2FPOA

Putative methyltransferase yhhf from escherichia coli.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
183
structure length
177
Chain Sequence
GQIRIIGGQWRGRKLPVPDSTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methylase yhhF
publication title Methyltransferase that modifies guanine 966 of the 16 S rRNA: functional identification and tertiary structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 56
structure length 177
sequence length 183
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.171: 16S rRNA (guanine(966)-N(2))-methyltransferase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fpoA00
3Q7EA 4QQKA 1NW5A 3BWCA 3EVGA 5GM2A 1ZG3A 4KIGA 2EJUA 3UJ7A 2C7RA 1XJ5A 5T6BA 2PY6A 3G8BA 5M5BA 3REOA 4QTUB 5FUBA 3EGEA 3AXTA 2OB2A 3NWBA 5D1HA 3P9KA 4IWNA 3JWIA 4BLUA 5K0GA 4E2WA 5K0CA 2AVNA 5EGSA 2AR0A 5GWXA 3EVEA 4DCGA 5T64A 3LCUA 5K0EA 4E2XA 2PXAA 2PV0A 3KR1A 4PYMA 3OFKA 3G89A 3GNLA 2CWWA 2PX5A 3LBFA 1NW7A 3EVAA 1G8SA 1VP9A 1R8XA 1JG3A 2YXLA 3LL7A 2CMGA 4GBED 4HGYA 1N7JA 3U81A 5GOZA 4X60A 3HCCA 4E32A 2GH1A 3ELUA 2XVAA 3F4KA 3I53A 2WA1A 5EOVA 3NVKI 3SX0A 4AZWA 1QAOA 3FYCA 5K09A 2NXEA 3TM4A 3KPUA 3KQPA 1RJFA 2WK1A 5IKMA 3BGIA 3HA5A 4Y2HA 3UA4A 1JSZA 1F38A 3M70A 4DA4A 4QQNA 4RX1A 4ER7A 4C04A 3B89A 1SQFA 3G5LA 2E5WA 3R9XB 3DXXA 3E8SA 1FP1D 5DM2A 4P7GA 1H1DA 4C05A 2ZZNA 3MTEA 2EFJA 1D2GA 2ZBRA 3IV6A 5KS2A 3A7DA 5EZQA 4BLWA 3A26A 5EEHA 3SSOA 1QAMA 2NP7A 3VYWA 1B42A 1O54A 4FS8A 1ORHA 3KPJA 1O9GA 2OZVA 1NE2A 2B9EA 2G72A 5K0BA 3OCJA 2H00A 2YTZA 1VPTA 3IEIA 3P2EA 2GLUA 4R8SA 5C0OE 2NP6A 2EX4A 5GP1A 4C08A 4DQ0A 3HM2A 4M36A 2ZZMA 2VDUE 3KQWA 2QM3A 5CCXA 3MGGA 2YX1A 1JQ3A 5FA8A 3AJDA 4DCMA 1XVAA 3TLJA 2AVDA 4KW7A 3NWEA 3V8VA 4B17A 4RVFA 5E9JA 3E23A 4KDRA 2B25A 3MAGA 5DX8A 5FADA 4YMHA 4LECA 