2FPOA

Putative methyltransferase yhhf from escherichia coli.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
183
structure length
177
Chain Sequence
GQIRIIGGQWRGRKLPVPDSTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methyltransferase that modifies guanine 966 of the 16 S rRNA: functional identification and tertiary structure.
pubmed doi rcsb
molecule keywords methylase yhhF
molecule tags Transferase
source organism Escherichia coli
total genus 56
structure length 177
sequence length 183
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.171: 16S rRNA (guanine(966)-N(2))-methyltransferase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fpoA00
1X1AA 3DTNA 4GBED 3ANXA 2JHPA 3JWIA 4NECA 5EZQA 4HTFB 4RTQA 4C03A 3A27A 4YMHA 4B17A 3UJDA 2VZ9A 2FPOA 3DXXA 1D2HA 1JTEA 2GPYA 4LG1A 3HEMA 3HVKA 5LQAA 1YF3A 2Y1XA 3V97A 4GEKA 5EEGA 4YV0A 2HMYB 3PFHA 5FHQA 4XUDA 2PWPA 1VIDA 3DUWA 3AXSA 3LBYA 4JXJA 2AOVA 4GUAA 4F85A 4RTPA 3FPGA 3LGAA 4E33A 2AOUB 3GCZA 4FT4A 5G02A 1FJXA 5GM1A 3PS9A 2PX2A 5HFJA 4KWCA 4PYQA 5CVUA 5F2OA 1L1EA 3FUXA 3HTXA 3PFGA 3DMHA 2JH8A 2Z6UA 5C1IA 1KPGA 5E8RA 2XVMA 5LQUA 3KQTA 3EGVA 4PWYA 5EZSA 1QZZA 2PJDA 5FUBA 4GC9A 3G2QA 5JUWA 2K4MA 1ZKDA 5CUQA 4BP3A 4QDJA 5EIFA 2OB1A 3KPJA 4LECA 5DM0A 4RVDA 3CJTA 3FPHA 2PY6A 4YUVA 1B42A 3G2OA 3E7PA 3FTCA 5K0FA 1EQAA 1L3CA 2AOWA 3DOUA 2N47A 3FPJA 4KDCA 3EGEA 3DH0A 3IEIA 2XBMA 5ICFA 1KR5A 4V0RA 5M5BA 4KVZA 4L7VA 1O54A 5GINE 4ER0A 3NW9A 3OPNA 3BXOA 4QVKA 5BXYA 3ELYA 3PLAE 1NKVA 2ZIFA 1JSXA 3DXYA 4OQDA 1R8YA 1M6EX 3KQVA 5FULA 5HEKA 1Y8CA 1O9HA 4QQKA 1RJDA 4X63A 3BWBA 4Z2YA 3C6KA 3HCCA 3PT9A 4U7PB 5EKUA 1ZGJA 1QAOA 3EEYA 3R0QA 4DMGA 3P71T 3LECA 3ELUA 4PCLA 1JTFA 2PWYA 1G8SA 3KQPA 3VYWA 4CTKA 4ER6A 1U2ZA 4PYJA 1XCJA 2FRXA 3GDHA 5MHTA 5DRTA 2NP6A 2KW5A 5HOQA 5K01A 2B3TA 3P2IA 3M6XA 3KPUA 4DF3A 3EVGA 3HCEA 3KHKA 4HGZA 4RX1A 5K0JA 3BT7A 2LD4A 2Z6QA 1SKMA 3B3GA 3FPEA 5FWAA 3A25A 3ER8A 3IYLW 3MQ2A 1IM8A 1YZHA 5CCXA 1AV6A 2PVCA 1G8AA 4EMSA 2ERCA 3LCUA 3KQMA 3OE5A 3MERA 4XUCA 1FP1D 3AWIA 1JG3A 3CCFA 3B5IA 4KIGA 1T43A 1RJFA 1VLMA 1QANA 3P8ZA 3Q87B 4HH4A 3HP7A 1YZ3A 3TR6A 2PX8A 1KP9A 2P3LA 3T7RA 5KVAA 1PJZA 1SUSA 2VS1A 4KW7A 4QTUB 3OZTA 2GH1A 3HCDA 3MTIA 4PNEA 3I5UA 5IH3A 4FR0A 1NBHA 3HCFA 3ME5A 3G88A 3GIWA 1BKYA 2BZGA 3AY0A 5DM4A 2NYUA 2CWWA 5K0LA 4AX8A 2VDUE 4CWAA 3AJDA 2FYTA 4IKPA 4LWOA 1DUSA 2AZTA 3OU7A 4CKEA 1NV9A 2PX4A 3M6WA 2BR3A 3OU2A 1N2XA 2GAFA 4MQ4A 2VDVE 3S68A 2Q41A 3EVZA 3M33A 1WY7A 4GOND 4RV9A 4X41A 5DXAA 2EFJA 2GS9A 4EKGA 4FP9A 4P7GA 4R05A 4AZWA 1WZNA 1RI4A 2GB4A 3MB5A 3HCBA 3NTVA 3KQYA 3C6MA 3F4KA 5DM1A 5E9QA 3TOSA 2P35A 4P7KA 5LQNA 3GRYA 1XDSA 5GM2A 2P40A 2I7CA 2IGTA 2YVLA 3VC1A 4BP1A 5ICCA 2JG3A 3M4XA 3LDFA 1EAMA 4BLUA 5HIKA 1KYWA 2ADMA 3NDJA 3OU6A 5CD1A 2BM8A 3P9IA 3KQSA 2B2CA 4RVFA 2ONZA 3SR4A 4DA4A 3T0IA 2C7OA 5GIPE 2IH5A 3LL7A 3ER9A 4PYNA 1RI5A 2YXLA 5EQJB 4A6DA 3KKZA 5EG5A 2B9EA 2JHAA 3DLIA 3KPWA 4IWNA 5K0BA 3ERCA 3SX0A 3REOA 2YXDA 4E70A 3FRHA 4FSXA 1RJEA 1OR8A 2Z6AA 3LSTA 4RTSA 3WSTA 1NW7A 5LQKA 2PXAA 5E2AA 1DL5A 3SMQA 3KR2A 2CMHA 3U81A 2OKCA 3GRRA 2O05A 2O0LA 4R6XA 4GQBA 2FK7A 3FUVA 1QAMA 1JR4A 3QOWA 4E32A 2P41A 5EC8A 2NXCA 3MHTA 5E8JA 5HIMA 4RTLA 2ZCJA 9MHTA 4HC4A 2QE6A 4EVIA 5HIIA 2BR4A 3FPFA 1P1BA 4CXMA 3NWEA 5HILA 3ELWA 3G8AA 3KPYA 5DX8A 3BUSA 4X1OA 3LHDA 4DCMA 2ZW9A 3K0BA 4H0NA 4F86A 3BWCA 4GOOD 1RJGA 3LDUA 4R8SA 2IFTA 5H02A 3RODA 2V7EA 3SSMA 1WS6A 3V8VA 2P7HA 1YFLA 3GJYA 3RIEA 3UJ6A 3THSA 4UOEA 4ATNA 1MHTA 8MHTA 4KIFA 2PV0A 2PX5A 4G56A 3G2MA 1TPYA 5DTMA 5C9ZA 1O9GA 2IBTA 3ID6C 5P8WA 4DCGA 5LQCA 5F2KA 1D2GA 1XDUA 3CGGA 3M70A 5CIYA 1EJ6A 1VP9A 2O07A 3HCAA 4V0QA 4Y30A 2XYRA 1M0EA 3FYDA 2OY0A 5ICGA 3JWHA 3KQQA 3C3YA 5FCDA 2I9KA 3TM4A 4BLVA 2YR0A 3GRZA 3M6UA 1TW2A 1XVAA 2AOTA 4EQZA 5BW4A 5K05A 1ZHFA 3CVOA 4RTKA 3ELDA 2G1PA 4E2YA 3TKAA 3FTEA 2ZIGA 3SGLA 5HIJA 2YQZA 2ZTHA 3GGDA 3H2BA 2EJTA 1IY9A 1L3IA 3X0DA 2PT6A 3LBFA 3DP7A 5CVDA 2FK8A 2OYRA 3EVDA 4PCAA 5FHRA 1X1CA 5T67A 1XCLA 5DX0A 1R00A 3SVZA 2IH2A 1ORIA 5CM2Z 3TFWA 3BWMA 3KR9A 2ZFUA 2EJUA 3EVFA 3EVCA 3UA4A 1RI1A 4EK9A 1SUIA 4MWZA 1JG4A 5GWXA 5DPMA 3EVBA 2XVAA 3CKKA 3HVJA 1NW3A 5EHGA 4AZSA 3CJQA 4RTNA 2UYHA 1UFKA 2C7RA 2IP2A 5LQJA 2VDWA 4DZRA 4OQEA 4PGGA 1BOOA 3A7DA 2H00A 5FQNA 5IKMA 5LR6A 3TPZA 3THRA 5GOZA 4M38A 3EVAA 3LCCA 1NV8A 5B1SA 3G7UA 3HA5A 5KQRA 1XTPA 3M6VA 5CVEA 3GRUA 5FA5A 2B25A 3NWBA 1SG9A 4QTTB 4R6WA 3SXJA 1SQFA 3UFBA 3LKDA 2UYQA 4FSDA 3G8BA 2AVDA 3TQSA 5EMMA 4YV1A 2NXEA 3DMGA 3E05A 3O4FA 3R6TA 1F38A 3FTDA 1VL5A 3HVIA 3PB3A 1JQEA 3NVKI 2NNWB 5DRYA 3FRIA 1VQ1A 2CMGA 1VE3A 2QYOA 3O7WA 5BW5A 3UZUA 1BHJA 3UJAA 3UJ8A 4U7TB 5GP1A 1WG8A 3L8DA 4IV0A 5T64A 1DCTA 3FUUA 3P9NA 1X1BA 4FT2A 1AQIA 2ZLBA 3NDIA 5EHIA 1VPTA 1H1DA 4K6MA 1TW3A 2AOTB 4PYLA 3HNRA 4GOLD 4YUWA 5CVVA 3I53A 5HZMA 5CCBA 2AOUA 1KPHA 2F8LA 3CC8A 3OZRA 4RVGA 1KYZA 4WVLA 2IDKA 4WXHA 4C4AA 4YUXA 3B3FA 1NBIA 3R24A 3C3PA 1Z3CA 3OZSA 1M6YA 2WA1A 3KQOA 2JH9A 4MHTA 1N7JA 3NVMB 4R8RA 2PT9A 4CKCA 2ORED 5ERGB 1ZGAA 1HNNA 3EGIA 1NW6A 2ESRA 5K09A 1R8XA 4QVGA 2PKWA 2A14A 