF0A 5SY9A 3BACA 4YQYA 4O7ZA 3NPAA 3LYUA 3SFZA 2HNAA 4E2YA 2CEAA 1U7WA 3VC1A 2FRXA 2H2IA 4FOLA 5F5XA 4Q82A 4BVKA 4KNYA 4WNIA 3G3EA 3DZFA 2NZ8A 3QKTA 2XQKA 4D9JA 3N2NA 2Q9BA 4OJMX 4OFZA 2GN2A 2HA0A 2PLNA 3ORQA 4QW8A 2WD7B 4EL0A 1CY0A 3A3YA 4YAFA 1YFJA 1R0WA 3Q5DA 3CX6A 5G4LA 3EGEA 4E5PA 1ZM9A 1JXQA 4G8DA 3NV9A 2HMAA 2QDXA 5KKAA 4RL6A 4KB5A 1NVDA 5CA1B 2WK1A 2CE7A 2DFTA 1U90A 2O7VA 1RKUA 4O7TA 1ZNWA 3AGQA 4LECA 1MF7A 2V97A 4YO8A 5BN3B 4ZV9A 1WW2A 5HQ3B 4DCJA 3OT4A 4K1XA 5EHNA 1KO5A 2C31A 3HUUA 1WKVA 1M3SA 5JVLA 5FWYB 4Q1BA 1O0SA 1UDCA 1VIVA 1KH2A 4QQFA 4WT7A 7MHTA 4NRDA 2ZUCA 3RUHA 2Z1MA 3KQYA 5CYOA 5CW2A 1CFJA 3OHBA 1VCHA 4X93A 4BC1A 2F1HA 3WWCA 1XO1A 1V3QE 3D0QA 4CWAA 1JMYA 2P69A 1V3UA 3LMKA 1M10A 3CUYA 1QIFA 2Q2VA 2ZBRA 3FVTA 3GLIA 2AZXA 3ABSB 2VYVA 4IGIA 2NYAA 2ZSDA 2FPGA 3MUNA 2IS2A 5JNTA 1FOEB 3EVEA 3TW8B 3DFIA 4UUMA 3MTQA 3ZY5A 5J23A 3ZU3A 3H6KA 3THYA 5D7BA 1MBZA 4DBLC 1EFRA 3M4NA 3MTEA 4LBYA 4LGCA 4FM9A 2WWWA 1M2NA 1Y5RA 2XC9A 4BKMA 4MWEA 2B92A 5JNWA 4Y8VB 4Y67A 4PO3X 3CF4A 5AKJA 4Z9YA 1KMMA 4LYFA 5KNCA 3BA9A 4QXPA 1E9DA 4TUYB 1OBCA 3INGA 1G21A 3GUYA 1T25A 1VI2A 4ND3A 1KYIA 3LRPA 2BC9A 3N59A 4OLFA 4Q15A 5LYJF 4HPJB 1K1EA 4DUYB 2ZI7A 2G77B 5WRFA 3L0DA 4E32A 3VAYA 4DAEA 2FN4A 4YJ3A 2ADOA 4MR8A 3QMVA 4N5DA 1XMPA 4QX6A 4Q19A 4QBIA 2QPOA 4RENA 3AKYA 5CVDA 1E1LA 2NO6A 2A9VA 1PD0A 2XCRB 1RRPA 3UYLA 2DKFA 1KORA 3ESAA 1H9AA 5HF6A 5A3QA 4D9FA 3EZ9A 2H16A 1SXJC 1Z22A 2FFRA 1CKEA 1OJLA 2IHJA 1YUBA 3S5UA 4U3JA 4RB0A 1Q95A 3AERA 1FYEA 5LYJB 3DCJA 3SU8A 1IN8A 4HBZA 4HN4B 1N1GA 4JI3H 3OC0A 4YALA 3H8VA 4PCLA 4YP0A 2OAP1 4NEGA 1LDNA 3KHRA 4N47A 2ZI4A 1M2HA 3UNXA 3ZLTA 3WDKA 1VGRA 4NHOA 3AV3A 3UVEA 3E0XA 4JN6B 4PYMA 1ODCA 2H29A 3DPUA 2YY6A 1R50A 4YB8A 5REQA 3ES9A 3RS4A 3IP9A 4EFMA 2OO5A 3QX7A 1P4JA 3FGPA 3L06A 2NO7A 4OGFA 2GR9A 3WLQA 3DYIA 1M6EX 2WVHA 3QZ8A 2C98A 4C01A 3TW4A 4OHXA 3LOQA 