2FPOA

Putative methyltransferase yhhf from escherichia coli.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
183
structure length
177
Chain Sequence
GQIRIIGGQWRGRKLPVPDSTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methyltransferase that modifies guanine 966 of the 16 S rRNA: functional identification and tertiary structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords methylase yhhF
total genus 56
structure length 177
sequence length 183
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.171: 16S rRNA (guanine(966)-N(2))-methyltransferase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fpoA00
3V97A 2GA9A 2NXNA 1VIDA 2FCAA 3M70A 4U7TB 1VBFA 4GC9A 4F84A 4M36A 4YUYA 4FS8A 3FUXA 2NP6A 2Z6QA 3MTIA 2IDKA 4YV2A 5KQRA 3BWBA 3FUTA 5CVDA 4X1OA 3EMDA 2BH2A 1RI2A 2WA2A 3NWEA 4GBED 4CKBA 4C07A 2BM9A 4MWZA 1JG4A 5FULA 5E2BA 3B89A 3BKXA 4POOA 1UFKA 1AQIA 3HCDA 3HVHA 5LQCA 3KU1A 4YUXA 1ZG3A 2PVCA 4KDCA 3VC1A 1M0EA 2GLUA 4ER6A 5K0LA 4YUVA 4F85A 3DH0A 5EPEA 3EGVA 3JWHA 5DSXA 4MHTA 3UZUA 2E5WA 5FWDA 1G8SA 2YXLA 4RTSA 4FP9A 1RJEA 2AOUB 3M6VA 1JQDA 1XCLA 3JWIA 3HCAA 1JQ3A 5EIFA 2KW5A 4OQDA 2OB1A 3FTCA 2O0LA 4WXHA 5DM4A 2AZTA 3G8BA 4K6MA 4RTPA 4UOEA 4B17A 4ATNA 1XTPA 3BUSA 5DT2A 4ER3A 5EEGA 4HGYA 2OB2A 4OBWA 2ZZKA 5G02A 3RIEA 3UBTA 1Q0SA 3SSMA 4GF5A 4E2XA 4HRAA 1RI1A 2AOXA 3ELWA 1O54A 2JH8A 3HNRA 5ICFA 3FUVA 2IFTA 1G6Q1 3M33A 3P9NA 5CVVA 3KPYA 3ELDA 3ORHA 2Q41A 4V0QA 3DLCA 3M6WA 1F38A 2P41A 4AZTA 5KVAA 4RTKA 1BC5A 1Y8CA 5EQJB 4GQBA 2GAFA 2Z6UA 3UJ9A 4OA5A 4AX8A 2FHPA 3LX6A 5EMKA 5H02A 1EJ6A 2ZIGA 3GRRA 4RTJA 3WSTA 2IH2A 5MHTA 4DM3A 2PXCA 2H1RA 1NE2A 5CVUA 1WG8A 4PONA 4HTFB 1MJFA 4PNEA 1BOOA 1P39A 1KP9A 2IPXA 3M6XA 3P2KA 5JR3A 3KPUA 5FQNA 2YVLA 1KYZA 1KPHA 2G8NA 3KR9A 3LDUA 4P58A 4P7GA 3T7RA 1WXWA 3P2EA 4CKCA 3BXOA 2HTEA 3GRVA 4V0RA 3ELYA 2ZW9A 2AVDA 3FPJA 5E1OA 5EGSA 2G1PA 3KQMA 1R74A 2QYOA 1QANA 1G60A 4X63A 3GRUA 5E1DA 2CL5A 1L3BA 1INLA 1ORIA 2IGTA 3FPHA 3FTEA 1NW8A 3OE5A 2EG5A 1R18A 1X1BA 3Q7EA 4RVFA 5EC8A 5K0CA 5GM2A 2PSSA 5D1HA 2PT9A 2AR0A 5E1MA 1KYWA 5EMLA 3G2OA 2B3TA 3K6RA 1ZQ9A 3KQOA 2NXJA 1VP3A 3NVMB 2PJDA 3G5TA 3OU6A 4C06A 5GOZA 4GOND 5FWAA 4E32A 9MHTA 3UJ8A 2PXAA 4FZVA 1B42A 1VE3A 2PWYA 2WK1A 4BLUA 1VPTA 4QQKA 5DX1A 5FA8A 4E2YA 3EEOA 1DCTA 3NW9A 3RODA 3DUWA 3SMQA 1AQJA 4RTOA 1R8YA 4LWOA 1YUBA 3A4TA 1L9KA 4RYLA 1IXKA 3HCBA 3PVCA 2JHCA 2I7CA 3FPFA 5CVJA 5FHQA 1M6YA 3O31A 3OZTA 5LSAA 3GO4A 2F8LA 2B9EA 2OXTA 4ISCA 3SVZA 3CJTA 3GRYA 3HEMA 1RJFA 3RW9A 4C4AA 5E9JA 1JG3A 4OX9Y 1EQAA 4PYIA 3OFJA 4HSGA 3UJ6A 1X1DA 4PYLA 1F3LA 3JWJA 3MERA 1YB2A 1G38A 2IDJA 2IH5A 3BWMA 3KQQA 4FSDA 4X60A 4ZTBA 2PGXA 2UYOA 2NNWB 3ANXA 2H00A 1N7IA 3KKZA 3BZBA 3SXJA 4HTFA 2HV9A 2NXEA 2YTZA 1NKVA 1ZGAA 3HCEA 5HFJA 2ZBQA 1SUIA 3B3FA 3T7SA 2CWWA 5HIMA 4EKGA 4C08A 3UJAA 3LGAA 4FGZA 3TFWA 3DTNA 4OQEA 4RVHA 4R6WA 5BW5A 4RTQA 3HVKA 4E31A 3OU2A 1X1CA 2UZ4A 2VDWA 3E7PA 2UYQA 1FP2A 3ER8A 4KIGA 5FHRA 4YUZA 2OBFA 3KQTA 3A25A 3BGIA 4KIFA 4JXJA 2BR3A 4PWYA 5GP1A 1YZHA 2AN3A 5BW4A 3NVKI 3C0KA 5EOVA 3OCJA 4KVZA 3OPNA 4RX1A 4BLVA 1I4WA 5CIYA 1EIZA 5LQNA 3EVZA 3KQYA 4HH4A 4A6EA 4RWZA 4RTNA 3PTAA 2QY6A 4DCGA 1D2CA 2HWKA 5FTWA 4BY9E 2Y1XA 3CKKA 3F4KA 5GWXA 3TQSA 2XYVA 1XCJA 3UJCA 2OY0A 3LSTA 4OBXA 3LPMA 5K0FA 3LCVB 3A7DA 2FPOA 2PX5A 4XUCA 2NXCA 1SG9A 2PV0A 5FQOA 1H1DA 5CUQA 1MHTA 2EX4A 1TPYA 4HGZA 3TM5A 5K03A 2C7OA 2N47A 2C7QA 1KIAA 4LECA 4R6XA 2Y1WA 2HR1A 3FTFA 3T0IA 3BGDA 4EQZA 1NW3A 3KPWA 3THSA 1YF3A 4EK9A 1JR4A 3CVOA 2G70A 2P7IA 4E30A 4YV0A 3EGEA 3I64A 5GIPE 1KPGA 4PCAA 2YQZA 3CCFA 3HVJA 3IYLW 1RI5A 3G5LA 2CKDA 3NWBA 4QQNA 3TR6A 5ICCA 4ER0A 1QAOA 3DMFA 2NP7A 5HILA 3K0BA 4PYOA 3VYWA 2EFJA 2AS0A 5K0GA 1U2ZA 3FTDA 3P97A 3DLIA 4FT2A 2YR0A 5DX8A 3SR4A 2EJUA 4WVLA 5F2NA 3QOWA 1BHJA 8MHTA 1JSXA 5CCXA 2ZFUA 5JUWA 5U4XA 2ZWVA 2VS1A 5BP7A 1NW7A 3EVBA 3BKWA 4X61A 3PFGA 2P3QA 1SQFA 3I5UA 5K0NA 4R8RA 4R05A 4YMGA 5ERGB 2ZZNA 2HNKA 3HM2A 3C6MA 1ZGJA 3CJQA 5E8JA 2ZBPA 5DXJA 1NT2A 1RJDA 3EPPA 5P8WA 1FBNA 3GNLA 3R6TA 1NV8A 1O9HA 1TW3A 1G55A 5E9WA 3VC2A 5K0JA 3KQWA 5K05A 5GIOE 3X0DA 2I9KA 3VSEA 3EVAA 5LQJA 3A7EA 3DR5A 3MGGA 4FT4A 2P35A 4KDRA 1N7JA 3C6KA 3NDIA 4OA8A 4P7FA 4H0NA 2R3SA 1JTEA 5EHIA 5DM1A 4EVIA 3IHTA 2G72A 4HC4A 3CC8A 3G89A 3M6UA 5ICEA 2C7RA 5GINE 3R3HA 5T67A 1VQ1A 1XVAA 1JSZA 3SGLA 5DTRA 3CBGA 1R8XA 3EVFA 2OPBA 3IEIA 5K0BA 1PRYA 2OZVA 4E2WA 1EAMA 3NTVA 3UA4A 3AY0A 2B25A 3TOSA 2IIPA 4M38A 3GIWA 1P91A 3AWIA 5ICGA 4IWNA 3G2QA 3LHDA 5E1BA 3MB5A 4DA4A 2I62A 2IBSA 3OFKA 4DZRA 1YZ3A 5HIIA 2AOUA 2PXXA 5LQUA 3LBYA 5C9ZA 2OYRA 3DULA 3FRHA 4A6DA 5DXAA 2ZBRA 5K01A 4P7JA 3KR0A 3SSNA 2B78A 2PX4A 2DPMA 3OZRA 2ADMA 3UFBA 2ONZA 4GOOD 4IKPA 1JTFA 4FR0A 1NV9A 1KPIA 3DMHA 4XUEA 4G56A 5HEKA 1YFJA 5CD1A 3HVIA 1FJXA 4GUAA 5DRYA 1UIRA 3CGGA 5EIWA 3FUUA 2VDUE 5EEHA 2BR5A 2DULA 2H11A 5EKXA 5FCDA 4RTRA 3GU3A 3H2BA 1XJ5A 5E2AA 3AXSA 1L3CA 1NW5A 3BWCA 1DUSA 2Z6AA 2AN5A 1R6AA 4AUKA 5LR6A 3D2LA 1FP1D 3U81A 1Q0TA 3Q87B 3OZSA 3UWPA 1XDZA 3A27A 3P71T 3FYDA 3SX0A 2ZULA 4NECA 2UYCA 2PT6A 5DRTA 3THRA 2O57A 3LDGA 