3P2EA 4FGZA 5EKXA 2DULA 3VC2A 3QV2A 3EMDA 5FADA 1ZG3A 3BKXA 3ORHA 5FTWA 2PXCA 4ER7A 7MHTA 4OBXA 2P1DA 3KU1A 4GC5A 2HR1A 3KQWA 3C0KA 4AZTA 3NMUF 3LX6A 3DLCA 5DM2A 1JG2A 1FP2A 4O29A 2G72A 4GOMD 1FBNA 2UYOA 3BZBA 3GXOA 3HA7A 2AS0A 4CTJA 2JJQA 2R6ZA 2WA2A 4PYOA 1RI2A 3GO4A 3I64A 2YTZA 3UJBA 4RTOA 1G38A 4C05A 4E30A 5DT2A 2YXEA 3CJRA 3B3JA 4P7FA 4XUEA 4ZTBA 3TMAA 1MJFA 2P8JA 2ZVJA 5K03A 4P7JA 1R74A 2ONYA 4PYMA 1XJ5A 3G2PA 4OA5A 3T7SA 2ZBPA 3HM2A 4LWPA 4M36A 4X60A 1QAQA 4YUZA 1ORHA 1R18A 4YMGA 1JSZA 2G71A 1L9KA 3JWGA 2UYCA 1KHHA 3IV6A 3DMFA 2E5WA 4OA8A 5EMLA 4E2WA 1KIAA 3GRVA 2EG5A 2H11A 2QM3A 3DR5A 1ZQ9A 2I62A 1UWVA 2PBFA 1RI3A 1NT2A 4IV8A 2UZ4A 3OCJA 3G5LA 5C0OE 2R3SA 2ZBRA 3IHTA 2ZSUA 1WXWA 4M7RA 3TRKA 4DM3A 2QRVA 3UWPA 4HGYA 2BR5A 1P39A 1SQGA 3TM5A 2HNKA 3BKWA 4PIPA 5DWQA 2OO3A 4RTMA 3GU3A 4M37A 5E1DA 5EOVA 4F84A 1IXKA 1X19A 3PX2A 5F2NA 4RTRA 3PVCA 3UJ7A 2OPBA 3UBTA 2C7PA 4CKBA 1EIZA 1V39A 1AQJA 1BC5A 5EGSA 3OFJA 2NP7A 2AN3A 1XXLA 2AN5A 3QOXA 2FCAA 2ZWAA 3R3HA 3EPPA 5K8VA 2YX1A 2YUIA 5DLYA 3EVEA 2AR0A 3RW9A 3UJ9A 4MIKA 3K6RA 2HTEA 3FUTA 1I4WA 1Q0SA 3UA3A 3DULA 4E2ZA 4YV2A 2ZBQA 2ZIEA 3LPMA 4A6EA 2PSSA 3B7PA 4FS8A 2ZZMA 4YUYA 3B89A 5E1OA 10MHA 4BY9E 5EEHA 1UIRA 5EIWA 4PYIA 4PYKA 2GA9A 4Y2HA 1JG1A 2OB2A 3P9CA 4QDKA 1INLA 4RVHA 5EMKA 5DSTA 2O57A 2C7QA 2CL5A 1NW5A 4QPPA 2BM9A 2V74B 5JR3A 5DXJA 4AZVA 2I6GA 3KR1A 2ZZNA 3MAGA 1VP3A 3FTFA 1G6Q1 4HRAA 4DQ0A 4QQNA 5EMJA 3A4TA 4RSRA 2ZWVA 2QY6A 2AVNA 5EVJA 4AUKA 1X1DA 2IBSA 2WK1A 4HSGA 2HWKA 5T6BA 2NXJA 1EG2A 2P3QA 3Q7EA 5DTQA 5E1BA 4PINA 5U4XA 2IH4A 3VSEA 5K0EA 5CVJA 3P97A 1I1NA 3A7EA 2IPXA 5D1NA 1NW8A 3PTAA 3G89A 4PGHA 5DX1A 3EMBA 5LQRA 3BGVA 1SVUA 3SSNA 4KRGA 1JQDA 2FHPA 5ICEA 2OXTA 5E1MA 4C04A 2QRVB 5KQSA 2JHCA 2AN4A 2CKDA 4KDRA 3P9KA 4ISCA 3SM3A 3UJCA 2PXXA 1P1CA 4HTFA 5DSXA 1FPQA 3LKZA 5D1HA 3T7TA 4POOA 3FYCA 4P58A 1KPIA 2O06A 3BWYA 1YUBA 2GLUA 2PGXA 3D2LA 3E8SA 1D2CA 2G70A 3MTEA 1N7IA 4OBWA 5BP7A 5K0GA 3TLJA 4C08A 1KXZA 3G5TA 1F3LA 4RWZA 3EEOA 3MCTA 4RTJA 2NXNA 2ZULA 4EKIA 5E2BA 5KS2A 2IDJA 4X61A 3TKYA 3JWJA 4ER5A 4GF5A 5K0CA 4ER3A 1R6AA 5KYGA 3FZGA 5E9JA 2B78A 1XDZA 5FA8A 3AXTA 1L3BA 2XYVA 3A26A 2OBFA 3I58A 2HV9A 2PLWA 4BLWA 3GWZA 3BGIA 2OZVA 4XCXA 5LSAA 2BH2A 5FWDA 1EJ0A 1Q0TA 1G60A 3HA3A 1YB2A 2AOXA 1VBFA 5GIOE 3GNLA 2ZZKA 4OX9Y 4E31A 2G8NA 3FUWA 4QPNA 4C07A 3PX3A 4HG2A 4MTLA 2P7IA 1QYRA 3BGDA 1WXXA 4FZVA 3MCZA 2VP3A 3OE4A 2P3OA 4PONA 1NE2A 5K0NA 3MGGA 1I9GA 2DPMA 4RYLA 4C06A 1G55A 2Y1WA 3LDGA 3O31A 3CBGA 2H1RA 3DXZA 5EPEA 4DKJA 2XYQA 1HMYA 1P91A 3R9XB 3OFKA 1AF7A 5DTRA 4E2XA 1YFJA 3E23A 5E9WA 1JQ3A 3SSOA 3I9FA 3KPVA 3KR0A 3P2KA 3HVHA 3LCVB 2EX4A 3NJRA 1PRYA 4PIMA 2IIPA 5FQOA
chains in the Genus database with same CATH superfamily
4HXFB 5LU9A 3LP6A 4D02A 2G63A 5CEEA 4ZU1X 5JY6A 4CEIA 3I30X 4LF7B 4XRRA 1UZAA 2QLLA 4C3OB 4YQZA 2V7UA 2P4QA 4EFKA 5CD9A 2DR0A 1DAOA 4WEOA 3ZDBA 2VZ9A 4KG7A 4BU1A 2V9ZA 2WHPA 4DIMA 5FUQA 2HA2A 4WCFB 4GEKA 1HE3A 4I50F 4XVRA 3MRSA 4MQEB 2WF6A 3ZPXA 4A8PA 4BEWA 4TUYA 1DKQA 1ZCBA 3GXBA 3LRPA 3CPHA 5DHFA 4U8HA 1VIDA 4HT3B 2QL9A 3S1AA 3ECCA 1T8SA 2GJ4A 3AXSA 3BG5A 3WP1B 3ET4A 4L5YA 1P1FA 4NP6A 2BLNA 4JQYA 2OCGA 3NVAA 3UWKA 2RI6A 5G0TA 1P81A 5G02A 1ZKMA 3AMVA 1KZ1A 1BOFA 1DC4A 3VX3A 5GADl 1OIXA 3AYXB 3QYJA 1Y9ZA 4EYKA 2ENUA 1H2YA 3FUXA 3PFGA 3WADA 2F90A 3DMHA 3QX3A 3P9XA 3TAXA 5AJWA 1PYGA 5C1IA 1Y8RB 1K97A 3IQDB 1ESEA 2QTCA 1YJAA 3K3PA 4XPIB 1RWBA 1H2XA 3RO7A 1JKJB 1MQSA 2R0QC 2O7QA 3L4BA 3IDZA 1XD2A 3G2QA 2BBTA 3RRYA 4QDJA 5K7SA 1XEXB 1ZOLA 3DLAA 3KM0A 1GYPA 4J76A 1CV2A 2WEKA 4JJ6A 4KZPA 4BYMA 3PF8A 4XRGA 4ZYUA 4Q3AA 1PDOA 3DZ8A 4MGHA 2VJPA 4OMFG 4XJTA 3O1JC 2AFIA 1PVDA 2JKYA 3QX9A 2OFFA 5ICFA 4MXDA 2NW6A 4U0KA 2VXCA 1CRLA 3CH4B 1XX6A 3AHHA 1U9IA 3PFCA 1U04A 4QVKA 4ND8A 1QOZA 4TVKA 1P80A 4TLMB 2SKDA 5LBTA 3E15A 4LDAA 4QQKA 4G1BA 1O9BA 3R6GA 4WI1A 1QCYA 2NSYA 2IE8A 3F90A 1XRSB 3MXOA 4GZ6A 1AQ6A 4OREX 4QECA 5EYPA 3QV1A 1M0SA 1THTA 2RAUA 1TAQA 2V7TA 3OM1A 3KKKA 4KRYA 2XB4A 5AM2A 5AVTA 1DV1A 1JWAB 2K87A 1NC1A 1RYZA 4DR5B 3SS9X 1G8SA 2DG2A 5EIHA 2H1WA 3EQ7A 4ZYWA 4A0GA 5KAMA 4G0NA 1PR5A 3QE4A 4A91A 3R7NA 3OQVA 1KO5A 1VJ1A 4R9RA 1IU9A 3H86A 4PRKA 2OTCA 3WOHA 1W4CA 1J2RA 1R0LA 2XXAA 5CG1A 2G9UA 2E6KA 2I0FA 4E15A 5HVNA 1JDVA 4ROSA 1KU0A 1II9A 3N0TA 4A92A 4CIAA 3ER8A 1MH1A 1SIOA 2HZ7A 3CUWA 1IM8A 1IK6A 2FPRA 3F47A 3MRVA 4HZGA 4LRTB 3UGTA 4DBLE 4QJIA 1KMMA 1JG3A 1NFQA 4YRPA 3PC7A 2AEMA 1V6AA 3EZNA 4WSOA 2SNIE 2ZRMA 1JVNA 2OV4A 4DOMA 4UTOA 4Y7CA 3WX0A 1IJEA 3FXAA 1Z7YA 4DLSA 4BRWA 1CS0B 4OXQA 1Y3DE 4D4IA 1CEEA 2ZRAA 3UOGA 1JGTA 4JMLA 4MARA 1U2SA 1LBEA 2J5XA 4TKZA 1G20E 4ZAGA 1WDKA 1VC2A 4LQ4A 3DDOA 2VPQA 1YCFA 2P0EA 3ZBQA 3Q9UA 4IHAA 3AY0A 3QZUA 3ESDA 3QPWA 1H8HA 1RIFA 4MUNA 1N2EA 3VR2D 4BFZA 2AWNA 4N54A 3DV9A 3EIHA 2QG9A 4Q4JA 1FLAA 3MCUA 4YP1A 5G53C 2RC5A 5HE9A 1WMFA 2ZUEA 2FSVA 4GZ3A 4JAVC 4EA7A 2H63A 1M1NB 3KEQA 3WS7A 4QKQA 4EHLA 3UWSA 1NP7A 1TM3E 1UJBA 4PG5A 4PVDA 2XUQA 3ZE7A 5SYNA 3ORFA 5IJXA 1KDVA 3A6FA 4Q16A 1PYOA 4BBPA 1YB7A 3KE9A 3W0LB 4CIYA 3KTFA 5GAJA 5BWMA 5AKKA 2QP3A 1GFIA 