4O59O 5JIBA 2QRQA 2PV0A 1B74A 2X14A 3W7BA 4WKNA 4MP6A 5KFWA 3C8UA 1A04A 2QRMA 4DCCA 2SICE 2HDOA 4JLOA 5KX5F 1A8IA 3D5EA 3QU5A 3D6MA 4AB1A 1W4BA 2F9MA 3GJTA 3K96A 1OR8A 1U7DA 2DIKA 2ENUA 5HIIA 4QARA 2HJVA 4HSEA 1PJLA 5IZCA 3DKVA 3IAS6 4OQNA 3PITA 1ZIXA 4N3CA 3AFOA 4KAFA 2YHSA 2RB4A 5BV8A 3GP8A 2OA0A 5HS6A 4X1KB 3PXEA 3B6EA 1XTBA 2Z5FA 1E32A 4DJDC 1E9RA 4FUQA 2ZYDA 3O92A 2PEZA 5B36A 2BSQA 3QW2A 2QX9A 4CEIA 2C5LA 3HGQA 1QHGA 2CNKA 3L6DA 2BSAA 4MEJA 1XMQB 4QTZA 1JUDA 2XJ4A 1JDNA 3I9V1 4A0QA 3WZ2A 2ZTLA 3S8EA 1GPYA 5TMPA 3T34A 1Y4AE 1S6YA 3MD0A 2VBCA 4HQOA 1TVMA 2QUHA 5KX5B 2CMHA 1K3UB 1ADFA 1ID8A 3VPBA 3F73A 4TSFA 1KK3A 1E18A 1JIVA 1OHHD 3RF7A 2XJ9A 3UCFA 2PL9A 1UPXA 1BE1A 3UMCA 1YOBA 1BKDR 4RTPA 5LLTA 4RQUA 2OM6A 1SULA 3B9RA 2HA4A 4NF2A 5L6LB 4QDOA 1GSAA 3R24A 2JJQA 3QQMA 4L4YA 3Q7TA 1P7ZA 1VKOA 1DAPA 1BXGA 1Z5ZA 5JTUA 1ZXLA 3QKUA 2BFCA 1RYDA 1EG2A 1NA5A 1L4LA 5A1JA 4H3VA 3SBXA 3QPAA 4WHXA 2WWYA 3K3VA 5FD6A 1BS2A 5DSZA 2XCPA 4HNVA 2WSYB 4NMXB 1P33A 3LZCA 2AG1A 3KYCB 2FKLA 1T24A 4JX9A 5ECDA 3NT2A 3ZQUA 2VXOA 4INZA 4C0HA 2WE8A 1QNLA 2GRAA 3HZRA 2D1SA 1YE8A 3UUWA 3M49A 3FCSB 4C4TA 2YMMA 3M7IA 1LDBA 2C3MA 5BR1A 3CWCA 2CXRA 4KWTA 2Q6KA 5JZMA 3LOPA 1OIXA 4LJ4A 1CVLA 4CBVA 4I3FA 3RAGA 4PF1A 5HKKD 5KYTA 4XDHA 3VPCA 4HGZA 5LQKA 3TKAA 1UAYA 4C7XA 3VTZA 1A7JA 1M76A 2X2EA 1WLYA 1NNUA 4FGRA 2Y0BA 1AS3A 5J63A 1NLMA 2R86A 2QYSA 1E60A 3HB1A 3UJ7A 5JCPA 2HU7A 4WERA 1A5SB 2B98A 4E7PA 3OLXA 4N01A 2QV0A 1U2DC 1I4OA 1XZBA 4MB0A 3TEJA 3ZK9A 2R6ZA 1SUSA 1W4AA 1ZIYA 1TB4A 3B82A 2WU0A 3QJYA 4IX1A 1JA0A 1DUIA 4G0MA 5HUHA 4K0KH 1QH8A 4DSNA 4I46A 2X2OA 1YO6A 3MPUA 2C9MA 2P3SA 4RMNA 1A5ZA 2ZJ2A 2PMZE 3PR3A 4J16C 3IHTA 4HX9A 4CKYA 3A1SA 3WZMA 3L4EA 3HB4X 2R5NA 4AX8A 1UK6A 3O75A 3T7SA 1HZZC 5DISB 3S1LA 1IG3A 2Y1DA 3IX7A 1GU1A 2OG2A 3PU6A 3IAAA 4ODIA 3ED1A 4MXDA 3PI6A 4CL0A 4OI2A 3N8DA 1OFUX 4MR9B 3MCVA 1KDRA 