2FPOA

Putative methyltransferase yhhf from escherichia coli.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
183
structure length
177
Chain Sequence
b'GQIRIIGGQWRGRKLPVPDSTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methylase yhhF
molecule tags Transferase
source organism Escherichia coli
publication title Methyltransferase that modifies guanine 966 of the 16 S rRNA: functional identification and tertiary structure.
pubmed doi rcsb
total genus 56
structure length 177
sequence length 183
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.171: 16S rRNA (guanine(966)-N(2))-methyltransferase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fpoA00
3JWIA 2B2CA 3O7WA 1N7JA 1QANA 2G1PA 2N47A 3LX6A 1RI4A 3TM4A 5DTRA 4EQZA 1VBFA 1Q0SA 2IH5A 4R05A 4HTFB 4OQEA 2OBFA 1JR4A 1KXZA 1XCLA 5P8WA 3BWYA 3HVHA 3KHKA 5E2AA 2PSSA 4QPNA 3BT7A 1P1CA 4QQKA 5LQKA 2HWKA 3WSTA 3GDHA 3LDGA 2CWWA 3ELYA 2NXJA 4RTNA 5DXJA 2FK8A 2ERCA 3SGLA 2ZW9A 2BZGA 3H2BA 3KR2A 2HR1A 2UYCA 1G60A 1V39A 3THRA 4E2YA 2BR5A 3D2LA 2C7PA 1ZGAA 2EX4A 2NYUA 3MTEA 5HEKA 3SSNA 5DXAA 1X1AA 4U7PB 2O57A 4HGYA 2H11A 4P7GA 4RVFA 2JHCA 4E70A 3EMBA 5K0LA 3JWHA 3JWGA 3GRVA 2QM3A 4BLVA 1ZG3A 2BR4A 4PYIA 3KPVA 4NECA 5EKXA 1JQ3A 5EZQA 3DOUA 3OZRA 4RTOA 1D2GA 4PIMA 3LKDA 3HTXA 4WXHA 4OBWA 3C6KA 3I58A 3I53A 2GAFA 2CMGA 3MTIA 2OPBA 2YVLA 3ID6C 2ZIEA 5JR3A 3ER8A 3G88A 4IWNA 2I9KA 2DPMA 1WY7A 3B7PA 3PT9A 4CKBA 2OB2A 4PYNA 5EMKA 3FTFA 2Z6AA 4U7TB 2GPYA 3AY0A 3ORHA 4PCLA 5HOQA 1RJEA 1EQAA 3LGAA 4OX9Y 1BC5A 4X41A 5FUBA 4GF5A 2A14A 2OB1A 5EMMA 4EK9A 4LG1A 3BGIA 2ZTHA 4YMHA 2Y1XA 3ANXA 2Y1WA 5U4XA 2V7EA 3DR5A 5GIOE 2AZTA 5LQUA 3F4KA 2AOVA 1IXKA 4OA5A 1ORHA 2Z6QA 5E9WA 1XDUA 1UIRA 2VDUE 2AN4A 3E05A 3FUVA 4YV2A 3PLAE 2IIPA 2V74B 2P35A 3CJQA 4Z2YA 4AZTA 5BW4A 2IBTA 2ZZMA 5E1MA 3JWJA 3S68A 4YV1A 2ZWVA 4XUEA 3IEIA 1UFKA 2AOWA 3EEYA 1R00A 1AQIA 3FUXA 1YB2A 3SX0A 5K0BA 3M6VA 3M4XA 5EVJA 4EKIA 2IH2A 4DA4A 3NMUF 1G8SA 4C06A 1NW6A 3GWZA 5IH3A 2JH9A 1DCTA 3OU7A 5E1DA 3DLCA 2WK1A 5LQRA 4AX8A 1IM8A 1YZHA 1B42A 5EGSA 3UJDA 4FSXA 3FYCA 4RTJA 2PJDA 3DP7A 1I1NA 2NXCA 3AJDA 3KR0A 3P2KA 3EVDA 5C0OE 2BR3A 1U2ZA 2JH8A 3KQOA 4QVKA 4C07A 1QAQA 2OY0A 1YUBA 4GC5A 4C03A 4PYKA 2CKDA 3T7SA 3R9XB 4LWOA 1VP9A 3GO4A 5FHRA 1QAMA 3B5IA 3EVAA 3KQSA 1WS6A 4MWZA 5CVUA 5KVAA 2XBMA 3SSOA 3BKWA 1NW7A 1P91A 2WA1A 3CJTA 2NP6A 2QE6A 3TMAA 4F86A 4ISCA 4M37A 5KQRA 9MHTA 1WXWA 3KU1A 3M33A 3B89A 3PFHA 4RSRA 3G5LA 2GB4A 3KQYA 3EGIA 2YXLA 3LKZA 2QRVA 3G8AA 4IKPA 2EG5A 4FT4A 4FS8A 3KPYA 4WVLA 2IP2A 4AZVA 2AS0A 2PY6A 4DCMA 2LD4A 3M70A 3UBTA 3G5TA 3G7UA 5DRTA 4QPPA 5E9QA 4GEKA 4P7JA 2P41A 4QQNA 3VSEA 3U81A 4KDCA 5K0EA 2JJQA 1KPIA 1HNNA 2G71A 4XUCA 4LECA 3BGVA 1RI1A 2FYTA 1FPQA 1R8XA 3I9FA 3KPWA 3OU2A 3ERCA 3UWPA 3VYWA 2GS9A 3GU3A 1KIAA 4KVZA 5GINE 3LECA 5BXYA 3R6TA 4CTKA 3EVFA 4PGHA 3DTNA 2PKWA 2PT6A 1JQDA 3EGEA 2YTZA 3C6MA 1PJZA 3EVGA 3Q7EA 3DMGA 1UWVA 5EC8A 3MERA 2ORED 5E2BA 1WG8A 2IPXA 4M36A 5DT2A 4ER0A 5HFJA 4FZVA 2CMHA 5CD1A 3P2EA 1G55A 4RTMA 3DXXA 3KQWA 5EMJA 3OPNA 3TLJA 1R74A 3PS9A 3QOXA 1SUIA 2PXXA 3AWIA 5EHGA 1VPTA 4IV8A 4QVGA 1R18A 3MCZA 3E7PA 3UJ9A 3B3JA 3BWCA 2BH2A 1AV6A 4ER3A 4HC4A 3THSA 5K0CA 4YUYA 1MHTA 5K05A 1EG2A 2HV9A 2NXEA 5D1NA 1NW3A 2AR0A 4ZTBA 5IKMA 1JG4A 2PWYA 3LSTA 5FA8A 1XDSA 3GCZA 1O54A 4BLUA 1EJ0A 5MHTA 5T6BA 2IGTA 2AVNA 2ONZA 1JG3A 2ZBPA 1RJGA 1O9GA 2GLUA 3P9IA 3REOA 3NJRA 4PYOA 2I7CA 2VZ9A 5EMLA 2ADMA 4E30A 3HP7A 3G2PA 3NWEA 5HZMA 3SSMA 3P71T 1JG1A 3EVEA 1YFJA 5M5BA 2YQZA 4FR0A 2B25A 2ZULA 3P8ZA 1JSXA 2AVDA 3P9NA 5K01A 3PTAA 1NBHA 3C0KA 3DMFA 3MHTA 2PT9A 3FUUA 3T7TA 1OR8A 2FHPA 2H00A 4MTLA 5G02A 5BP7A 5K03A 2C7RA 1X1BA 3KR1A 1I4WA 1L3IA 5EIFA 4OBXA 2ZSUA 3LCVB 4MHTA 3BUSA 3HCDA 1NW8A 3UJBA 3NVKI 2JHAA 2YR0A 4V0RA 5EEHA 3PB3A 3T7RA 3UJCA 1JSZA 1RJFA 5D1HA 3HVJA 3X0DA 3G8BA 2XVAA 2E5WA 2ZVJA 1AF7A 1SQGA 5E8RA 2PX8A 4AZWA 3HCBA 1M0EA 1FBNA 4OA8A 1VP3A 4FSDA 2AOTA 1NKVA 3DMHA 4R8RA 3K0BA 3SVZA 3BZBA 2IDJA 2K4MA 5CVDA 3G2OA 3MAGA 4HGZA 1L1EA 5CVJA 5E1OA 4DZRA 5DWQA 2WA2A 3P9CA 2O0LA 3LBYA 2VS1A 3LL7A 3LDUA 4L7VA 4C05A 4E33A 5JUWA 2C7OA 5DX0A 2EJUA 5C9ZA 4YUXA 2I6GA 4E2WA 4F85A 4PYLA 3EVZA 2FRXA 2ZIGA 4M38A 4IV0A 5DM0A 4C4AA 4R6XA 2YXDA 2KW5A 5F2NA 5B1SA 3OZTA 2UYQA 4QTUB 1R6AA 3LBFA 1XCJA 1DL5A 1INLA 2ONYA 3FTCA 2ZBQA 4BLWA 2ZLBA 3TKYA 3KQTA 3PFGA 4X60A 2P3OA 3C3PA 1ZQ9A 2FPOA 5ERGB 2VDVE 4CKCA 1NV8A 2YX1A 3LPMA 2FCAA 1JTEA 4Y30A 2Q41A 5GP1A 3T0IA 1X1DA 4M7RA 1FJXA 3TM5A 2ZBRA 1SKMA 3GXOA 1NE2A 4KIGA 3P97A 2PXCA 1KHHA 4MQ4A 4PYJA 3CC8A 5DX1A 2PWPA 2ZFUA 5E8JA 2G70A 3DXZA 3GRUA 2R3SA 3EVCA 5DRYA 1Q0TA 3O31A 3O4FA 3HNRA 3UA4A 5DTMA 4QTTB 3SM3A 4HTFA 3IHTA 3NTVA 1HMYA 4B17A 1WXXA 2AN3A 3NDIA 4OQDA 5ICEA 3FRIA 4RTSA 2UYOA 2O06A 5FHQA 5GOZA 2H1RA 1F3LA 3A25A 3HA7A 4C04A 3LDFA 1YFLA 1QZZA 3OCJA 4FP9A 5DX8A 4RTKA 2FK7A 5K0JA 1AQJA 3HCEA 1KYWA 2O07A 4KIFA 2QYOA 3KQQA 2GA9A 4RTRA 3BKXA 7MHTA 1YZ3A 5ICGA 3UA3A 3MCTA 4RTQA 2IH4A 2XYRA 2P3QA 1N7IA 4HH4A 4X63A 2QY6A 4GQBA 1KPHA 2PVCA 1RI3A 4CTJA 4A6EA 4POOA 1I9GA 1M6YA 2P8JA 3PVCA 2IBSA 