3R24A 2FK7A 2IBTA 2PXXA 3TOSA 2AOWA 4QVKA 5EIFA 2GAFA 2GS9A 3BWYA 4YMGA 1WS6A 3OU7A 4KIFA 2P7HA 2AOUB 4YUYA 1KXZA 3LPMA 2DULA 3OFJA 4HC4A 2P3QA 2PWPA 1JSXA 4LG1A 2HV9A 3DLIA 1XTPA 3LX6A 1VP3A 4PIMA 4PYQA 3OU2A 4IKPA 5FTWA 1NBHA 5FCDA 3G2MA 4QPPA 1WY7A 4CKBA 1INLA 3CVOA 3TKYA 3KPVA 2B3TA 3BZBA 1R8YA 3FZGA 2ZWAA 3EVBA 1U2ZA 2NNWB 3O4FA 4M37A 5CD1A 2IH4A 3TFWA 2PSSA 3TKAA 3DLCA 2VZ9A 3THSA 5LQJA 3PFGA 3FUVA 4XCXA 1MHTA 1T43A 3G2PA 3PT9A 3G2OA 2ZBPA 3HA7A 3ERCA 2ZW9A 2AOUA 1L1EA 1DCTA 3KU1A 4X1OA 5DX0A 3CJTA 5LSAA 4PCLA 3LDUA 4PYIA 3R3HA 4RVDA 5G02A 5LQCA 5E9QA 3SSNA 4YUWA 2P3LA 3NTVA 3T7TA 2Z6AA 5K03A 1VE3A 2PJDA 2VDWA 2YVLA 4C03A 3DMGA 3DR5A 8MHTA 2AOVA 5EPEA 4MHTA 4V0RA 3KHKA 2AN3A 3GIWA 4PWYA 1HNNA 1L9KA 4FGZA 2O57A 2H11A 5K8VA 2AN5A 1G6Q1 3FTEA 3PVCA 3LKDA 3CJRA 1D2CA 5GM1A 2O0LA 3KR0A 2PXCA 5EMMA 4QDKA 3UJBA 5E1MA 4KRGA 5ICGA 2JH8A 3LSTA 2UYCA 3P9CA 1FBNA 2IPXA 3BKXA 1YFJA 1QZZA 4CKCA 1JG1A 3UZUA 3GRRA 5MHTA 4P58A 4RTSA 4DKJA 3EVZA 1ORIA 4OA5A 5EIWA 3BGVA 2H1RA 3UJ9A 3I58A 1YB2A 3FPGA 4ISCA 3QOXA 1RI3A 4GOND 2ZULA 5DTQA 3GRVA 4YV2A 2G70A 2AOTA 3HVHA 4MWZA 1Z3CA 5LQKA 4RYLA 2XYRA 3PX2A 2BM9A 5FWAA 4ATNA 3FTFA 3A25A 3VSEA 1M0EA 4ER5A 4RVGA 3LDFA 4GOMD 1SQGA 4OQEA 2UZ4A 5CM2Z 1ZGAA 4CTKA 5DX1A 5GIPE 2C7PA 2PGXA 4OA8A 2FPOA 3UJCA 4RTPA 3IHTA 2GA9A 3GRZA 4IV8A 4G56A 3T7RA 2HTEA 3SSMA 2BM8A 1ZQ9A 4E2ZA 4RTKA 1YZ3A 3IYLW 3KR9A 3EGVA 1NBIA 3LKZA 4H0NA 4MTLA 2ZZKA 4P7JA 1KP9A 3CJQA 3G5TA 5DRTA 3NW9A 3TMAA 3ELYA 2OY0A 3Q87B 4QPNA 3P9NA 2HMYB 5P8WA 2OB1A 3B3JA 2JHAA 2VP3A 1KPGA 3NDIA 4AZTA 1PRYA 1XXLA 3UJ8A 4GC5A 2ZVJA 2O07A 1OR8A 3PB3A 5HIMA 3EPPA 3HCDA 1YF3A 1M6YA 3OE5A 2JHPA 2XYQA 3FPJA 5EVJA 7MHTA 5K01A 4MQ4A 2G8NA 5CVJA 3FUWA 4R6WA 2QYOA 4RSRA 3D2LA 3SVZA 1WXWA 3HP7A 2YXDA 1SUIA 3FTCA 4QDJA 3BUSA 2WA2A 