2YV1A 2K7ZA 1GGEA 2PMKA 3CSSA 4MUEA 5ALUA 3K73O 3G8CA 3L0ZA 3X1YA 2ZSDA 3NDJA 3WNQA 1RXYA 4EVQA 3KQSA 4RVFA 3JZDA 4YAJA 4YRSA 3GUVA 2OCIA 5HMMA 4IWXA 3ADDA 1DRVA 3BCHA 3C97A 3K96A 3LPDA 4ZVKA 1H42A 3LZ6A 4IWNA 3GH3A 3LPAA 4LYHA 4D5GA 1OBOA 2ZAIA 4DNOA 1P7PA 3NBYC 4ARZA 5KTYA 4KQ9A 1E2NA 5EE0A 2C7BA 3WSTA 2Z95A 1WZ2A 3PEEA 4BVKA 1EGHA 3PXDA 4LXTA 3QLJA 4FYPA 2ZIXB 1SD1A 2Q2OA 3DT9A 4QUBA 4FJ1A 3GLSA 4JA0A 1R12A 1O3YA 1PGOA 2AXQA 2UVQA 2V8OA 3HUTA 1E9SA 1N6IA 2GF0A 3LT1A 4KO1S 5ES3A 4ZV7A 4EG5A 2H9AA 2P41A 5EC8A 2NVWA 2O1XA 3TMKA 3SQMA 4E14A 1XDWA 2Y1DA 1GYRA 3D43A 1MABA 2JFWA 4F1JA 3F2VA 1SXJC 3HB5X 1N2OA 1ETHA 1OFVA 1P1BA 2B30A 2O2HA 2VK2A 1YZVA 3I2YX 4MQ5A 4OHOA 5F1YA 2WYIA 5H7XA 3RT9A 4RF3A 3TTXA 2YCLA 1SVWA 4IMPA 4ZCSA 3CVVA 4UMVA 2E4VA 2FA9A 1BA2A 2Q46A 4R8SA 5H02A 3VOBA 3AETA 1NVMB 1L4HA 3I73A 2Z5VA 4EHKA 3C3EA 1P8JA 3R5FA 4MI9A 5PNTA 5T57A 4HCJA 4RS3A 3H2SA 3Q8XB 4MQ6A 3RS3A 3UOAB 5FEUA 1GLVA 3DO5A 1VMIA 2GCEA 2Z58A 3OMLA 3Q7TA 3EFOB 5IKPA 3NWOA 5DTMA 4OGLA 1XLTA 3R9KA 3KSAC 1S3GA 4C6SA 3PPWA 8ADHA 3MTBA 2CBZA 5IJAA 5TS3A 1UMKA 5KQLA 3K1AB 1CB0A 2JVKA 3DHWC 1X1EA 3ENWA 4MITA 2O3RA 5DK4A 4BFYA 1QGYA 1X80A 4M8IA 5DHQA 3RS0A 1DIRA 1EWVA 4LMPA 1E0AA 3AFGA 1QGUA 1XJ0A 1GD1O 1KHTA 4TWIA 5TVKA 3GBPA 4P4SA 2AOTA 4RHEA 5FL7A 1HNWB 3IFSA 3THYB 5FUVA 5EGNA 3AR3A 4G8DA 1B4DA 2O8DB 1G0NA 3AERB 2YVKA 4RD1A 1CZUA 1IXSB 4ALMA 1PT6A 3FNBA 5GJWC 2GM5A 3O3NB 4V0ME 3AUAA 3OLVA 2Q6VA 5IHXA 3QI2A 2QPTA 1BJTA 1TTHA 4CV2A 3LT5A 1OX5A 3MUFA 4RSMA 3VZPA 1K66A 2QBYA 4X44A 4RBNA 1Y81A 2P75A 5I7RA 3ZHUA 1M6WA 2QGFA 3MWEA 2IYLD 1YQUA 3Q7PA 5D7NA 3PUKA 4CU2A 2I34A 3PC8A 4C2BA 3E6AA 1JX6A 3UPTA 5IH7A 4RTNA 1GR1A 1NE7A 3CJQA 2B2XA 4YQYA 1UEJA 2EKZA 1G8JA 1UM8A 2B6HA 2FKNA 3I23A 2C29D 3QG5A 4TKUA 1ZCFA 4KGZA 2HBZA 2XCRB 4MPTA 2OWEA 4HATA 4ITUA 4DLLA 1DLIA 2FOIA 1UBLS 2E4WA 3QNWA 1IVYA 1G8MA 4JEUA 3GRUA 3FWKA 1VOTA 4QTTB 1M8JA 4ZT7A 3M8KA 4K6OA 3SE0A 4C4ZA 5IMSA 3LWBA 5E6SB 4AKHA 1O96B 3ES9A 1U9YA 1ADJA 2QSZA 1QIIA 3SZGA 4YAIA 3PP8A 1QKIA 3BB4A 3DVQX 3EVNA 4QBKA 5DYIA 1L8OA 2GWHA 1Z4MA 4Q24A 4LYJA 3VR5A 1FRFS 2QX9A 4G1UC 1GDHA 2J87A 4IJVA 4WL0A 1NRWA 3P5BA 5CK4A 3L7DA 3VVLA 4PG8A 4CM8A 1HBJA 1DEKA 1SVIA 1PZHA 4JSTA 3PZBA 2QRNA 3RC9A 1ESMA 1N2ZA 2PSHA 3Q0TA 5GMOA 5BORA 2ZYVX 2NU7A 2P5SA 2O6LA 5KX5A 1CUBA 3EAGA 3C6XA 2DXIA 4OGKA 4IY1A 1TU3A 2FUG6 1ECCA 1WXHA 2FFBA 3QPCA 2ZSEA 1X74A 3HUFA 4UTXA 2FHSA 1BVUA 2VR1A 1ZP6A 4UVGA 2GPWA 1N7JA 3WICA 4RJIA 2I1WA 2HXSA 2WWIA 3MCWA 1AKMA 2H4YA 2BJHA 1NW6A 7GPBA 1GTZA 1A71A 3ESCA 3NI2A 2J46A 2XCUA 4IICA 3WC4A 1XELA 5K09A 2DULA 3WMGA 3A31A 2HCTA 4JB8A 4TTIA 4U3JA 3NRCA 1FVOA 1Z5ZA 4XW2A 4UU0A 4D8UA 1BKDR 3SVLA 1WB5A 4RZIA 3AM1A 3PXXA 4J90A 4P31A 4KXFB 5LYJF 3B8EA 4MLZA 3E18A 4GC5A 3M9WA 4M98A 5FKJA 1NL3A 3SX2A 1FLNA 3JQ9A 1ZN8A 1L2TA 2UYOA 4U02A 3ZNPA 2AS0A 2JK0A 3LP8A 4B84A 3H9EO 3R5XA 4PYOA 4DCPA 2B1QA 1Y1SA 5I9SA 4L4ZA 4K03A 5EIEA 2RH9B 1Z5NA 2XQFA 1ZI9A 2XDQA 2X2EA 1OLUB 3BD6A 3WYCA 4F4UA 5JROA 5G3YA 5K03A 2P8JA 3I4CA 1JT2A 2WJGA 5KTSA 3HVUA 1USIA 1UJ2A 4ASUA 4RKYA 2ZBPA 4DLKA 4X1KA 4URZR 3FPCA 3LQQA 4HLCA 1BXZA 1ORHA 1X7ZA 2DCUA 2OCPA 2O4UX 5EKDA 3LGXA 3CVYA 3OCUA 2C2KA 2RDMA 1V4BA 2V0GA 1T2UA 4JL5A 3DMFA 3DEYX 1WCIB 1R6TA 4JT4A 2QIPA 5PGMA 4AJEA 2JEYA 2AC7A 4I4CA 1RP7A 4IV8A 4BTLA 2UZ4A 4FNOA 1SG0A 1Q5PA 1OH5A 1WXWA 1XVUA 4F9TA 2R11A 1USWA 2YZMA 3MJCA 1Y7IA 1IULA 4X6XA 4F97A 1Z16A 1OLSB 1QTIA 5L3QB 3N07A 1E4YA 2YXPX 3LMKA 5LL6P 1YQTA 4G4JA 3PWZA 4BKMA 3REFA 1BMTA 3K1TA 1FTGA 1FYFA 3DAFA 2BKAA 3T95A 4R8VA 4CMHA 1IHDA 3F5DA 4H77A 4IGKA 2QHXA 2WPDD 5DLYA 3URKA 3UCEA 4FMDF 3V4OA 4BECA 2HTEA 1XU4A 3HKBB 3Q85A 2VXBA 4ZZ2A 4TL9A 1V3UA 2C2GA 2AJCA 3GX1A 3T8YA 1M1YA 5BSRA 5FV7A 1DUVG 1UMDA 3B7PA 1PR9A 1NUQA 3BIWA 3M1LA 4MKZA 4W7SA 3UJ3X 1JEQA 4E5MA 3HPRA 3M2TA 3SJZA 3ZZUA 4AMVA 3N6XA 3P9CA 2W58A 4JXXA 3DF7A 1PNVA 3MS7A 3S70A 1R4NA 5JR3A 3Q3HA 4MTCA 5H0IA 3G79A 3RF6A 1OFHA 2GR9A 1YA6A 1ZO8A 2IZOA 2J9ZB 2FDRA 2NUPA 5HFNA 1GYQA 4JLWA 4P32A 4DGQA 4HSGA 1J7JA 1M6VA 5IBPA 3PD7A 3ZEAA 1I7LA 4EBBA 5J1SB 4AY6A 2GN9A 3H1GA 1QV9A 1YZFA 2FWPA 4D80A 4GPD1 4M0PA 3P97A 4MVJH 2D3TA 1EUDA 2G6TA 4PGHA 3EMBA 1NPYA 2C88A 3D8RA 1K8QA 4U4AA 3WB1A 2XTZA 2CHGA 4DV0B 3RVSA 4TWAA 2WQZA 5DBIA 3TTVA 4AJLA 5CA0F 1KDYA 3RJTA 1U7TA 4HTFA 2ZJYA 3I6ZA 4KKXB 2QZ4A 3PEYA 1F1BA 4MCAA 3RBZA 3RHSA 3Q0IA 3W05A 4Y0VA 1JA9A 4MZDA 4N49A 2N1MA 4DAOA 1QO9A 2HV8A 5EXTA 2IUUA 3RUIA 3QXSA 4EKIA 3UC9A 4B74A 1IATA 3AUFA 2DM6A 2P9YA 1TYCA 1JR3A 2H4JA 3V7YA 4RH3A 1BSVA 1R8JA 1U65A 2MSLA 3GFQA 4II7A 4DR1B 1IG3A 2BD0A 2Q3MA 4BLWA 4HFNA 2YHIB 1J33A 3GWZA 1FFCA 3BGIA 4HQ0A 1SQ5A 1VG1A 2CNOA 3R41A 1K7XB 1EP9A 1R4MA 2P9FA 2AOXA 3E7FA 3EHDA 2FR0A 2VA9A 1JLLB 3ADKA 3E9YA 4GZMA 4I6JA 4YMSA 5EHQA 3WJ7A 5TQ0B 4NDAA 2C4UA 1L7AA 4Q9HA 3OPYB 1RMTA 3ZGXA 5LLSA 4HB4A 4AO6A 5COAA 3KQKA 2VAWA 1IWPB 1PL0A 1E2EA 3KT6A 1LK7A 1LXCA 3DCIA 4RE6A 4P82A 1UKCA 2Y1WA 1VDMA 3KT3A 1REQB 4LZAA 2OAGA 4X3CA 2I55A 3IO5A 2O5RA 2H1RA 1VKHA 1FLVA 4RDHA 2GUGA 2P1ZA 1LV8A 2VDWB 1DADA 2X8AA 3I9FA 4V24A 4LXIA 2XUOA 4JLMA 3X44A 