5JATA 4ADSG 5F77A 1GN8A 4BVLA 3DTVB 4D4LA 1C1XA 5JSUA 1KK0A 1GV1A 2G1KA 1MDFA 4JI0H 1K88A 2XGOA 2V7TA 4NBNA 4NYJR 3W06A 5DM2A 1UJNA 2DH5A 4N7JA 3T38A 1TU3A 2Q4RA 3GIDA 4DZZA 5C4IA 3TNDA 1OC4A 1ZEMA 1RADA 2GDJA 1UQTA 2B21A 3ZWXA 4NP6A 3ORSA 4M8SA 5K0NA 3NBZB 5A2GA 4BXOA 2N1BA 5KSYA 1WY7A 4QDTA 5BVGA 3GVCA 2E1PA 4G1MB 4OOEA 1G9SA 1WXIA 2C57A 1PFKA 3AEKA 4TRMA 3MSCA 4HX5A 3KTDA 3BT7A 4MJXA 4EZBA 4S1PA 2QL9A 3ZD9A 1Y7HA 3LVBA 1DIRA 3ZEIA 2M6SA 3RSOA 1QRAA 1XZLA 1XEWX 1B8NA 1NR5A 3C6KA 3GN1A 3SZUA 2R00A 2WYVA 4QREA 3D43A 3KTAB 3KKZA 3TLKA 1XRLA 4GD3Q 3WNZA 3BF7A 1XZQA 1ZNXA 4JNKA 2GPNA 4AKEA 3TLZA 4P58A 3GIIA 2P9TA 1GL6A 2L19A 3MCWA 2JIZA 4H7HA 3IUYA 4WLNA 1JH9A 3W6ZA 1GRRA 5KB3A 4X7MA 3OQ6A 4L5CA 2J6HA 2ZAIA 5FBQB 2QGFA 1KT8A 4LSWA 1YHZA 4MVJG 3II6X 1U7UA 4OTZA 4ROTA 4H6VA 4GXQA 4TTRA 4EDFA 1N5RA 3C39A 4BFUA 1LA2A 3W04A 3OJXA 3ITNA 5BP7A 4R68A 5C37A 2R6HA 2NTVA 1EAMA 4RZ3A 4RLHA 4YCLA 3ONNA 4FYMA 4K9KA 3MQ2A 1JFFA 2JFBA 3MNFA 5JS1A 3CO0S 4R7RA 4J9KA 1QKJA 5L3SA 2WM2A 4ZVRA 3KLBA 2VZ0A 4FIZA 1WXHA 3LPCA 4BVEA 4JI6H 4Q39A 3QJ5A 3WSVA 4PZZA 2PDAA 5CYGA 3WMXA 1UWLA 3OP4A 4RM2A 5D1OA 2VDKB 1KPHA 1C8KA 2RD2A 3GLHE 4IIDA 2OLJA 3DV0A 4YAUA 1CIPA 3T5BA 3D6JA 2CL0X 3IIKA 2B35A 3LLCA 3BMCA 2AGQA 4EHBA 3GDFA 4AWBA 4DR3B 4CUZA 1WY5A 4HQLA 1KDOA 2VJAA 3AIKA 4FCCA 3VTKA 5JS7A 2PMWB 2NVYA 2Z08A 4RMIA 2CYCA 1KMCA 3ED5A 2SCUA 4DV0B 4YHBA 1JGTA 1GARA 5LQJA 2WHXA 4IQ8A 3G6VA 3GAZA 4RY9A 4AZWA 3BD9A 1L4HA 3ENWA 3NJRA 3CX7A 4F4FA 2OCPA 3BMXA 4OYYA 3AV0B 3RYFA 4UARA 1IOZA 1AG9A 4JV0A 4NLLA 1IM8A 5FLXA 2XOXA 4RVGA 1RAAA 4PNHA 5HUJA 5KNBH 1HE8B 1MTZA 1W0CA 1WH2A 1IVNA 1PIWA 2C96A 3H11B 3ICCA 3KTFA 1P3DA 2FR8C 4TM5A 4L5BA 4M1QA 1XU7A 2VHYA 1NYLA 3A9SA 1JKXA 2C8LA 4MX8A 1OFUA 1T6BY 3DE2X 2WPDA 4YECA 4UBOA 4PO1A 2I78A 1U0EA 4F5WA 4I4TF 2ZZMA 4G0WA 1NL3A 3HUDA 3MOIA 2YZLA 3R23A 1GU7A 2PUAA 3KALA 2AOXA 3JAMA 