1Y8CA 3KR9A 2VDWA 3QOWA 4LWPA 3GIWA 3KPUA 1R8YA 3UJ8A 2P7HA 5FQNA 4P7FA 4E2ZA 1EIZA 1XVAA 2R6ZA 3TRKA 5KS2A 4R8SA 3EEOA 1VE3A 1QYRA 4PIPA 1QAOA 2XVMA 3HVKA 2OO3A 3QV2A 4RX1A 1BKYA 4R6WA 1X1CA 5CCXA 4PCAA 4QDJA 3G89A 3HM2A 5GM2A 2BM9A 5CVEA 3LCCA 4H0NA 1P39A 5H02A 5CIYA 4PINA 5HIJA 1XDZA 3L8DA 5ICFA 3BWMA 3EGVA 5K09A 2NXNA 1BHJA 4DM3A 4E31A 3C3YA 2PX5A 5DTQA 5KQSA 1YF3A 1ZKDA 2AOTB 3NWBA 4RWZA 5CUQA 4DQ0A 5CM2Z 4RTLA 2PX4A 5DSXA 4RVHA 1JTFA 5HIIA 3DH0A 3DULA 3FTDA 3CKKA 5T64A 3UZUA 5GM1A 2F8LA 2B3TA 3IV6A 2CL5A 5LQCA 4C08A 2OYRA 3OFKA 4RTPA 5FWAA 3TQSA 4F84A 10MHA 5LQNA 2HMYB 5FCDA 4HRAA 5FA5A 3CJRA 3A4TA 3FPGA 5EOVA 5EHIA 2YXEA 4X1OA 2Z6UA 3RIEA 1NBIA 1XXLA 2P1DA 3E23A 2PX2A 3ELDA 4GBED 1BOOA 3HCCA 2PV0A 4YMGA 2ZZNA 2IDKA 2UYHA 3NVMB 3ER9A 4P7KA 2B9EA 2IFTA 5DM1A 3RW9A 3LHDA 1RI2A 4DF3A 2PLWA 3EVBA 2YUIA 1NW5A 3CBGA 3M6XA 5DSTA 3AXSA 4GOND 1FP2A 5E9JA 4Y2HA 1EJ6A 1M6EX 5DPMA 2C7QA 4CKEA 5FTWA 4XUDA 1IY9A 3HEMA 5EQJB 3I64A 1TW3A 1NV9A 3HCFA 5LR6A 2ZWAA 5EZSA 3PX2A 3UJAA 2AN5A 3PX3A 4YUWA 5CVVA 3A7DA 1ZHFA 4V0QA 3ME5A 5K0NA 1G8AA 3VC2A 4DCGA 3SXJA 2HNKA 3FPHA 1L3BA 5E1BA 2OZVA 3A7EA 3E8SA 4KWCA 4XCXA 5LQJA 1D2CA 1F38A 4HG2A 4KW7A 2NP7A 2B78A 1JQEA 4BP3A 1NT2A 5LQAA 4RVGA 5F2KA 4ER5A 4PYMA 3UJ6A 4BY9E 3GRYA 4GC9A 5EG5A 4FT2A 1Z3CA 1O9HA 4CWAA 1VL5A 3G2QA 5FULA 3MQ2A 2OKCA 1H1DA 1KPGA 3B3GA 3FUTA 2P40A 3UFBA 2G8NA 1PRYA 1FP1D 3NDJA 3A27A 3GGDA 3R24A 3K6RA 3KPJA 3FPFA 3OE4A 3DUWA 3R0QA 5ICCA 2O05A 4G56A 4KRGA 4A6DA 5GIPE 3CGGA 5HIMA 4YUVA 4E32A 2ZIFA 3GRRA 3Q87B 4X61A 3SR4A 2BM8A 3FUWA 2DULA 5T67A 4AUKA 1G6Q1 3BWBA 4GUAA 4UOEA 1KR5A 1KP9A 1P1BA 2P3LA 2AOXA 3MGGA 2PXAA 4JXJA 2JG3A 2UZ4A 3UJ7A 8MHTA 3KQPA 4HSGA 5K0GA 4P58A 3BXOA 4PWYA 4ER7A 2ESRA 5DLYA 4O29A 3CVOA 4ATNA 1G38A 1RI5A 4EVIA 3DXYA 5F2OA 3ELUA 2JHPA 1WZNA 2NNWB 3MB5A 3V8VA 4KDRA 5FADA 4E2XA 2ZCJA 1N2XA 2EJTA 4MIKA 4PGGA 4DKJA 1L3CA 3FPEA 3IYLW 2GH1A 1MJFA 3B3FA 4FGZA 1VIDA 5DM2A 5EIWA 1ZGJA 3AXTA 3TR6A 3V97A 5K0FA 3M6UA 4GOOD 3I5UA 4YV0A 2AOUA 3P2IA 5KYGA 2XYQA 3KQMA 1TPYA 4GOMD 1DUSA 2HTEA 3LCUA 4RVDA 1JG2A 1KYZA 1VQ1A 2QRVB 4K6MA 5HIKA 5DM4A 3TFWA 3FRHA 3HA5A 3EMDA 2G72A 4CXMA 3GJYA 3RODA 5FQOA 2EFJA 5EEGA 1ORIA 3OU6A 2PBFA 3GNLA 3HVIA 3OFJA 4RV9A 5EKUA 5GWXA 5CCBA 3A26A 3CCFA 3TOSA 3GRZA 1L9KA 3HA3A 4QDKA 5EPEA 4GOLD 3VC1A 4BP1A 1SVUA 3TPZA 3R3HA 2AOUB 3HCAA 3KQVA 1X19A 2PGXA 2ZZKA 1VLMA 4EMSA 5BW5A 4PYQA 3FPJA 4PNEA 3ELWA 2OXTA 1D2HA 2XYVA 3DLIA 1SQFA 5FWDA 5HILA 4EKGA 4AZSA 1T43A 1RJDA 3KKZA 3SMQA 2I62A 3BGDA 4DMGA 3OZSA 3FTEA 1EAMA 1SG9A 3P9KA 1SUSA 1XTPA 5LSAA 4RYLA 1TW2A 4YUZA 4ER6A 3FZGA 1XJ5A 3OE5A 3EPPA 2P7IA 2VP3A 3G2MA 3M6WA 5C1IA 3TKAA 4PONA 3FYDA 3NW9A 5K8VA
chains in the Genus database with same CATH superfamily
1T8WA 5AUNB 4XM1A 1Z8NA 1WMFA 1VKJA 2IY9A 4DIKA 3A31A 3ILVA 5KHLB 1SVKA 1EXVA 1ENYA 1U5CA 1IOLA 4KXQA 1Q0SA 4UEJA 3MB8A 5CNIA 5D84A 5E6RB 3SOZA 4EUKA 2WQ7A 2NTEA 5CLFA 1PP4A 1OU4A 3E4CA 1OX6A 2X5JO 4M0KA 4QGFA 3AR7A 2AXNA 5CFPA 2B98A 1R5OA 1T6NA 4KBGA 2QM0A 4QBGB 5E2AA 1W2WB 5CH5A 3AR3A 1JLMA 1XLTA 3OTHA 4XOUA 3U5ZB 1CG6A 1NKTA 2NZ8A 3O75A 5AK3A 4F6CA 4BVFA 4DV1B 3I04M 5D7BA 1R0KA 3HU2A 5IM5A 2HMVA 3PC4A 1OAKA 2X6RA 3PDHA 5LIRA 3THRA 4QU0A 5AW7A 1L4FA 5CX1A 5FFMA 1L5GB 2ZJFA 2I55A 2EFGA 3LGXA 5D6NA 3UUWA 5IK2D 5BT9A 3G8YA 4ADSG 1JI0A 3NEPX 1XLTC 3KAKA 3ABSB 2PIAA 2VJQA 1C30B 3ACDA 2AFIE 4JLWA 3L4EA 2YC2C 4LXGA 3TRFA 5DIFA 3IAFA 3SP1A 2I4IA 3OOWA 2DTDA 1G8GA 3QIAA 3VR3A 5HM6A 1A7KA 2H2WA 2JFUA 3BSWA 1Z88A 3OIDA 3Q7IA 4MQMA 4QXQA 4YPOA 2O5CA 2I2BA 4S1OA 3BFJA 5EZQA 1Q74A 3Q9LA 4RFLA 1RHKA 5HKBA 5AHXA 3MTIA 4A2WA 4QTZA 3VPDA 2JJ1A 1KEKA 2BF7A 4B33A 2V3CC 2BISA 3RUPA 1TRHA 3AR5A 4IG9A 2D8MA 5JZSA 3CEAA 1EWKA 5ALMA 4EITA 1JEQA 1QG0A 2G4CA 5JQGA 2WV9A 4EGJA 4F38A 4KKXB 2CHVA 4ISBA 1I0LA 2O23A 5BV8A 2Z8XA 4R01A 1M75A 3AU9A 4OSPA 2UUCB 2C2KA 3I39X 4RMHA 1N2ZA 3S70A 3ZHUA 4ENPA 4YMHA 3ESYA 1EVLA 2CLDX 2FP4B 1Q0ZA 2Y1WA 1BTOA 3OE7D 2NUPA 5DLQC 5J40A 2ZUBA 2YH2A 4WN9B 3JXEA 3TZLA 3RAFC 2V7UA 3KAJA 3NXSA 3LUHA 1CEEA 5LD2B 3H18A 4AJ1A 1LDGA 1UJ4A 3C3WA 4WL0A 4NH4A 1H2BA 1ULAA 4Y7DA 3GLGE 2XXBA 1L4UA 4FGSA 4JKOA 4MR8B 1Q6YA 5F5LA 3EUWA 5FTNA 3RYHA 4EUEA 5LYJF 1YK0A 1D2RA 5C3UA 1QF9A 2EFEB 2WD7A 4CN9A 2GA8A 1AQIA 1MT3A 2AJ8A 2C2MA 3A3PA 3G49A 4XQGA 1KQFA 2FRDC 1GAJA 2RFLA 2XMRA 3CX4A 4I3FA 1NVFA 4I1IA 3NVAA 1DIGA 4PG8A 5C32A 2QVLA 4MVJG 3ROFA 5E1DA 2QPOA 2B1GA 1SUFA 1HBJA 3CLSD 3VH2A 8ABPA 3OG9A 2CFTA 4EF6A 4KOEC 2PGJA 4XH9B 2PKRA 4KITB 1Y6GA 2C7BA 1KJNA 1H0KA 3FFTA 3O95A 3VTAA 3KTDA 4NBTA 1Y8QA 3EX7C 1LX7A 1V0JA 2Q5LA 2PPLA 5JQWA 1E2BA 4UC0A 2DUNA 2R7NA 2Y67A 3GXBA 4I5GA 1CS0B 4M8KA 4QDUA 4YBRA 5A6VA 2A8YA 4HGPA 3T7SA 3UKOA 1KDVA 2OXCA 1HY3A 2H29A 4JR0A 1SVIA 1JDZA 1BXRB 5GJVC 2OK8A 4PPYA 1HDCA 1U0TA 4R1PA 4J0QA 4U7GA 4ZVQA 2PG3A 2QAIA 3MTDA 3TMAA 4I0WB 3AEUB 1YVEI 4YH1A 5JD3A 1UADA 3NBQA 4MRMA 4UXJA 5G4LA 3T52A 5DBOA 4CMIA 1KE1A 3G8DA 4G5XA 4QRDA 1NM5C 4A1OA 4PZUA 3V32A 3LKZA 4IGEA 2QVGA 4DLKA 1O6GA 4DR7B 2Y0EA 1K2VN 3EEFA 1G8PA 1JHRA 3DHNA 4P33A 5DDIP 5L7YA 1M34E 1UMBB 1OXXK 