2J59A 2J6CA 3TD6A 1UOOA 1KAOA 5ALZA 1IRXA 3L84A 1FSZA 1T2AA 2Q3HA 2A1IA 4QYWA 1JI0A 1PJ8A 2F43B 2ZSBA 3V4FA 4H6WA 3C5CA 5DLQC 3S1SA 3TRHA 2JHPA 1GFZA 1P2UA 1IZ7A 4KBYA 4RZ2A 3PUWA 3DKVA 4YMHA 3O5AA 4EZIA 3KAQA 3WLLA 1EHIA 3MQFA 3OTIA 2V3CC 3T5AA 2O8BB 2PZAA 3LUCA 3N8HA 4ALNA 1RWKA 3PDJA 2XSZD 2JFHA 3HXPA 2UUBB 4NZMA 1EXVA 4DJAA 3JQBA 2W7TA 1UKYA 1QQ6A 2VJNA 3OZ7A 3P0JA 4UBJA 3MQ4A 1B1AA 3LBYA 4HYQA 2UYYA 3WLFA 4EF5A 1XZNA 4JENA 3KAPA 4J1TA 4IIEA 3WFZA 1OB5A 2YS6A 2BEUA 2Q5QA 2PX2A 3PS9A 3PNLA 4PYQA 2RD2A 2ZYGA 4UHFA 3UYLA 1GPH1 3HTXA 2ACVA 1J39A 4JQSA 2VEDA 3ENQA 3R6WA 5LMUB 1SHTX 4S1WA 1A95A 1RKVA 3SC3A 4Y2JA 3ZU5A 2BF7A 3QU2A 1XE3A 5JWRA 1JS1X 2QVLA 2X8LA 3MNFA 3ICPA 1IQPA 1SB9A 1BFUA 4YUVA 5D5PA 2GHIA 3ZLVA 2JCBA 3VJMA 2N47A 2I9PA 2DECA 2ZWIA 4M0KA 3AESA 3U13A 5GV7A 1NA5A 2XBMA 4PLCA 3H5WA 2EKQA 1NMZA 3WL7A 1TTPB 2ZAMA 3BXOA 3C7CB 1G3RA 3ELYA 1N2IA 4D9KA 1XF9A 2NT4A 1O0BA 4KHPB 2XJ9A 5GZ6A 1YS4A 4GP6A 5HEKA 1OMOA 1G66A 4E1AA 1Y8CA 4DJJA 2GEDA 1J2TA 3AQ4A 4X63A 3SC4A 3JV7A 3VPXA 3PKIA 4MSUA 3AILA 2BGJA 4NZYA 1T9GS 5ALGA 4EL0A 5GJBA 2OECA 2E1RA 3ONWA 4UXJA 2HW8A 5F2EA 3KFLA 5KQPA 4MW7A 1UJCA 3ASYA 4EKNB 1ML3A 1NRIA 1Z75A 2XADA 4MGYR 1XZLA 4D8TA 4DUZB 3TJMA 3FSGD 4ECAA 5HG0A 1QKKA 1OHHD 3HNPA 2FZKA 1TCBA 3RNLA 4DMCA 5DRTA 3KKNA 3UT5B 5HOQA 4OQYA 1Y7PA 1N5MA 2BHTA 1J8VA 3KPUA 2PL5A 3UAZA 5BRJA 3I2FA 3ZZ0A 4H7DA 3IUQA 2Z9DA 4E6PA 6AT1A 2FMTA 4DKXA 4GLLA 1GT91 3GCXA 3G0HA 5FBZA 3BIJA 3SR0A 1CUXA 5B2FA 3KT8A 2HSGA 3DTYA 1ZJWA 4Q7KA 1GADO 1MZVA 2CFTA 1H3NA 2E21A 3UM9A 4YPVA 5AI0A 2AMYA 1QANA 4KRXA 4AQDA 2ZAYA 2J5KA 1EB8A 1WM1A 2CXUA 3LNCA 1U0OC 3NKLA 5C1PA 2CHQA 2OESA 3RFFA 4AN1A 2AJDA 1E1QA 2VS1A 4CKXA 3FTFA 5C80A 4KW7A 5AHOA 5JXHA 4R0NA 3CU5A 2UVPB 3I8SA 4CW7A 1GDTA 1R50A 5LXTA 1CW2B 4XD7A 3PPYA 1PJQA 1H0SA 3COSA 5AYVA 1EPUA 5JSQA 1GPAA 1FYWA 3VDNB 3E4DA 4LY6A 4AX8A 2VDKB 5ALHA 3P2YA 3WNZA 2ZVPX 4PC1A 3ZKWB 1KNQA 4XWAA 1FMCA 4Z4QA 1GA1A 3KLNA 5F3RA 1XZMA 1L6IA 2JIOA 2PHZA 5CYGA 3EVZA 3I5YA 4HYYA 5DXAA 2JIPA 4B45A 2IELA 5A4AA 5H1YA 2ODNA 4L5CA 1XJCA 2ET6A 3C7DB 4YI3A 1K3FA 4TRRA 4WFKA 3TNFA 1TZKA 2R6AA 1NVGA 3ESBA 4M7WA 5F73A 2GX6A 3AHCA 3EF3A 3RAPR 5LNK6 3F4KA 3RYCA 3IXQA 5B7GA 1M34A 1RTTA 1E2BA 1OC2A 2HBQA 1XDSA 2PN1A 4AU1A 2IGTA 4IDPA 1JRLA 4IFEA 1CLEA 2B5WA 2CJFA 4HRVA 3WRXA 3UV7A 5JBQA 5JZVA 3TCKA 2JLYA 2RHWA 2C5AA 2VSQA 3L01A 3TRDA 3KLMX 4C30A 1IY2A 2XEXA 3IQEA 2ONZA 1FF9A 3OQBA 3RV3A 1VI2A 4RXTA 1ZMXA 2WD7A 4BQSA 2IEDA 2V7PA 2YXLA 2JLSA 4NVRA 2YMLA 1V2GA 3B6MA 4CN8A 2CXPA 4EO4A 1W5BA 4I6EA 4O59O 3VO1A 2FB9A 2O5EA 1EM8B 1ZGBA 2IEZA 1ANKA 3HBNA 3NUQA 2FQQA 4D8YA 3N59A 1T9HA 1J2JA 2FRVA 3FMPB 4LFBB 4G4SO 1RHKA 1PK7A 2DPLA 3OZCA 3AEKA 2W6NA 3E58A 5IK2A 4CMBA 4R8MA 5CLIA 4KQHA 2CMHA 4KLZA 1ZH8A 2LDBA 4OJYA 4YI5A 3ZNOA 2ZR7A 3VZQA 2O05A 4N8SA 4PC7A 2P11A 4R6XA 3TL6A 3UAOA 1PQUA 5AI9A 2GZ2A 2XRYA 5DB4A 2KM1A 1QH1A 3QVJA 4RU1A 5LKAA 1SXQA 2ZCJA 4KCGA 2OGWA 2GCIA 4CXMA 1X7GA 1NFFA 4MWGA 2ID9A 3FKSA 1BX0A 3G8AA 4X1OA 2YN2A 2P3SA 3HN2A 4K87A 1I13A 3QW2A 1NATA 1XT6A 3JARA 2V7EA 4BC0A 1U0JA 4F9EA 2VQFB 3BA1A 4ZYTA 2Q4EA 1T5OA 2GWRA 2Q2WA 2W98A 5DTEA 4JD5A 3UW3A 1OW3B 1PFWA 1I01A 2I6TA 4RXMA 1NX6A 1M5TA 1WVIA 2EYUA 2ZJ7A 2HRQA 4X8LA 3S2SA 1SBQA 3G2LA 3NBQA 5C51B 4QPCA 1VTKA 2XMPA 4LCJA 4B7ZA 1D2GA 3MWDB 4JX9A 5LKRA 5EKUA 3AOEC 4OB6A 4OPMA 4YA6A 1VSTA 2HK6A 3EXG2 3MM4A 3OKAA 3UMBA 5IVIA 3K7EA 3A9WA 4CI0B 2O07A 3I45A 4FZRA 4OV6B 1CY7A 4H7KA 4XKJA 3TW8B 2F8SA 2VWGA 4FBGA 1T3HA 1XV5A 1S2GA 3C3YA 4G23A 1W76A 5LQDA 2PUWA 4EQZA 4RTKA 4C4TA 5K05A 1K75A 2WD9A 4C7OA 1M8KA 4OI1A 4G0VA 3T3DA 2ZIGA 3T4PA 4EB6B 3JD3A 2EFHB 4FLFA 2I7TA 2G4VA 2FOXA 2FUEA 2ZTHA 2CZCA 2FSHA 4AI6A 1WPGA 2Q5FA 5DHUA 3CZ9A 2AW3A 1P61B 1G8YA 2FRDA 2COKA 3D3WB 4HNAA 4I2NA 1LX7A 3FLEA 4IBOA 4QFCA 5FF9A 1AZWA 3WXMA 5IJWA 2X3FA 1U1EA 2VYNA 4DBVO 5BYKA 5E95A 4EKYA 2IZZA 1Z17A 1BG6A 4FEEA 4ZU6X 1G18A 3RBVA 2YNMC 4CTNA 5ADHA 1E63A 2Y1CA 4D0LB 1E79D 1NW3A 2B8EA 1S9DA 2UZ1A 4RFLA 2C7RA 3V1MA 4FINA 2WLTA 1J8MF 1E1YA 1IJBA 2PQ2A 2HLPA 1TL7C 2O5CA 3HKDA 3KNZA 1FY2A 1XRNA 3MTJA 1BIFA 1MUUA 2MR6A 1ECJA 3N39C 3OTWA 4IDHA 4MV5A 3RDPA 7REQB 2CNNA 5ARDA 4JWKA 3TG2A 3DKPA 1V25A 4P1ZA 1FFAA 4TLEA 2D4AA 4UFNA 1XQ6A 4B2YA 2CXQA 4BMNA 1T29A 2XGGA 2XNJA 1JMKC 3B6EA 3FWHA 4H16A 1XMIA 5CCDA 3HMKA 3S5UA 3O4FA 3SEFA 1HYEA 5IYZB 1Z7BA 3K5HA 4QDUA 1OILA 3YASA 1IN8A 1VE3A 3RGWS 4EAQA 5BW5A 3HN6A 5H8WA 2P6NA 1E3WB 2RB5A 3DL7A 3KEOA 4WN9A 4YK7A 4BVLA 4F8YA 1WABA 3CTPA 3SQXA 5LZ9A 1X77A 3Q9SA 4HS9A 1SGWA 1EUCB 2CVZA 1KJ9A 2FOLA 4KYVA 4MW4A 4WK2B 1DIHA 5D8DA 3V6MA 1WBDA 1CK4A 2OFWA 4A36A 3T7EA 5JBNA 2GXAA 4O25A 3GA5A 4Q9IA 3N86A 3K9BA 4RXUA 4F2GA 4NE7A 2I6UA 2VUTA 2CLIB 3ED1A 3QKSB 4FGSA 4OF4A 2DC1A 2PJZA 4JP3A 3B3FA 1C9EA 1RWWA 1JLSA 1Z3CA 2JI4A 1M6YA 2NIPA 3EIXA 2NZWA 4L3VA 4LZZA 4MVWA 3TXAA 4ECEA 2XOKA 2IYEA 4DGSA 4LBVA 1IB0A 4A2CA 2ESRA 3H8WA 3SYTA 4GE3A 3VDRA 4WOBA 3NXKA 4H3HB 3NWJA 2D5CA 2H0AA 5FADA 3S2FA 1X92A 4U00A 1JIQA 1RKXA 2H07A 4Z2AA 2HD4A 1JJIA 1UFQA 3H5AA 2BYTA 1I4EB 1UC9A 3R3VA 2Q1SA 1JE1A 4ZRDA 4AKSA 3N1UA 