4OBXA 3FTDA 5EZSA 4HSGA 2QY6A 3VC1A 5BXYA 9MHTA 1RJDA 2GB4A 3GO4A 3P2IA 2IGTA 3LBYA 2EJTA 3KPWA 4M38A 4RV9A 1WZNA 5CVEA 2UYQA 1NW8A 1EAMA 1NKVA 1EG2A 1G55A 1NT2A 3SGLA 3AXSA 3NDJA 1YFLA 3FRIA 3AY0A 4O29A 3KQSA 2VDVE 5FHRA 3HCEA 3E05A 2P35A 3OE4A 4FSXA 2ONZA 4WVLA 1RI2A 2PKWA 2PX2A 3KKZA 3B3GA 3E7PA 4Y30A 4POOA 4PGGA 4YUVA 3RW9A 3LCVB 4OBWA 1NW6A 2G1PA 1EJ0A 1P91A 4GQBA 2FRXA 1EQAA 4CXMA 3UBTA 3C3YA 4X63A 1TPYA 4HTFB 5GINE 2Q41A 3CGGA 2YXEA 2ZFUA 3TQSA 5E1BA 3FRHA 5HFJA 1O9HA 2AS0A 5FWDA 1XCLA 4U7TB 4IV0A 2PBFA 1BHJA 3OZTA 4QVGA 2JG3A 3MHTA 1JR4A 3A4TA 5HILA 2ZSUA 1ZHFA 5E1OA 2YUIA 4CTJA 2Z6QA 5D1NA 1WXXA 3EMBA 1KHHA 2EG5A 3BWMA 4GC9A 4PIPA 3M4XA 3QOWA 1VQ1A 2K4MA 2PWYA 5E8JA 2FHPA 4Z2YA 2ZCJA 1YZHA 3GU3A 3S68A 3H2BA 3GWZA 4PONA 3HCFA 1FJXA 3K0BA 3PFHA 1UIRA 4PYOA 1L3BA 3A27A 1G8AA 3P2KA 5LQUA 2BR4A 4HTFA 3VC2A 2P3OA 3I5UA 2XYVA 3FPHA 5DLYA 4GEKA 1TW3A 1BKYA 2Y1XA 3BGDA 3FUXA 5DM0A 2C7OA 3ER8A 4YUZA 3OPNA 5KQRA 1EJ6A 4GOLD 5HZMA 4GOOD 5LQAA 1KIAA 1SG9A 1DL5A 1DUSA 5K0JA 1FP2A 3DH0A 5LR6A 1V39A 2AOXA 2Y1WA 5EMJA 2AN4A 1P1CA 5EKXA 4AUKA 5DXAA 1RI5A 2FYTA 1KYWA 5EC8A 1R74A 3TM5A 3HTXA 2I6GA 3WSTA 3HA3A 3OZSA 3OZRA 2NXCA 2B2CA 3JWGA 4HGZA 2QRVB 4AZSA 5T67A 1IXKA 4LWOA 4RTRA 2ESRA 3I64A 1IY9A 3M6UA 4DF3A 3EGIA 3TPZA 3KQOA 1KR5A 5DTRA 5C9ZA 3HEMA 1XCJA 2ORED 2G71A 2P8JA 2YR0A 3EMDA 3DULA 3K6RA 4PYKA 3UJ6A 2IH5A 3HNRA 1BOOA 1R00A 2R6ZA 4RVHA 2P41A 4FZVA 2CMHA 2JJQA 4CKEA 5EMLA 3DXYA 3DXZA 1F3LA 3M6WA 4KVZA 5IH3A 1VLMA 2VS1A 4PNEA 1AQJA 4LWPA 3KQVA 3GRUA 3BT7A 1UFKA 3THRA 2BR3A 3FUUA 4FT2A 3M6XA 3C6MA 2QRVA 1R6AA 2HR1A 2GPYA 4XUCA 2PT6A 2IFTA 2F8LA 1R18A 1X1CA 1NV9A 1RJGA 3B3FA 3PS9A 5E1DA 5DM4A 1JG2A 1FPQA 3UFBA 3NJRA 3KQMA 4R8RA 10MHA 4DZRA 2BH2A 3CKKA 4EKGA 2OPBA 2FK8A 4FSDA 1KPIA 3LDGA 5DWQA 1VBFA 5E2BA 