4IV0A 3TMAA 3GWZA 2V7EA 4FSXA 1IY9A 2FK8A 2P3LA 1SKMA 4AZVA 5F2OA 3SM3A 1VL5A 2AVNA 1NBIA 4DQ0A 3PLAE 3UJBA 1WZNA 3DXZA 3TRKA 2PX2A 5KS2A 4CKEA 4RVGA 3QV2A 2JJQA 2ZVJA 3G2MA 2C7PA 4BP3A 1HMYA 3I53A 4DCMA 3GJYA 3E23A 1N2XA 3P2IA 3TPZA 4R8SA 1X19A 2O07A 2IP2A 2XYQA 5M5BA 2IH4A 3TM4A 1M6EX 1AV6A 4DKJA 1KHHA 4U7PB 3EMBA 3DOUA 5HIJA 4AZSA 4BP1A 3EGIA 4CTJA 3R9XB 1QYRA 2K4MA 5DM0A 1RJGA 2YX1A 4KRGA 3G88A 3GCZA 2XVMA 3C3YA 3TKAA 5EVJA 3LECA 2G71A 4E33A 1QAMA 4CXMA 3KQPA 5E8RA 5EMJA 5IKMA 4Y30A 5HOQA 1ZKDA 4QPNA 5C1IA 5T6BA 2ZTHA 2O06A 3FRIA 1VLMA 2FRXA 2XVAA 3B7PA 4PYNA 4LG1A 1FPQA 3ID6C 3EVDA 3S68A 2UYHA 2YXDA 2ZIFA 1HNNA 2FYTA 3NJRA 5EG5A 4HG2A 2BM8A 2QRVB 5CCBA 3B3GA 4PYMA 2GH1A 4EMSA 3E05A 5T64A 2ORED 4ER5A 2AOTB 4MTLA 3E8SA 4DMGA 4YV1A 3B5IA 1D2GA 3IV6A 2P3OA 3PFHA 4PGGA 3FPEA 3MHTA 3EVGA 2I6GA 2P1DA 4MQ4A 2P8JA 3B3JA 4PYJA 3GGDA 5LQKA 5CVEA 4RVDA 1JG1A 3OU7A 4E70A 3EEYA 2JG3A 2PLWA 2JHPA 3DXYA 3FYCA 1WY7A 1V39A 3P9KA 5B1SA 4BLWA 3P9IA 1OR8A 2PY6A 4C05A 3GDHA 3LKZA 3HA7A 5F2KA 5FUBA 3ER9A 3FUWA 1I9GA 1G8AA 4C03A 3P8ZA 2P7HA 5E9QA 1NW6A 3DP7A 5FADA 1XDSA 3PX2A 4XUDA 2XYRA 3I9FA 4P7KA 3PX3A 4YUWA 7MHTA 5IH3A 3LL7A 5DTMA 3O7WA 3MCZA 2VZ9A 2XBMA 4L7VA 1SUSA 5DTQA 1JQEA 3EVEA 1D2HA 2GPYA 3MAGA 3L8DA 4AZWA 4KW7A 4QVGA 2ZCJA 4GEKA 1R00A 2LD4A 2IBTA 3REOA 2VP3A 3AXTA 3JWGA 1BKYA 2PKWA 3KR1A 3G8AA 4M37A 5HIKA 3QOXA 3FZGA 2ESRA 3MQ2A 4PYKA 5DPMA 5FA5A 3PS9A 5KQSA 3MCTA 2O05A 4M7RA 2JHAA 3KHKA 1Z3CA 1NBHA 4PIMA 4CWAA 5KYGA 4CTKA 2AOVA 3LCCA 1XXLA 3DMGA 2ZWAA 3GRZA 2PWPA 2ZIEA 2AN4A 3PB3A 1AF7A 3CJRA 1TW2A 3ELUA 3ME5A 1P1BA 3G2PA 2CMHA 3KPVA 2B2CA 3SSOA 5K8VA 3TLJA 3I58A 5EZSA 3BWYA 4RV9A 4RTMA 1KR5A 3P9CA 2P40A 2QE6A 2AOTA 2A14A 1JG2A 4QTUB 3R24A 5DM2A 3G7UA 3UJDA 10MHA 3KQSA 2WA1A 3AJDA 3KPJA 5D1NA 4X41A 1DL5A 2YXEA 2AOWA 3GXOA 2R6ZA 2ZLBA 4QPPA 5EZQA 4DF3A 1YFLA 1WS6A 4RTLA 2EJTA 4KWCA 1UWVA 1XDUA 4Z2YA 2HMYB 2BZGA 2OO3A 4Y2HA 4O29A 3M4XA 4GC5A 5DSTA 3HA5A 5BXYA 1L3IA 3R0QA 5EKUA 1IM8A 3PT9A 4F86A 5K0EA 5C0OE 4EKIA 3OE4A 4QVKA 4PINA 3HA3A 1T43A 1SQGA 4MIKA 4XCXA 5DLYA 3HTXA 3BGVA 3FPGA 5GM1A 3C3PA 3HCCA 2NYUA 4IV8A 4QTTB 2QRVA 1QAQA 1ZHFA 2ERCA 2JH9A 3A26A 1O9GA 4PIPA 5CM2Z 5EMMA 2GB4A 2OKCA 2YUIA 5K09A 2PX8A 5DX0A 4PYQA 5HZMA 3HCFA 3T7TA 1P1CA 2QM3A 5LQAA 1VP9A 3UA3A 5EHGA 4E2ZA 3LCUA 3V8VA 3KQVA 4GOMD 4PGHA 2ONYA 1I1NA 1QZZA 1L1EA 4GOLD 3O4FA 3LDFA 2ZSUA 3NDJA 3EVCA 1KXZA 2FK7A 4QDJA 3LBFA 3UJ7A 3DXXA 2ZZMA 1EJ0A 2CMGA 4YMHA 3TKYA 4ER7A 3KR2A 4PCLA 5LQRA 3ERCA 4LWPA 1ORHA 1RI4A 2BR4A 1RI3A 2V74B 4C04A 3BT7A 3LKDA 2GS9A 5DWQA 1EG2A 2PBFA 1SVUA 2VDVE 3MTEA 4QDKA 1PJZA 1X1AA 3NMUF 3HP7A 4RSRA 1WXXA
chains in the Genus database with same CATH superfamily
3L92A 5CITA 2X6RA 2WU8A 3ZNNA 1BEEA 1BEUB 3L1UA 4KN9S 4XH9B 3ROGA 1N77A 3FAZA 3NKLA 3JQ7A 4Y9SA 1C7ZA 1WSAA 1EZZA 2B2XA 2WFLA 5CK5A 5ENZA 4CKBA 2F8TA 2G06A 4MWZA 3ZWYA 2G25A 3KP1A 3BKXA 3RABA 1U0EA 1X70A 1FW6A 3LNTA 2NQ8A 3HZRA 2JFZA 3SDZA 1KO1A 3GEGA 1E0SA 2ZYAA 3Q7SA 4KDCA 3IOCA 2ETVA 4N41A 2QQ5A 4F85A 3DH0A 3BMQB 2JGEA 3EGVA 1N2HA 1ZIYA 3RTAA 5LDHA 1CUUA 1E1DA 1S2GA 1YI1A 2DPLA 3ESYA 1NVTA 1U8CB 2WHPB 2Y1OA 5LB4A 3ZVRA 4X8LA 5CB4A 1QHFA 4I7EA 2O8FB 1ZMRA 2Q2VA 3FF4A 3J7TA 3QXCA 4D2IA 2F64A 4G23A 2W93A 2OCYC 1T8PA 3B70A 4ATNA 1JQBA 4CMAA 5EJ8A 3W0LB 3JASA 4M0KA 1F0YA 5EEGA 3RVPA 2H85A 1X42A 4QNMA 4DC9A 1Q0SA 4XLLA 1HDOA 3R0ZA 4Q03A 4DLWA 1G66A 1YHYA 3W8FA 4ISBA 1DX6A 4L2IB 4AQ7A 5BSMA 1E5LA 1UODA 5K4GA 5HWSA 2XQKA 1G6Q1 1W46A 2H65A 4MNTA 4LSMA 1QXSA 1SKQA 3HS3A 1PTJC 4G0XA 5FWXA 4DR7B 1PYOA 5CLHA 6REQB 4HDRA 4KHZA 4K6FA 3GF4A 1J06A 4M9RA 1RHKA 3CPJB 5H4GA 1RP1A 5EMKA 1GEGA 1YO6A 1QHIA 4FKMA 1M9NA 1IY2A 4XM2A 1T4DA 1IUOA 1SU4A 5CURA 5CVTA 1I3OA 2LKDA 3VR6A 3ZIDA 4DM3A 5G4KA 2W2XA 5J3JA 3QVMA 3TK1A 2OCXA 3B60A 3C5VA 3K16A 3RU2A 4BO4A 4DVJA 1P5RA 2E89A 5CB0A 1JDUA 1KP9A 2OP1A 5DLQC 1OB5A 4TXHA 3KB8A 4Q9KA 2EOAA 4Q05A 5M2QA 4FJ1A 4H0FA 5A6SA 1CQJA 4M22A 3STYA 5E4FA 1NNI1 4ZCMA 1AH2A 2Q6LA 1NC1A 4HNTA 4ZVRA 2Z4RA 1UEJA 3NBYC 2FV8A 3FGNA 2GO1A 1COWD 4JUCA 5A7FA 4HVCA 4KK3A 3AFHA 1YOVA 1MXFA 3LA8A 5CLFA 4N8DA 4ZVUA 1VMKA 1WOMA 3IRUA 2XGGA 1S8FA 5KAPA 4BKQA 3NU1A 5LZ7A 3FTEA 2EW8A 1T5HX 5EC8A 3Q7EA 1XMQB 5EXDA 3HJGA 3GG2A 2B3TA 2HWYA 1LF5A 3LQKA 1XD9A 4KR9A 2R4TA 4Q3LA 2OR3A 2BP7A 1CY0A 1V47A 2FR8C 2CNWD 2O3QA 2OMKA 3E22B 2F43A 2AI1A 1B1CA 1DCTA 1Q1AA 2R48A 3H19A 4LGVA 2PNJA 2Q29A 1Z6XA 3ZCTA 4GRIA 1RHMA 4P31A 3NBQA 1L9KA 1P1FA 1NMQA 4GX5A 3UKOA 4IVQA 2A8YA 5JLAA 2B83A 1WCXA 3X1JA 4ZHSA 3VBCA 1XWFA 2G9QA 2GKGA 2XF2A 6YASA 1HKHA 3HEAA 3KVRA 2BSAA 2X9LA 3LV8A 1LD3A 3ENKA 2GWRA 1Y9JA 2P0AA 1BWPA 4RC9A 2C1EA 1Q0HA 1C2YA 4RGQA 4CMGA 2XA9A 1ADYA 4QZVA 2F00A 3HN7A 1BOFA 4FGWA 4OMDA 2J31A 2XT6A 1JJBA 1M2HA 2NV6A 4MA4A 3H8VA 5ARBA 5HFJA 3QU2A 2NXWA 4CV2A 5KTMA 2WNHA 3V34A 5K3CA 4DDUA 4DB2A 1FRFS 3TQIA 4IRUB 3DTNA 4HQKA 3W05A 2UAGA 4CMCA 2DFDA 3ZUPA 3KUDA 5HRCA 2WG2A 4EZIA 4E5MA 3KIPA 1Z29A 4L3WA 1KOGA 5FHRA 1ZP6A 2C8VA 1UBRS 3HQ4O 3HYTA 3TH5A 2EF1A 4LV5B 3KLPX 3UGQA 5DYGA 3WKEA 4LGYA 4WQMA 3SOPA 1YZHA 3BBPA 3NUZA 