5F5NA 4C6TB 3AKZA 2PNFA 1GPJA 1IVNA 2OAEA 2DBRA 2P27A 4CU5A 2Q5IA 4CFYA 4ECEA 3GLIB 3N75A 3OP4A 3ZHCA 5K45A 4H3SA 4EHDA 2HHLA 2ATCA 1C41A 3A6HA 3KG2A 3STTA 4DNQA 1MC4A 1AUVA 1NX9A 2VVTA 4R71A 2AC2A 3NORA 2PZGA 1GNPA 1ZINA 2FSFA 5K3SA 3ZVNA 3GJQA 5AI8A 2FN3A 1JXAA 2JCSA 4V3CA 1OGYA 4LSGA 4V0NA 4TV8B 4RELA 4ZP1A 1KIAA 4TKZA 4MUFA 2YRXA 1F8YA 3AF0A 2GBLA 1H2AS 1XMPA 1AY0A 2GYYA 2NOAA 2J6HA 1N2BA 1QRSA 1QHHA 1KQNA 3OVMA 1RHRA 3A6ZA 3P0FA 4B6JA 4N3BA 1PJAA 2J08A 4G07A 3X44A 2UVPA 4NCHA 4N4AA 1XYGA 4LJKA 4ND6A 2YNMA 1JQJC 2J7KA 1PK9A 2QR2A 1F8XA 1ZD9A 3KQWA 5IZ4A 2GK6A 4HS9A 2BLLA 2D2FA 1ONSA 2F62A 3O3MB 4MITA 3BMQB 1Z7GA 6LDHA 3DO5A 2P9EA 1BX0A 1DXYA 1JVSA 2XZTA 1U8UA 3DV0A 3W8EA 3UWSA 3FSGA 4BO2A 2D6FA 1SIBE 1ACLA 3V2HA 1ODCA 4D79A 2WWRA 1YKFA 3LPNA 1K8ZB 4KK4A 2C94A 3HE3A 3Q15C 4DPKA 4F8EA 3TLGB 4LZOA 5EZYB 4I66A 3A6KA 1OU0A 2W90A 4WW0A 1ENZA 3ABOB 2YCBA 5HKKA 5C7YA 1P7VA 1HV8A 4GMGA 4B3MB 2XGOA 1E3EA 1R4MB 5I9LA 2WTXA 2JIZA 4J7XA 2D2XA 3A2MA 3EW7A 4JC8A 3WXMA 3ADDA 1Z6TA 3LRPA 1NDQA 3GGOA 1P60A 1ZGGA 2VC2B 1IQRA 1HLDA 1RJGA 3AEZA 4OLHA 3U1TA 4K9RA 4PYOA 4TZTA 2BV3A 4TYMA 4X1YA 3RU7A 2C2ZA 4Q7JB 2W8ZA 5BN3A 3N2EA 3MMPA 2E4YA 5ALVA 3FHLA 3MGKA 3L4JA 1DC3A 2HLDA 3O92A 4KXWA 4YDSA 1GA1A 3LOUA 3SF8A 1J9GA 3G17A 4YAJA 2AD5A 1GG2A 1VHQA 1PQYA 3T7TA 1XD8A 4DTCA 2M1XA 1H2XA 1KFKB 2LPMA 2VRNA 4ZC8A 1TQHA 4FMPA 4OBXA 1SEVA 1F9AA 2ZSUA 3IP8A 3PC2A 4AI6A 4KX3A 4S0ZA 1WKVA 3GLVA 4RIHA 1TO1E 4JLOA 1HDEA 4I2VA 4JIGA 4KZPA 1M54A 4GZ6A 3RREA 5M04A 3UICA 4RDXA 4AQ7A 1TEVA 1J20A 2V59A 2YJNA 3L6UA 3NXKA 3UH1A 1YZQA 1KZ1A 3IRVA 1YS1X 2GOYA 3FFBA 4MCHA 1VE7A 3I4CA 4RIFA 4TRNA 5CR9A 3TQCA 4DV0B 1WBDA 1E6LA 1IAVA 1XVUA 4IDPA 2SKCA 4UARA 3ZZNA 2W6QA 1OXVA 1SUAA 3HJTA 2N3ZA 1P6UA 2HJGA 1G9SA 3WHKA 1TADA 4DYDA 1UPCA 1VYTA 4IDOA 1HFKA 3PQ2A 2P6NA 5ALOA 1ZIYA 2HSWA 3EVZA 2OC4A 4OBBA 2F59A 3ORRA 5TXGA 3AVUA 3R7WA 2BKXA 5I7AA 4TS9A 3COZA 1VGQA 4LBZA 2O5EA 4O4LA 4PLGA 3UMYA 5FUQA 3QMPA 3GLFB 3X1DA 1UBKS 1JEYB 5I45A 1B8OA 4D9FA 1E60A 4UATA 3GYBA 3WNBA 5GP1A 4E94A 2HRDA 3I28A 2PSHA 5B1DA 1K63A 3EB9A 1TM5E 1CQIB 2ZBRA 3I1FA 5LLSA 1UBSB 4XYMA 4MX8A 1RU3A 4RL6A 4XQEA 3RANA 1JMKC 1R6VA 2C3PA 2ZFUA 3IFSA 3LNTA 1F51E 1CTQA 2FHSA 4GGPA 4MW9A 5E8JA 5IS2A 2GETA 5LXTB 1CE8B 1XVLA 3CH5A 3BIOA 3HKBA 5F77A 4J0JA 3VVCA 3L7OA 4D80A 2Q3JA 4U2EA 5I7RA 2UZIR 1XV5A 5LQDA 1QGYA 3AI3A 3RB8A 1UBTS 3HYLA 3RIMA 2J6IA 2I8AA 2NIPA 3C98A 2IZZA 3AF4A 3PYLA 5I4CA 4LXYA 4MUIA 4U6SA 4NP6A 3BJZA 4LXHA 4CV3A 4TWBA 1YDEA 1GUAA 1X39A 3EXHB 3L79A 1TM7E 5KOJB 4RTKA 4BRWA 5B3JA 2QG4A 3U3OA 1EVKA 2QYOA 1ADBA 1HTTA 3KQQA 1YU9A 3VM6A 3KRTA 4C22A 1C7IA 1N0IA 2CCJA 2E1PA 2O1XA 1QR6A 4YJFA 1U98A 3SS8A 4AIIA 1AZLA 3I72A 5ES4B 1GXSA 1A9ZA 1J21A 1FDOA 1UANA 4U2GA 4RHXA 3S2GA 5ADHA 2IZ6A 2OHXA 1KVRA 3KTAB 4A6EA 4BO8A 1OTXA 3PEYA 4RD1A 5AW5A 3TOXA 3VH1A 1SC4A 1P8JA 3GIWA 1H3FA 1ZD3A 4REQB 4IIDA 4EDHA 4MZDA 1EDBA 2RG1A 2XMZA 3MCWA 4OTZA 2R6ZA 5COAA 2AZXA 3RC1A 2ZE6A 4PANA 3VPAA 4KL8S 3DFIA 2XKBA 2XVMA 3SE0A 4WA8A 2QK4A 4B9EA 3G89A 3TMYA 2ZOSA 9LDTA 4P3YA 2NGRA 2WMYA 1RHJA 2QEQA 3M4YA 6REQB 4TN1A 3D4LA 3D7LA 1RRVA 3KVNA 2ZS9A 3CW9A 2WYOA 4HATA 3V34A 4Z7OB 5EJEA 3FDFA 1VMIA 2ZEJA 3Q8LA 4H3KB 1LFDB 4ME6A 3C3JA 3Q12A 3WMWA 3ON5A 2IEZA 2Y0PA 1GOTA 4FBMA 2IXTA 1Z37A 3PRYA 5ITZA 2CXUA 1MZPA 4ZK2A 2XD4A 2YOHA 1MO5A 4J3NA 5K99A 2VWPA 1JJAA 4ETWA 3GARA 2OYRA 2IPMA 4LYEA 1U3TA 1JHMA 1RS0A 4UEOA 3R77A 5J1SB 3HJHA 3RG2A 3ZK7A 2DCMA 3HGMA 3D4PA 3ONEA 4QGGA 1CRLA 1Z22A 4MW0A 4N7BA 1UZUA 1JAYA 2PX2A 2EYQA 5HA5A 4WMLA 3LH5A 3ESCA 3VZSA 2UYHA 5KVVA 1RZRD 5H5JA 1GXSB 1P0PA 4BWYA 1P5ZB 2HU7A 2FUEA 3IVAA 1UBMS 2ZYGA 3O1JC 4J0KA 1XNHA 1NIJA 2G67A 4RACA 4FOPA 4DQDA 2A4KA 4JASB 4EDFA 3WWYA 5DYWA 5EUMA 3QE0A 3GRKA 2O8FA 3OZAA 2H2IA 4IIJA 1NQ5A 3A3OA 4LDQA 1E3WA 4G9EA 3UC9A 2JAOA 2IQ5A 1KDPA 4TZKA 1ECPA 2QTFA 5C2JB 5CXSA 4HNRA 2AUNA 2YY6A 1ZM2A 3RASA 3U7JA 3ZHBA 2O9JA 3E70C 4AZ0B 4TGLA 3CKMA 4XCXA 1K68A 2HQSA 1WCWA 5DHAA 1PWXA 3MGAA 3UTCA 3ZWDA 5KTOA 4B80A 4BQNA 5LQAA 4ZKEA 2POQX 2D5IA 1JEAA 3K73O 4KV7A 1U8ZA 4BTLA 1PZNA 3AR6A 4BO1A 3I2YX 3QW2A 4G1CA 4J07A 3WGJA 4EUSA 2GRUA 2VK1A 1PQWA 3E58A 1V7ZA 3KM0A 1YS7A 4MGIR 721PA 3VU0A 4BNLA 5HZMA 1FP1D 1RJ9B 2WF6A 2ID4A 4LAFA 3IAAA 3LA6A 1RFLA 1Y82A 3VPSA 2C2OA 2R6R1 4IDFA 2DHDA 5HK8A 4ZVNA 3UEOA 1IG0A 3DDZX 2CDCA 1VRWA 1XRRA 5GIPE 1KY3A 3JQEA 3GJ4A 2QLFA 5IYZA 1O5IA 1Z74A 3EF0A 2GKSA 3CG0A 1JDPA 4LOIA 4AUKA 2IGBA 4M49A 3PRHA 2AJLI 3B2QA 2OENG 4K9MA 4MKFA 1R6UA 1WDLA 3KK0A 2O8EB 4MV1A 2CJWA 5JFGA 1BS1A 2GHRA 4B3GA 5K0GA 8LDHA 4LHYA 2YIVX 4P58A 1N4DA 3PQ4A 4TV8A 4OCZA 4ER7A 3X1JA 1T0JB 2XWJI 3FMIA 3LW8A 2GN9A 2NU6A 2DTXA 5GOTA 2PUVA 7GPBA 1CCWA 3CVOA 2PUHA 1Z7EA 3K94A 2W70A 1I0ZA 5HUJA 1R6DA 1GKYA 4WASA 1AIPA 3DYIA 5CU7A 4N3NA 2W2NA 4KDRA 4O63O 3V8QA 2AEFA 5DCYA 2XW6A 3JQ6A 5LA6B 3TN7A 3IKVA 1BZYA 2ZCJA 1MJFA 3O93A 1KJZA 3BWEA 4QBTA 5DM2A 5G2OA 3R8FA 1DBVO 1HKHA 4HUQA 4EENA 5K5EA 4HADA 3VU3A 4W5TA 5A3SA 1T1IA 4CM8B 1PK7A 1KYZA 1K6EA 4Z54A 2SCUA 2MYPA 2P79A 2QT0A 3VR5D 4GE0A 4WI1A 1FY2A 2YL2A 3HA5A 1H1TA 2EX1A 2ZAMA 