1XNJA 1LC0A 1XVVA 2OZVA 3RC1A 1GPDG 3P5BA 5EE0A 4Q4CA 2Q3CA 2ZSIA 2AOUB 3WL8A 3RR2A 4RHEA 1RD4A 3EQZA 3TL6A 3EDYA 4ETSA 1FP4B 1JQ3A 3SE7A 4F4YA 1L1EA 3EXFB 4QGAA 2ORIA 4KKXB 4UU1A 1AQJA 1UBRS 5DNDA 1Z6XA 1CP2A 4Y2QA 2HGXA 4PZ6A 1V26A 3LCCA 1NUUA 4I4TB 2VPWA 5C8YA 4ZOLB 4EJSC 5LPNA 3T3DA 2HRCA 4IRCA 1XEWY 5DVZA 2ZRGA 1HH4A 1MO3A 2XBMA 1WMDA 2BMFA 2Z5LA 1A8UA 5F7JA 4AJLA 4D81A 3RREA 3RJTA 1NHWA 3JASB 5KFYA 2I6FA 1MMFB 2EJVA 3IBCA 4QELA 4NI5A 3GCWA 1Z6ZA 3CX8A 4ZC8A 2V4RA 1FP2A 2D1QA 4RC9A 1O0BA 1FTYA 1F20A 4M3NA 5DNEA 1IG0A 3ZHCA 3ZZMA 3NPMA 4QJ3A 1HZJA 2RI6A 5CM9C 5AM1A 4TWIA 5J4LA 5T4BA 2W48A 1G19A 3TECE 2WE6A 3NOQA 5KTSA 2C9ZA 3CJTA 3FUWA 4YR0A 2OT3B 4UASA 1ZUD1 1INLA 3NTUA 5EG5A 1VJ0A 2X9QA 3HPRA 3NBMA 5DRYA 4ZK2A 5FPHA 4QYIA 4WZAA 4LMRA 4JJ8A 3H9BA 2G36A 4B9EA 3W5OA 4KOEC 4RZQA 2VOJA 3G2KA 4NEQA 4V0LA 3FPKA 2BJHA 2CE2X 3SI7A 3T5KA 3DZDA 1O89A 4RBNA 4J90A 1I36A 3K0AB 3KPVA 3AL2A 4XKJA 4ERNA 3JZMA 1UFRA 1L5GB 4PGHA 2HK9A 2EYUA 3FHLA 2YN0A 2WVAA 1PWHA 3PCRB 4HS4A 3T1YH 1TC2A 5KSPA 1SVLA 5F52A 3HN6A 3PBKA 1PT8A 4P22A 5D1NA 5KT7A 1WBDA 1USIA 1JWBB 2FP4A 3S2SA 2YCBA 3RS5A 2O54A 4RE5A 3DLIA 1X15A 2PZEA 4MZXA 1U8AA 1CR2A 4ZQGA 5D6NA 3VZBA 4U7JA 1Y89A 1QRDA 3QY9A 2QW0X 3CRVA 3X43A 1M34A 2KJQA 1SVOA 4RAQA 4D8XA 2DABA 3GPIA 2HMVA 5KWSA 1BQEA 4DL7A 1HGXA 2ECQA 1D04A 4BB9A 4KJXA 3KE8A 3TQFA 4EYEA 1CPYA 2Q1XA 4G0YA 3CIOA 3ZWYA 3QSGA 1L4BA 4ARBA 1LC3A 2P79A 4II7A 1ZK2A 2UXCH 2XNSA 1J8FA 2J6TA 2X9NA 5BSHA 3UYYA 3A4YA 4H7PA 2L0XA 1WAMA 3SC2A 4IJ6A 3DMPA 4E2WA 4O29A 3VNUA 3ZGLA 3AVYA 3R0IA 1N9GA 2GARA 4PWQA 3DVAB 4MROA 3AVVA 4JV2A 4X8HA 1X77A 5KVSA 4AS1A 4U9UA 3I01A 1RHUA 1BFUA 1JEDA 3WQRA 1V7QA 4FYPA 1QPGA 5T41A 1EUZA 3HVRA 2ZJFA 4MGHA 4DR5H 2J85A 4XYEA 1R0YA 3ZI4A 4JLUA 2DFNA 4CLXA 1NQTA 1W4RA 2ARKA 4ZODA 4LWOA 1CUDA 1FFSA 3ROZA 5CBPB 7REQB 5TPZD 1Z4LA 2ZTHA 3ZHUA 3C45A 4R5HA 5CFNA 1RJGA 