4AZTA 3NMUF 2ZJ8A 3AVPA 4IDFA 1FP2A 4B75A 1H8HD 2CF6A 4KB5A 2I6FA 2BUCA 1U0TA 4P98A 4QOSA 3T1NA 1E7MA 2BGWA 1EXDA 4WZBA 3WB9A 3GO4A 2YZ2A 4HEJA 1ZZGA 2YTZA 1RAGA 1DRWA 5FB3A 4E30A 1A7JA 3CJRA 3B3JA 1A2QA 2AA3A 2VT2A 4ZTBA 3EXHA 4Z4GA 4NBSA 2ONYA 4H27A 3UB2A 3N0RA 1S8NA 1NMYA 3GJRA 3HM2A 2PFSA 2HYIC 3NDRA 3Q40A 1X3LA 4E5YA 4YRZA 1N77A 1R18A 4FJ2A 3VO8A 3KYIB 1VYTA 1Q3KA 2UYCA 3IV6A 2OWDA 1T1RA 5GGXA 4ZKEA 1QP0A 5JQGA 2GM9A 2QXYA 4N4AA 3CUKA 5BQOA 4F2WA 3UICA 1XQ1A 5FNVB 5C0OE 3ZU6A 4YRAA 4M7RA 4R5HA 2BTQA 3PXCX 3W6OA 3ODPA 3J81A 1K63A 1XA3A 3F6SA 2CLOB 1V9SA 2POCA 5DGXA 4DC9A 3AI1A 4TOIA 4PIPA 3IAS1 2HU2A 1T0UA 1L4BA 1X70A 3LAWA 3B48A 5CX1B 4NBRA 4AECA 3PVCA 4XQCA 1XFDA 3BL6A 1B16A 3IPRA 1JHUA 3EISA 3U31A 3OFJA 3OICA 1LFAA 4ZC8A 1RYHA 5K8VA 5BVHA 4DNPA 3DOHA 3ASVA 4E7OA 1RQXA 2AMVA 1WLSA 2ECOA 4A2WA 5ALEA 4NEHB 3ZJ4A 6ABPA 2IYNA 1IEWA 2JZCA 1GQSA 2Z56A 2PG3A 3PGLA 4NU5A 2ZBQA 2PNJA 2PSSA 4NBKA 1U0EA 4JEHA 4QAJA 4Z4CA 3F46A 2ZRCA 1DBSA 5CDTA 1AVTA 1A9TA 2Z3ZA 1LLDA 3H9UA 3OP1A 1UDAA 3QE3A 4QDKA 5G4KB 3RSQA 4UM9B 1EA7A 3M9LA 5JUWA 2NPFA 1MJGM 5KJEA 1XQVA 2OXIA 4F91B 4F6CA 3ZQ6A 1R0RE 1WMSA 1B6RA 4N0QA 4JP1A 2DKOA 4XDGA 5CNIA 3HKCB 2NTEA 4RIEA 5SZIA 3ZV3A 2R5NA 4JOCA 5JH7B 4CF6A 1H6AA 1DSSG 2J8ZA 5JDIC 1PJ3A 4KXWA 4DDKA 5C46F 5KQMA 5JCOC 4PY2A 3GGGA 2CMKA 2G9NA 1WVMA 1Q11A 3A6KA 3ZEIA 3IR6A 3K35A 1EVQA 1QMPA 3FCXA 5IM5A 4IQ0A 1H6BA 2X3UA 1Y4UA 1P9NA 2RJOA 3X3HA 2XB8A 1CD5A 4JCOA 4MV6A 4MX8A 1JG7A 2I66A 4RK0A 4RK4A 4XR4A 3U9TA 3W6NA 2FGJA 5FL7D 5T3YA 2H4HA 3AU9A 5YASA 1JYSA 2XXBA 5C7OO 1THZA 2WNSA 3BILA 1P1CA 2AH5A 3D4LA 4N5MA 3PGA1 1YOVB 3TE6A 1Y42X 1PJ2A 1T25A 3E8SA 4V03A 4CIDA 1WBBA 4I4TF 1E20A 4D0RA 2QSJA 4YRTA 2RGRA 1C4OA 1NP3A 4ONEA 3V1LA 4PVCA 4L95C 3ZCVA 4JP8A 3LBHA 1AURA 1XYVA 3SF0A 4BP8A 1T4GA 1NJSA 5K0CA 4QO7A 1RBQA 2I3GA 3MA0A 2RMKA 3VBEA 1YR3A 3AXTA 3EULA 3PUJA 2HRDA 4YPOA 2EWWA 2OBFA 3LC0A 1GUFA 1HG0A 1XWWA 4HNQA 1NUSA 3PYMA 3MWGA 4ZGGA 2AUMA 3IVRA 3KJXA 3O3CA 1K9SA 4NONA 3RVPA 4ZGBA 3AL0C 3R9WA 4X94A 3U2QA 2G8NA 3TZQA 4MTLA 4Y2XA 1CY6A 1Y8RA 1PWHA 1T3GA 1T9DA 2HQBA 1RQGA 2K2QB 2XB9A 5BMVF 2CT8A 4WZAA 2CGEA 2VPZA 4MP8A 4B1FA 2Q1WA 1I9GA 2IXEA 3PIIA 2NUTA 1UC5B 1V8BA 4KODA 4UC0A 2QUIA 1XEXA 1KR2A 5HTOA 1YZNA 5FPKA 3FAKA 3MD9A 4DCTA 1OVGA 2QN7A 3DTVB 4KFUA 1ESNA 4PLFA 3KTDA 3LOPA 5HCIA 2XQJA 3DZCA 2GYWA 3I9JA 5AHRA 1NUUA 3NT4A 5ILQA 3VR5D 3KPVA 2CSXA 1TEVA 3DO6A 4B47A 3FVWA 1N1EA 1D0IA 5AVRA 1HLDA 4WD3A 1V48A 3LHSA 4KTTE 5F12A 1R0BA 4RULA 3PJFA 4TV9F 4IKOA 4W5WA 4WV3A 3EXAA 3PXEA 3KHTA 3EDQA 4JZKA 3ANXA 4KQ6A 2O3SA 3WAGA 5EZQA 1LK5A 4IJQA 1UXIA 1B15A 1CR2A 2BF4A 4Q19A 1Q91A 3BORA 4PX2A 3SQLA 2BCEA 5EXEA 4C7KA 4WLFA 1FW8A 3C3JA 2IWRA 5KBYA 4ZPJA 4DLXA 3CHYA 3I01A 4L8VA 5LQAA 5EIXA 1G9XA 4KSYA 2HJRA 5FPSA 2C77A 3PA6A 2ZUTA 4PSUA 3T34A 5LQMA 2HMYB 1TK9A 1M1XB 3NHYA 3QU9A 1CRZA 4LBZA 2B8TA 3OUTA 5FHQA 3JQ7B 1JLKA 2O2ZA 1NN0A 2QQGA 2QTZA 4LVCA 3TVDA 1N2GA 2ACKA 2I03A 1RJ9A 5ALFA 3RVBA 1J0DA 3GGJA 2BRUC 5HFJA 1O08A 1YACA 4RHXA 1CNMA 3FE2A 4RD2A 5IAOA 3IPLA 4ZO9A 1O87A 2BUBA 3FYHA 3WIVA 1HDYA 2HT6A 2JLCA 2JLUA 4QDXA 4MP6A 4UBLA 2HFKA 5FI5A 2OA0A 5IVPA 3CLUD 2XECA 4OL0A 5EIFA 1KP3A 4O2BB 2BT4A 2Q45A 4ASUD 3L7JA 4CIBA 4ZWNA 5G2OA 1J25A 3HJBA 4OK5A 1OYWA 3NCTA 4ND6A 5D7BA 1X9HA 3JQAB 4ABYA 1MN6A 4GYYA 4C2AA 3R7WB 1E99A 2I6QA 3C3WA 2VHYA 3L77A 3ZLJA 1Q7GA 2CJPA 5AHWA 2HA3A 2KBFA 3A1FA 1LDGA 3H18A 3OURA 2VJBA 2B7BA 3ZTYA 4D4KA 4N7RA 2HMUA 3K6SA 2FMKA 3G49A 3BXPA 4WNCA 3EUWA 2VZLA 4DCCA 4AQ7A 2XJ4A 4YMUA 2CJXA 1GAJA 3P9PA 3PGXA 2Q4TA 1UP6A 1XAGA 3WNCA 4CCAA 3T52A 1AK2A 2V54A 1K68A 3H4MA 4EG0A 3P71T 3F9CA 4BRZA 3Q8LA 3AZQA 2H1HA 3LO5A 3ROTA 2ZBUA 3KQPA 4A5OA 4QPDA 1FXUA 5D5HA 3CLVA 1DOHA 1ZY2A 2P79A 4R2JA 1MPTA 3BMQB 1EE1A 2AFIE 4BNIA 1NNUA 1SOWA 1Z8DA 4RPLA 4N5HX 3VKGA 3I42A 4ZTZB 3KHKA 4ICIA 4J6EA 4BUJA 1QHNA 1TFRA 5F98A 1UP4A 3OJFA 5AM3A 3AKZA 2G1JA 2PANA 3UG6A 3IV9A 4HMPA 3TR0A 1YRWA 4Q03A 3U1BA 5LP6B 2ATEA 3DP9A 3W5DA 1FDUA 4I1OA 3I5XA 1CDOA 1SZPA 1RJFA 4RY8A 2ZBEA 3KDSE 1CIVA 3Q87B 4L9RA 3OQHA 2ZRLA 5D3MA 3CPJB 5B57C 1T9CA 1Z5UA 5TQ2A 1TJPB 3U16A 2VF7A 1ZN7A 3FWPA 3DL4A 3WAJA 2IEAA 2PT7A 4QG7A 1MD9A 1T35A 1K7CA 2FR8C 4N1AA 3VYVA 5I7OA 2ATCA 2X0NA 1M76A 1HYQA 2H1CA 2P90A 4FEGA 3WGZA 3C14C 3H2KA 4QT0A 1OGYA 1TM2A 3K6KA 1E7RA 5T3UA 1D09A 1QFSA 5JPDA 5FWXB 2NMVA 4CPDA 4LW8A 5B1HA 3GEIA 5A6SB 4BASA 2EXXA 2CC2A 3K0FA 1DKLA 3VKWA 1MVOA 4L8WB 3I9MA 4WE3A 1EXWA 4X41A 3TDMA 1IPFA 2Q1XA 2FSPA 1IOWA 2WJWA 3P9RA 2OZPA 3QA9A 5HCUA 4P7GA 5FBLB 2IUSA 3WK7A 2FEWB 2PU5A 3EFOA 5KNDD 3O8LA 3KOMA 2O2CA 2PXHA 2B98A 3QVUA 4DDUA 5C52B 1BCSA 3GG9A 2PH5A 1QX3A 1WKVA 2E9SA 1V6CA 2P40A 1AGXA 4J0GA 1F2TB 2RGUA 3G7SA 3M4XA 3MZ0A 4OO3A 4BLPA 1JR3D 3MWYW 1K8YB 2JAWA 3C7AA 3FR8A 2CZQA 4WH0A 1XZHA 1UBOS 3I3SR 1HTWA 3STVA 2BM8A 4IG4A 2BONA 2FX5A 2EFDB 3O8BA 5GIPE 4UW9A 3SICE 5I4IA 1YZTA 2Q49A 2Q5LA 5FO0A 4Q37A 2REQB 2WFLA 3HCRA 4TMTA 3FJ1A 3JXEA 2XVXA 1QLWA 1W25A 3E3LA 5JJ5A 1GN9A 3AERA 4RLQA 2HCBA 2MDTA 3DBRB 3EMVA 1TCCA 1XAIA 2VUUA 3DWEX 1KOJA 1CUGA 1M0TA 3ZV4A 1EDDA 2PL3A 1QHHA 