2XGJA 3DTYA 4TLEA 4MWSA 3CLVA 5FLXA 3TX6A 5E6SB 5FO0A 1NFQA 4BO3A 1QLHA 2OXRA 4DLAA 4WZBA 3IBGA 1TUIA 5BVHB 2JJMA 3EZ7A 3LWZA 2YC4C 2VSNA 4UVDA 2BRUC 3QU2A 4ABTA 2JS7A 4L27A 3DV2A 2ZS8A 4EW1A 1NG9A 1NXQA 2LCIA 3A1NA 2PQ6A 3CLHA 1EH5A 1JHXA 4EMSA 4J0EA 2YASA 3AUAA 3IODA 1SG0A 1SM4A 2G09A 2QM8A 4NABA 3LVRE 3ZE6A 3DLIA 1NYTA 4AF8A 4E15A 3EVNA 2ZWOA 1QM5A 3PD7A 1A5TA 3OSUA 4AJKA 4GLFA 4HH3C 1RBMA 1D2EA 3TJMA 4MO2A 1GQSA 3SEQA 2I62A 3JQ7A 1SBNE 4O2BF 2GFHA 2L69A 4ZU3A 1PBTA 3I4FA 3H2ZA 3B1WA 2HAEA 4H3HB 3I1JA 3B1ZA 3TZBA 1BGXT 4HEA1 5ADVA 3LUPA 3L9WA 1JIJA 1F4PA 4HTAA 1TK2A 5F1KA 2HPVA 2GCOB 2I6XA 2VTVA 3FCUB 3LD9A 2DCUA 3QOFA 4X6XA 5DULA 4F5ZA 5K3OA 3V00A 3ADCA 1ISFA 2XRZA 4MKRA 2AFHA 4X1IA 2P67A 1IWPB 1L5WA 5KTNA 1Z6YA 4UCWA 4GZ5A 4HPWA 3RI3A 1T8TA 1C3EA 3I04A 1RQGA 3ONVA 4FZJA 5C3MA 5EXDA 3WBBA 4FEEA 1GQQA 1USKA 4Q0MA 1E2FA 2KM1A 3QNWA 4FK8A 3R3JA 4QU8A 1H3NA 4S1TA 1XRLA 1CY1A 3M5PA 4JFRA 3OF5A 1PNOA 3B85A 1T4BA 1JFFB 4Q4HB 4WZBB 4YAOA 3TWOA 3WGLA 2G36A 2HNBA 1RVDA 4CT5A 4KO1S 2OZPA 3TNDA 4BPRA 1UKZA 2NPFA 5ER9A 3WK9A 3C3BA 1JQKA 1ZOIA 1JPUA 3LRXA 4HDRB 4WXRA 4V2UA 1U3DA 4FYJA 4MYCA 2QTGA 1QOZA 1ENPA 4OATA 1YB6A 3I42A 3AO0B 2G0TA 2EBHX 5F9FA 3GRVA 3MS4A 2EKDA 2HJ9A 2QM3A 3CLTC 4M4SA 4UZSA 4PRKA 3QBVA 3STWA 1OCEA 2FUCA 2I4TA 1MC1A 2ID9A 4OBWA 1SVLA 2AMYA 4XLZA 5LZ8A 2Q7OE 4QATA 3IALA 2XVZA 3UBMA 2FFBA 2WHQA 4ZEWA 3G88A 5F35A 4LQ4A 3EOAI 4MCAA 1M2KA 5BPFA 2HY7A 1BYIA 4RA9B 4BJHB 1H4SA 4WEQA 1Z47A 3TTWA 3GBPA 2QWXA 3GZNB 3VXKA 1MOPA 3CNBA 3QPVA 2M9MA 3FYHA 1ZX1A 3JATA 1WQ3A 2CNOA 3HXPA 4KFTA 2VRCA 1D1SA 1FQOA 3BGIA 1XCPA 4P22A 6Q21A 2FPIB 1E4VA 1S2NA 3SHTA 2I1LA 4TYYA 2QRMA 1MIHA 1FTYA 4B43A 3WMGA 1KYTA 2WJHA 2BTQA 1KMCA 3ZQUA 2PCLA 1S7CA 1TK9A 2IF2A 4DV2B 1E1CA 5CDSA 3W5DA 4BO6A 3I09A 4C0SA 4YV2A 3B8EA 1DEKA 4MHSA 3F98A 1N0VC 3AM5A 4LCEA 3UPTA 2HEIA 5E1MA 3L7BA 3NO4A 4TVBA 5KHOC 1XHLA 2XMBA 5I9IA 5DHQA 2WJ4A 1TTHA 1JHZA 1R00A 4JBLA 1NRXA 2QENA 2QX7A 1IXSB 1J22A 1LDBA 3GJXC 4TTQA 3WFZA 1R8SA 1YL5A 3ZS9A 2HF7A 1K0UA 1NW6A 3B5JA 5IM4F 4CCAA 5EJ6A 3DOOA 4LJ6A 2X6TA 1TEXA 4BMXA 3SFTA 1U31A 1JJVA 5JYEA 1ISHA 2AN1A 4DJ5X 4P4SA 2PZLA 1VKHA 3A9SA 3GFPA 3OZXA 4I3HA 1QF7A 1LPMA 2OTCA 4QUAA 4RQTA 1RPTA 2AH5A 4QVKA 1EWTA 3H5VA 3D43A 1JKMA 2VZLA 3QFFA 4PQEA 4QBIA 5BV2P 2G6TA 3PNQA 5FHRA 1OTYA 4MWZA 3SX4A 4O5AA 1U0JA 3DUFB 3RTDA 1RP1A 1XZDA 3L8YA 5JSHA 1I6LA 4O33A 5NLLA 1IH8A 9MHTA 4RSRA 4CLXA 3QE2A 3T95A 3B1YA 2UYYA 3F8WA 2KQUA 2ZR9A 4MYTA 4W8HA 4CM8A 3Q9SA 3OQOA 2E89A 4IKPA 4ILEA 2XCSB 1YZUA 2X1VA 2WTAA 3UGTA 2VP6A 4KN9S 1EK1A 2SICE 4DY4A 1P45A 3G5TA 4FXOA 2CDNA 3UBTA 4QPPA 4IXMA 4LV5B 1X6VA 3KOUA 4DSAA 5LBIA 3VSEA 2HSJA 3OHPA 1UEXC 3H5LA 1D6MA 2YRWA 3VJKA 1ISGA 1DP4A 3ZHYA 2HT6A 1L8QA 3COWA 3Q3EA 3QKSB 3TW6A 1PJRA 4J90A 4OQ4A 3THXA 3AGPA 1KO4A 4IKOA 1TCVA 2BGJA 2FWMX 3RRFA 4B75A 1M6VA 2VTEA 2L18A 2QR3A 3LL4A 5FYDA 3U1BA 2PM8A 1NVUQ 3W4IA 3KEMA 3GW8A 5EJ2A 3PXGA 1LI7A 2W4MA 1O4WA 5DT2A 4E0BA 4A9AA 1LS6A 2QVBA 2XWSA 4XCVA 2I6UA 3WLRA 3VZQA 4RTMA 1HE4A 4GI1A 5AT1A 4BKPA 2VQFB 1MW8X 4KYUA 1R74A 2NZWA 3HFGA 2Q3CA 1T2EA 4J1QA 3IHKA 1EK5A 5AXBA 1KDOA 2Y1EA 1YL6A 1R18A 1Z0FA 3D5QA 3EXAA 4U2BA 1TGYA 3DM5A 1GPNA 3HDTA 2QUAA 3SQWA 2O8CA 3B3JA 3JAMA 1M9NA 3A4VA 3FHJA 4BNHA 1ZS9A 3COVA 4BNKA 3L7JA 1P5FA 4KJXA 2JEYA 1PDOA 1TO2E 2AA3A 2OESA 4Q4LA 1ZKMA 3U4QB 1SVOA 4WBNF 1YCHA 4ZREA 4S1PA 3UAWA 2ZRAA 3AETA 1Q1ZA 3FSEA 3LP5A 1QVVA 2V03A 4MGZR 5ALQA 3RWBA 4CQMA 2PANA 4P32A 3DBRB 1DDIA 4IGIA 4K6FA 4Q9JA 4TUYB 4AQYB 4MB6A 2VFAA 1N2CE 4GWGA 2ZI7A 2X1HA 4I8DA 4P6VF 3T1VA 3OHSX 3OF3A 1DRWA 3DNFA 3CCBA 1W76A 2WWXA 3HH8A 1PYDA 1TYCA 4DDUA 1E79D 3C14C 2O0HA 4NR0A 3NUQA 4DXHA 1PR2A 1ODFA 5ALHA 3GLKA 4PICA 3RUHA 2MINB 2FW6A 3PRJA 4B2IA 1U81A 1SH7A 5JD4A 1L7OA 4L74A 1GNRA 1RE1A 4YIKA 4WCVA 1DEXA 2OD9A 3G0IA 4Y9RA 1P9LA 2AOTA 3MCVA 5F73A 4DA8A 1ZSVA 2H9AA 1GEGA 1OKKD 5JXWA 1W96A 2V5UA 4C0LA 1XPRA 1R4AA 2CUZA 3FOAA 3E5RA 3RRZA 3WLKX 2WUEA 5H8WA 1XQ6A 2VIIA 3K2EA 3OFND 4D0RA 4Z4HA 4G63A 3TXXA 5JROA 1CU1A 2EJUA 4ZHQB 4NBLA 1KAMA 1WHTA 1JIXA 3C8HA 3O90A 5AO9A 4QM7A 3ROQA 3HBFA 4HLUC 3RVKA 1CULC 4HOYA 4OSOA 1EK2A 3A6FA 4IV0A 3ZWAA 3I3SR 5TVKA 5AP9A 1T8PA 5KJEA 3O0TA 4YHBA 4PHCA 1K5DA 5ENZA 2BEJA 4NJMB 2BFEB 3WWPA 3TKYA 1XZPA 4IJ6A 3SSAA 2GZHA 1WF3A 1AHPA 4RM3A 4ZEVA 4H7JA 2QYHA 1C9EA 4MWTA 4TMWA 1EQUA 1JW9B 2QUHA 4YDHB 1XZMA 1BH2A 5E3HA 3QBJA 1MQ9A 1NZJA 2GJ8A 4Q3OA 1EFDN 4ZCIA 5HTKA 5KI6A 4CM4A 4H3VA 5DN9A 4IIFA 2G08A 2XQFA 5CHEA 5JH7B 4LJAA 3P4XA 4BZXA 2JHGA 1A77A 2FZGA 2WINI 5AVSA 3L4BA 3O47A 4J94A 1U4OA 4J0FA 1LPNA 3HKEA 1QG2A 3R2JA 4GKVA 4L4YA 1UKCA 4JKYA 4FYWA 2WU0A 5IAGA 4UQPA 4FFMA 4B8WA 5JAPA 3AHDA 2YZMA 3N6VA 1E94E 4DIUA 4DG9A 1MAWA 2H4YA 1CDDA 4RTSA 2HWUA 3KSBC 1SA0A 1TYEB 3CF6R 3MT0A 3HVRA 3HA7A 4JC4A 3AF5A 1I4OA 2B92A 3V7WA 1NBMA 5CB6A 4HN4B 1A5SB 1E2HA 2WPDD 3V8BA 4P0PB 3PFNA 5FFNA 5BYKA 4L9WA 3UA3A 4UDNA 4RTQA 2H4WA 1OPXA 1VZ2A 3WGOA 2FW9A 1U7ZA 4HWPA 2YV3A 4GQBA 4KK3A 1UC5B 2PVCA 4O2LA 3C48A 2B83A 3OT1B 4OPMA 5E6UA 4I4TA 2OG2A 3Q3HA 1VPVA 4O4LB 4HQLA 3VPXA 4BFSA 4B2LA 4WJZA 