4EKIA 5DPMA 1D2HA 5B1SA 3EVDA 2XVMA 3NVMB 2UYHA 3P9IA 1M6EX 3SR4A 2ZWVA 5H02A 3M33A 4U7PB 2KW5A 4V0QA 4A6EA 4BP3A 4E30A 4EK9A 3B5IA 2CKDA 5DT2A 2PVCA 4UOEA 5GIOE 2O06A 4OQDA 3ORHA 3SMQA 1Q0SA 3HCBA 3TRKA 3EVCA 3UA3A 3GRYA 4HG2A 4XUEA 5EG5A 3V97A 1RI4A 2JH9A 4K6MA 4DM3A 3X0DA 2I9KA 4E2YA 1JTEA 1I1NA 2IP2A 5CVVA 2JHCA 5FQOA 1X19A 1ZGJA 1MJFA 5FA5A 5HIIA 2OO3A 5FHQA 2IIPA 3A7EA 3C3PA 3FPEA 1TW2A 2V74B 3UJAA 1NV8A 3DTNA 3R0QA 4RTLA 5CCBA 2O05A 3MTIA 4ER3A 2IBSA 5E2AA 3HVKA 2ONYA 3LECA 1JG4A 5CIYA 3DOUA 2IDKA 1VIDA 1PJZA 1QANA 2P7IA 3G88A 4QTTB 4BP1A 2HWKA 4HRAA 4C4AA 5LQNA 2UYOA 3BKWA 4P7FA 1N2XA 3O31A 2NXJA 2ZIEA 3G8AA 1QYRA 2NYUA 3FYDA 3DP7A 3GDHA 5LQRA 1RI1A 4YUXA 1G38A 1I9GA 1NW3A 4A6DA 1SKMA 3KR2A 5ICEA 2ZIFA 5F2KA 1Y8CA 2DPMA 3SXJA 4XUDA 2PLWA 5C1IA 3FPFA 4RTOA 3PTAA 2B78A 3G2QA 3LHDA 5KQSA 5CUQA 1X1AA 2ZLBA 4ZTBA 3T0IA 3HVJA 4GF5A 3BWBA 3UWPA 4F86A 1YUBA 1VL5A 5CVDA 4AX8A 4PYLA 5FQNA 4C07A 1QAQA 4RTMA 1BC5A 2FCAA 2PX8A 2PT9A 2ZBQA 1P1BA 3KQQA 3LCCA 2XBMA 3MCZA 5F2OA 3MB5A 3EEOA 5JUWA 2OKCA 1AF7A 3B7PA 3G7UA 3P71T 4MIKA 4CWAA 1XDZA 3LGAA 1UWVA 3QV2A 3OU6A 1N7IA 5DRYA 4ER0A 1EIZA 3DMFA 1JQEA 4NECA 5KYGA 5FULA 5BW5A 3ER9A 3C6KA 1RJEA 3CCFA 3PLAE 4P7KA 3EVFA 4AZVA 2IH2A 4PGHA 4WXHA 1P39A 4R05A 2HNKA 3NMUF 4R6XA 5ERGB 1HMYA 5HIJA 2OYRA 4YV0A 4GUAA 1L3IA 3O7WA 3JWJA 5DM1A 4E33A 3M6VA 5HIKA 4F84A 1XDUA 2BZGA 4L7VA 5EMKA 3FUTA 3T7SA 4ER6A 1ZKDA 4PYNA 5U4XA 1AV6A 3R6TA 3ME5A 3EEYA 2N47A 4JXJA 2CL5A 1KYZA 3I9FA 3PX3A 4KWCA 2AZTA 3KQYA 4EMSA 2LD4A 3P97A 4EVIA 2ZTHA 3L8DA 2I7CA 4PCAA 4RTQA 4RWZA 5K05A 4X41A 3GJYA 4YV1A 3UJDA 5DXJA 2ERCA 3AWIA 1X1DA 1SUSA 2A14A 4FR0A 2ADMA 4X61A 3JWHA 5EHIA 3GGDA 2C7QA 4PINA 3TR6A 1IM8A 3HVIA 4FT4A 4OX9Y 3ID6C 2P40A 3ANXA 5DTMA 3ELDA 4BLVA 4E31A 1JTFA 2YQZA 4E70A 2QE6A 2ZIGA 