4EGFA 5KIAA 1SHLA 3VXKA 2I3DA 3Q4GA 2OTCA 4IUYA 4Q1FA 4W1QA 1T0IA 5K51A 1VI2A 3I61A 1H2XA 4AG5A 5E6UB 2RCYA 4KHPB 1A9SA 4I1OA 5IJ0B 2AFHB 5BYAA 3CKKA 3HZOA 2ODTX 4LBZA 3CVXA 2MSEB 3WGVA 2V5VA 2FZLA 2DEUA 1X7XB 2LR0A 2REQA 2YWEA 4LYHA 1U1GA 4RXMA 3A7DA 4RHYA 2VCEA 3MJ4A 3I92A 4RGYA 1PSZA 1KJYA 4RPCA 4LFCB 1DLIA 4JWTA 4W6ZA 2Q62A 4JLKA 3TM5A 2WJGA 3TRFA 1R0YA 2NU9B 2G0NA 3E70C 4D5EA 1EWQA 4OAOA 1XRQA 1GCAA 2FMUA 1I7SB 4FEEA 3Q0TA 2V6MA 3ONFA 1JNXX 1E5XA 3QVJA 4GNKA 4GM4A 4F9EA 4QRHA 4EG5A 1DBWA 4D3ZA 4I4IA 1JZTA 2ATXA 4YDRA 3QH4A 1GTVA 1PTKA 2BFEB 2JLCA 4MXDA 3RVSA 3E9DA 1DBRA 3JVDA 5JNVA 1Z08A 3QENA 3UG6A 5JUWA 2RARA 3KKPA 5U4XA 1CJKC 1XU7A 4N0QA 5DW0A 1CF2O 4Z3DA 3ST7A 2M6SA 2QX4A 4DSNA 1TZMA 2EL9A 1LVHA 4YJFB 1GLGA 5HRAA 2IS4A 1ULUA 3OCVA 3IQHX 4H7IA 1KMQA 2ZBPA 3AFMA 4UDNA 5P8WA 1KI2A 2YN4A 3TLZA 1EFDN 1V3UA 2DZDA 2HC9A 1RYNA 1KFEB 3GLRA 3NIDB 4ZT3A 3ZGZA 4OHZA 2IHJA 3LKVA 4B09A 3BXGA 1WDWB 4DCJA 5K05A 4OQZA 3U7EB 3IMEA 4U6SA 5HJ5A 4YQYA 1AMOA 1OTHA 3QEMA 1TAHA 1T2VA 1W5BA 3F6SA 4CFZA 1ISSA 1ZOOA 5KU7A 3UYLA 2HIAA 2XXAB 3KXPA 3UAWA 1F8UA 5EKTA 3GEEA 3AVWA 1YVUA 2PX6A 5BSKA 3PUZA 4ZAVA 3G89A 1QHNA 1T9ZA 2OZLA 2PWBA 5H9VA 1ZJ4A 3UCXA 1U2RA 3Q8MA 1LK0A 4LHEA 4EBFA 1W1WA 1AQYA 3W5HA 1Y3DE 1NHWA 2OZVA 1C1HA 1G59A 1QGZA 4O0MA 1UOOA 1NR1A 5H4HA 1N2BA 2QT1A 4M38A 3MTAA 4CEIA 3GLGB 1KYVA 4HAOA 3G2QA 5E1BA 1PLJA 2YIMA 5LDDC 2AE2A 2JK0A 3OLWA 2PRJA 2PXXA 3GEMA 2QV7A 4H1VA 5LQUA 2BE9A 3KOOA 1JLHA 4IOKA 2O8NA 3W2HA 1GSIA 2GCIA 2FZ5A 2WD7B 3B1FA 3WAKA 1SURA 3NUQA 4FFPA 4KPEC 1H2YA 4GOOD 3KWMA 3IESA 2FZGA 2O2GA 3E3LA 5JAPA 3WDSA 4IQ4A 4CL8A 1T3ZA 3Q3IA 2FHSA 3DMHA 4ALKA 1YFJA 4EW6A 4FDTA 4Q7QA 4GUAA 1E3EA 1AD2A 1Y9ZA 3EZXA 4WCVA 5EEHA 2D1FA 4JL8A 5IVDA 1B0AA 2IE8A 3GCGA 4NF2A 4UC0A 3CHYA 4ZU6X 3H2BA 1P1HA 2EW2A 1NX9A 2GRJA 3KNZA 3ONNA 4JUIA 1L5NA 3PGXA 1MEEA 3EC7A 3QG5A 3RWBA 2EFGA 4IXTA 4UNQA 1O8CA 3PCXA 1H3NA 1DXOA 4L74A 2FSVC 2ZULA 4NECA 3SU8A 1VJGA 3VNAA 1UPCA 2V6BA 3HYCA 4YAUA 3UMYA 1CX9B 1K98A 3MJSA 5E95A 4KGZA 5D5PA 1FFSA 3BBLA 3MPOA 3SM3A 3EEIA 1N3YA 1FMCA 1EXMA 2AR9A 2GBIA 4RMGA 1C0KA 6CHYA 4G1FA 1P19A 4KAJA 1E6MA 3A36A 3MRXA 5GAJA 2JJQA 1XYGA 1EGHA 4YJGB 1Z2DA 2OAGA 3E23A 4R41A 3KYBA 5CDTA 4AO6A 3ADDA 1XZFA 2XYQA 1TTQB 4Z49A 3WMRA 3LUGA 4XOIA 4G4IA 2ZBDA 3FLMA 1X9GA 3QOFA 3ONDA 2WTEA 3JSXA 1UR5A 3GJ3A 1X6VA 5HIJA 5JBNA 1HDIA 2QMEA 4JKIA 5FRDA 3RSGA 2GYYA 3UTCA 1FPMA 4C21A 3QQPA 2YX1A 5EFZA 3ABIA 3H84A 1MGPA 2XVMA 3HDYA 3WK7A 5L45A 4QUHA 3ZE1B 5E8RA 3WB1A 4I6GA 3ZXUB 4NJMA 3RS4A 1O8BA 2ZTMA 5KC8A 1XLUA 3EXHC 2LV8A 4B3XA 1PEYA 3WGIA 1Q7GA 5FL3A 1I0IA 3VBEA 2B2NA 2FH5B 5U9CA 1KJNA 1WULS 4NLLA 2YJ6A 4QU0A 4BC1A 1QPZA 3Q8XB 3ZDCA 3QIVA 4IIEA 2QRVB 1T5OA 2EQAA 4PYRA 4ZJUA 3S40A 3ASZA 3D6TB 3CZRA 3R7LA 2P5UA 2FMIA 1O57A 2ORVA 2XITA 1ZD1A 3QPCA 4IZ6A 4F21A 4B3DA 3PFHA 4NENB 3TVYA 2HK9A 4MKXA 3KD2A 2V7BA 4Q9DA 4DQKA 2JEYA 4MW7A 1TYDE 1DTSA 1TGVA 3HA2A 3RS7A 5IC5A 1MC1A 1MG0A 2PKQP 3QKIA 5IBRA 5KQMA 3NYQA 5AJWA 3W6UA 2HWXA 4FK8A 3PPWA 3QVOA 4D79A 3ZWXA 2W22A 4HRYA 2O8BA 1P4HA 2ILTA 4TZKA 4TYPA 5D2CA 3ZQ4A 1A9OA 3U9LA 3NX4A 1BA2A 3PDJA 5B2ZA 2I7XA 5EMHA 3U40A 4N1AA 4C2BA 5C8DA 1UC8A 2XCQA 2FLWA 2N9UA 4UQLA 4BLQA 3FTNA 5G40A 3JQAB 1OFUA 4O1HA 5CH5A 5G0TA 5BNFA 4W5QA 1F0NA 3CZPA 3ILYA 2LGJA 3B1JA 1PJTA 7MHTA 3NGLA 2P77A 5IH3A 2CF6A 4MKIA 3AJRA 4EHLA 5AUOB 5JS1A 2VAWA 1J22A 2UZ0A 3A6ZA 4IS2A 4YVFA 3NRCA 3AI2A 5GONA 1KDYA 4DYHA 2GM4A 1FNMA 2XB8A 1G42A 2CMKA 1ZMTA 4D02A 1SY7A 1QHHB 4QEDA 1ZH6A 2PH3A 3MAGA 2X0EA 2POQX 1HWYA 2REBA 2VXBA 5JCXA 4LZAA 5HJ2A 2VDJA 5FFNA 1NMYA 4TL8A 3G8YA 1T36B 1NI5A 3LUDA 4PG7A 3VJLA 2CXQA 4A6PA 1TCBA 4TMZA 4YN3A 2HJRA 4CU5A 4ENUA 1JBEA 5GTDA 2P4UA 5HOEA 4BRWA 1VIVA 4W6QA 1DAIA 4P33A 2QJRA 3OEHA 4MW6A 2JBAB 1L2TA 4RQAA 4X8MA 1LLUA 3IPRA 3IXMA 5IDQA 5ALQA 4ZQBA 2D0OB 5C1IA 5H7XA 1RQ2A 2VYNA 5ALWA 1TADA 2H51A 2J8ZA 4UPVA 3X3HA 3EW7A 3PSAA 4OHWA 4CNQA 2VO1A 4MW2A 4LHXA 5SY6A 2P40A 3KV1A 4HEQA 2Z83A 2QKYA 3IDOA 3R24A 4F5WA 3A1EA 4OQFA 3NCTA 2JFUA 1U0SY 1ATZA 1XTTA 5LKAA 3L8CA 3DMNA 2P11A 4JR1A 1UKYA 1P2SA 1J90A 2BL4A 2VL7A 3D6AA 1G21B 2O6LA 3BDIA 2OUKA 4MPDA 1R16A 4GOJA 4QFMA 4REMA 1P44A 2JEZA 2ZWOA 3ZK8A 2VRBA 1ZX1A 2Z8ZA 4M89A 4H7EA 1KOFA 1WE2A 1FNDA 4Y2HA 4QRIA 3VA7A 3MJTA 1DNPA 2H92A 2DH5A 2R6DA 1NXOA 3AT1A 2CDAA 4RE5A 3NAQA 1G5RA 1QHSA 2XWPA 1XP8A 4M98A 3IIMA 4XGRA 4YCCA 1NUPA 3U4CA 1S9DA 4D3FA 5FH9A 4LQDA 4MKGA 1JLRA 5GONF 2QTGA 3DVRX 2NTNA 4IJVA 1I7DA 5JSKA 3ZNQA 1G3UA 4EBBA 5FBRB 5KOIA 4QJ4A 3IAHA 1O9GA 3CWCA 3KOUA 4RLHA 4F6CA 2YUIA 5ADWA 3FFAA 2WJJA 3HL0A 1O9BA 3I2YX 4HS9A 3U31A 3GGOA 3TTSA 1N92A 4RABA 4JLWA 5EP1A 3ZV4A 4YRGA 1H9CA 4NFSA 1VKRA 4K9QA 2HIHA 2YZNA 4Q3DA 3N2EA 4NFLA 4R7ZA 3WQRA 5I7FA 4OK3A 1HSZA 2R8ZA 2I6UA 2X5KO 4UBIA 1DRUA 1Y6ZA 1MXHA 5CFOA 3FTQA 3K9FC 2X7XA 1XEFA 3MWFA 4V0OA 4DR2B 2BV3A 1RI3A 1XKLA 2I1LA 5LU8A 2P5TB 3E9YA 4B2IA 1J97A 1BDIA 2WD7A 1C8BA 3R6GA 1IZ8A 3UXMA 4HDNB 4K2HA 3A9WA 4KQ9A 2JHGA 3HP7A 4OVKA 2BFFB 2N3ZA 3QPUA 4WEOA 3DV0A 1TDJA 1R8JA 4Q3NA 1SC1A 3QHAA 4FS8A 2ZXUA 2OHFA 4V3CA 3MTIA 4FW9A 