1Z3IX 1CY6A 2IC5A 2TSYB 4MQEB 1ZUIA 1CF9A 1EEXB 1M1XB 1CRPA 2PAAA 4RX1A 5DJ5A 4DIOA 5EFZA 2BDTA 4FWTA 1HYGA 2GTPA 5IDXA 1QXSA 4E6EA 1B2LA 1CVRA 1C3OB 2H07A 3S7ZA 1CXZA 3C43A 3TSAA 3VYUB 3ZR4B 4DJDC 3GQBA 1YBAA 2WG1A 1VJTA 2C5BA 1U65A 4ZMRA 4BC0A 1XR3A 5A0VA 2TMGA 2AG1A 4M1QA 2PL3A 3JARA 2M32A 4N03A 4TRJA 2Q46A 1Q2UA 4CIDA 4RWZA 3TQHA 2WFAA 1W46A 1NLYA 1SNYA 1Q16A 2ATEA 4JEUA 4N0MA 1R10A 3UOGA 2JD1A 3R8XA 3B70A 4MW4A 2C29D 2XCIA 5KTRA 2V8BA 2L2QA 3GLIA 5CNJA 3IUMA 4LZNA 1SVNA 4U9IS 3PXCX 3ZIDA 3MJRA 1QP0A 4EIWA 2PFGA 1YUMA 4R9UC 3BE6A 2P1DA 4IEIA 4JYMA 4AO6A 3A4NA 2CWDA 4L02A 2CZGA 2A3NA 4AO7A 1JKJB 3D2CA 1KF0A 3AEUA 1VTKA 3DW3X 3E35A 5IANA 2HCBA 3RHZA 1NVEA 2QPAA 4IWXA 5IKOA 2QDXA 1AA9A 2OBXA 2C99A 2AFVA 2QP4A 3FYTA 3ICWA 1US8B 5IXJA 1OKKA 1E1NA 5KMGB 3AUUA 4WBXC 1WA5A 1MN6A 4KAXA 2AYXA 2OBLA 1E66A 2BHNA 2QJFA 4ZO4A 3L6CA 2GNAA 4I4LA 4WY5A 4Y6RA 3ZE7A 4YRZA 3LF1A 5C5CA 4TTAA 3MD0A 2GHTA 5K0NA 1G8AA 1SRQA 3AEKA 4O4HB 4RYDA 2BHRA 4JR1A 1DRUA 1Q95A 2J3MA 1YHYA 4LRSB 4PLHA 3A7EA 3F7MA 5E1BA 3QU4A 5J5CA 3DMDA 3NIBA 3I8SA 3O3CA 3DAGA 4UUAA 1H2WA 1KKLA 4CF3A 3EDRA 2ZGVA 4CQLA 1JEJA 2BL4A 4FI3C 4ER5A 1KO5A 4O0MA 4LRXA 1RTKA 4CF4A 4MIOA 1C4OA 2P6OA 4KNYA 2PGLA 4R41A 1AM4D 2VRBA 3DLAA 4FJ0A 3WLFA 1OREA 1W2GA 4IINA 2YFHA 1ZSNA 3OIGA 2O2GA 1GYRA 5GZ3A 3G8CA 5FJIA 5IVPA 1CUEA 1M2OB 3DUWA 2NU9A 3FPFA 3I01A 1XL1A 4CQMD 2B1JA 4D9KA 4EVQA 5LKAA 3KSMA 1TAUA 3ZWBA 3PDJA 2J3EA 4TMKA 3UVEA 3K16A 5IF3A 1M72A 4RL4A 2J8ZA 4X61A 1P19A 3SR4A 2W58A 4WTOA 5T67A 2QLTA 2JGLA 4AUEA 3SBDA 4Q4CA 2MYTA 4JI6B 4WFJA 4ALKA 4DLZA 1T9GS 3CSUA 1E3MA 1W0JA 4QJ3A 2O8BA 3TTTA 1P5JA 3GFOA 4A6PA 3HI6A 2RBGA 1L4KA 1PFWA 2GPNA 4MK4A 4D5GA 3RFUA 2JCYA 1X74A 4URUR 3GRPA 5TGDA 3WICA 2DPHA 1A71A 1FVFA 4G1VA 1PV1A 4WN3A 4PZCA 1V71A 1AN9A 3LAWA 4ZHQF 2HPZA 1W4AA 2HGZA 2IDMA 2NQ8A 4ZVLA 1A5BB 1H66A 4A8TA 4NESA 1YVUA 3OIYA 4Z53A 4G2NA 4X7MA 2Y6VA 5L95A 2XPCA 2XZDA 5CLHA 3GPLA 1WVMA 4CTOA 2CXXA 1JGTA 4EW6A 2FWAA 3IAHA 1N7GA 5FQOA 4QUJA 3ROKA 3T7DA 3OU6A 1ZC3A 1LZLA 3EIQA 2QLBA 5EKUA 3RTBA 3CX8A 1XCBA 1QHYA 4XDGA 1CZOA 1QNLA 3QHPA 3ZGXA 3PQ8A 5B3JC 5BMOA 1SVUA 2FW7A 4WBNA 2DFTA 1VJ5A 1EUQA 1ES9A 5AW6A 2G9RA 2QBYA 1VLMA 5HJ5A 4BCCA 3WRVA 3IJPA 1UFRA 2ZAOA 3CUYA 3FPJA 3BYZA 2MR6A 1KH3A 4CDRA 2YVUA 4CM9A 4NDZA 1HG0A 2JNWA 1E77A 3U3RA 3HS3A 2BIFA 1E18A 1QE0A 2V7PA 2RGDA 5ALUA 1U7HA 4ZT6A 3PNMA 5TSDA 2GEBA 1T3TA 3K1AB 4G0UA 4MYRA 2XEDA 3M9LA 4II3A 5EMHA 4E21A 2ETXA 2HIHA 1T5OA 1XKXA 2P7IA 5D7NA 3M6WA 3VHQA 3GCXA 4RFSB 2Z83A 3FYDA 1FJXA 1O9BA 2QSYA 3O7WA 4L0MA 3ANLA 3NANA 4M9QA 2JLWA 3SI7A 5DTRA 1IQUA 1VBFA 4FOTA 2WIGA 4UASA 2J4CA 1U9YA 1QV7A 3LIPA 2EFCB 4HTFB 4O2BA 2BMFA 1XCLA 2P2DA 1S02A 4E4RA 1NGSA 5AUQA 2CK3A 1JU9A 3SEAA 4XQ9A 4CV1A 1G98A 2EDCA 2VHJA 1M1UA 2CXPA 2E55A 4F46A 1UK6A 1RWVA 3CNOA 4LK2A 4UBIA 5LQKA 3H2HA 4IL5A 3FFWA 1L5KA 3VUEA 4MARA 2OGWA 1AT1A 1ULSA 2P91A 2J3HA 5B2ZA 1KQOA 1YJ8A 2FFHA 1GU7A 2ODNA 4L85A 1V39A 3P9ZA 1LK5A 1PNTA 1UOQA 1F48A 1ZH6A 3GPIA 1YSCA 4KLAA 4DMFA 1OJ7A 5DLDA 2F9LA 1AK1A 1L7EA 1NXWA 1XHFA 2Q62A 4Q3CA 2QNIA 1WUTA 3U09A 3B1VA 4OXNA 3GVHA 3NNDA 3RUFA 4BKUA 4ZRMA 2X15A 1TEHA 3MOGA 4M7OA 4J7UA 4N0QA 4X8MA 4NECA 4YQYA 1I4LD 4MQ6A 1JDBC 1B0AA 3SNHA 5C1PA 3HTXA 1IN4A 4XOIA 4PZDA 2DEUA 3AERB 2ZIEA 4YRLA 4PAGA 4IWNA 4E5PA 3HBJA 1BGWA 5FI1B 1ACMA 5AHWA 2IITA 3L0PA 3H05A 2EXXA 1QIIA 4B79A 4M55A 1GSHA 4ZYYA 1A9XA 1QGDA 2GPSA 5DM70 2G25A 4EPXA 5TQ2B 3OQ1A 4QREA 4XIYA 2ZUSA 1JFRA 4M0CA 1C2TA 1A04A 4G4SP 2JIPA 3IIEA 5IYZF 2AZTA 1IXKA 1JHDA 2EJWA 5LWQA 3NHRA 2I22A 2Z8ZA 2Z6QA 2AFHE 1XDUA 2IV7A 1WHTB 4FFNA 4DW8A 1GAEO 2H52A 5A4KA 1JLSA 2BCEA 3OJLA 4NAVA 4QSHA 1G4HA 2RK6A 2C95A 4YV1A 2I78A 3H1PA 3TQQA 1G3IA 2EGHA 3TJRA 5JZOA 2IPAB 3QKSA 4JVSB 4L51A 5K0BA 2DM6A 4PX5A 4LSWA 2FVXA 3OLYA 4I7EA 4CETA 3ZI4A 3I61A 1DCTA 4PNHA 1UAGA 2AE1A 2BFWA 3QUCA 3G9TA 4AYXA 4JI2B 1WQ1R 4MUJA 3TTUA 1QHNA 5C18A 4LGMA 2ZUEA 2O4UX 2BI7A 4B2PA 1IM8A 2JLBA 4DUGD 4Y2UA 3DEJA 3HG7A 3HN7A 1I1NA 1UXKA 1WLSA 3TZ6A 2WTNA 2FZ5A 2GCGA 4IVNA 5C8VA 3JAWB 4O2RA 1NBWB 1ULZA 4UM7A 1U0FA 1YVDA 2IXFA 2ST1A 1Q0RA 3H3FA 4W6ZA 4DCSA 4ID9A 2PZ8A 3SYMA 5K8LA 1E4OA 3OX2A 4ZCPA 2D5AA 5TS2A 3DFFA 3EJ6A 4LHZA 2WA1A 5SYNA 4OUDA 1NP7A 5AVZA 3GLGA 3VUFA 4UDXX 3RWOA 4RZQA 2KI5A 4EYOA 3KU1A 4FI3F 2TS1A 1NMQA 1IFXA 1L6RA 1ZJ5A 1PUIA 3P4YA 4QXPA 1P44A 2EG5A 4FT4A 5DYYA 1UBOS 2II6A 3SIRA 4HUTA 2JIMA 2DXIA 3FW1A 2QUJA 4I5EA 4DOMA 4JP5A 1Q11A 2EFHB 3M4JA 1MEEA 2OHJA 4OUKX 2QQGA 1DJLA 2J9ZB 3HDYA 4JODA 4W5HA 4NXNB 2W8BA 2ONKA 4BMSA 3T54A 1L1RA 2W71A 5A05A 2Q50A 1E2UA 2CL0X 4GXNA 5DI3B 1QHIA 2NZ2A 4CGYA 1CERA 1ZA1A 4HN9A 5EA2A 5ENVA 5KYXB 2A58A 2GARA 3ZV6A 1WXEA 4KLCA 1A9PA 1K27A 1LWOA 2ZJAA 3T41A 4DBLE 2G7ZA 1RI1A 3I83A 4G84A 1IBCA 2ADOA 1O8BA 2XCRB 1IRIA 1YCDA 1TKAA 5DN6D 1DO2A 4PG5A 5E4JA 4HDQB 3ABZA 3OEHA 4BAZA 3KALA 5GINE 1DAPA 1A8HA 1UQTA 2XUZA 4JL6A 4RK1A 4LOAA 5SY9A 5A5EA 2Q1SA 2YTZA 3AM4A 3H1EA 4GPAA 5FBWB 4DCTA 4YHHB 1IQ0A 4EB6A 5AW2A 5JI2E 2WC1A 2AYZA 3GEIA 3DC2A 2JAWA 3E7DA 3O84A 2J9FB 3NP9A 1Z5NA 2CLEB 1P17A 1T3LA 5JNVA 2OXIA 3ABRB 2PD4A 