1Y4SA 2QLBA 3EZ6A 3PHJA 2DGDA 4GI5A 4OXKA 1EDEA 4FCTA 5K2MA 2GAJA 1ZR2A 2WRZA 5HDQA 3D7LA 3ZDEA 5CLQA 1FZQA 1TLTA 2V1UA 1PL6A 2H2GA 4TQAA 4X7RA 5K8TA 2BGTA 3DBIA 4Y67A 2ZYSA 3H11A 4GNKA 4PZAA 3RRJA 1U0SY 3SEQA 3DGEC 1AOXA 5AVXA 1TQHA 4IMIB 2OQRA 4DWWA 3K8QA 1NURA 3E9CA 3BTOA 3FPFA 1JHYA 2CE2X 3AJ9A 4JJAA 3Q3GE 4DLWA 5F51A 1VSVA 2QLMA 4H0NA 1M9NA 1RJGA 3LDUA 1T0BA 4BS9A 1QIKA 2VC2B 3K2IA 1TC2A 2VBFA 3TIVA 3OEED 1AGYA 4JS0A 1GCGA 4RHFA 5HKOA 3X43A 3ZD7A 1II8B 4G85A 3R8FA 5E6SA 2PU7A 4G56A 3BK2A 1TPYA 2QPAA 3ZHSA 3C3KA 5I9NA 3ZWQA 2BC9A 4URHA 5BSHA 2QS9A 2GD1O 1ZA1A 4HP8A 5F9MA 1NUHA 4HJXA 1H2BA 3W3AA 5AOVA 3M70A 4KR7A 4LQDA 4QNRA 2MINB 4WWHA 1JBKA 3R3WA 3HPQA 2VHUA 1ZA2A 2GBLC 4H2DA 5T4BA 3AGPA 3TG8A 2NO0A 2Q5EA 4UZFA 1LWOA 4N8EA 3M6UA 4WZZA 2G9RA 2NU6B 3T99A 4XH9B 2H3EA 3PICA 2B0CA 1PR3A 4FD2A 3BVPA 1OX4B 3SCZA 4IH9A 1LCIA 3GPCA 4N48A 1J1UA 2Z2JA 3EQZA 4DRXB 4RK1A 2NYRA 4QZVA 2YY5A 4EUSA 1OI7A 2IXBA 3DEKA 3LBFA 1C41A 5CVDA 4CI9A 5BT8A 1I8TA 4NQZA 9ABPA 1NJ5A 4OQQA 1XCLA 2VUIB 2YJZA 2MYNA 4YREA 3CLRD 4IXTA 4A27A 5JU6A 3JSXA 3TFWA 1YDGA 3HYLA 3K71B 2XUKA 1FX1A 4YJ2A 4HTAA 4KVGA 4P8RA 2APJA 1ZNXA 1AXEA 2BGNA 1G8KA 1YIAA 4ZJYA 3U5ZB 3EGDB 1H5NA 3R9XA 4EZEA 1XK7A 2NYVA 3E1SA 2BZSA 4COKA 1QQAA 2WE7A 1CUSA 5ALJA 2PMDA 2AZXA 1G7SA 2A1UB 4ZODA 4DA9A 5BSVA 1L5KA 2FI1A 3B20A 4OB7A 5B1SA 4YXWA 3KWFA 3V8BA 7ADHA 1HK7A 2XUJA 4N12A 2BMWA 1PDWA 1FE8A 4L72A 2FZWA 2YBEA 4KQFA 1SG9A 2RC6A 1NYRA 2QJFA 1DDIA 1XCPA 2CW5A 3QF4A 2OLKA 4WFIA 3TSYA 1XEWY 4FSDA 5GZ3A 2D0DA 2IX3A 5AM5A 3VC7A 2G1KA 2C42A 4BO1A 1VJRA 4PXAA 3PUVA 2GLXA 3AB3A 3R6TA 2QPOA 5EHZA 2G88A 1SQ0A 3UGKA 1NN1A 1I5EA 3JWEA 1FYXA 4V0SA 5U4QA 5HGXA 1VIAA 4ZQEA 2IS2A 2BUAA 3WLTA 1WCIA 4L5AA 1MQAA 2DWQA 1DKNA 2C4WA 1MJHA 1RHJA 2Z8XA 3L8DA 1ZICA 4JUCA 5AXDA 1TAHA 5EHXA 5JYCA 1DCTA 2HHJA 3OECA 5ESDA 1S0UA 5L7YA 5JNTA 1US8B 1H1DA 1GU1A 3I9LA 3O3MB 1UEXC 4DYHA 3OC0A 1N92A 2AOUA 5FI3A 3OEYA 1OLSA 4DR2B 3BD8A 4EJMA 2B1IA 5B4VA 1ISIA 4RCZA 6GPBA 5LOVB 1XZJA 3I28A 4I66A 4C0JA 1J8YF 4E94A 4HEQA 1F5NA 3F4BA 2P78A 4LDQA 1GZ6A 3G2HA 3DAHA 4Q7LA 1PJSA 2CXXA 4CIVA 2E18A 3HY4A 2D74A 4FGZA 2CLSA 4ARCA 3T38A 5J4HA 5HX7A 2VZEA 1E1QD 4YRQA 3HKBA 2Q5HA 3N2KB 1CY2A 3GF4A 2JIMA 3A28A 3DM5A 3I1JA 3IKLA 2J32A 3N2EA 4KQEA 3I5AA 3LWZA 1FMJA 2E85A 4XD7D 5DXFA 3SK0A 1UZNA 3M0EA 3UMGA 3LIPA 2AKAB 4PM4A 1N32B 1DAMA 3T4EA 1FBNA 3HXKA 5A71A 2O1SA 3RRFA 3IPYA 2YMPA 1RCTE 3INGA 3KBOA 4Y6PA 2AN1A 1HO3A 1RACA 5ESRA 3ZR4B 2F3QA 1E7QA 3MGBA 2OILA 4ALIA 3HJFA 3G9QA 5TGTA 3HI6A 2I2CA 1M66A 4FM9A 1EXNA 1T8TA 2X13A 3Q4GA 1GY8A 4FHFA 4LHSA 3ICEA 1SIWA 4MVJA 2PE5A 3NKVA 1XTZA 4BB5A 4D9IA 3IURA 2XWJI 4IUDS 2BBOA 4Z9BA 4DDWA 1C0IA 4BVBA 2LCIA 2HJHA 2B4RO 4E88A 3ZXIA 2BDTA 5JEDA 2DWCA 3LDAA 2ZJ0A 1S89A 1ZRNA 1KE2A 1DT5A 4RACA 4HVTA 5G0SA 1SMKA 3WRYA 1UAYA 2D4HA 4NC9A 5CTJA 1D7AA 3ZIAA 1E18A 3FJYA 1G59A 1PKXA 3HWX1 1C7FA 1MDBA 1TCAA 2ECFA 3MMSA 4YJFB 5JPCA 2C4VA 4KK3A 4MCHA 1BQ3A 1PKEA 4NYJQ 1CZNA 5ES4B 1JHOA 3MJVA 4Z0PA 4M37A 5ERYA 4DSTA 4BMZA 1J9EA 4EJSC 4NCNA 1WV1A 1V4VA 1ODIA 1N34B 5IK2D 5F52A 1IL0A 5C1BA 1MO6A 4XLLA 4CHGA 4PLTA 3PJEA 4MROA 1FDWA 3I9KA 1EK0A 4IIJB 3FOBA 3WGHA 3SI7A 3LU1A 3EPPA 4NCXA 5DU2A 4D0GA 1VYUA 5LZ7A 2AR0A 4R1MA 1CYEA 4IXMA 3H5VA 4V38A 1PDVA 2ZXFA 5G3ZA 3KUKA 3UHAA 3FZQA 1ZU4A 2QN3A 1CJCA 4RVOA 2VP5A 4XEHA 2YHIA 5TT0A 4KPUB 1Y3AA 5FP0A 1U3TA 1F6BA 1A9YA 3RCBA 3UYKA 3VDMA 4IDOA 3FWNA 3FKSD 1JLLA 3OWHA 1M6NA 1H66A 3RPEA 4ALKA 1ZCZA 3J81k 3JPWA 5TQ0A 3W2EA 2EGUA 2B0JA 4I99A 3TZEA 3OPYA 2A9FA 3E2PA 4L27A 2WP0A 4E5NA 1LTHR 4LZLA 3CRNA 5J2UF 2ZTMA 4PLGA 5DXJA 4HY3A 1A4IA 3MAGA 4F92B 3NV7A 2DF8A 2OBXA 3LW8A 1XRJA 3RYIB 2FW6A 4UM7A 1LBIA 1RYBA 4FNMA 3ODGA 4H7EA 1CKEA 3UFXB 1WZUA 2WHYA 3WV5A 1FNBA 5KCZA 2IPOA 2M9MA 1NXSA 2QAGC 4ZVTA 4TL7A 1V35A 3X2FA 3HB1A 4E6EA 5JAZA 1NMQA 2XWSA 3FCAA 4OMCA 4YIKA 2XKJE 4TGLA 2D1QA 2R66A 5J9FA 4CMIB 2GEFA 1ZIOA 2I4NA 2IPXA 3OT4A 4G81A 4OXNA 3QVOA 4CODB 3OQMA 4X7BA 2WV9A 1ZD5A 4JYZA 1F1JA 1YAJA 3DZJA 5ICEA 1OBVA 4LPSA 1K6EA 3X1KA 3ETDA 5JI3E 4D57A 4Q4AA 1JNYA 5HCNA 1YA8A 4MW5A 5KVSA 1KZ6A 2PUGA 3BWYA 5SY6A 4D3XA 2O7RA 1BEUB 1KXZA 2IEYA 3JYLA 1Q0PA 1BDHA 3PGMA 2B4YA 1VKRA 5D3KA 4DMMA 2RHBA 2VYND 5CT6A 1NVKA 1L3BA 1C0EA 1O6ZA 4US0R 3SEAA 3PEWA 1FU4A 1SHLA 3LUHA 1KBOA 3IL2A 3L5OA 4H3KB 1Z18A 4CQMB 3IHKA 2G07A 3E8MA 3HA3A 5GIOE 1VBFA 2A0KA 1E5TA 2JD1A 4E31A 1K1EA 2Z2KA 4F4CA 1NN5A 2JK1A 3HVRA 2IYQA 4D0SA 4RVNA 2JJ2A 4CT0A 1LBSA 2GPNA 1R7RA 2JGDB 2OV8A 3OX4A 2QN2A 3NHPA 3OE4A 1NE2A 1FYEA 2JVIA 3GEGA 2O20A 2E4UA 2QPLA 1MRZA 2ZRGA 1PGJA 1G55A 3R3ZA 1TQ6A 5DW0A 1HDEA 2F17A 5K3BA 2VYCA 1QB8A 3M1IA 3Q3CA 3HB7A 2C8LA 3RUPA 4F9GA 3H05A 1ATZA 3T3NA 1Z7WA 1Y9JA 2FG5A 4RZHA 1C1DA 2Q6OA 3WO1A 2WM8A 3IUEA 2CB0A 1NOIA 4BGIA 1TRKA 1DT3A 2IS4A 1HKUA 3B13B 3KSUA 3NETA 5B3JC 3SZMA 2R79A 5H3LA 2VTEA 3TOZA 3OIUA 5BNZA 3GCDA 1SBYA 4EHHA 3LSYA 4DLUA 2HFJA 4QT4A 4CQLB 4AYXA 1RKQA 1MT3A 1YL7A 3F8TA 4CT4B 2CUKA 4KZKA 4H1WA 5A5EA 3E82A 5BPFA 1KVRA 1S9HA 3FB1A 4AY4A 3HEMA 2XOKD 1KL7A 1XRMA 5TMEA 3WDMA 4FQ7A 1OYVA 2RGNC 4PFJA 4EYOA 