2ATXA 3GK3A 1IHOA 3UKOA 3GPBA 4DL6A 2ZPUA 1TRKA 1CETA 1SXPA 3KUKA 3D4BA 5JFTA 1A96A 3AK4A 4COOA 4RKWA 4DCMA 1QBKC 3UUEA 4IUBS 3SDSA 4F86A 3GTQA 2FN7A 4LVOA 4L08A 4B3GA 5ALLA 1FZTA 1ZJYA 3PQEA 3RTGA 2BFPA 1JS1X 4LH7A 2B61A 2P2CA 4DCPA 2CCGA 1XTRA 5TDHA 1GTG1 3ET4A 1CHDA 3X2FA 1TEVA 4XJTA 2Z2KA 1SXJD 1VMKA 3JAKA 4MARA 5FTLA 1GLNA 2BRUA 1IULA 4C89A 1YC2A 1XE3A 4FOOA 3KZ1E 1G17A 2PR2A 2HAEA 2MU1A 1WXDA 1YDEA 3AI1A 3EZGA 1XP8A 4Q45A 5DM1A 2MR6A 2IA6A 3I39X 3M2PA 1T5LA 4RY2A 3E9MA 4PHGA 3DOEA 2IDKA 2TRSB 4NJMA 5ELXA 2XDAA 4Z8XA 2IZ1A 1N5KA 1DHTA 3KS9A 1SEPA 3C85A 4OM7A 3T4EA 3AC0A 3LYAA 4C0LA 3N1UA 4YRTA 4JL6A 2E2WA 3U54A 4QG7A 3K8QA 4RQBA 2VO1A 4AO8A 4JVOA 4UJ3A 3H17A 2RSLA 5K2OA 1DXQA 2FKAA 5KG1A 1NY5A 4JP2A 2BQUA 1HE1C 3OF3A 2LVBA 2QZJA 1CF9A 4NARA 4M1EA 4M8KA 4ROSA 4MGEA 1IM5A 3FZGA 3GRZA 2PKYX 3BDAA 4P53A 1EU1A 1FX0B 1Q0UA 3LK7A 1XDUA 4DNQA 3A9RA 3AI2A 1QE0A 3I04M 1OYOA 2VUTA 4UUOA 4CM4B 2W9BA 3FI0A 2AFRA 1FFEA 1VG8A 2ROQA 221PA 2ZIWB 4JI2H 1HSZA 2Z3VA 2PNFA 4GXNA 1MR3F 4HJRA 1U6KA 1ZRHA 2JAUA 4LDPA 3WYFA 4XIJA 1WDLA 2CQYA 2UZ0A 4BX9A 1W35A 5CIWA 4RIHA 3SZRA 2P9ZA 3LHFA 4EY5A 5IDQA 2YJGA 1WPRA 2PZAA 3AR4A 2BGWA 3DP7A 2H9YA 3I12A 3LOUA 5JDIA 2QJFA 5EEHA 2EDCA 4D5GA 1BEZA 2FPSA 4K05A 3DAOA 5ER6A 3RVNA 1RYZA 4KX3A 2R97A 4H0FA 1LWNA 4RKEA 3ZQ4A 4IZ6A 4OX9Y 3TLEA 1XZFA 3IKMB 4OHVA 1ZVVA 1WZUA 4BTLA 4ZI3A 3UYKA 2WTNA 1ZJ6A 3DBVO 1OLUB 1R0KA 2OQIA 1XPUA 4X7PA 1N36B 3BWYA 3OFSA 1GNLA 2WY2D 4AQDA 3SJAA 3AU9A 4RD0A 2GOYA 1YKGA 3N42B 2XUPA 3HZHA 4Y9RA 4NXMB 4DLNA 4O2AB 5CHYA 3EG9A 3SNKA 4B6RA 4ENSA 2WWHA 4JP1A 3DTTA 1G8SA 5HILA 3JZFA 4LDAA 1W73A 4IMPA 4UM9B 1E2KA 1TMYA 1MP0A 1XZNA 5AJHA 3OU6A 2IXGA 3DHVA 2A0YA 3ABIA 1KZHA 3K71B 1V5FA 3L6RA 1VYTA 3P9QA 1TOAA 2ZRDA 1F5SA 2NXNA 1OZFA 1Z5NA 1ZKMA 1FDWA 5IS2A 3BXHA 1M6YA 4EQ6B 2ZE6A 1DAFA 3QIAA 3EH1A 3HCRA 3VNSA 2YZ2A 3UB2A 4F6CA 4RMJA 2FSVA 