2HGSA 2Y9PB 1DQNA 1E6WA 5HBGA 4MVJI 1KH3A 4KXYA 2GX6A 4R1OA 2JGRA 4EG6A 3KYDA 2RBKA 4BNZA 5ADUS 1REQA 1A1VA 1JG4A 4LC1A 1D1TA 3Q9SA 5HF5A 2R65A 4I9HA 1YZYA 3SF8B 2YY5A 4FIZA 2H5EA 2IPAB 5E38A 1ZG3A 1TKRA 3O8QB 5A05A 3RI3A 4B0OA 7REQB 4I1VA 2ADFA 5KB3A 2Q5JA 1Z0UA 2JJ2D 1XAIA 1L8AA 4OQMA 4BMNA 4OFZA 2Z09A 3QYJA 4AJKA 1E20A 4HGQA 2Z04A 5E6RA 4IOMA 5J59A 3PL5A 3M6VA 5IYZF 3T5TA 5KI6A 2XNCA 1ONSA 4HKTA 5DNDA 5BN1A 1BCRB 4FZ5A 1WWKA 4XIGS 3AIIA 1C9EA 1S2IA 2JGKA 4AUMA 3W5AA 1BHQ1 4YRTA 1OFHA 3L41A 4IIGA 4ER3A 3BSSA 4R2XA 5G02A 1B8OA 4Z1MD 5CLGA 1PYGA 1LTQA 2WHYA 4JUFA 4HRAA 4TLAA 5ECWA 2W42A 2DWQA 4YMUA 4Y9RA 3VISA 3ZWWA 4HQ0A 4R9SA 5EXPA 2QW1A 3SZ3A 3GD5A 3L7BA 3O4HA 4F4HA 4AF6A 1UBSB 1NW4A 3R0IA 4Z54A 5KTRA 2JJYA 1BH6A 4BFLA 1LBQA 2MSNA 2I33A 4DWJA 1VCNA 3CUWA 5FL7A 5TJ9A 4URWR 1GG8A 2V6JA 2FHPA 3AQ4A 3N0WA 5CM9C 3R7BA 4BRUA 2ZIGA 3M3PA 4ANFA 2HHAA 3EZYA 4Y0AA 3E3OA 3LPNA 8ADHA 1GPJA 3EZ9A 2FUNB 2CJWB 1G0NA 1P29A 1Q1BA 1A2QA 2J7PA 3KSUA 4IDEA 4TTRA 5TPWA 4AZ0B 3ZCVA 4LJAA 1WG8A 2XBLA 4HTFB 1XROA 2VG8A 2AEEA 1CZKA 2Q99A 4KSBA 5J2UF 2Y68A 1ZNXA 5ICSA 5FO0A 1FLVA 3NKVA 4LXUA 3RYCB 4C7OB 4F4UA 3GRVA 3HKEA 3Q3EA 5EGSA 4A0QA 1EFUA 2Y66A 1GVHA 3FPJA 3VO9A 4D4KA 4ACAA 2CYAA 1QANA 3H1TA 2Q21A 1QKIA 1E2GA 2BMVA 2XPCA 4OHUA 5F12A 3ZY6A 1QVWA 4L07A 4P3PA 5I7OA 3IAUA 2YICA 3DLPX 1KSFX 4FE4A 2ROQA 3W5VA 3WKDA 5KX5B 4TSKA 3PGMA 4EWLA 1PUIA 3RYIB 2CV2A 1GRVA 3VU9B 1UDXA 3OE5A 2G9VA 1VE5A 1X1BA 4WDQA 4HPXB 2ZRAA 3G0DA 4PLTA 2XUAA 3HI6A 3SQMA 3D7SA 3FX2A 1OXMA 1ZQ9A 5TVGA 1RYZA 2WSIA 1NFQA 2NYVA 1GT91 4CCYB 1JHXA 3DEHA 3KBOA 1R4NB 3LIPA 2XVXA 2PUCA 4HQ6A 2O50A 1DBPA 4F06A 3RRMA 4EB3A 2FEMA 3THXB 4WK6A 4KPYA 4OH1A 3A37A 1OYVA 1YTLA 2CSXA 4LWOA 2BJVA 5EJMA 1NW9B 2OHVA 2I78A 2J3DA 4E22A 1G7CA 5LSAA 3AUSA 2OGWA 5JJKA 5JMTA 4C0KA 2ORYA 3RQSA 3SVZA 4F2WA 3QEMB 3OJLA 1APBA 4U6QA 5A9RA 5K5EA 3UJ6A 3ORYA 2WB4A 3SP1A 4PYLA 1TF5A 3D8TA 5G3ZA 3WRWA 1QH9A 1YB5A 1OHHA 3U5TA 2YHBA 3U16A 2XTJA 3OQ6A 4S2EA 3FYHA 4QDUA 3R77A 1R5JA 2PKEA 4Z3OA 3TIVA 2Z57A 5GGYA 2YC2C 2AT1A 3U0BA 2YMPA 4MWTA 5LBTA 5BWOA 5JYDA 4FMDB 3RKRA 1AKUA 1CEXA 3OIFA 4DMFA 2KS6A 2CWWA 1EJ2A 2E4XA 1VMAA 3LGAA 3L3BA 3Q7PA 1OXVA 1TZ2A 1T2UA 2O2XA 3CUTA 5DYTA 2BI8A 1EB9A 3C4JA 4RVHA 3RVDA 3W2FA 4BO3A 2Z6VA 3H75A 3HVKA 4KXXA 1AK1A 3MT7A 4XM1A 1I7QB 3FJOA 4CTMA 5CAEA 2G4LA 4CM1A 1RQPA 2VUTA 5AKHA 5F9FA 3M81A 1UT6A 4JL6A 3E2MA 1U9YA 4N82A 4FYXA 4U1RA 4F72A 5HGXA 1I80A 3AGPA 1KTIA 1Z35A 2X2EA 3LVRE 4LRXA 1JI0A 2AN3A 3PUIA 4RM2A 5ES3A 4F97A 3C0KA 4FQ7A 1XNRB 4ZYUA 1NN5A 4KVZA 4Q01A 1ZH4A 5LIPA 1ORVA 5E7JA 1ZL0A 3A1UA 3EVZA 1RXSA 1O5OA 3GZTB 3JQBA 3RRJA 3VH3A 4TLDA 4DCGA 1YQEA 2Q3DA 3JQAD 1GTJ1 3DCNA 4NBSA 3TSZA 2GFHA 1JQ5A 1X92A 2CW5A 1XCGB 2DQKA 4QXOA 2YOFA 1Y3HA 2RHOA 1PP4A 1FTGA 3EMKA 4OBXA 4FLMA 4Q16A 5E0KB 5I45A 1AE1A 4AXBA 5TGDA 1YBVA 1XWWA 5K0ZA 1RXIA 4OBEA 3T9DA 1FYDA 3MTJA 1ST2A 3FTFA 1YF3A 2B7BA 4UE2A 2VPYA 5H83A 1Y9EA 3K5IA 4A73A 2WOJA 3UGJA 3B6MA 4BKMA 1KU6A 2JFBA 1EFCA 2IEBA 3TR6A 4DM7A 2EVWX 4X20B 1N2CA 2PZLA 4MB6A 4W8HA 1QYWA 2FPGB 1A9TA 3EOAI 3P9XA 4C7KA 1I5OA 3KXKA 3DLIA 5I5EA 1S1MA 1P2FA 3PPIA 1W4LA 4XWGA 5LWQA 1ATIA 2ACKA 4WZAE 3O8RA 2NUAA 3GCDA 3ELBA 4DTIA 5IWCA 1QS0A 2A9FA 1BYIA 4MJXA 5IUJC 1E5QA 3FYUA 4JWKA 3BXPA 3HY4A 4N5MA 1RKUA 1X77A 2J6HA 4LY0A 5K0NA 1FF9A 4NL4H 1TM5E 3UWOA 2RHRA 3BJIC 4M8LA 3ZDXB 3CQ9A 2ZR9A 3LOPA 1DCMA 4K7JA 1J8DA 3CNLA 1N6HA 2I2FA 2ZPTX 3T95A 1NT2A 2BDTA 1E2NA 1G41A 2OYCA 1WV1A 2FP3A 3L43A 4TKZA 3B52X 1PL6A 3ND5A 4CQMD 4RJ2A 2DUJA 4PSVA 4E5KA 3VSEA 5JDIC 3PHLA 4WLUA 4AJ1A 3FWPA 3N0RA 4QTXA 4FQ8A 4P5DA 1N1DA 3QA9A 5AKKA 3PEWA 2R00C 5BWNA 2SKDA 1QDLB 3QFSA 2VNAA 4BQIA 4DT1B 1H2EA 2Q46A 4N3CA 5JSYA 3CS3A 4ESOA 1FSGA 1Z4KA 3TIXB 2F2TA 5DI3B 3UFXA 4PC6A 4ZOLB 5TQ2A 3KQNA 2PT5A 1KI3A 3EZFA 2GRAA 3HVUA 5EJ2A 3RJMA 1JQKA 1D1SA 3DMYA 4HQOA 4IIDA 2G1AA 4BEWA 2C00A 2B25A 5FOVA 4IO0A 1QIFA 3AHEA 1M1YE 2FJUA 4W5OA 4NIMA 1R5NA 4RSHA 4I5GA 4AYXA 1MVOA 1SKAA 1RHQA 1U9ZA 2F9MA 2YV3A 5HIIA 4UOZA 1C3JA 2ADOA 4I8DA 1S3SA 2KSQA 3C6ZA 3Q11A 4DBVO 1D0IA 1DQYA 2ZRIA 3ZXSA 1AY0A 3FOWA 2NO5A 3OZRA 3E48A 1IVYA 1GM5A 4OHKA 3QLVC 2JH3A 1ONNA 2W6JA 4X44A 1GDHA 4OGFA 1E4YA 1Z2PX 3QMMA 4TXJA 1JT2A 3BF8A 5EUCA 3VH2A 4LF8B 1SB8A 4G9GA 2TRSB 3WADA 4EYEA 1V1JA 2J3MA 2KBFA 4DB4A 4QM6A 4CKCB 1HFWA 1XSEA 3OX1A 4N76A 1NP7A 1C7JA 3SQLA 3TMKA 1JXAA 1VGVA 4FEAA 4DLNA 3INRA 3AM3A 3OE7D 2BM0A 3TINA 1LNSA 2BMJA 5HQ3A 1NW5A 2HAEA 3LPCA 2XRZA 3OLZA 1WEHA 1ECLA 1LJUA 1UJ2A 4J0HA 3U81A 2MJLA 2LWIA 4AT1A 1YE3A 1M8KA 1R6XA 1VHTA 2ZUVA 4M6WA 4M49A 5EUMA 3EWNA 3ZU3A 1V5GA 3UMBA 4DAEA 3EQ8A 3HRKA 5K3BA 2XNSA 1CE8A 1NXQA 1SIOA 2JZNA 2VUHB 3BMOB 4ADSG 3B3AA 2FSGA 4DCCA 2P3LA 3ZHQA 5KZMB 3NJ8A 3S55A 4B47A 4DJAA 1L1RA 3V4LA 3OPVA 2X1MA 4AN0A 3UQZA 3CO5A 3LRPA 1EK2A 4ON9A 3M6MD 3EC2A 3RS5A 3ZLJA 1QTIA 1NBEA 1Y5NA 1ZNZA 4UDOA 3GGGA 1NLMA 3TPZA 1VZ3A 3KZMA 3P2IA 4R9UC 4QVIA 3ZU6A 4ARZB 3ZOKA 5KTKA 2O54A 5MDHA 2V8BA 3NI2A 4C89A 1WL8A 4XDHA 4RKEA 4F9GA 5AHWA 3DO8A 4BP1A 5F23A 5DM0A 3BRSA 3DMPA 3SXUB 5JCPA 1V35A 4L27A 5KTTA 3ZD8A 2HUNA 