3RODA 4PYJA 5F2NA 5BP7A 5K0FA 5EEGA 1X1BA 2BR5A 5BW4A 2AOTB 5HOQA 5KVAA 5DSXA 2OXTA 3P8ZA 5DSTA 1I4WA 2Z6UA 2R3SA 4BY9E 4FP9A 1XDSA 2NXNA 3RIEA 3DMHA 3MQ2A 1AQIA 5K0LA 2P1DA 4EQZA 1SVUA 3MCTA 1KPHA 2IDJA 4DMGA 3C0KA 5EQJB 5ICCA 3KPYA 3MERA 4HH4A 5E9WA 4RTJA 4M7RA 3CC8A 1G60A 2OBFA 2V7EA 5K0NA 3ELWA 5EHGA 3KQTA 3DUWA 3SM3A 2I62A 1WG8A 5E8RA 5JR3A 3CBGA 1Q0TA 4RTNA 4KDCA 3BXOA 5ICFA 5HEKA 1JQDA 3HCAA 4C06A 2PX4A 3GCZA 5EKUA 3GXOA 4F85A 1L3CA 5CVUA
chains in the Genus database with same CATH superfamily
3AUUA 1PDVA 1ZJ5A 5DHSA 4BZQA 5AM2A 5JNRA 2IUTA 2W4MA 5B2FA 1KMIY 3KVNA 1Y8QA 4WZBA 4DUZB 3LH5A 3N8DA 2Y27A 1AK2A 3G9ZA 1FQKA 3R20A 4R3UC 1T3LA 2XTMA 2C2KA 1TUGA 2FOXA 4NBTA 4YPFA 2A5GA 3LNTA 4QOGA 3WYCA 3PPIA 3ONEA 1FJHA 4MVJM 3B1VA 4BO7A 5IT0A 4E2WA 1NVEA 2BLNA 3IAFA 4LXTA 2YWRA 3DKRA 3IRVA 4UAUA 4E2XA 3IUSA 4P4NA 1JAZA 5ALEA 5GPBA 3DTVD 1V8OA 1P62B 2DLNA 4BUJA 3EVAA 3S2ZA 1RWNA 4GBED 2OXCA 4XTRA 1E99A 1W4CA 4X60A 2OV2A 5KYXA 5EOVA 3H0CA 1G7TA 1IMJA 1ZIXA 2AHRA 1G5HA 2B69A 3SX0A 3RFUA 5ALMA 4WFIA 1CC1S 4XEHA 1DEXA 3U4AA 4C4PA 4RX1A 4UMDA 5CLGA 1YK1A 1UINA 3FDFA 3G0BA 4AQ7A 1M6HA 3PC6A 2YY7A 4RFSB 4C05A 1V8BA 5ITZB 4V0KA 1I3KA 2CNBA 2DGDA 4YJGA 4HEHA 3ZOZA 1KJWA 1R4ZA 5AJHA 3VYWA 4ARBA 3LLSA 2YICA 1HYBA 2BHRA 2V3WA 2X3FA 2ZAGA 4J90A 3SX2A 4CG3A 2FEXA 2FXIA 2PUVA 2JDIA 1U6JA 3GJZA 3PDHA 4MRRA 4OGFA 4TTTS 3RIXA 3U48A 1KNXA 2CV1A 2PRZA 1OLUA 3M9XA 1LV7A 4MVJI 4DREA 5BWBA 1V11B 4DQ0A 5B7GA 3L8HA 4I55F 3ND8A 4BNVA 3RC2A 2R66A 3NGMA 2I9PA 3WMFA 4ROSA 2BDEA 2BUCA 4NZYA 1NVAA 1ISSA 1K5GA 1MV8A 3DAYA 2CCGA 2PO7A 3JTMA 2CJYA 3OEED 3IFSA 3DD5A 4EI7A 1GR1A 3RBAA 3NFYA 1T5BA 4L76A 4ZANA 1TK3A 1U9CA 3CRMA 4YMHA 1YRHA 2X6QA 2XODA 4RPJA 3NORA 1SELA 4IRXA 3S8YA 1YVPA 2GAFA 3HN7A 3RHTA 4CKXA 2O3RA 1X7DA 5H9WA 1JWAB 2OCPA 