2ZTMA 1WS6A 4GPAA 2WVGA 2ABWA 3O94A 4L15A 1V5GA 3DZHA 1UBKS 5C34B 5JI2E 3V8MA 4M9SA 4F4CA 4PYQA 2NTEA 3DOIA 4OXQA 3LQQA 1DIAA 4EL5A 3HP1A 4QM6A 3FHOA 3NIGB 4P93A 3DO6A 4R6XA 4LFCH 3JRNA 5BW8A 1QG4A 3K9WA 1XBTA 1X1BA 4YMIA 2E2HA 4C22A 4B6SA 1D3AA 4PLFA 1ZW1A 3Q9UA 2WTMA 5ALKA 5JAMA 1GT6A 3CA8A 2O3SA 2XMRA 1TAUA 1BC5A 2OXRA 2QRKA 4B2LA 3EA5A 4EA6A 1R9MA 3MEQA 5PNTA 1J0BA 4XUGB 1BCRB 3RT1A 1P39A 2OQ2A 1HNNA 1W93A 2FETA 2R65A 3ESZA 4Q5IA 3ZZ1A 2DB3A 4OGWA 5FR2A 1CQIA 1E9SA 3JQFC 3T7AA 1L4FA 3VNAA 2EFJA 2A30A 2HWKA 4D8YA 1G63A 5TMDA 1J1IA 1F60A 1FNSA 5EERA 1M0EA 4K6FA 2C58A 5DV9A 4C07A 3F8SA 2NU8A 3FBWA 3TIGA 3SEZA 4Y2JA 4OHKA 4HK4A 1HWYA 4BQOA 4LXTA 2FRVA 3OLYA 3I6IA 3TJZA 4A93G 3H5TA 1EI9A 1QGUA 2OBXA 4IH9A 3NHSA 3I0MA 3AETA 2HGWA 4MQBA 1L9KA 3IUBA 3H5RA 2Y0CA 1RJ9B 2EGUA 4R6WA 4B31A 4P2GA 5CTJA 3TFOA 4B3MB 1TWCA 2E4ZA 3UGKA 1NXVA 2A2ZA 3JQPA 4Q3DA 2W93A 3NDBB 3PC8C 1I2ZA 4FBUA 2A57A 1A7AA 5L1KA 4Y3UA 2AE2A 1XAGA 1JG7A 4RVCA 1N2ZA 4BKRA 1IC6A 4N76A 1F3OA 4EG4A 1TM1E 2ZRJA 3CTPA 1SUAA 1KK2A 4M37A 2WM9B 3VO9A 1E58A 1GDDA 4ZVSA 3T3HA 2A5DA 1VYVA 1HL7A 4DJAA 4NECA 4FGJA 5G41A 5JUMA 2BGUA 3T94A 3L9XA 2V96A 3SZMA 2CL7X 1P1JA 5I8ZA 4NULA 2WZCA 2HLPA 2JA2A 4I55F 4AMYA 5EWLA 2YCLA 1YTUA 2VHVA 1YBVA 2EIXA 4L5IA 4NJEA 4IIVA 3D8SA 3P2KA 3AP3A 3VVLA 3OBBA 1KAQA 2Z6AA 1MGPA 4MIOA 2QXTA 3SNHA 2HUPA 5A9RA 2ZI9A 3RS9A 4Q05A 2VF2A 5D3QA 3VZPA 2QG9A 4LY0A 5BXQC 4TZKA 3CSUA 3KHTA 1OGJA 3OLCX 2Y9MB 3CVZA 3O2NA 2BEKA 5IP7G 3RAEC 3IJEB 3EOAI 3T95A 4ECVA 1SCJA 4AJIA 2E18A 2YQZA 1M9NA 4ZU3A 1CTQA 3HWX1 1D1QA 3I42A 4JCCA 1YFLA 2IUFA 5B3AA 3A7EA 1GAWA 3OKPA 3PUYA 5CDHA 4M8LA 4R98A 2P4UA 4QGBA 4I55B 4NYMR 5CVJA 1LI4A 2BFWA 1QG6A 3LF2A 2GN1A 1EE2A 1FDRA 1KA9H 4I6GA 1RRGA 3PV0A 2V6IA 1EBFA 4GU5A 3RK4A 3W3AA 2QRPA 1YR2A 4RTLA 3UGTA 4S1VA 1JYFA 2R82A 4BFWA 2VTKA 4C0SA 2R87A 4I5FA 1ISMA 5E7JA 3RS3A 2O52A 4LNAA 