2QAIA 3TKAA 5HHTA 1RCFA 3NV7A 2WICA 4YLGA 4E33A 3A2LA 5EMJA 1CR1A 1T36A 4CR6A 4PO3X 4L08A 2W00A 3IALA 1EWTA 1PSWA 1GARA 5T6BA 1RNLA 1H6CA 2IHKA 3VU1A 3B53X 5L6LB 3FB1A 1QYIA 2HA2A 4FNAA 4HMPA 3RJ5A 4IH9A 1W4ZA 3PD1A 4X85A 3EGXA 1KU0A 3G7SA 4YYEA 5AXDA 1UQRA 2WOOA 4JQCA 1GZSA 2IBMA 3OPYB 1DBSA 4JS0A 4ROTA 3UN1A 2SNIE 3O4JA 3ET4A 4RKQA 2AFIB 1WP4A 1NONA 1Z06A 4BV9A 4DKXA 2QG4A 1V1RA 2UZIR 2CHEA 4LWQA 4DWVA 4UFPA 1Q14A 1RIFA 3MK31 1VKNA 1R12A 4M9QA 4L4RA 2O8CA 3A58B 1SOMA 5CA1B 3C3AA 2W2PA 2JHPA 4IVNA 2YQ5A 3IR6A 5JNUA 1IK4A 1Y8ZA 3IP7A 1OT3A 1T3TA 4I46A 1JWAB 2HMTA 4Y6SA 1T5DX 4NBRA 4UOQA 4ZAWA 4RQTA 4TKVA 1QZUA 3V2UA 1MB9A 2QD5A 5KOYA 4FHDA 4RVOA 5H3LA 2OFFA 4QGSA 2ZR7A 1NW6A 4W9NC 1TFUA 5C81A 1ZEJA 2ZSDA 3CB4A 2POCA 1SGWA 2ZIAA 1QC5B 1Z16A 3DT9A 2Q6IA 4LRSB 3ZHOA 1MO5A 3G0CA 4CUJA 1C3EA 1Q7RA 3T35A 1Y4UA 4FONA 4LISA 3RRZA 2I8AA 5HM6A 3N70A 1KBOA 4AZWA 1KY2A 2PUTA 3FHCB 1RW4A 3FZEA 3WGGA 1YRHA 1ZH8A 4LGMA 2IUTA 2X6TA 2QTLA 2QE7A 4EJ2A 2O1XA 2QTRA 1V37A 4P3OA 5JXHA 2I4TA 2YV2A 2FEWB 1CEYA 1IATA 3L7OA 1YJAA 1UKEA 4ZVSA 4UTPA 3V7NA 3VDQA 2VP9A 4UDXX 5TEWA 2CFIA 1XQ6A 7REQA 5KQSA 4FHCA 4LJ4A 1RWQA 1NBHA 2HWUA 3ZCSA 9ABPA 1E1QD 4K9OA 2WKSA 5BN5B 4E5SA 4C01A 3AI3A 5J23A 2W11A 1ODIA 2JBAA 3UB3A 2PUAA 3TS1A 1H2RS 3WGKA 2IXGA 2XHZA 3CBQA 4DNFA 5EWJA 1YDMA 3PU6A 2R7AA 4JYMA 3BWEA 2BEJA 2I29A 4JZKA 5CIQA 2I9PA 3KSBC 3K2EA 4KAAA 2A14A 2CVZA 2JFQA 4OHCA 4OF4A 3SC3A 3UJDA 2Y2VA 1V2GA 4CCWA 1NVDA 1EX7A 2C9ZA 2E7ZA 2WA1A 3KPJA 4PFJA 4WESA 2QQGA 2YXEA 1ZD2P 3JARB 1XHLA 3ZY2A 3ZXYA 1OTYA 4HX2A 2OESA 4KR3A 1P74A 3RSZA 3AOEA 3WQSB 4M46A 3IQEA 1ECFA 3JQQA 3K6SB 1FXSA 4DDHA 1IY0A 3E9NA 1ZLXA 2VJDA 4B81A 5AI5A 3F7TA 2BCJQ 4HH3C 3NONA 4DG8A 3PQEA 4N6GA 4LRWA 1QRAA 1LK7A 4BAUA 4R68A 2CXPA 2IHBA 3K3PA 3QK7A 2RC6A 1UEIA 5JS2A 1G8GA 1G3MA 3U7RA 2CHFA 4HLNA 4NE7A 4PLCA 3RAGA 4G67A 3SZLA 3OM8A 3WFJA 5CYFA 4BAZA 4ZALA 1BMFD 1TMGE 3U13A 2NYUA 2RC5A 4Z1MA 4TSFA 3E0QA 4XR9A 4KDEA 1E3JA 4HXYA 4WZAB 3BF7A 1A8QA 4RELA 4GMFA 1KERA 2VWQA 3O1LA 1WAMA 3HCFA 3PR3A 4X94A 3WOHA 3CVUA 2BKUA 5K8IA 3X1MA 1HOXA 1V6AA 2IW1A 3O82A 4CMEA 2BDUA 2EP5A 1ZEMA 2IX3A 1ZC3A 2PLFA 2ONYA 3EZ7A 2JLUA 1I1NA 4XOUA 3S2GA 1E8MA 3CX6A 1S2MA 3VNSA 3I9JA 4BXOA 3DXXA 2CMGA 4YMHA 1I0ZA 4LKRA 4DLBA 1E1KA 1ORHA 3GQVA 2C2YA 4PPYA 3AVQA 2ID7A 3LKDA 3Q0EA 1IQUA 3F3KA 2VDVE 2VTDA 4R0NA 3SLRA 3KVVA 3NHYA 1PJZA 4P3NA 4HBZA 5EE0A 3F5SA 5DNEA 5EJ4A 4A3SA 1JFVA 2B5WA 1MFZA 4U7TB 1V5EA 2FR1A 4WTOA 3B2QA 5G0VA 3LLSA 1P6UA 1VE6A 3L7CA 4HWPA 1VHQA 1VHLA 2RFLA 3MRVA 2WILA 1UP6A 2QTHA 4RAOA 2PGAA 3GJ4A 1PYDA 1CYEA 2PIAA 4HVAA 2P2NA 4OHOA 4C07A 2PTGA 1LH0A 1YR6A 3JRWA 4D6XA 5C35A 5IPFA 2QXYA 3RADC 3GA7A 5CM8B 1XZNA 2YBDA 3GLVA 4JROA 4LMRA 3ZKAA 2JCXA 3F67A 1WB6A 1M7HA 3Q9LA 1VMEA 2XTNA 1OSNA 5CDYA 1R66A 2FPIA 5K8CA 1O77A 4LYGA 5AJVB 4JJEA 1EVIA 2DUNA 4TTPA 1EFPA 2YXLA 4G6ZA 2C2HA 4FP9A 4CMHA 5BNZA 1YJ8A 4MUMA 4RTSA 1T8YA 4DAOA 2OPHA 4RCVA 4JSRA 4JU8A 2ERXA 3I73A 4WXHA 1W1IA 5DHSA 3CCCA 3A9TA 4JUAA 4X1IB 4QGBA 1VC2A 3M5PA 3Q6IA 4P80A 1DTEA 2P4HX 1V45E 1MENA 3BMNB 1FLNA 1MJ5A 3H7AA 4DNQA 4EMBA 1UZLA 1S4MA 1FFBA 4ZIRA 3QEKA 4EA6A 2FW8A 4NPHA 2GA8A 1ZIXA 3AFIA 3D3WA 2IFTA 1CDZA 4XR4A 2O7VA 3ELDA 2H7XA 2RK6A 1C30A 4EI9A 1W4BA 1OZFA 2QQ0A 2XDQA 1BE6A 3TTWA 1Y8CA 3TVDA 1OZAA 3U19A 4LJKA 5IM4A 1O94D 2P5SA 1CZNA 1XFAA 2UZ1B 3IS3A 3LNCA 4OA5A 3NRBA 2WI8A 3LX6A 4J03A 1MNQA 1V7PC 3G2NA 3H4VA 3P9PA 5CK4A 1BGXT 4PSAA 1JMYA 1J1IA 5DLEA 4JI5B 2WIBA 2FPUA 3SBXA 3WSTA 3R7AA 4YAFA 4QD3A 1P1RA 3H13A 2E1PA 4BJ3A 5MHTA 4YCBA 1R3UA 2G7ZA 2QTFA 4X90A 4KVAA 5CVUA 1EFHA 3FLAA 4GLJA 1YS2X 5C5EA 1K7SN 1N8SA 2MYTA 2WQZA 4W5WA 5JCZA 2ZJBA 3B20A 4ZP1A 3TNDA 3ZGVA 3HJBA 3GI1A 4G1CA 2F8SA 4RY0A 1GKYA 5K3OA 5TQJA 2OGZA 2X4GA 3W5UA 4QNRA 5BVHA 1P1KA 4X7MA 3KL2A 2OWEA 4IHJB 4JU9A 1EGVB 1P62B 2QYOA 1DS6A 1R6VA 4QJIA 1QB7A 3COPA 2P9HA 3GRUA 3MS2A 2F3UA 3IHWA 5IKOA 3W4IA 4NMWA 2BEUA 3SJZA 1SRQA 4EZEA 1RTKA 4XB2A 2O2HA 2JAWA 3W77A 1KRHA 2EG5A 3BZUA 3T5CA 2X23A 5KEIA 4DV2B 4NBTA 3ORSA 3MWDB 4FZ3A 3N8NA 3RTCA 2GBCA 5AVTA 3VPFA 4N9QA 1JIKA 1UPXA 3QNUA 5GOZA 2HW8A 2Z56A 2PWYA 4BLUA 1MC5A 4E2YA 3S1LA 3TG8A 1WEKA 1X80A 2XWSA 1Z5PA 4E0BA 1HNXB 2ZATA 1E1YA 3UT0A 1Y1QA 2YN2A 3FIUA 1CBUA 4JIMA 4MUFA 2C4VA 4PSCA 1QP4A 2HEIA 3PHGA 3GO4A 2WSLA 2NIPA 4ISCA 1WTCA 2QUHA 4X93A 3O8CA 5EAIA 1EQAA 2IZZA 3I1IA 3FDJA 3RRBA 5E9AA 2A0KA 3HZHA 3QX8A 2BELA 1XGKA 4LDAA 5KTYA 4BQOA 1L7QA 3WL6A 5C8XA 5C37A 1ICIA 2FUG6 4HLQB 5IM4F 1SD2A 4EA7A 4PGFA 4NS1A 1W4AA 4JLSA 4ZI5A 3H8WA 3N3AC 3QVTA 4CHGA 2CJFA 2C7BA 3BE6A 3IAEA 1KZHA 3AUKA 3OETA 2J3EA 1MF7A 5FL7D 2AQKA 2VP6A 4MMXB 2ZBQA 4L75A 4IGEA 3UMFA 4QG3A 1XKXA 3UJAA 4CETA 4TRMA 3RUDA 3BQNB 1I6WA 3F98A 4WBNB 1TE2A 1DVRA 3SZRA 1TMYA 3SIXA 4MIYA 3E53A 4FGLA 1NM5A 3C5WP 1W5SA 1NY6A 3EFEA 4DSUA 1IM5A 1Y3AA 5AQ1A 4TTIA 2Q3HA 4L7QA 1L7OA 1I4WA 1Y7HA 4OX9B 2AFHA 4A5OA 8LDHA 3RUEA 5KX5A 3KQYA 4YCDA 1Z2NX 4JOBA 2IYTA 4KCGA 1EVLA 3D6JA 2FE4A 1HRKA 1VB5A 2PCLA 3AG5A 3UT5A 4GKKB 1F8FA 4NV1A 1PFWA 4IFEA 2MOKA 5KYVA 2G77B 2FE1A 3GA5A 3PEUA 4JSTA 1KO5A 4MAAA 