4KXLA 2QT1A 4HEQA 3BXHA 2W00A 1JYFA 1ZUHA 3OPNA 3GFFA 2JFPA 3R5HA 5C5EA 2E2WA 5ES3A 5AVUA 3MIIA 4KO3S 4KLZA 4WFQA 2H1OA 1L2TA 4KWIA 5JT1A 3E7PA 4L2IB 5C7LO 2ZVQX 1E0KA 4FFBA 2Q5CA 3BOSA 2QRKA 3HL4A 1VI5A 3LPAA 1RMYA 1OE0A 1EA7A 3FZQA 4G36A 3CF2A 5D5QA 2QG9A 4YUYA 3AH8A 5FOXA 2PTGA 1QFZA 3AFNA 3R0JA 1BN6A 4ZYTA 3N0XA 4JZKA 2WIBA 2ZS7A 4CF5A 2J7PA 1R1DA 1P7ZA 1FUUA 2Z5GA 4MV6A 3KIPA 2H0AA 2MSLA 4IUCS 5K3AA 4DV3B 1O9GA 1FW6A 2QTRA 3HUFA 3MT7A 3HKDA 5BY2A 3OP1A 3NWEA 1GTZA 1ECFA 1IWBB 1N6IA 1JZQA 1OWNA 1V95A 3VBEA 1YKGA 2FPXA 3ZWCA 1K3FA 2YOGA 3G02A 1WZEA 4KIWA 5GONB 4ACAA 2B25A 5H4GA 3HCNA 3TLZA 4N5MA 1M2GA 3HB4X 4BB9A 1DRJA 2WWHA 1U2GA 1P0IA 3P0IA 4I50F 4PIVA 2PMEA 1Z26A 4MW5A 1PE0A 5CIQA 4DLPA 3RK0A 4J16C 4IBOA 2EP5A 1MOQA 3I01M 3S8YA 4LIPD 5DE3A 2VJAA 3PQ7A 1JSZA 4G1UC 5KWSA 2J41A 2P9BA 3IVMA 4KPUA 1DMSA 3IDAA 1OZFA 1RWOA 1Z2CA 2B94A 3OC6A 4WKGA 2DWCA 2Q2NA 2BHLA 1FS5A 1UEJA 1V2GA 4P1ZA 4PAOA 3KFXA 3HM9A 4TYWA 1I3CA 1F2UA 3GUZA 5HRUA 4FD3A 2GCPA 1YQUA 5CVDA 3BSFA 3VHRA 2FETA 3LJKA 7MDHA 2KHZA 4DAOA 1TDJA 2O0LA 1Q0PA 2YXBA 1YRLA 4GX5A 3ADPA 4YQFA 1USGA 1XTIA 2D5BA 1FDVA 2R1TB 3S2IA 3L4KA 2FE4A 4LVUA 1HK7A 2J5RA 4E2WA 4F71A 4ZI2A 1YI8A 3FPBA 4MR8A 3QXJA 4I2NA 1DJOA 2YXDA 3VZBA 5CM9C 2QBYB 3F74A 1L8LA 1N0WA 3KYCA 4Q21A 1SXIA 1PG0A 3Q3VA 3SIPA 3GJTA 3FNIA 2P2SA 1M1YE 5FOTA 3LKBA 4BE4A 1RRFA 2XQVA 521PA 2EJBA 4LGYA 5L4NA 1CUUA 2HZ7A 2IZ0A 1T9DA 3A6GA 2AXQA 3EFHA 3WYGA 1L5LA 3IP5A 3RUCA 1XL0A 3TX2A 4JMPA 1Q7BA 4TSRA 1I32A 4RVUA 2HQRA 1FSSA 3CC8A 2BBTA 2DSNA 1DX9A 4I4IA 3OBBA 3DOHA 4HQNA 2OLKA 1M5RA 1VHJA 3K32A 5DO9A 1R5NA 3CKLA 3AFGA 4TMXA 3WG9A 5JI3E 4FD2A 2XMGA 1OYWA 3MJSA 1K08A 4OFZA 5IDQA 4NZ9A 4G5FA 1BWSA 1DBPA 1E7QA 5CHYA 2CXSA 3SM3A 3WKBA 2HA7A 1LKZA 1TX4B 2W6MA 4UTOA 5J58A 4KXXA 4MPTA 5H82A 2NLOA 5HQTA 3K4QA 2XYHA 4D0GA 2GN0A 5GOZA 2HA6A 3R5JA 4G9GA 2DY0A 4IJUA 3DJYA 4LMRA 3V2GA 1MAUA 4U5XA 1XZKA 4B3XA 5HQ3B 1F17A 2QD5A 3C1UA 3EXHC 2D2VA 5K0JA 4I46A 1JLKA 3GRFA 4PQRA 1NF3A 4Q1EA 5EQDA 1QO9A 3AX6A 2QYTA 3GVPA 3NOXA 4MKXA 3JAKA 4NJEA 3ZU2A 1KWKA 3KETA 1NBMD 2FR8A 3CN7A 4DIMA 2PUAA 4I50A 2NAPA 1UBHS 2O50A 4PZAA 1GLNA 4JSRA 1KEVA 4R3WA 4EI8A 1C1DB 1TJ3A 2QZ4A 2P2CA 2XNCA 2WF7A 2YWGA 4N5DA 1PJQA 2EKZA 4PC1A 4R8SA 5AKYA 4E2ZA 4F97A 2D7DA 3C45A 3ODGA 1G3MA 2P6UA 2ZRLA 2HB6A 3H83A 4C0JA 3CF4A 3O7MA 4QWMA 1J2RA 4OGWA 1RABA 4L8WB 1FQJA 1WUIS 4UM8B 5B6IA 4DDWA 1OH5A 4TS4A 2F3QA 4WRRA 5CIYA 4W5JA 4PINA 2J30A 1CUVA 3HZRA 2ZBFA 1RRMA 2HLPA 5A7HA 3WAJA 1V3TA 5AJZA 3ROGA 3V2IA 4UVEA 1W34A 4GMDA 2A67A 1OROA 1LU9A 2IEAA 3SZUA 3AIIA 1VL1A 2JGAA 3IMCA 4OX9B 2GEKA 1AKVA 1X1QA 1ZWLA 2BZ1A 4N5NA 1A88A 2VZEA 4XD7D 5GM1A 5A6SB 3U7QB 3ZHTA 3IV6A 1T3HA 1H2YA 1IZZA 2B3DA 1JR2A 1FJ2A 2Q7DA 4C87A 5JNLA 1I1OA 4D9NA 1ADYA 3KJQA 2CD9A 4DR6B 1AKYA 3L40A 4MJ3A 3D81A 4TWZA 4WKNA 2C8KA 1KJQA 3FWKA 3IOMA 3LMKA 3Q5EA 4YMGA 1NXOA 4RENA 1TCAA 2XOXA 3PTZA 4HLUA 4OYLA 2WIDA 2JI6A 5EYPA 4B4WA 1P4HA 3KUDA 3T0GA 1SC6A 2ZT7A 1OLXA 4O59O 3AI1A 4CQNA 4HNSA 4RZ3A 5BRAA 3RJMA 1PVVA 5K3FB 5DNYB 2BN4A 1FLDA 3EQZA 2FUNB 5AUPB 1JPNA 4LNHA 1J4AA 3UMMA 1IDOA 2QGZA 4CQMB 1I4TD 1NAHA 3BRSA 3OEED 2V7QD 3O4HA 2WFLA 1XLUA 4UBMA 5EIBD 3WDKA 4NBRA 2QTWB 3VC2A 4IQGA 3FPHA 3FBWA 2B4YA 4FLMA 1L7RA 1M33A 1MB3A 2X3UA 3R3SA 4KODA 4RIEA 5EXXA 2CNDA 3UKJA 5F7OA 5LMZA 3U4QA 4TKUB 4TWRA 5CDHA 2WWIA 4II7A 5EINA 4C7XA 2RKWA 3VR5H 3RYHB 1NR5A 1GCOA 4ZCRA 3V1UA 2ANCA 6REQA 4IQFA 2OBMA 4DHWA 3SJZA 3HDQA 1CEQA 1TIKA 4KQMA 1UZLA 3G1WA 1T8UA 2IYEA 2JJ2D 3IPCA 3LX4A 2KLHA 4MYHA 5K2MA 1H2FA 4NU6A 5ESRA 1WMEA 4BGVA 3LLCA 4BV9A 3CVUA 1KVUA 1VKZA 3OE4A 3ANNA 1E1QD 3WSWA 3MBKA 3Q2KA 1XCGB 3MWDB 4MAFA 4Y2SA 3JPWA 2C4TA 3WMEA 3GVIA 4D0SA 1YL7A 2H7CA 3TOZA 1KR5A 5KKNB 3PNOA 1NNSA 3H04A 1DAHA 3D7MA 5C4MA 4FYKA 4HWSA 2C2WA 3E3LA 3QKWA 4HSGA 4YJFB 5JMPA 3VR3D 4D9MA 2GN6A 3NHPA 4EO4A 2V1XA 4TM8A 2ESRA 3DOIA 2P9YA 4BEJA 1YQTA 2ZSHA 4O29A 4YONB 3OZDA 4GI2A 3M82A 2FSSA 4MV8A 5AKEA 2WWGA 3RUDA 3I9LA 2G82A 1WZNA 4Q1FA 5E9AA 1VLJA 3QTLA 4HSEA 4L3VA 5EE0A 5EWJA 1KK0A 5IK2A 2BMVA 3V8VA 4G6ZA 1X42A 1QO0D 2EL9A 2IIQA 4JR2A 4BMZA 2GH1A 3OMXA 1V1RA 4J43A 4QYSA 5AIBA 5EIWA 1V26A 1ZN8A 2LGJA 1TLTA 4ZVUA 3CE9A 2X19A 3WGKA 1YHNA 3ZWVA 1Y7IA 4YV0A 1VA5A 1OA1A 1Y6ZA 4RVDA 1WDMA 4GNKA 2I4LA 2QRVB 4KEAA 2XNDA 4EB6B 4YRSA 1TA9A 3FFXA 1IZ9A 5AI4A 3WIVA 2JAQA 1EESA 3D6TB 1NQAO 3EMDA 1GGFA 1AKWA 1T5TA 2R8EA 3KKLA 3H0CA 5DBIA 3RODA 5JJ5A 3AF3A 4DVGA 3ZDBA 5I51A 5SY6A 4AZ3A 3O4IA 3L6RA 4BLRA 1L9KA 4FHDA 2J07A 5CH8A 1Y5MA 2NYAA 4ZALA 1OGJA 1F14A 3IAM6 3TNLA 3UK2A 4LJYA 4BP1A 4ZJPA 4YCMA 1MG0A 3MWDA 4CKCB 2PGXA 3ZD7A 3M89A 3UXMA 3G82C 1EBUA 1RWKA 4LUCA 4AJNA 1Z4OA 5ANRB 4P93A 4PRLA 4P4SB 5HILA 1PEKE 2V7XA 3AB3A 3SC4A 1RJDA 1DNPA 1RPNA 1U2EA 2Z3ZA 1NU6A 3M5CA 5JH7A 3OZWA 3K72B 3BGDA 3Q5GA 2OGSA 3H1FA 4NAHA 1TYAE 4LGVA 4PFQA 4DMGA 5KU1A 1IN8A 3OPXA 4ZEXA 3DE1X 5HUHA 2P2LA 4CM4B 3S0JA 3ITDA 3BA6A 4JA2A 2QB5A 4L4SA 4OU5A 5THXA 5JY6A 2WTUA 4KHPB 3I9KA 2QRQA 3IAS1 2IUEA 1OY1A 1ZIXA 3T3PB 2V8OA 5A5FA 5DGXA 1I8TA 4R9SA 4CR8A 2UZ3A 3TM4A 2F43B 3EDMA 4XZ3A 1RLTA 1X15A 