3RS7A 1CK4A 4QPJC 1E9DA 1O0CA 1QKIA 5GONA 1EGQA 1I0IA 5K8CA 1IIRA 1QWSA 3BIJA 2RG7A 4UUPA 3MWJA 2REOA 1SM4A 2YW9A 1P6QA 1P19A 3E2MA 1INLA 4KOAA 5KNBH 1FXUA 2QGNA 3KPVA 4JDPA 3BZBA 3IBTA 4RW0A 1GPH1 4WKPA 3SJ7A 4WZAB 1SXQA 2XUOA 4L5YA 2IH4A 3DE6X 1CNMA 2XMCA 2COUA 1BWQA 1IY0A 5JFTA 1MHTA 1A7KA 2WUVA 1E1QA 3CCBA 3QLUA 5JS2A 4KUEA 5IAKA 4Y98A 3UV3A 4AMVA 3HDJA 4DV7B 3RC1A 3K30A 4I4TF 1L1EA 2JI7A 2YWJA 4K9NA 4PZDA 4QYIA 4LJKA 3W04A 4DRXB 2VBGA 5TE9A 4JOSA 4PCLA 5GONF 3WGOA 2Y1EA 1BSVA 1LVUA 1ZRNA 3LC7O 4MR7B 1CQIB 2J6HA 2X4IA 2I6TA 4URWR 3ZWDA 1WAMA 2P3LA 1S4QA 2GI4A 3VXKA 2O2DA 5JC8A 4DUGA 5J2TA 2VDWA 3DMGA 2H9AA 1SOAA 3E35A 4V1CB 4DB4A 3ZJVA 2V3VA 4XIJA 2RCNA 3GIWA 3PRYA 1ULUA 3OG9A 2H11A 1WPQA 1MENA 3LKDA 5CD9A 1GPAA 3DPIA 1LQUA 2AF4C 3NB0A 4RL6A 1HFWA 4DGQA 3KR0A 2Q8QA 2VPPA 4MB0A 3WS7A 3QW2A 4DXDA 1C5KA 4R41A 1FBNA 1YCDA 2A6PA 3I6BA 1SD1A 1YQUA 3AZOA 2VJYA 4G0YA 4X6LA 3W5UA 4IEFB 2HSGA 1DMSA 2XA9A 4NENA 2JCSA 5LLSA 3S5UA 3VGJA 4GZ3A 1FNDA 4A0HA 1YR8A 4CMIA 2OO7A 3H87A 1YS9A 1V48A 1QE5A 1KVSA 1PFVA 1Z6TA 2HA7A 3AFIA 4P31A 3WJ7A 3IO3A 1Z4OA 2PWAA 1H3NA 4L0MA 2VDOB 1RI3A 3C24A 3L9XA 4BX2A 4OI0A 1XVTA 4WOJA 1KJNA 2FPWA 4CPDA 3AOEA 3A11A 1VLHA 3KYBA 2C3OA 2XYRA 1Z9BA 1T2UA 5HKBA 3L06A 1OBFO 4Q4DA 1XYYA 3UANA 4BKRA 4HMPA 1MIOA 1ZGAA 2VIIA 4WN3A 4BFSA 5GIPE 4DA8A 2FEWB 4JI1B 3BTVA 3TTSA 1FZQA 2WWGA 3E3OA 4D5GA 5CH5A 4DYVA 4L7QA 3L9WA 2GNAA 2BFDB 3QEJA 4HQNA 1UBUS 4B44A 3ZHCA 1EFAA 1FDOA 2GZ1A 4K1LA 1XD2A 4M8IA 4CQMA 4ITVA 3KJGA 2WYOA 1RLJA 4JOBA 2BMAA 4IHJA 3CJQA 3OTGA 5ENDA 3GLHA 5ENZA 3G9TA 4DXHA 2P62A 3RF6A 1K4MA 3AY7A 4UXHA 4BZXA 2EKLA 1ZD4A 4DV6B 4TQUS 4WHMA 4BNDB 3Q3HA 1CS0A 5AKYA 1N2ZA 1B7GO 4GC5A 2PD4A 5JNWA 5GJVC 4F8JA 3LC2O 4EPYA 4Y1EA 3I01A 4XGRA 4POAA 4JB0A 5DNAA 4A7PA 2CLLB 2XYQA 4F2DA 1DOHA 