3OJEA 5CP8A 1BVHA 1ZRMA 3UHPA 1Z15A 4FHZA 5FTJA 4FZ5A 4JXJA 1XDGA 1R6VA 2JAOA 3WLEA 5KYXA 4E33A 3T9DA 1EFDN 5KOHB 3EIWA 5TQVA 1UCFA 1ZJZA 3TGWA 2Z2IA 3BZWA 3O47A 1UP7A 3TLEA 4CNBA 5EIBC 1BGVA 2ICAA 2Z6UA 3ANNA 1BVYF 4Y6QA 2YV3A 1LA2A 3B7GA 2CHUA 3HC7A 5MGBA 4Z7QB 4BQEA 1ZMOA 4J6FA 3MC1A 3AI3A 1W4ZA 1QZZA 4FBMA 3MT9A 3TQQA 2Q7DA 2JHGA 5B7PA 2HIHA 2CL7X 1YTLA 1ISHA 1E1MA 2RG7A 4FDVA 4L15A 1YRBA 2CDNA 4AJOA 3AI7A 1EQAA 2GN0A 1SCUB 3MAJA 2X86A 2B37A 4LJKA 1MC4A 3K9NA 4CGYA 2VL7A 1N5RA 3KELA 3UGJA 3HJTA 1DWQA 1ZK4A 5M5BA 4Q66C 3RRBA 4L2IA 1U8ZA 4JT9A 3DYVA 1E5DA 1SOMA 3H6GA 1Z2AA 3RUCA 1PHPA 2ASEA 4N7MA 3PWSA 5JZOA 2PLFA 3L46A 1EESA 4Y9RA 1CQIB 4OMUA 1ZU5A 4BEJA 1WAMA 3SLKA 2ZXEA 1NFRA 1GP2A 5TC4A 3SBOA 1W7AA 2WMNB 3A37A 1WEKA 2P2LA 2Z04A 4BZXA 1GKUB 4I1SA 4Q1AA 1UT8A 1XP5A 3IOMA 1BQ4A 1MF7A 2FR1A 5KSWB 2A1TR 2NM0A 1SQSA 2I91A 2GPAA 2G0AA 3DOOA 1MJ5A 4FYXA 5DNYB 1WDTA 2A0WA 2O14A 3I2IA 4LKOA 4Y9TA 4B3HA 1KQGA 4RX1A 1DG3A 3PKZA 2C5GA 3GGOA 2HSWA 3IEMA 4UAVA 2O3TA 4RLSA 1UPCA 5TLSA 4PO8A 5IF3A 3ET5A 5CCXA 3SHVA 1XN4A 3ADBA 4KUEA 4BV9A 3BAFA 1FFEA 2GF9A 3LCUA 4BVFA 3AWIA 3DD1A 3DZBA 3HNOA 1JIXA 3EZLA 3NJ8A 2WPNA 3P19A 3PVZA 3D8TA 3ZQUA 4BZZA 1YZ3A 4C6RA 1ATIA 4N65A 3K9LA 5JCZA 3L8HA 5F5NA 3W7AA 1XD9A 1X86B 4PFQA 3W5CA 3OJOA 4OQNA 3H2IA 3KZOA 1AM4D 1E3TA 1A3CA 2HK9A 4PNEA 4IIGA 4RPHA 4JSYA 3F6EX 5KHAA 4DV3B 2C4MA 1FFBA 1HDRA 2GD2A 2H2DA 4K9QA 4XWYA 1R8SA 2V6MA 1XP8A 2X2PA 4WFJA 1FTNA 1I1OA 3D4OA 1BKYA 5CEFA 3E22A 4OGFA 4JGIA 4FB5A 4MLCA 1DIAA 1ZM4A 1R4AA 2CZGA 2D5LA 4JGBA 3CS3A 4YRJA 2ID8A 2ZUSA 4K9LA 1S96A 1VJCA 1TIBA 4KOAA 1TU0A 3O26A 2J0EA 3QRWA 4GOND 4KLRA 5AW1A 3OF3A 1WZNA 2Q8NA 1P5ZB 3H6HA 3QNUA 5D87A 5J5VA 1KF0A 2H31A 1LZLA 4RQBA 1ND6A 3ESAA 1IN1A 5C7YA 1KZYC 2DFDA 1JXQA 1CEYA 3DDNA 2X4DA 2C2XA 3WA7A 5L4SA 3MWDA 5ICCA 4CGZA 1RABA 4YIHA 4HDMB 4F1WA 3O8OA 4GSKA 3COVA 2LP4Y 5FFMA 1RLOA 4YJKA 3EPRA 4HWOA 4MV1A 2ORVA 3OLXA 4D5EA 1OAOA 4MIYA 4ZAFA 1SBNE 2AZMA 4J7AA 5A5FA 1D5WA 3BIFA 4ZT3A 1AB6A 4IF4A 2JHAA 4ZYLA 1Z7GA 1VCMA 1EE9A 2ST1A 3BHMA 5CPBA 1CUJA 2Y1KA 5G0WA 3UMSA 3VV3A 2HJWA 1K7YA 2GCNA 2EYQA 3RTBA 5KTPA 1E6UA 4BNNA 2XNDA 2AG5A 3EJWA 4REQB 5IT0A 1A9RA 3ZLTA 4GMGA 3DAPA 2OCBA 4MAMA 5A2QA 4DQXA 3U3MA 3F4LA 4GDFA 2NZJA 1E3SA 3D3WA 5JARA 4IJWA 1M34E 1POXA 3KSDO 1FDRA 3GAMA 1KZGB 1ZIYA 2OK8A 5F7OA 1SCDA 1BXRA 1QAMA 2OHOA 1P4RA 2GYUA 4KKVA 4MQFB 5HIMA 2OK7A 2WFMA 4PZUA 8ATCA 1UPXA 2F6RA 2OZLB 3IP6A 4J0HA 1ZXXA 3G85A 2REXB 4D3DA 3MPOA 4R41A 2HF2A 3WL5A 4CLOB 1QG0A 4TTJA 2HT1A 1G41A 4LY3A 1H22A 3RODA 3JYHA 4H08A 5L9AA 1MVLA 3EH1A 7REQA 2P7HA 1IOLA 4LKRA 4YDSA 3G59A 4IDNA 4M0CA 1L8LA 4FCVA 1E8MA 5EN4A 5AXAA 4P86A 3G2MA 5C9ZA 3AGQA 3L7NA 4OAPA 2AF3C 4KI7A 3ZD6A 5JCPA 4TWZA 1UWCA 4IX1A 2EFYA 4EJ2A 1XEAA 4KACA 1CUVA 3DMTA 1E3WA 2A6PA 1VP9A 4OHCA 2ZIAA 2IDMA 4WLEA 5C8YA 1M8GA 4BQOA 2PQMA 3AIIA 4ZOBA 2R6FA 3VR0A 3MK31 2PKCA 1HE4A 5BW4A 4OSOA 1UF9A 3VJKA 4WCDA 3VAZA 2XKKA 5HIJA 2QRLA 3B78A 3SS7X 1QRRA 1VRWA 1GUYA 2H1IA 5ECGC 3AHJA 5LFAA 4R40A 1EQ2A 3U3JA 1NJFA 2PT6A 3DE7X 3CZPA 1AD2A 1KI7A 3B1WA 1D4FA 1P4HA 3IUMA 3CO0S 2X15A 4TUYF 2X5XA 1ULHA 1YJQA 3PIRA 5CXQA 3ZWAA 3KHSA 3UEOA 2EJUA 3OLWA 1Z4KA 4BQQA 4D3YA 4ZFNA 3JVIA 4ZYYA 4UNNA 1N4AA 4BLSA 2BI4A 5DULA 2RI1A 2QJWA 4S12A 1JR6A 1LF5A 4BBJA 4W1PA 1H2WA 3A7DA 5DVZA 4N6GA 4DDTA 1S2OA 2W2VA 3WLRA 1V8DA 3R74A 3K20A 3OF5A 3THRA 3LCCA 3NYQA 1XTRA 5DHPA 5TF4A 4G5GA 2RHTA 5KQRA 1JFSA 3SE7A 1ZBDA 4F8JA 2GAIA 3TZLA 2JI8A 3R7LA 4Q1BA 1PUXA 3L7BA 2BFNA 4GH5A 1YQGA 1I3OA 3QEJA 1YNSA 1RPJA 5JAQA 3W8DA 2DHDA 3E05A 5DGIA 4YT4A 1T1EA 4L6IA 1VL5A 2HIMA 2X76A 4NL4H 5BSGA 5DRYA 2QJOA 2DE0X 1QHEA 3KKPA 4R2KA 2QP9X 4H0FA 4KE8A 3IQIX 4JI3B 1AQLA 4F3TA 1KC1A 2MYUA 4MWDA 3HHEA 3HJGA 4JITA 2NVUB 1N0UA 1Q57A 1N5KA 1CRQA 3ZH2A 2X0EA 1DAHA 1G21B 2HEGA 2QN8A 4IIBA 3HDHA 4M1EA 4QGFA 2FG6C 1NN3A 2G08A 3NDIA 4ZC1A 3BGOS 3VO9A 4CRWB 4LSMA 4HI0E 4YMTA 5C5EA 1OZGA 3DGFC 1FSPA 3SWWA 5CCBA 3OZRA 2OXFA 3MFYA 4RVGA 1KYZA 3PUHA 4M0EA 1QTQA 5FRDA 1RTKA 3F5FA 4RKWA 3HLTA 2WWFA 2YC4C 4BO3A 2VOJA 2WA1A 5JAUA 4X66B 3R0ZA 2L18A 4NCBA 2C97A 1Z33A 2Y05A 3UOWA 3V1UA 1Z2NX 4EPXA 2F1JA 2QR2A 5THKA 2RK4A 2VHWA 5D00A 5D84A 2GZAA 4CFYA 3C1AA 1A1VA 2MWMA 1F2VA 1A2BA 2CUZA 1VIVA 4NY1A 3OTGA 4A8JC 3I6MA 1C7IA 3ABRB 3NTOA 3C0KA 5JYEA 2NT3A 4RYDA 2A92A 2FWMX 4OXYA 4G5RA 1NI4B 4G5QA 3RVLA 3I4LA 2VCEA 1KAQA 3FFBA 4RTOA 5CT9A 4W5NA 2Z3VA 2H08A 2G5TA 1VJTA 3IAS6 4Y0NA 2O0MA 1X7DA 1U2GC 4MR8B 1H65A 2E4ZA 3H65A 4WX2B 1I30A 5JH7A 1U2DC 3DUFB 1C7EA 3FRJA 1KYYA 4ZCQA 2WT8A 3IBTA 3RVQA 1U3GA 4E4YA 1MT0A 1SC3A 3VVBA 3RFVA 3R1IA 4FVTA 4NMWA 3RT1A 3GPIA 5L4NA 5FPTA 1KJYA 4P2BA 1BAPA 4D45A 4CKEB 3AVVA 3WNBA 3V2HA 1XRLA 2Q3DA 1G8HA 2HY7A 3HU1A 4G8JA 5GY7A 1AN9A 2CLEB 2R00A 1BTOA 3AEUA 3EODA 2OAEA 1JKXA 4EVSA 4HGYA 4JROA 5LMNB 3DDZX 1C0LA 2EP8A 4EYGA 4BC1A 4P0QB 3OWXA 2OO3A 4TV8A 3RFUA 1ZJJA 4LRQA 3IERA 3OCWA 1YOVA 4WESB 1ECLA 1SEVA 2VBCA 4V1CI 1VMEA 1X19A 3KX2A 3MJHA 1XRPA 4NMXB 4PQGA 4RFSB 4L0QA 1X7HA 3AZOA 1F6WA 3QVLA 4GNRA 4KNVA 1P2VA 4K9NA 2HPAA 3T6KA 3ETEA 1RAEA 4GKBA 1XKQA 