2AC4A 3VPGA 3QITA 3JQGB 5BVHA 1Z2NX 1M67A 4KO2S 2FPLA 1CUUA 5BWCA 1PDOA 3EC2A 2AD5A 2IUTA 1T26A 1RYHA 4IRXA 5H3HA 3QQPA 1JFRA 4BJHB 1SVSA 3SKYA 3VU1A 1HQDA 1MABA 2BL4A 1C3OB 1XRQA 1SOWA 5I8PA 2GXQA 2GJKA 4UCRA 3AFIA 4AP9A 4YACA 1WULS 3B1WA 2IXFA 2V7GA 2XB4A 1GFWA 1WMSA 2F7SA 5K0TA 3R9RA 2PUVA 3HOVG 4Q18A 4NS4A 4U2FA 2Q4EA 1VLMA 1FRFS 1KP9A 2ZIXB 1HKHA 4PSCA 2FR1A 2BGJA 2AT1A 4JKYA 2ORVA 5EPOA 5CT5A 1SFOA 3UW1A 2FVXA 3L49A 1XELA 4EUHA 2GCNA 4LE1A 4QJIA 2GN6A 3PXXA 2TMYA 4WADA 4X1IA 1I33A 3IAEA 5BWTA 3CPSA 2G6BA 1MX3A 1IBLH 2OHXA 4CMIA 2OL4A 2P67A 3BM5A 2VJKA 4CM3A 1M1NB 4H2DA 4A6EA 1DTEA 1WKCA 3WLIA 3EY4A 4I3GA 3FKJA 5FAKA 4EHJA 4ZHQF 4DLRA 5L6MB 4DQVA 4H7DA 3NRBA 2CFIA 1YR3A 4H7JA 4L4SA 4EGQA 3QVGA 4WXRA 4KDFA 2VJMA 3CE9A 2F4NA 3DBHB 2PVCA 3O1HB 3U3XA 4B6GA 3H05A 3NUAA 5GP1A 1KDTA 2FK8A 5J5AA 2NU7B 4CMHA 3CG4A 3IKTA 2WA2A 3F8WA 1GAJA 2B25A 3TNFA 2K4MA 3HADA 2O7RA 4YJDA 3EX7C 4ALIA 2BCEA 5SY6A 3QXJA 5FTWA 3COZA 4JOQA 1S9HA 1CR6A 4YNBA 1E6EA 4HD8A 2FFJA 3ZWPA 2RBEA 4CKBB 1C9YA 4QGFA 1VL2A 3BHMA 1NVVR 3AOEC 3ODPA 3FDSA 3GVIA 4YAJA 2CMDA 4XCQA 1DXOA 5IK2A 4ZHQB 4HVAA 3OQIB 3NR2A 2PU7A 3LRXA 3FZYA 5KJFA 2J0VA 2RJ3A 2Q8PA 2F3RA 4YT5A 2PX6A 5BR4A 3IVRA 2PGIA 1V4BA 3KXDA 3CF0A 3CRMA 1MJHA 1RHKA 3AR2A 3OPNA 2OHHA 4JUZA 4HT3B 5DGIA 4XPIB 4EW3A 1K7EB 5K8UA 4JOBA 1QJCA 4KXMA 4URZR 2VP5A 5IARA 2E4UA 1MA0A 3PR1A 4ZAXA 4ZGBA 1BRMA 1E8NA 5CPFA 3TG8A 4HNAB 2B30A 2PRYA 2XNCA 3LMLA 3DOFA 3E7DA 4CF7A 1CZRA 3D4NA 2AVNA 3TGLA 1E7WA 4CIAA 2C4KA 1KJJA 4B0OA 4OL0A 1P0QA 2QTWB 2RGAA 1UNNC 1IHYA 3RGGA 3CXUA 2MSDB 4B5KA 1W1IA 4N0EA 4GGPA 4QEKA 1DJNA 4R05A 5TR9A 4EPXA 3OZAA 4MJ3A 3AEQA 4K6HA 4G25A 3RK0A 1NOIA 1WD5A 4ZPJA 4YRBA 1S8FA 1T3SA 1Z75A 2UVRA 2NADA 3GH1A 2NVXA 3BTVA 5JZ9A 4JI5H 3AI7A 1JMKC 4XASA 3LU1A 2FZVA 1O54A 4DMUB 4AKHA 1G8FA 4C6SA 4CU5A 4LF9H 2XGPA 1FJXA 2LIVA 2R7MA 4U2EA 4ZYZA 3BSWA 1VIMA 