4W1SA 3K6SA 3RNLA 3IDFA 3T5PA 2QYOA 2P4SA 3QPBA 4Z8XA 2EBWA 1BQ3A 1GPWB 1QB7A 3R7LA 4BO5A 1JEQB 1J00A 5JNVA 2H2GA 3EFOA 4D4GA 1ADJA 3BL6A 3HDQA 4HSGA 4LFAB 4KN9S 4ED9A 5H1YA 1L5GB 2BMVA 3R6LA 3FA2A 4JLUA 2RGBA 1G55A 2W4QA 3SOPA 4RADA 4Y1RA 3S8MA 2ODTX 3RSHA 3NP7A 1X0XA 1FTQA 3UC9A 5CURA 3UMFA 4YHBA 4XR9A 4YRFA 3D1LA 3OQBA 3A0RB 4HGNA 2GKOA 4L6AA 2IXAA 3RSQA 5AI6A 5ITWA 2E82A 1WZ2A 4CKWB 5AW6A 4HNUA 4G36A 4F46A 1UK6A 2FTKE 2CXOA 1HM5A 1YGPA 1R9MA 2YVQA 3JR7A 4MYUA 1E0SA 1O96A 1Z5PA 3H9JA 4UAGA 4J2OA 1EJ0A 4GQBA 1A1VA 2Y76A 2Q9BA 1VHLA 3GARA 4LOHA 1WMDA 3ORYA 1THGA 3U1VA 2AMVA 1Y7IA 3ZVKA 1JMKC 1FXSA 4R51A 2XQIA 4RV4A 4LHXA 4K6FA 1CJMA 4KGXA 1MABA 5IC6A 2ATVA 3M1AA 4ZYVA 5F5LA 2QD2A 2RGXA 2V7VA 2Z2YA 2I03A 3EF0A 4HF7A 4EY5A 3KUDA 5HKKA 2ID9A 5EJ4A 4UJ5A 1YTUA 5BN3A 4C04A 7REQB 3JQDA 1JJAA 4B4UA 2HI0A 3ZNQA 2XSZA 2LE0A 4MS3B 3S68A 5LOVB 1B16A 3W6NA 3U4QA 1DRKA 3NATA 1MX5A 4L16A 2QZSA 3B7GA 4IIGA 3RREA 1IAVA 1PTJA 2XCSB 1XD8A 5JS1A 1WDTA 1E2DA 1R6UA 3BGDA 3PI7A 1Z0AA 1Z75A 3URMA 4YONB 3ZVMA 5DZSA 4Z4IA 5K51A 2QTBA 3KUCA 1JHZA 2VSYA 3PFNA 4OY3A 5L95A 2NNLD 1V26A 5CPBA 2VF2A 2QD5A 2VDPB 3OMWA 4RCYA 1NYTA 5GJWC 5G1PA 5TS3A 4DILA 2FJUA 2PWZA 4LV6A 4EVSA 5EMJA 2AN4A 2D2XA 1QMGA 1J2JA 2GEUA 3BYZA 1SEPA 4CCWA 1EXMA 3II6X 3M3DA 2QUBA 4G0ZA 5T6MA 1GGMA 1MRNA 4E5YA 3WHPA 2GUGA 4HGZA 2GK3A 5JNLA 1NQUA 4GUDA 4MIOA 1WB4A 2ATIA 2G1UA 3OX3A 4OK6A 4R2HA 2G04A 2WIBA 3VJLA 1GQOA 1YMQA 5BMVA 3OC0A 4ARIA 3WLMA 1H66A 2GAOA 2B7BA 3KQOA 4LVNA 2HDWA 5BYKA 3KVRA 1VBKA 2W6ZA 4FQ7A 1DCFA 1E2QA 1UXOA 2G25A 2R4QA 4I9UA 3FCCA 4PRZA 2AKAB 2H85A 4D81A 1FB5A 1XFDA 3H9EO 1XQ9A 3JV7A 3PR1A 3U4MA 1U28C 1JJIA 4CKEA 5HRCA 2A3NA 4COOA 1CKEA 2CDCA 4D0RA 5IKPA 3R5KA 1DKNA 5AQ1A 4IZ6A 1ZCZA 4UBJA 2JLRA 2QGFA 1S3GA 3ZCPA 5FUQA 3F8TA 3JQ9A 3OE7A 