2YWJA 3NHUA 5EWMB 1A0OA 3Q15C 3VPDA 2R85A 2NZWA 3T06B 2EX4A 5CXXA 1MNAA 1CS4C 3GIDA 1WKBA 4MA0A 3A70A 1C7QA 5HMMA 4LY3A 4QBKA 4WGGA 1YMUA 4UATA 3PIDA 3RT7A 3I2GA 3T0IA 5KHLB 2PG3A 3L0YA 3ZDAA 4N8SA 5BQXA 1QFZA 2YDYA 5JD5A 3NMUF 3JYQA 1UMCB 4E14A 3H7IA 2FEAA 3CRMA 3HV0A 1SVMA 2NZXA 4E3WA 3R3VA 1W0KD 3DMFA 4TV9B 3UJPA 4L8FA 1Z74A 4O0LA 1VJ1A 4OXXA 5DX8A 4LF9B 2QUJA 3OIUA 3OFSA 4R54A 2M9MA 5KDOA 4BVEA 3AUXA 1UK8A 3SYKA 4EO9A 5KJFA 9GPBA 2XUJA 4U00A 1NW7A 1FQKA 1JIJA 4MMYB 5LBUA 2ON6A 4HAWA 4HI0E 4J0KA 2KPOA 3L0CA 3CRZA 1XXHB 3C5EA 4F2GA 4Q3OA 4HBGA 3GRPA 2WM9B 4FWIB 4W5HA 4ZHQA 1RJDA 4B31A 1LCIA 2OHOA 4RJKA 2PNFA 2DR2A 2VZ0A 3I4CA 3PD0A 2XZLA 2FOXA 2J6IA 1K5HA 3A7EA 4FOPA 1GAJA 3I6ZA 4G1VA 4EVRA 3EGXB 4JP3A 5J4LA 1XAJA 4ZOEA 5K45A 5THXA 2X3YA 4TX1A 5JSQA 2X76A 3LT0A 4PO8A 3IEXA 4L4SA 4EKDA 2HRCA 1LGYA 2Z8YA 4JI4B 2EDAA 3B9BA 5JWRA 1BHO1 4PHHA 2Y4OA 5LKRA 4NZMA 2QVLA 3CBGA 1VGRA 3EG9A 1OF1A 2XNKA 2Q6KA 4WXYB 5KNCH 3UV6A 4C20A 3N2KB 5TMDA 8AT1A 1KK3A 1VL1A 1FL9A 1OWLA 3AWIA 3QLVA 3FCUB 3D1LA 4QGHA 1M6HA 2Z58A 2E37A 1NBWB 1BN7A 1HE1C 3N5KA 3R4CA 3SPXA 3ZJYA 1E2MA 4I1IA 2LTAA 2W71A 3DO5A 3K30A 1N34B 4F12A 3ANLA 4B6GA 1CZUA 5KCZA 3FH0A 2JFGA 4N03A 3PEEA 2OXFA 1OH7A 1K8QA 1X7YA 4FFDA 3DFFA 2XNDA 3C4VA 4LXGA 5IJZA 1WMEA 2W6JD 4XUEA 1MOPA 3E8XA 5DRYA 1UIRA 1N5OX 2HY7A 3GAFA 4QXRA 4RTRA 4R2HA 1WPGA 3N7UA 1AZTA 3IUBA 5IHPA 1ZS9A 3LA6A 4IMRA 4L2IA 1VJRA 4N5IX 4JQYA 3BWCA 4EELA 2I7TA 1KNXA 1H5QA 5ALYA 1LX7A 1P60A 1MTZA 3C97A 3T0GA 1UM9B 3WNCA 5IANA 1Q0TA 4EEXA 4EJMA 3LQQA 3CCBA 1X7GA 3UMGA 1JMKC 1P7CA 3EIXA 3A6JA 3GJ8A 1JAIA 3URMA 3ED1A 3CF6R 3DBRA 3LDGA 1IOVA 3DD5A 1AIPA 1P5JA 4XSGA 2BMFA 2XXBA 4FW8A 5E4JA 4E11A 1XDBA 3GLTA 3KYIB 4Y2TA 5F2OA 1AKVA 4Q1EA 5FP0A 4L4XA 4NEQA 3D4IA 4BQSA 4DUYB 4QO7A 5TPWB 5EWLB 3ZV3A 1L5SA 3IELA 1O6CA 1W93A 3AB8A 1E2IA 1OWPA 3F6PA 2H4XA 3M8KA 4KC0A 2DWPA 1ZAYA 1KIFA 3VR1A 1E5VA 1T4MA 1GGEA 2Q1WA 3UW1A 4B3FX 5HK9A 1UKZA 1Y8QB 5COQA 3PXGA 3NOOA 3LZDA 3D5TA 1GSAA 3W1VA 3O8DA 1JPUA 1WPQA 1HT3A 1Z4IA 3A1NA 3E82A 3FJYA 2BISA 1G6HA 4PG4A 4YRFA 3V4ZA 1K0UA 2CNNA 1G5HA 2R7MA 3HM9A 2QLMA 3MAAC 2R6FA 1D6MA 3C3JA 4IIVA 4X1KA 5K2MA 1U2EA 4Q4LA 1ZYUA 4D9KA 1QRRA 2GN0A 4ZQEA 5HOQA 1GGHA 3ENNA 3Q72A 5TS2A 2DFVA 4PYNA 1EUYA 1UMBA 2K2QB 2PO5A 4KJZA 4M9XA 1GCOA 4G0VA 1EWKA 3VDRA 3VKFA 3HLYA 2ZSHA 5C8YF 1JDSA 3PHJA 1TO6A 1G18A 3Q5DA 4C30A 1K5PA 1TUBB 3IFSA 1I8TA 4H3HB 4U5XA 3O9MA 3QUTA 3I5YA 2C0PA 1MO6A 3QUSA 2CVPA 3IMGA 2J5KA 5CDGA 3BSYA 4INOA 3DPUA 2QRGA 1X38A 4RK0A 1WTAA 1L9XA 3UWSA 1X1SA 4RHEA 5AUNB 4RA9B 3QUAA 1M2NA 3Q6MA 4OXYA 3CZCA 4X95A 3K6SA 3GGDA 2IOQA 3G59A 4GZLA 1FQWA 4ZYWA 3QU7A 1DO8A 1UBEA 1XZAA 4PZCA 5FX2A 2ZQZA 5JI3E 1UL1X 1V39A 3PHBE 2X0JA 1B1AA 4BE4A 2VN8A 3HWX1 4UASA 1E2BA 5MN6A 1KETA 1NX6A 1Z7GA 2ZSKA 3OZWA 4JJ6A 1RMYA 4MRVA 3S5UA 4G5GA 1G8AA 3BL6A 2B99A 3AU8A 3JQAA 4IR7A 5I8ZA 2QIPA 4YXWD 1V2HE 1I94B 4YFVA 1PTJA 2V0NA 2CNLA 2ZS7A 1NL3A 5FJJA 5GVRA 4RIIA 3G79A 1DELA 3ODGA 4GYWA 3HV2A 1XZ8A 3I9FA 3DCIA 4LXYA 1R0SA 2X8LA 3Q98A 1YB1A 3A1SA 5FIUA 4LF5B 5FPSA 3NM4A 3DL0A 2RK4A 1JQEA 2R8RA 4A27A 4DR6B 1ZUNB 1US8B 2VAMA 3WV4A 1UKVY 1GAWA 4IDFA 2BH9A 2C57A 2VFAA 4IIJA 2JZOA 1DTWA 3REOA 5DH9A 3KLOA 2V9PA 4QTZA 3KOMA 3GMSA 3QX3A 3I0NA 1H5UA 1XZBA 2JDIA 4UJ3A 2PS3A 4LAFA 4TWBA 1YHNA 5CBKA 1QH1A 3PKJA 1CULC 2IYPA 4UMFA 2AI3A 4U7FA 1EUDB 4QUGA 1QO0A 4B4UA 4A1FA 5DULA 5AOAA 4TQGA 2OBNA 5EYPA 3LH5A 5CFQA 4C4PA 4P34A 5FBVB 1COWA 2ZG6A 3FWKA 3SYMA 3X1YA 1RCUA 2B8TA 5LDGA 3I2JA 1X39A 3WFZA 1QP7A 2A88A 4G9EA 4A91A 1S3GA 4E08A 3UQYS 2HEGA 3ZZTA 1N9GA 2QRQA 3KPVA 1WA5A 5EESA 1UANA 4D0SA 1KR5A 1JU9A 4XDYA 4R8KA 2ECFA 4EHIA 1F6BA 1T2NA 3QFHA 3AL0C 4LOKA 1I14A 3FF1A 4EUFA 2C4TA 1K7XB 3EXHB 3CN7A 1AA9A 2AV6A 3EHEA 3UJ3X 3WQHA 4BGUA 4DJEC 4DUZB 1QO0D 1HQYE 2ZLBA 4EGJA 2PIDA 1PG2A 3G2IA 4DYDA 3I9KA 5F1KA 1YZQA 2H7CA 2W6NA 5F21A 2MTBA 3LUAA 1XPOA 1ZUIA 3M6AA 2IU3A 1TIBA 1YZGA 2AJCA 1NJFA 4DBLE 5DB4A 1QGED 2I2WA 4MHOA 4BVAA 1L5RA 4WKNA 1Z4PX 4KMRA 1CP3A 3TZEA 3WIOA 3V9AA 4BJ1A 2ZIVB 4D99A 1FOEB 1WX1A 1QIGA 3LBHA 4QOHA 2F1JA 2JCGA 2V6GA 1BXRA 1HT1E 2YVAA 2QMOA 5B5SA 2PLNA 1HTBA 5TEVA 3FBTA 3ZLTA 1E2DA 1WB4A 2M98A 2HIMA 3IKJA 1B0PA 3SX4A 3QBVA 2P2CA 3JATA 4LE0A 4MP6A 4P8RA 3LBIA 1K27A 3I2HA 3OJ0A 3LCUA 1Y4SA 2YZKA 2ZEJA 4IHJA 2J30A 3WS7A 4BU0A 4C76A 4D9MA 4YUAA 3OZAA 5JXGA 2B36A 2V9ZA 1BFKA 3HDJA 3ILXA 2CKMA 1HTWA 3RUFA 2HJ9A 2FK7A 4QUDA 1U7PA 2FP4B 1RQRA 3I04A 4K1XA 2PRKA 4UHCA 2JD2A 4RV4A 1EE9A 3KR2A 2RKWA 4G1EB 3OG9A 4HDNA 2V74B 3CUEF 3SHQA 3UAXA 4F5YA 4EB8A 3TQQA 1MABB 3V46A 3R3ZA 1EG2A 1TKBA 1T26A 3ZWAA 3DF9A 1GPUA 4RSMA 2IIBA 4UREA 1LV7A 2ATVA 5JI2E 4R1NA 4LZWA 3EUAA 1NI4A 4A36A 2GA9A 4F84A 2NVWA 3LY9A 3I9LA 3B6JA 5TMPA 2O0JA 1DEHA 4EW1A 1P77A 1HSOA 3FCEA 4K1LA 2KHZA 4YV2A 5KQRA 1UKBA 4WIAA 5LZ4A 1IY1A 2XTAA 4XD7A 1JR3D 1V41E 3GNSA 1ZISA 1H5NA 5FULA 2M6LA 5E2BA 5REQA 2AC7A 1YA8A 1M1NA 3HVHA 3ODPA 1WDLA 4P7BA 4U9IS 3HJCA 1B8VA 5JSFA 1A7AA 5KYNA 1BE8A 1WXHA 4FWTA 3EISA 2GLUA 3I05A 3PDHA 1EP9A 1DKRA 4GMXA 3ER6A 1MQAA 4LF6B 1RPNA 1YAJA 1THMA 3T7EA 1U99A 