2Q7XA 1WZUA 2XXJA 3MF4A 4AULA 4NG5A 1PWEA 1SHTX 2N42A 4QT4A 2P0AA 2R79A 2C3MA 2ZI4A 4MR9B 3CX3A 3RVQA 4QKQA 5JC1A 4BDSA 4B84A 5CA1F 3NHKA 4MICA 1NJ5A 1ORWA 1UK7A 2CUKA 1OIWA 1K97A 1NR7A 2GK7A 2P9ZA 3EHDA 3DPSA 3E8MA 3L05A 2ONJA 3TO5A 3WRWA 1OB5A 3JALA 2PGOA 3DEYX 3OOEA 4OAOA 5BN4B 4GS5A 1GAWA 1TYZA 4X20A 5DXJA 5FBLB 2D54A 4I14A 1KI6A 1H9CA 3DUFA 3K53A 4N3GA 2BMEA 3F9RA 3KX2A 1EM8B 2J45A 4P08A 1FA9A 1G20B 4HRYA 1OLSB 3SZ3A 1Q3KA 4C88A 1EDZA 3BTOA 1K7FB 2A1UB 4I6JA 2QJRA 3OTIA 3QG1A 2V6IA 4QECA 2GPTA 3EZ6A 8OHMA 2NN3C 3TQOA 3EMBA 2JFNA 5AFSA 4AJJA 3AI2A 3LPCA 2CXOA 2EW8A 1JR6A 1SXJE 3D7NA 3H11B 3PPWA 2R44A 3MWLA 4J16A 4AMZA 3A1SA 2HI0A 3LKDA 1FU4A 2YN0A 3NHBA 3TVTA 4DJEC 3A8TA 5JNRA 1IJKA 1DC4A 2D0OB 3IVRA 3FG9A 3NGMA 2WOJA 4RKWA 5DCWA 3M6MD 4CT0A 3UUFA 2I9KA 2ZJOA 4B7XA 1GGNA 2Q9BA 3LHIA 1N5DA 4O1MA 1FDIA 2IY8A 2Z09A 1BEUB 2UV8A 5D3KA 3RE1A 2X8AA 1BCSB 2QM7A 2XOKD 4GF5A 4MLDA 4C7BA 2J6BA 4YRFA 1K66A 2G04A 1RYHA 4B3RB 1J09A 1TAQA 5CA0B 2XAAA 1OI3A 1V1RB 4NY1A 4LYJA 3V48A 2G5GX 4BMOB 1T36B 3DR5A 3EBLA 3W5JA 1KEEA 1AZSC 1B6TA 3FAZA 4MW2A 1OYVA 3TAUA 2HHAA 3AUFA 3NDPA 2XXAB 1FFAA 1U94A 3TH5A 3BZWA 4B7AA 3E05A 4ML3A 1IL0A 4CMEC 4G1BA 4UOQA 5BW4A 1ACJA 3CJQA 3P2JA 3N8IA 4EYGA 4MDFA 4GL2A 2DPGA 3ZXXA 1XMJA 2JCVA 2ZWVA 3T9CA 3QIVA 3B7WA 2IH2A 5EVJA 5HQ3A 1Z56C 5JBQA 3SC2A 2JDIA 1YR6A 3GWZA 1ZVMA 3LT1A 4O4HA 5T8KA 3DOEA 3IXQA 4G0VA 3DCIA 5TC4A 3ND9A 4BXOA 5IJ0B 1BA2A 2IYZA 4AX8A 4RBNA 1DBIA 1RRGA 4ABYA 3BFKA 5K3CA 2RKBA 2AG5A 4FYXA 2P9TA 5IXYA 5C31A 1K6MA 2E7ZA 3K5PA 4C07A 3UNXA 1XPJA 3HUUA 4S0XA 5DYGA 4LDZA 2CFOA 4GMFA 4CIWA 4M22A 1VP9A 1F8UA 5HKLA 2NSYA 1EE9A 1JTVA 4IICA 4NCXA 5EXEA 5A7GA 1KSJA 2HSZA 5EKSA 4LBWA 4U4AA 4UCXA 2QE6A 4RK5A 3WHIA 5JFOA 3KYDB 3VA7A 4MRPA 3ETLA 1BXRA 1EVEA 1MCZA 3KQYA 4I08A 4K5QA 1H4QA 1J39A 5TARA 5DV9A 3W0LB 5KTYA 3I32A 5JSZB 2OHHA 2FXVA 3NOQA 3K1YA 2NYVA 3U7QA 2OV4A 1XZQA 2LD4A 3IQDB 4J76A 3D54D 1WD7A 3TIGA 4IHAA 3ZBQA 2Z8YM 3KBOA 4MQ5A 5IVKA 1W9HA 1ULTA 4Q9NA 3KXIA 3L84A 1II8B 3RSSA 5IRCD 4Z4QA 1XQ9A 2WD8A 3VAAA 2KWIA 3K70D 4ZRDA 4X6UA 2KYRA 3AILA 3I76A 2BM0A 3Q40A 1R9JA 1KAQA 1C1XB 2ZSJA 3QTTA 4XWYA 1ZGHA 5JPDA 2X8JB 3OM0A 1N5IA 3R5TA 4FEGA 1PR9A 4GWLA 3UJPA 3INYA 3HJCA 3DCJA 3IUYA 5WRFA 1SK9A 3DMGA 1K4MA 3MERA 1J5EB 3INGA 1GPLA 1V6CA 5IMSA 1T36A 3BTSA 2DZDA 3KT0A 3DL2A 3IC5A 3QLJA 4H18A 2OVFA 4HGRA 4LBVA 4O2AA 2PL5A 3P2EA 5H16A 1PLLA 3A4IA 4AUMA 4YT4A 4PV7A 3D7KA 4BKMA 2XQIA 1KK1A 1ZJYA 2DVMA 3AI7A 3GEBA 2X3YA 4R0NA 5BOVA 4B4OA 1NVWQ 4FS3A 1O94C 2A94A 1DJNA 5FV4A 1ZYUA 3CY6A 1B6GA 1XNJA 4BMNA 1Q6ZA 1MJNA 4Q18A 4LF5B 2JGDB 1J49A 4BOYA 3LT0A 1ZN2A 4JROA 2QNBA 3ZEAA 4AXBA 4LHEA 1QFSA 3ZLJA 2EATA 3PE6A 1H8HD 4ZTBA 1DIHA 1FJHA 3MINA 1ZESA 1A8IA 2IEDA 3CXRA 1EK0A 2PWYA 5AHRA 1O54A 1ND5A 2WDPA 3IPRA 1OHHA 2V6JA 4AYWA 5MHTA 2BTQB 2H5JA 2WWWA 2UUAB 3D31A 4CIBA 3NRCA 1SU7A 1UP7A 2R65A 3LUFA 4M1MA 5AKXA 2NU8B 5K8JB 1HH4A 3NJRA 4QNNA 1C29B 3H99A 1E0JA 3KEFA 2AF4C 5JCJD 4BGDA 1Q7GA 1QYIA 2XT9A 4OHOA 3A6PC 1N6RA 1GCIA 3M81A 3TSYA 3QMWA 3CO5A 1AH2A 1WXIA 4Q9DA 1LLFA 2JFBA 3CW8X 3PA6A 1Y1RA 4C6SA 5K01A 3LU1A 4LYGA 2JFHA 4PO8A 3ZYCA 1XKTA 1OXMA 3QENA 4MTLA 1GSIA 3VPCA 5KCZA 5BWLA 1YACA 4FE3A 1WW3A 4D25A 3V5NA 1ZH8A 2P9FA 4OXYA 3EA4A 5C4IA 1FP4B 1W85A 1A4IA 4GM0A 4MTCA 4GOKA 3JD2A 3SEFA 3OZEA 3ZNNA 5I01A 5KVCA 3R23A 2GN1A 3S81A 3UMFA 2W4IA 2GILA 3ZN2A 5F3DA 4C0KA 3OD1A 3X0DA 4FNAA 1NTRA 5E8RA 3PEVA 3G9ZA 3ZXYA 1SQGA 1RKXA 1CUHA 4ZO9A 3F6RA 1XK7A 4FSDA 2PNJA 4I9NA 4NULA 4CKWB 5LC1A 2IDZA 4WIAA 5I9SA 1N5LA 1MBZA 1YFKA 2PUJA 3OUUA 4IJVA 1PT9A 4DZRA 2F8MA 2OLEA 4C05A 5JCOC 3DKPA 5KYWA 3HWSA 3AU8A 1O08A 3E03A 3HP4A 3TZQA 5J4KA 3E7WA 2FEWB 3TECE 2FRXA 1N6OA 3JR7A 3WBKA 4KQJA 5JASA 1ZICA 1TLFA 3ZC3A 1T24A 1XCOA 2GVZC 5EMNA 5SICE 1R6AA 1QTNA 2D1RA 2B8JA 4U1RA 2X0FA 3A0RB 1GR1A 4CKCA 2QPTA 5BN5B 4AXXA 3FROA 4N39A 3QPUA 2FCAA 3LQRA 4ZC1A 3T5GA 1MQAA 2XNJA 5JHHB 3T1YB 4M7RA 4FQ7A 3UHPA 1V47A 1Z73A 1SKMA 1JFTA 1X2EA 4F3KA 2SCUB 3LVBA 1NLUA 3ANTA 3DCYA 4MQ4A 1YIAA 5UKDA 1YONA 5JAQA 5B12A 1II8A 4R7TA 1G4UR 4W7IA 4DIBA 9LDBA 5T7BA 3OCYA 1H8HA 3KCQA 2HCRA 2C96A 3IJEB 4YXWA 1OGIA 2BGTA 1Y37A 4DMKA 1WF6A 2FPWA 5A1TA 1XI2A 1SBQA 3I9V1 4W7HA 4YFYA 4L4XA 2PRZA 2GO7A 1THTA 3QVGA 4WOPA 5BNFA 3VSBA 3AKCA 3IHTA 1G19A 4BKRA 3AVWA 3HI4A 2QLJA 1G2QA 2BD0A 4OQDA 1UWLA 4OXXA 3FLEA 5IAAA 2GD0A 3ZY4A 1W19A 1TZJA 1V5EA 2DFVA 2H06A 1MLDA 5FBQB 4Y1GA 1XYYA 2CC2A 2FZVA 2Y1LA 3A11A 3DPIA 2DFKB 2O07A 4BAUA 5LXTA 2YY7A 1HQCA 4F06A 2F9MA 3CSDA 3EZ9A 3TTVA 4GYJA 4LW8A 1PJSA 2D5LA 3ZDXB 6NULA 1FW8A 3HZZA 1T8RA 2ZSAA 3LS2A 4TZ6A 1A2QA 3A32A 4CTJA 2KB0A 2WTBA 2ZI6A 2IBSA 3KZVA 2VH5R 3KR9A 3GFGA 4K3UA 2R5FA 4I1SA 5TMPA 1ZK4A 2H1LA 2NG1A 1BGVA 1KMHB 3H7AA 421PA 2B7BA 1ELOA 3B9PA 1LI5A 3UMRA 1JEYA 4C0BA 4C2AA 5AKHA 1P61B 4D9GA 1E1LA 5AVJA 3NTOA 1FU7A 2VHZA 3LUDA 3R74A 3NASA 3F0TA 2ZJZA 4QPJC 2B34A 1MX3A 5EIAA 3ENQA 2C7GA 4TKLA 1SXHA 5AJTA 1CQPA 1PL0A 1VJ0A 3V1TC 3L8DA 1L4LA 4QAQA 1K9SA 3PYXA 1Y9DA 2Z2ZA 2HMAA 3C3YA 1DDGA 4EFDA 5KQSA 2AOTB 1VFNA 2ZITA 4LGCA 4XD7A 1J2TA 3H5TA 4D5EA 