4DYHA 3CEBA 2JI6A 2AN9A 2OUKA 4Q4AB 2CZGA 1E1DA 4HDNA 4NATA 2I91A 1GKKA 5DOZA 2QVXX 3O82A 1P7YA 5ALEA 4TM7A 3FW1A 3LVFO 2LR0A 2VF4X 3U17A 3M82A 2QM3A 4EJ2A 1VECA 1QH1B 4HN9A 5AM4A 3IUEA 1E5LA 1FYVA 4XUEA 3AVWA 1KOGA 1CJUC 2BUCA 2ZT8A 1Q3TA 4GX0A 5ELMA 4KK4A 2I3AA 1T2NA 1WHSB 3A9WA 2XOEA 2RHOA 3OEEA 4BFZA 1IBKH 1IJBA 3HR4A 3WLSA 2NPIA 2NTYC 1OI3A 3X1MA 4IJMA 3C3PA 3E05A 2YN2A 5P21A 3QFFA 2W8BA 1RBZA 4UTVA 4GP6A 2FUNB 2XB9A 4GVLA 4ZOCA 3ZDXB 1EKXA 1XA0A 2ZVPX 1UFVA 1RM3A 4AC9A 4K2AA 4TSKA 3WVNA 1O6GA 3I92A 5B1EA 2N1MA 2XBUA 5G0TA 2B9VA 2XXAA 1YUMA 3OEHA 2AB0A 4TUYF 1W7AA 4TMZA 4L8FA 4YMGA 2VPSA 2F55A 2NUPB 4K9LA 2R6R1 5HCNA 1AGXA 3BIXA 3AR6A 3ZWNA 4DR6H 2DECA 2CFTA 1ENZA 3N2KA 4FE4A 5ENDA 1YR6A 3OTWA 2FPIA 5T67A 1BJTA 3RFXA 1G38A 2HLDD 2XZPA 5FFNA 3PJEA 1L5HB 3O93A 1NUAA 4UEWA 1WKBA 1GO3E 3T41A 1E2DA 2GM5A 1XRSB 2PZ8A 2AUMA 4KFRA 3B36A 2XCLA 3ROEA 4FSDA 3KQUA 5EAIA 5HYVA 2PL3A 3AJRA 1PWZA 3BQ2A 4IO0A 3DL7A 2Z9BA 4DT1A 3TAUA 3HG7A 2CJWB 5DEIA 4JJ7A 3SBEA 3P19A 1DMSA 2BD0A 1Z2EA 3R5KA 3BORA 1VGQA 5EPEA 2FUKA 3D3EA 1WCMG 2PUHA 4AJHA 2OFWA 3EQ6A 1ATZA 5CDFE 4Q93A 4PTYA 2QX7A 4P9NA 3E9DA 4M98A 4AN0A 3S7ZA 4PGFA 3HBMA 2FK1A 1NYRA 4GKBA 1JA1A 1E69A 2EIYA 5J1TB 3KPYA 3OT1A 2CL5A 5HZMA 2W90A 3CB4A 4IINA 3MJHA 3PPWA 1A4XA 3SI8A 1JVSA 1F48A 3JYHA 3OFVA 4F9GA 4G1EB 1DDOA 1HLGA 1Z8HA 1M1XB 4HLDA 4M9ZA 4MIYA 1EVJA 3MAAC 3OJCA 5KNDH 1F0YA 4ASUD 5KU7A 1W48A 3FMAA 3LRTA 3SYKA 1Z2AA 3RFCA 1E9BA 1K5PA 3S2ZA 4ND1A 3SMQA 5FYQA 1QYVA 5FFFA 5CH8A 4IAOA 3T5GA 3UMJA 2P2ZA 1RI1A 1L5RA 4OLJA 4UZEA 5C31A 1U3DA 3GWZA 4ZT2A 2WEKA 5IVPA 1EJ2A 5FLYA 5HTKA 1XLWA 2V7XA 1E8DA 2CWDA 2GA8A 3QOYA 3ZHYA 1KQOA 4MI3A 4BWFB 1YE3A 2I3ZA 3U7FB 2B8TA 4F2DA 2DEUA 4DOMA 3KSBC 3GFSA 2Z3ZA 5AR1A 4MI6A 4CIBA 1EHYA 3A6ZA 2BEVA 1EM8B 2VZEA 1PR3A 1ZOPA 4DB2A 4ZTUB 2WT8A 3IUMA 4FZ5A 2P9CA 5LDHA 1XCOA 1XX6A 1L4EA 4O63O 4PFKA 4JL8A