3WJ1A 1GL9B 4DPKA 3SM9A 3OE7A 4XDZA 4B3TB 2C9MA 2O0LA 1NUQA 5CDHA 3BGWA 2YASA 5EJ6A 3R7SA 3REQA 1T0BA 2EWVA 2NT3A 1TCAA 4TYMA 5C1PA 1VMIA 2QNBA 2X1VA 4HGYA 5I5GA 3RIEA 3Q7TA 3L7NA 3UK7A 1CY7A 4RD1A 3RNOA 4KWTA 1B41A 2OLKA 3GGJA 5G53C 1J21A 1JAXA 2VYCA 3OP4A 4S1NA 3NNNA 4A0FA 4TLLB 5HXAA 3BE8A 2FW9A 4M1TA 4MDYA 4HF7A 3RT1A 3AEYA 2OV1A 3GJ0A 5EE9A 3OMXA 4MQEA 2XQGA 121PA 1U2GA 3FROA 3QMPA 4AZTA 4DRZA 1H3FA 4MPRA 1NQTA 1PO7A 4AY4A 3PZRA 3DKKA 1EH5A 4FR2A 4TKUB 3NDBB 1ADCA 4BQFA 4NBUA 5KNCD 1GSOA 2UYYA 3GLGE 4CLOB 3MM4A 1A72A 1J49A 5L3SA 5KWVA 3RSFA 3DNFA 3CW8X 3F4BA 5P21A 1KSGA 1NOKA 1IQPA 5EWLA 3MINB 2NZ8A 3QLUC 3LC1O 4HMOA 4UBKA 5D84A 5B64A 3LDUA 4PTZA 3BAZA 5ENVA 4KWHA 3AF6A 3SS8A 1JDZA 2VDRB 3TD9A 1CU1A 4CMKA 2MYPA 1BVRA 3RIYA 5EIEA 5HDQA 3HR7A 4M1WA 1Y98A 4OMUA 5JZOA 2PQ6A 1GU0A 1TEXA 3VHRA 3WLQA 2J09A 2K7FA 1MD9A 2C82A 5DNAA 3JQ9C 3BRWD 4PNPA 4N7JA 3BTOA 3IBGA 5CX1B 4O08A 4CMIA 1NN1A 1T91A 3OD1A 1U5CA 2Z2ZA 4BASA 2SKCA 3PGJA 4YJFA 1PR0A 1Z38A 2VJBA 3GT3A 3MRSA 1NC3A 2JFPA 1SK8A 1BCRA 1NKSA 2WFAA 1GGJA 3DFMA 3LP8A 1EX9A 6REQA 4HOYA 2XSZD 3INYA 3DOCA 3FVVA 1ZVJA 3ZE9A 4YRJA 1YK1A 5LVAA 1C41A 2Z4SA 4D9FA 3IB6A 3DE6X 3AUUA 3GJQA 5FWAA 5I4IA 2QQEA 3GARA 4ZVMA 5J4KA 3R8FA 1VE3A 1EFTA 3AV0B 3MXTA 3PJEA 4KACA 5DX1A 4FFWA 3QKRA 3R7WB 3M9LA 5IT9A 1A5SB 1QGOA 4RTOA 2UU9B 1MJHA 3ZH2A 1CLEA 2E4UA 4TQUS 3I52A 2SECE 2B6NA 3RCBA 4ZEMA 3U3JA 3VNBA 4BZZA 2Z2XA 1U2TA 3MF4A 2D06A 5H82A 3C8UA 2HA0A 2OHGA 4Y6LA 3UANA 1ZRHA 1E0JA 2XOEA 4HSGA 4OX9Y 1EQUA 4KQIA 3C1AA 3NC0C 1GQRA 4IS3A 3WIDA 3WG9A 1G2OA 3VVMA 1AB5A 2P2LA 3EIQA 2JARA 1IZYA 1EFVB 2JB9A 3DE4X 3ANXA 1Y1SA 1ENZA 1JMVA 3DBVO 3FNEA 5FJIA 1DLJA 4BUJA 5LP6A 4ETIA 3FWZA 3EXEB 1NLUA 3ILHA 4QUEA 2G1JA 5HK8A 2EHJA 2X8JA 3A11A 2QB5A 4K6HA 3RC2A 4JODA 2K2WA 2WVHA 2B4TO 3WGTA 1UBJS 5ITZA 1AS0A 1VA4A 4DEXA 4W7SA 4HX9A 1CQWA 4EFMA 4MW0A 4TTSA 3E7PA 2A0WA 3E22A 3DDWA 3U17A 4A9AA 5KWEA 3DEZA 2VH1A 1MGOA 4CCAA 1IBSA 1NU8A 2D2VA 3GYBA 1NBME 4CI9A 5BW4A 1YUNA 1NQUA 5I9BA 4Q3KA 4CI0B 5M04A 4I50A 4AS2A 3JR3A 3EXHA 4R8VA 5CIYA 3AVVA 4GPBA 2OC4A 3WMFA 5JNLA 3PTAA 1XN1A 2GD0A 2J9RA 5BURA 1XPRA 4GLFA 1W7AA 1BQ4A 1KAOA 3F4KA 3CPEA 1CR4A 4ZV7A 4E1AA 3K0KA 1BD4A 3FMOB 1L6IA 1Z8HA 3LSTA 3W6NA 5A2GA 1LSUA 5IK2D 1QYVA 5HDBB 3DAGA 1UDRA 4FHEA 3V6LA 1TZKA 2PRYA 5E6SB 2QROA 2HK7A 4G5RA 3KZ1E 3LYAA 3U4IA 2RGAA 1OKKD 4EQZA 1XX6A 1E2KA 1M75A 2B8EA 2ZB3A 4N3BA 2P7IA 4REOA 2NVUB 3CEMA 3SAJA 5HNKA 4X3PA 1TT5A 3I5MA 4LOAA 4NAVA 1B15A 2D8AA 2H5JA 8GPBA 4JFRA 5F7XA 1PL7A 4U3JB 4XZ3A 1A98A 5A0TA 1G5FA 4JLUA 1OYYA 2XKJE 4IDCA 4AL4A 1IN7A 2EARA 5AESA 1MEJA 3GW8A 1XELA 2CUTA 3I8OA 4P92A 3TRDA 4MP3A 4YA6A 3AVXA 4DC1A 2QHXA 2R2AA 4QQFA 1JSXA 3TE6A 8MHTA 1DRVA 4HLCA 1J2RA 3ANMA 4PBSA 3S6JA 4D80A 4R71A 5HS6A 3OTOB 3I6YA 4X61A 3URKA 4J7CA 3WHKA 4L5JA 1GCGA 1WCV1 4JC5A 4R8RA 3VYTB 1DEOA 2F6RA 3Q3HA 2QG6A 4GPEA 3A6HA 1MRZA 3N76A 1W9MA 1ZK1A 3TOCA 1LXCA 2RGXA 3MFYA 4QULA 5E8JA 4GX0A 2X8JB 1IVNA 1FLDA 2Q27A 3AJEA 3ZG6A 1CDEA 5KC9A 5LP6B 3MFQA 2EATA 1VBNA 4LY9A 4BJHB 1SCDA 3P27A 4EL5A 2CLHB 1C3VA 1J0XO 4D56A 3VC2A 4IDNA 4R69A 5KWSA 1WRBA 3F5QA 1O03A 4FJ0A 1Z75A 4LA4A 3OOHA 4JP1A 1KDZA 4B32A 4AY2A 2WJAA 3U3ZA 4L9RA 3MPUA 2JGFA 2HA3A 4HFMA 3UMCA 2B94A 2X41A 4L72A 1G98A 1NNSA 2QM7A 4B4WA 3RR2A 1JTEA 2BFFA 4BWYA 2GWHA 2HMUA 1GU7A 1L5YA 4Q47A 3PUHA 3DL7A 3L7LA 4RQBA 3ZI4A 3P9RA 3EJWA 2N1MA 3NATA 4MV6A 4ZOCA 4D46A 1D03A 1VQ1A 1XVAA 2R7NA 3EAGA 3DEYX 2HHLA 3A4NA 3KO8A 4OIFA 3QLEA 4GOKA 1Z7YA 3V4FA 4EUEA 2J3HA 4L16A 2FWNA 4MR9A 2P6OA 4GUDA 2NTEA 4P84A 2ODPA 3X1XA 3ETCA 4QYIA 4EHAA 2ZCUA 3VFDA 5JECA 4MVJE 3LHDA 2CJXA 3SICE 2IBSA 1EIWA 4MVJF 2Q7XA 1PFUA 2AOUA 2BD0A 1Y8RA 3DG9A 3NYWA 3R7DA 2P9JA 3VOSA 4XVUA 2MYUA 5C9ZA 4ESEA 3CX8A 1C4WA 1DEXA 3Q8WA 1R0ZA 4CBVA 1Y82A 3ISJA 1A04A 3I28A 4LMAA 3E9MA 4PEVA 4RADA 3OD5A 1P61B 1TA0A 5GJVC 1PU2A 4JJFA 1SUBA 4NR0A 1NV9A 3WGUA 3NOQA 3CNEA 3OIYA 1FJXA 1H85A 4G5SA 4B43A 3AEQB 2WZQA 2YV5A 3KQHA 4H35A 2VDUE 2XF8A 3OZCA 2GN1A 3ZS9A 3GU3A 2IYNA 5A03A 3DXFA 4KITB 1GDDA 3BCHA 1RHRA 3JD1A 4MQUA 1M74A 1YR9A 4FR5A 1S9HA 1R6AA 5TDHA 4ZN6A 2Y1CA 3IULA 1SWWA 2QI9F 3KQUA 3TQCA 3KHUA 4CLHA 4ITUA 2D6FA 3CH7A 1A5TA 4JVLA 4W7IA 3THRA 2BLLA 1JJIA 2P0YA 1G5IA 2Y0DA 3OFND 1P75A 2FK8A 5F76A 4MZDA 4JC8A 5C80A 3DBRB 4H3SA 4DQ0A 1R0RE 4D41A 5SZKB 4TPKA 3PLAE 3DV0B 1HG0A 2Z1NA 3SBOA 2EKBA 3TRKA 4AJOA 4DIFA 2HYIC 1US8A 2E82A 2GK3A 3V7YA 4C4OA 4EI2A 5JEEA 3DWIA 3WAJA 4KJXA 4EY6A 3VNUA 3JQFC 3UFXB 1N2XA 4PO1A 3EWAA 4LQ4A 4R8SA 1X19A 4D0NA 3JD3A 3CF2A 2GEUA 1JNYA 1YOVB 2XMDA 3LHIA 2YHIA 5JIBA 4N7BA 3GY0A 2V7GA 3AR5A 1ECCA 1KDTA 3DSRA 3HB4X 3DO6A 3N8IA 4RZSA 1SUFA 2ODWA 2VBCA 4FCWA 5IAAA 2DTEA 4QLAA 4BNDA 1KZ1A 1EK6A 1SJ9A 2VJCA 2R86A 3CTMA 1J7KA 1ZRMA 5SICE 3U80A 5JWOA 4CM9A 1YR1A 2G82A 3LECA 4KOEC 3HE3A 3NOVA 4QRDA 2CUKA 4TTJA 1VLQA 5K6RA 1DT3A 1NIJA 1WLYA 1V1MA 3WYFA 1XDWA 5JROA 1KI6B 2C4HA 2WKRA 5IXYA 4CIBA 1EP2B 4HN9A 1AF4A 1CEEA 1L7MA 3NJRA 2DHCA 3SKYA 3MYRA 3OCWA 2DFPA 3OBBA 1W4CA 4CKEB 3QG1A 4QG7A 4BYMA 4MDEA 3PGVA 4W5TA 1F4PA 4NWIA 1I4OA 5B2FA 