3HJUA 1N5JA 2AN5A 4K9SA 2FPLA 4JC8A 4NYJR 3ZY4A 3ANYB 2FPPB 3GQBA 3O4JA 4JB0A 4DHWA 2B2NA 4ITVA 5D51S 4DMUB 1GRVA 2POQX 1WPQA 4J4HA 3GFBA 1UFVA 3LLSA 5EZYA 4MDFA 1PJAA 3NYIA 1KQ3A 3GJ4A 1ZH6A 3IVXA 2F4NA 5FPHA 1A8SA 3CUSA 4JHLA 1M33A 2ZIEA 1ADGA 2ZSJA 4KLNA 1Y7TA 4YCBA 1DJNA 1G16A 3BRCA 3DBOB 3TXXA 2A9PA 2RGEA 1FS4A 4X97A 1TM1E 2AEEA 5EIWA 4B0OA 5CB4B 1YIDA 2A1TS 2E0IA 2OGSA 2VHVA 1CUZA 1I80A 2JRCA 2RGBA 3DM9B 3NC0C 2W37A 4UMDA 3ZIUA 2C7QA 2QZJA 1P7CA 3N3BC 5TPWB 3WVNA 5I4CA 3C48A 4WK0B 3OFSA 1J8FA 3SS8A 4F5ZA 4B0PA 3WKCA 2I6GA 4BIIA 3HCWA 3CNQS 1VP3A 3KOXA 4DCOA 2ZZNA 1UIMA 3NT5A 3S40A 1RXEA 2DJ5A 4K3VA 1O4WA 3BRSA 2FPKA 2Q6LA 4TTRA 1T1GA 1XKXA 1V7ZA 2G06A 2HWKA 2OQ2A 3DTVA 3BD9A 3NOOA 1M72A 1GRNA 5DTQA 5CDFE 2BKUA 1YONA 4QOEA 2VP9A 5A5VA 1UFOA 3W3AD 5B4TA 3PQ5A 5EJEA 3I61A 3BULA 3E9ZA 1W6RA 1Z73A 4YTEA 3OIVA 4GT1A 3TRFA 4HN4B 2IPLA 2FW7A 4NK5A 1JAYA 1SAYA 3L41A 4AIRA 13PKA 1WQ3A 3CEPB 1JQDA 4IGIA 5K8LA 1GV0A 1XVLA 2B61A 3AFHA 1WPRA 1R4ZA 3UJCA 4AG6A 1H5UA 3KOZA 4W5JA 3I04A 3PQ4A 4QQRA 4AROA 4W6ZA 2QJTA 3WL4A 4XSVA 4K0RA 3T7TA 4GD3Q 4FN5A 5B3LA 1FQKA 2OV2A 3D2LA 4C29A 3PEFA 2BBWA 5GQSA 4MS4B 1T9ZA 2A0FA 2A9VA 2O3JA 3AW9A 4D56A 4K0KB 4XPZA 5ALRA 4NBTA 4JYMA 4MDYA 4FWTA 3JQ7A 4HGRA 4QFDA 1EWRA 2B78A 4PHCA 2DHCA 5BSFA 1KEEA 4R2IA 1G7RA 3FNRA 3PXBA 3FDZB 4PLHA 4X92A 1N3YA 2E6UX 1T0IA 3PC3A 5TB5A 4HLNA 3G5MA 2YASA 2HH9A 5BSTA 3ISVA 5TMBA 2JATA 3AUUA 3RAEC 1U1GA 1O0CA 4G2TA 5I7HA 1YTUA 4KGXA 3TZCA 5FH9A 3LG2A 3V4ZA 1N5IA 2ACEA 3N8IA 1VFNA 3D3KA 2M1XA 4AZ0B 1Y4DE 1T5BA 3R3YA 4FCCA 5L3RA 4YALA 5BN5A 1AHIA 4O2BA 2XAAA 2Z08A 4LDZA 4LF8B 1G63A 5HF5A 2D7JA 3A70A 5EPEA 4YP9A 3GJ7A 1I2CA 1E7SA 2M1ZA 3D8BA 4QVIA 4BB9A 2JI6A 4G0ZA 4NLLA 1DX4A 1FU8A 1ODSA 3D0OA 1RHRA 1Z4NA 3K1JA 3C15C 4QU5A 5E9WA 3R7WA 2QD2A 3SSOA 4B71A 1KY3A 2FW9A 4TXLA 4W5QA 2I4MA 4AULA 3MXTA 1SUFA 5LQSA 1YVPA 4N0DA 1QDLB 4YH1A 2PNFA 3BHJA 3QMWA 3VX4A 1T9BA 4PV7A 2JFPA 1E6LA 2BKEA 3T7CA 3ZWOA 1W87A 3QVGB 2ZJFA 4PS1A 3HDYA 4PANA 4PHTA 1SHUX 2W2MA 3KC2A 1G4HA 1P1IA 3AFIA 3JWIA 4D74A 4PLZA 4M0LA 5B6PA 4I9UA 4QARA 5DGHA 2HF9A 5BURA 3W5VA 4LOIA 4KMRA 4XOIA 1DJPA 3NS7A 4ZAZA 3N0WA 4YV0A 4OHRA 4KX5A 4D81A 1PNRA 3QYPA 4G3XA 2JAPA 2PWPA 3EEBA 1M10A 3BMQA 2QW8A 3TECE 2XE4A 2OBNA 1VGRA 1KK1A 2OBBA 2HQ1A 1LPMA 4C21A 4FT4A 3FGOA 2JIQA 4OHWA 1NWHA 4KSBA 2FNAA 3QMMA 4ZZ0A 4DJFC 5KX5F 1U2RA 3WLNA 3LHKA 4DSZA 3ND6A 1S3SA 5LQUA 5EZSA 4YCMA 2WVAA 3IQWA 2O1EA 4F04A 1RAFA 3THXB 4QJ4A 1A7KA 1AMNA 1J42A 2OB1A 2FEKA 2IT1A 3I6YA 4MVJD 3PVSA 2QMEA 2PY6A 4QBFA 1H2AS 1TQDA 1E1RA 3LVFO 4MO2A 4AMBA 4B9AA 2FUKA 2R8BA 3QY9A 3TLKA 1G2PA 2DWOA 3DAYA 3ORQA 1Z5PA 2FZCA 1F17A 1LSSA 4LA4A 1Q15A 4MKFA 3SF8A 4B34A 3LUFA 4KVZA 3EW7A 2ZE8A 3I72A 4QAQA 1QNLA 5JS2A 2WWXA 1JSXA 3QI7A 3IDSA 1JJBA 3P0FA 3SBXA 3KQVA 3T7JA 3ZIAD 5A6SA 5CFRA 3EZYA 1GG8A 1HC7A 2ROQA 3FNEA 1CBUA 2V4MA 3NR2A 3QFFA 4L73A 1Z5WA 4UQOA 5DTIA 3ZU3A 2F7SA 2WAOA 1NNSA 2W93A 3HMQA 1SCIA 4OP2A 4TMFA 4BX2A 1QQ5A 2NTYC 2JFQA 3NATA 2FWNA 4QATA 4II2A 2WZBA 3BCRA 3RG8A 2ECQA 3EFHA 2DOKA 4OD0A 4WOKA 2GPJA 2G9VA 2WG2A 4IO0A 3F78A 2J09A 3BBLA 3MUOA 2AB0A 4OBEA 1D2MA 1U2ZA 3LUBA 4L07A 3VYWA 5BWNA 4KIUA 2HJGA 1NTRA 5DHTA 1F2UA 3H2JA 1IONA 1T6XA 2MSDB 3D6MA 5AUOB 5K0JA 3KB6A 1ZIDA 5JV5A 1HT0A 3DV0B 2REQA 3BMOB 1D4AA 1T5SA 1P2GA 3FPEA 2XODA 2WU0A 3ZXSA 3ZC3A 3IQZA 2FPIA 3FYTA 4JBLA 1YZHA 3A1UA 4NV3A 4RJKA 3DBRA 1V26A 1Y48E 4KHZA 4ALLA 1NYLA 2I8AA 3OE5A 4O5OA 5BOSA 3DAOA 4NEQA 1KEWA 5BNTA 1DRJA 3PNPA 5EZ5A 3D4PA 3E7XA 5C5DA 4PEVA 1DOAA 4EHDA 3HGMA 3ICOA 1DLJA 1T8WA 4DSAA 1UPUA 3II6X 4M22A 4P53A 5AW9A 3VOAA 3LC7O 1G19A 5FI1B 4QBTA 3T1VA 2XZLA 3QLEA 3RTAA 3U4QA 2DERA 2AW5A 1RAHA 3A06A 1S2DA 1MIHA 5BT9A 3S6JA 4WLNA 3ZV7A 2BZGA 1Z25A 3IP5A 3UXMA 4LJAA 2WINI 1KRXA 1JQJC 3ZLUA 4HADA 1JHAA 4XASA 2ATXA 3E9QA 1E1NA 4RMGA 1L5GB 2WDZA 3QXGA 1EUQA 5HZKA 4ML3A 1ZUWA 3CF0A 3O0TA 2YWJA 3HCNA 5AW7A 1GRQA 3D5EA 3IOCA 4NRDA 4RUKA 3TNLA 5HBRA 4DADA 1FJ2A 1II8A 1Z2DA 4I55A 1YJXA 2GB4A 4OLFA 5KU7A 3SLRA 1PFQA 2PGOA 4NZPA 1T6ZA 3FNIA 4V3BA 1HDCA 1WRBA 4HAYA 4OFZA 4LJ9A 1P4AA 2Y1LA 1B00A 1XOIA 1GKLA 2OZKA 4YRCA 2MINA 1KFKB 2W2KA 1N1MA 4HZUB 5T5QA 3F3SA 1PVOA 3L5KA 3FIUA 1SHKA 4NCJA 3TLGA 5EP3A 4IS3A 3TI7A 3DG9A 5EHNA 2GFHA 3QENA 3RVRA 1TT7A 2ZRFA 1SUBA 4AICA 3BMCB 4KXLA 1TKBA 3N0XA 4CL0A 4PYNA 5EQJB 5KNCA 3JTMA 4R9NA 4G5HA 1M7BA 3AF0A 4Q1DA 1V3QE 3ZCUA 5AIBA 4MYRA 3ERCA 2CHVA 3ZK9A 1JLRA 1N6KA 1OX4A 1N5DA 3KCQA 4G5OA 4DRXA 1TFUA 1RWMA 2RH5A 3DBLA 3NGXA 4EF4A 1OA0A 5HRAA 3VH1A 3VR3A 1PAUA 1ZVMA 5AXBA 4KQKA 4G65A 3GLHE 5IS2A 1NRJB 2CVFA 5CXXA 1T9KA 5CH8A 4GQBA 3RASA 2ZQYA 4EY6A 2QQ5A 1B8VA 2GF2A 1NOKA 3CEMA 3N6VA 5ILGA 1IYZA 3WSVA 3NEYA 4RTLA 1XGKA 1KSFX 1RFGE 1X1TA 3EGDA 1E2PA 2OBLA 4MB2A 3HXMA 4RA6B 1VHWA 1U7DA 5GZ1A 1IFXA 1H1LB 1HSOA 4MKRA 4UVDA 5JSZB 1ZOOA 2EIXA 4TMXA 5KYUB 2W6MA 2ZW9A 2WR8A 3OKPA 1CXZA 4F86A 2XX3A 5EJ9A 3BWCA 1T5DX 1X15A 5KJ6A 1EFPB 1VMKA 4FNAA 4CNQA 3M83A 3SIRA 1FP6A 2VTKA 3THSA 4BNHA 3WGYA 4WAUA 3X1XA 3G1WA 4TMWA 1MXHA 2UUOA 1K89A 4HX5A 5AVVA 2D1TA 1BE0A 3H2YA 3FH0A 5F35A 3L6CA 2GVDC