5FV7A 3EMKA 2RHRA 4V3BA 3QU5A 3MRTA 2PRSA 3DYBA 4FBGA 2AMVA 1OT5A 3ASYA 1WO8A 3B20A 4H31A 4UQLA 1QGAA 2QJOA 2IV2X 1UDWA 1EAYA 1QYWA 4DNOA 2CDRA 1KL7A 1HT1E 1U9IC 3H0EA 1EWVA 2X7HA 1WP4A 3K0EA 1GRNA 3OAAD 4GT1A 4ZV9A 3HU3A 1QYXA 2HO5A 1RAAA 1U8EA 4W1QA 3PDUA 3X2SA 1CHDA 1RVV1 4O4JB 1AUOA 2CXRA 2H6EA 3V3KA 5C46F 5CXQA 4BFLA 1Z4NA 1T6ZA 1I2ZA 3SHFA 2A9FA 3V6MA 2JIBA 2ANBA 2QUIA 2V4UA 1RCFA 2WZBA 4HD8A 1AQ6A 4DQVA 3H3XA 1CIVA 4X6YA 5JJBA 1RKBA 5CH3A 3BBLA 3L0ZA 2DBQA 4NEHB 2WQ6A 4D02A 4ZYZA 3HEMA 1F7VA 3L0CA 2G9NA 4N6GA 2V6MA 1P2FA 2A1IA 4CFZA 4WZZA 2GN4A 3R0IA 3CUVA 1Q1EA 4Q3NA 4ANFA 4HGOA 3CRMA 4I99A 1U7XA 1O96A 2PUBA 1LQTA 3C6QA 1Q7CA 3G79A 3PEWA 4REMA 1N8SA 3QVGB 3F9CA 5LZ9A 2O20A 1LK0A 2RK3A 3E1GA 5JTTA 5AICA 5FBKA 2CUTA 1YDGA 3L8ZA 2E4UA 1P2SA 3LT4A 4BECA 3QEMA 1U2DA 4II2A 2X4LA 3S55A 4KVAA 5AVQA 5EG5A 1LVGA 1S2MA 1GILA 2Z2JA 1Q77A 1SHKA 3NVDA 4I6EA 4RHCA 3FKSD 1KEPA 5JCXA 3K35A 2YV5A 3FUTA 1Y9JA 3IKLA 1XD9A 2ZR7A 1E1CB 1SBTA 3Q9NA 4PSAA 3HWX1 2TECE 3C8MA 4KPGA 1PBNA 4W9RA 5JMOA 5JCJA 2PWZA 1U80A 1SOAA 1LV7A 2Z5LA 3Q7TA 4WLFA 4RC9A 1MB9A 1BS2A 1L5RA 2Y93A 4AK9A 5D85A 4BP9A 2XUAA 1KOFA 2EKLA 3N39C 5ECYA 4DB2A 2F3UA 1QP8A 3IX7A 2DWOA 2FF5A 3KUUA 4YI3A 1GARA 2QMYA 4GUAA 3L82B 4HEJA 3ZZUA 4CMGA 1S8OA 1U0BB 4KGXA 1H4TA 1MRSA 4E7PA 1HDYA 2YMLA 5D86A 5KDDA 2J6CA 1X94A 3JWEA 3RRYA 4B2YA 4DKXA 5EHQA 1OBHA 4GLOA 2CNWD 4YO7A 4YREA 3F4LA 4B83A 2C4HA 2RIPA 4FIDA 5HDQA 1NIPA 5JEEA 1X7ZA 3CNNA 5KWIA 1D9ZA 3T7IA 1GSOA 3RJ5A 1N9GA 1NPDA 2WJIA 3MTAA 2PRJA 3NTXA 1NMSA 5F2OA 4CL2A 3UK6A 2O7SA 1SY7A 2AMJA 3CNHA 3FMFA 2GJKA 5L3ZA 4WESB 1CP3A 5LOVA 4JJ7A 3H42B 1S2GA 4O2AF 5IAJA 4ZGWA 1GTJ1 1B3BA 4WKBA 4OHRA 2P0YA 1C9MA 4BVLA 1XCMA 3LCUA 1VQ1A 2D00A 4G25A 4D99A 3JQ9C 2REOA 4HNUA 1RFGE 2VF5X 3LQ2A 3WLNA 1HLFA 2G72A 2R8RA 1JXOA 4NU0A 5CA1B 4KDFA 2Q3LA 2IZOA 2P9JA 3HXKA 3UPDA 2ODTX 3MLEA 5MN4A 1L6IA 3CLTD 1TOAA 3PGXA 4NMWA 5EPEA 3WLQA 3GLFA 3VC1A 3BJEA 3OJOA 4Z8YA 2J3DA 2JGEA 4U9HS 1GNVA 3GH3A 5H0IA 1CS0A 1JVNA 4M60A 5BT8A 3EJWA 1MA0A 3CTPA 3EZXA 4MAAA 1X70A 4ROTA 1VKRA 1HLPA 4OXQA 3ZD8A 3HFSA 1NASA 1VE6A 3ZW7A 1EP3B 2BCGY 1ZZEA 5LFAA 2VRCD 3REGA 1XZ8A 5K0TA 1W8IA 3KE9A 3VV2A 4HVAA 3W8FA 5KJ1A 1MV5A 1Z62A 4RVOA 1N3LA 3Q72A 5LSAA 1NM5A 4ZZ3A 1RZUA 1M5UA 1TW2A 1XF9A 1OX4A 4J4BA 3V7UA 4UCQA 3V4ZA 1PTJA 1E3QA 4E2FA 5EJFA 2SECE 4ZT2A 2O3JA 3I0ZA 3PIIA 2VYND 3B78A 4OBEA 3GL9A 4BBAA 1SZJG 1X80B 4Z9AA 1DC7A 2RGNA 4LC0A 4XVUA 5HX7A 1R12A 5HKAA 5IH7A 1R66A 4NPAA 1K3UB 5KTKA 2QY9A 3RC3A 1QQBA 3A9UA 4PF1A 1TQ2A 3BWYA 5DF1A 1VIYA 2Y66A 1XTZA 4NOLA 4MGHA 2QL5A 5IKXA 3WNDA 3HJRA 3ZK8A 1FFGA 2PSSA 2X0NA 1GTL1 4UVGA 1UBJS 5IC6A 2JGFA 2PSFA 4QO7A 3R5XA 4NATA 4Q19A 3EUFA 4JFAA 4JB2A 4KTVE 4QQKA 2B1RA 1T1JA 3GDHA 1FFWA 1X7GA 3EUEA 4TMFA 4X6LA 3TOCA 3GR6A 2J0VA 5AW4A 1YV9A 1RADA 5ALPA 2G9UA 3AJAA 5IBPA 5LIPA 5CLQA 4FEAA 1ZGAA 3WQQA 3LYUA 1JJFA 2HPAA 4D57A 2AXEA 1A4XA 3OQHA 4CQLB 5L3VA 3H16A 2ZYTX 3F1KA 3KKOA 3H7IA 3NBMA 4C2BA 4F2PA 3DAYA 1XAIA 3KXLA 3RIXA 2PR2A 1ZL0A 2ZU6A 3ZE8A 3DDNA 5AMXA 2E6KA 4IZHA 3T9EA 3CF4G 3INRA 4EAAA 4K0RA 4A4DA 5IJ9B 4FXPA 4CG3A 4F0JA 3EIEA 1NQXA 3LLVA 2FEPA 1CY2A 3VI3B 2HCJB 2X76A 3P7MA 4AJOA 4IVQA 4JQOA 2WAAA 1ZI8A 2I7DA 1N5JA 5I9BA 2JRLA 4YRQA 1JLRA 2ZETA 2Q8PA 3OF2A 1DBSA 5JR3A 4RD0A 4PFKA 3GBSA 3DKIA 4YQEA 1ZRHA 3PT9A 1PTKA 4Z1OA 1YOBA 3EZLA 3ML1A 2OMEA 2ZR8A 2FZWA 3KHUA 4XIFA 5FXMA 1N77A 2PWBA 4DC0A 3CO0S 1RCUA 1N36B 3FX2A 1PEAA 3TCXB 3I2JA 3RU3A 3PXXA 5JISA 1GU1A 1ISMA 1UKVY 2Q0XA 1L7QA 2HSGA 1WKCA 1FMLA 3IT2A 4M99A 3R40A 3MWKA 5U4XA 2H92A 5ILQA 4N82A 3EAQA 3TG8A 1PHPA 1JYEA 2R8ZA 3DBVO 2P65A 2BGLA 3AVOA 3KZKA 1U2TA 2FWPA 2AOVA 4INOA 4ZAXA 4BATA 4HAYA 3KOMA 4OHZA 3W78A 1FXWA 1EFAA 1PLJA 4TLDA 5H81A 3ANYB 5LXTF 5EZYA 2YZGA 4M1YA 4RV4A 1HEYA 1T0BA 1N2JA 4S24A 2X1LA 1R6TA 2Y27A 3SC2B 1QE5A 5JXHA 1NA5A 3RFXA 4D97A 1YASA 3FBGA 2D0IA 4U7HA 2GM5A 5EWLA 3MPUA 3CR8A 4K26A 2LXNA 2YHUA 4R9RA 3B1FA 3M4XA 2VDOB 4DA4A 4L75A 1JQAA 3ZWQA 2V3VA 3UWMA 2ASEA 3DA8A 1T9GR 3EH1A 3G0BA 3LQ4A 2R6HA 2BKEA 1LH0A 1GYQA 2V9PA 4QGBA 1LLDA 5ERYA 3U3JA 3T7JA 3HJAA 1C3LA 4FZ3A 1YZHA 1O6FA 1B42A 1VBNA 3P2OA 4LMBA 4MJXA 4G01B 3LWDA 2RHJA 1CVLA 2OCPA 3M9XA 4M1SA 4UDOA 2JH8A 5KJ6A 3AYZB 5ELLA 3TQTA 4D41A 1V11A 5D01A 1BJTA 1JQ5A 1RQPA 3D7SA 4UUBA 5CRIA 4KHZA 6YASA 1JRLA 4WERA 1CETA 2O2JA 3RVPA 1JEOA 4XSVA 1BW9B 5KTTA 4MB2A 1E3LA 1PX0A 1CK4A 4H0CA 4N0DA 2RI6A 5C7OO 5K6TA 5KQRA 1Z0KA 2BEWB 2GB4A 1L7MA 2K2WA 4QBFA 1CYEA 3RT1A 2ZI5A 2P5TB 5JSKA 2OP0A 4Y2QA 1HMPA 1UPUA 1KNXA 1F6DA 4JLAA 3UC5A 3HXTA 1T5HX 1UP4A 4TQ9A 1Y4UA 5IJ9A 2D1YA 1OFHA 1YS6A 4N12A 5D00A 4DCMA 3AM1A 5BYBA 3GDOA 5DRTA 3LFHA 2YINC 4AN4A 3FKJA 2ISSD 3EY4A 2JEZA 2PPVA 4MS3B 4EFKA 4CV2A 1X8LA 2BPOA 3MMZA 4RM2A 4YXWD 1NN0A 5CIWA 1L4BA 3UYKA 2X9VA 2YZKA 3EA0A 2QSUA 4X95A 5JDCA 1X7HA 4NOKA 1HNNA 3ETDA 2TMKA 2X8WA 4BQQA 3RDPA 3T7KA 2HDWA 4HT3B 4YMIA 1FMCA 1FPMA 2KMLA 5FUVA 3UWPA 3IBYA 4KQHA 4ZAZA 3WL8A 4M2LA 4ZRNA 2R5WA 4BFCA 4PO3X 4EVSA 3U7FB 1RZ3A 2A9OA 4FKZA 1YRYE 3GUCA 4QLOA 2NWQA 4JQSA 2HMUA 5A4IS 4N54A 3OQBA 3ESZA 2IPXA 3M83A 3ZV5A