3CLVA 2HM7A 3NALA 2BSQA 4LF4B 2M1ZA 5I9NA 3RASA 2P3OA 3KTAB 1GZHB 3IERA 3M1LA 1WABA 4G36A 3ZU2A 2P1DA 1QGAA 5KQGA 3OPMA 2F3TA 4Q3AA 5CXUA 5KNBA 1Q44A 1NUTA 2AMYA 3NHJA 1AZLA 1NTOA 1OLUB 4JLAA 4Q82A 4NDAA 2IW3A 3P9KA 3SBEA 3DAOA 3ZGOA 2WC1A 2HHCA 3Q9NA 2C97A 1IQ0A 1X80B 3U56A 3QF7A 3AB3A 1CD5A 4MEAA 1KAMA 4PFSA 2YWGA 2BEKA 5ICMA 1OUMA 1SH7A 1N6LA 1X0XA 1LQ2A 1G2QA 2IP1A 5LOVB 1XDSA 3WC4A 1Q1QA 1I10A 2NYRA 3VKGA 1KI1A 3MUFA 5EXXA 1EBBA 5LLDA 4GBMA 4YUWA 4J4BA 4WZBA 1CY2A 3T3IA 1ZOPA 5CT4A 2HD4A 3IUNA 3ZDBA 2OXEA 1IH8A 1QIMA 3AETB 1P9NA 3OT5A 5DTQA 1Z34A 1JRLA 3EIEA 3WTBA 5AVYA 5LXTB 4I99A 2JF0A 1U1DA 1XVVA 1WIWA 3T7KA 5AIBA 2VRWA 4EFDA 3I4LA 4YRCA 2LD4A 1IEWA 2VHEA 1UDWA 3AXTA 2WAOA 4JLVA 2ZRKA 3WBBA 3NV9A 4KSCA 1ZICA 3GGCA 1IM2A 1XT6A 3Q5EA 3UMVA 4D74A 3D0OA 3GRAA 3MQ2A 5LOVF 3KE9A 1MO3A 3L2OB 1FFCA 2D2XA 4TXLA 5FA5A 1E3DA 2XUFA 2WPDA 4MI9A 1F06A 2O05A 4MR7A 1H6BA 4OI2A 4LSGA 4R81A 1C8LA 1JBKA 3H3FA 4ZMRA 3FVWA 1LZKA 1IZ0A 2CNDA 1HLPA 2AOVA 5JPDA 1XU9A 3RAPR 2HREA 5JZVA 1SXJA 1RRPA 1THTA 2VCYA 4V38A 4BO7A 2PH7A 1USIA 5FB3A 5BYBA 1TUEA 1FQOA 1AQ6A 1P1BA 2I55A 4NI5A 1YS7A 1YXMA 4EQ6B 2X13A 3WWOA 1N2CB 3AHCA 2ZJZA 2EZUA 4ZMBA 1VXRA 1C9YA 5DGTA 3T9CA 3JXEA 1QF9A 2L82A 3LOUA 2O3TA 3K9BA 4NY1A 2GHQA 4OQLA 3HR8A 1L5GB 2X8WA 4RMHA 2OK7A 5G4LA 4RF5A 3THYB 1YFLA 5KYUA 3QUQA 1UBUS 4OKNA 2PA3A 1IHDA 2IHYA 1T13A 3KJHA 1SXGA 4WN9B 1YR2A 4I3GA 2AQ8A 3WBJA 4BGDA 2Q3CA 1X0VA 1QHGA 1CHNA 1VZ2A 4IG4A 3KZVA 5DSTA 2F3PA 3CF0A 3MXOA 4P4SB 5K0EA 2IHNA 3PT9A 4KAXA 5TE9A 5CBPB 1X7HA 2JFNA 3OKPA 1CRZA 2Q2OA 5DN9A 3P5BA 1I3LA 4ECEA 1ZQ1A 4EVSA 1R9GA 4GI3A 1JE1A 4QUIA 2YY6A 2OOKA 1V6CA 1XUOA 4A6XA 2GPWA 2WJHA 1EZ1A 2QP9X 4Q4AB 3ZTTA 4TM7A 2ERCA 2WFZA 4WZBB 3PXEA 1U3UA 3HB5X 4QARA 4Q39A 1E3WA 4XQ9A 1XCMA 2F1OA 2PS1A 4FINA 1H8HA 4RY2A 1I9CA 5ERXA 2JIQA 2GN2A 1KEEA 2DBVO 1CJBA 4HNAB 2VXCA 4BRZA 5IDWA 3BJZA 1SZDA 1U31A 3LWBA 2ZSUA 1VBKA 1PN3A 1YZKA 3LBFA 3GVPA 4CG2A 3FNIA 3T1HB 4ENTA 3NANA 1YZFA 1PGQA 3GB9A 4R98A 2XOKD 4MINA 4KQMA 4UTOA 1PNRA 1MFPA 2WNIA 4P4UA 1YOBA 2GKOA 2HF7A 3E4DA 3RS2A 3U1TA 2J46A 5BW8A 3PI6A 4EG4A 4YR9A 3RLFA 5TMEA 2C3YA 1E89A 1PNQA 2A67A 2XWBF 1LVUA 1SFRA 3TUZC 2PHZA 2CXHA 4JI3B 4W5RA 421PA 3AEQA 3GGSA 3OHSX 4F8JA 2CYBA 4M2LA 2JLXA 2FWJA 2WJYA 2VNIA 1UCFA 5A4AA 4UEKA 1P6XA 2FN7A 2FWPA 2HWWA 2QVBA 1S2NA 3B89A 3GFRA 4EPRA 1UFKA 1KO7A 1DOZA 3MIIA 2D1RA 1I2CA 2PVCA 1R10A 1N2IA 4L8LA 1LTHR 2YCLA 1LPPA 1IWBB 2H1CA 2PN1A 3B1KA 3K1YA 4WOKA 2CLFB 4FVTA 3D2CA 4R51A 2O4UX 1G8SA 2O5CA 4PY2A 1XNQB 2AOUB 2PL3A 1TUIA 5K2OA 1Z2EA 3LY5A 5K3DA 3FTCA 2JFFA 2XE4A 3Q6NA 1F0KA 2IEAA 2I0FA 2IYAA 3PC7A 5C34B 1H6DA 4DRXA 3VZPA 4JB3A 2OB2A 4OBWA 4B3RB 4KIUA 1O96A 3PE3A 4UNIA 1YS9A 2OZKA 4HWOA 3KWLA 2P6RA 5KYKA 2JBHA 4L28A 4Q4AA 4BQNA 1X7WA 1G16A 2IGBA 2NLOA 1AGXA 3DHNA 2ZJ0A 3TRHA 3DDUA 3OKAA 3AJAA 1CERA 4HYEA 1CNEA 2JLWA 5IAGA 5JMPA 3IUEA 1VG9B 4N0EA 5EKDA 1JQAA 4GXTA 3TDMA 3WJ2A 1EFLA 5CCEA 1IONA 1UT5A 2PT7A 5B1IA 1E4EB 1G7RA 4UJ5A 1BX1A 4ZVKA 4NV3A 4DMKA 3NYIA 4INJA 5E4YA 3U37A 4RO0A 2UYGA 1OVGA 5DHQA 1R6BX 2H1RA 2XECA 1EU1A 1RKXA 1GTSA 1GL6A 3SNHA 2FR8A 1V9CA 1P0MA 2G9ZA 1RPAA 1HFJA 2C4WA 2O2DA 4N3NA 2E5FA 5EQFA 3T7RA 5IJ9B 1XP5A 1DT5A 4D0RA 1Z6AA 1JI3A 1K88A 1GRQA 3GP3A 1KEZA 2COKA 2EBHX 3BSFA 4UVIA 3A3PA 3OC6A 4R1UA 3BD9A 4EOGA 4LUCA 3ENQA 3KAKA 3WJAA 3W04A 1LBEA 5CH3A 4LJSA 4AQYB 4OL0A 1IPFA 4JYPA 3AP3A 3T1YB 1EK0A 5DO9A 1SKYE 1OAOC 3COSA 3WYDA 2GUGA 1BJKA 3U4AA 3HN6A 5TARA 1WDTA 1OU0A 4EF5A 4P83A 4WNYA 4BMOB 4AUEA 5J4VA 4P38A 3USCS 3WLPA 3KQOA 2FTKE 4RVCA 1JU4A 2GAOA 3LHKA 4FDLA 4BO0A 3SHOA 2NXJA 3FOEC 2HDOA 3H6KA 3TCKA 4JI7B 3KWJA 5ALJA 2HJSA 3LU1A 5TLSA 3NTUA 1B14A 1NR7A 5KJCA 1OASA 3DUWA 1C1YA 1RADA 4LDJA 4RH1A 1FU4A 1ZHOA 2MMCA 5CDFA 3CPHA 4WXRA 3D8NA 1IXKA 3HCBA 3L05A 3PVCA 2I7CA 3AETA 3ZE2B 4RFSA 3O73A 4URYR 3RTDA 2PKRA 5L7TA 1JF8A 2Q9CA 4R3NA 2BE7A 5LP6C 2GPJA 4KLAA 1QRTA 7MDHA 3OCXA 4RY8A 2WMNB 1TUGA 1OKKA 1T5BA 4KFSA 2VF4X 1B0ZA 3ZR4B 2EZ4A 1RAIA 3FDFA 4FDVA 4A0RA 5DISB 4AURA 1CUJA 3Q2IA 1KRXA 1XJWA 2YFYA 2HPAA 4GMGA 4H16A 3ZXIA 4JT4A 2QRJA 3IBSA 3M89A 3D6HA 4IGKA 4L22A 1ADJA 3TZ6A 1OFUX 3PEVA 4RL6A 1N7IA 1FFDA 4CG0A 1F5SA 1OLXB 4FHFA 1U9IA 4NPAA 821PA 2FQYA 3L7MA 3ED5A 2WAYA 3AB7A 3B5JA 4XVHA 3TLKA 1N32B 1E7WA 1V4BA 4G8BA 2AW3A 3NWOA 2OL4A 1PLKA 1ZJJA 4HTAA 1DAGA 2QN3A 2VPXA 3FPAA 4PLWA 5A1JA 1R9JA 2B1JA 4BFCA 5LYJF 3JAWA 4HDMB 1SXHA 4CMJA 2FUKA 1IXYA 3WLEA 1ZONA 5CU7A 2AK2A 3NBKA 1CEQA 6NULA 2GZ3A 3K5WA 1KF0A 1M73E 5AVJA 5UKDA 3TAHA 3TQTA 3MTGA 2HLNA 5LLTA 3SY8A 1IOLA 2R47A 4RX1A 4UEJA 2P9FA 4JJAA 5TJHA 3EIHA 5A62A 5B3AA 3QPVA 4KPGA 3ZKWB 3IDZA 3DDOA 2DG2A 4MVWA 1K2VN 1U98A 1XA3A 1OJLA 2PVSA 4J16C 2ZUTA 3ZDFA 3C7CB 3LRXA 4AIIA 4BKUA 4DIOA 1TVKA 2H4JA 3ZC3A 2Q1TA 3BJRA 1L1QA 2B98A 2XUZA 4Q9IA 3FI0A 3K73O 4YAKA 4C4ZA 2FLKA 3L6DA 1RYFA 3QIAA 1KIAA 4MGZR 5LBIA 1W36C 4FOOA 1UXIA 4IUCS 1B6RA 2W48A 1WUTA 4CN8A 3RU7A 4IZIA 4EF6A 3CVOA 2G70A 5LP6F 4AP9A 2VA9A 3G9XA 3VVBA 4E5NA 3Q2KA 1OIVA 1GTMA 1MG5A 3GLFA 3L0OA 1DXQA 4AKHA 1OE0A 3MGBA 3UXHA 4RSGA 2ORIA 3ZW7A 5A4FS