4QPCA 5KYYB 1PU2A 4XCQA 2HUNA 3LP8A 2HC9A 1OFUX 3Q5DA 4E1BA 4M1MA 9GPBA 1B0PA 1MH1A 5EWJA 3NBUA 1X86B 8OHMA 4ZV7A 4EPRA 4DV2B 4U2GA 3PS9A 2BRUC 1M8JA 3VU1A 5BOSB 1FPQA 2Y77A 1WM1A 3HJAA 2QUAA 4ZOEA 2Q29A 3B85A 2W2MA 2EJWA 4D42A 2Z3VA 1Y6RA 3TH5A 1AQLA 1KPIA 4HPJB 3HKDA 4FHCA 1J39A 2XVMA 721PA 3CUYA 4YRMA 2KB0A 4EMBA 1V4BA 1EAYA 3QQPA 4R16A 4IY1A 1TK9A 2VRCD 3C5VA 4E30A 1U65A 1RPAA 2H1IA 2GK7A 1N0HA 4JQZA 4URVR 5ADHA 3IBYA 5KU1A 1LPPA 5IUJC 3RRZA 5HUJA 3C70A 1G5PA 5JD3A 4IDFA 1E2EA 4G5GA 2N1MA 3KKPA 5LUAA 1O3YA 1NVGA 1JTEA 3W5VA 3K70D 1FNBA 3O0DA 3ABSB 4AG3A 4TKUB 1O89A 2WYHA 2BC9A 1SU8A 3PD7A 3H5OA 1D7AA 1KFJB 4HJXA 2UXCB 3W9BA 3ZDQA 3KZ1E 1JT9A 1X7ZB 2AD5A 5AXCA 4ZFNA 1P17A 3SHFA 5HTKA 1DKLA 3HPRA 3VKUA 1AOXA 1EX7A 1PZXA 3TDNA 1JG4A 2JATA 1V41E 1DKUA 4DEXA 1TUBA 3HR8A 1CUZA 4YS6A 2ZOSA 1TF2A 4RELA 1ZA1A 1LQTA 2NUTB 1I6LA 1UKVY 3DP7A 4DBZA 1FDVA 1H8HA 4JC5A 4DKXA 1QS0A 1ZI8A 3K31A 3GFOA 4RK4A 4P2GA 2I1VB 3WLKX 4H0FA 2P67A 4LZLA 5CA0A 4BJHB 1KHTA 4I66A 5EYPA 3BWVA 2XDQA 4L6IA 5JATA 4FFWA 1SHTX 2R85A 3QEKA 4I3FA 4RHEA 4YP0A 5LMZA 5IJAA 3AEZA 1DBPA 1DINA 2IYNA 1A9TA 2F1OA 3JAWA 5T3YA 3HVJA 3UWPA 5ALXA 3THWB 1AB5A 1TD1A 4LNHA 1SXGA 4AX8A 3RUPA 4RK0A 4ZVKA 4UEOA 1QAQA 1OROA 3EA0A 1ABFA 2GUWA 2W11A 4W7SA 1NXWA 3ZHXA 1KU0A 3DDSA 5F2OA 1B1AA 1QIEA 5K0TA 4ZDWA 2G0NA 3VX3A 4AJEA 1GA4A 5F3WB 2FVYA 1I7PA 4X3CA 4QXQA 5TMBA 2ZJ3A 2JA1A 1WXHA 2OD7A 2R62A 1Q91A 2ZJ5A 3PGJA 4QHSA 3VU9B 3SYMA 1NZFA 4IGFA 4XJSA 2VYVD 4DCSA 1I7DA 2H5IA 4RHXA 5EL0A 3NIBA 5CA0F 1FS5A 3ILXA 3PR2B 1JU9A 3SZMA 1RXYA 1G2QA 3AUJB 5CLQA 3GLFA 4DY6A 2SHKA 3VPHA 2HNKA 3Q0EA 4W7IA 3O1IC 3FTFA 3DDZX 3BE5A 1B76A 3PKIA 1XDUA 3ZQJA 1P7CA 1XJWA 3GROA 2B5VA 3EEQA 3ICQB 3HSYA 4JXJA 3GH3A 1HZZA 2JGDA 3TBKA 3WTBA 3B6EA 4L15A 4MRSA 2QLBA 3AU9A 3SZ3A 3A4NA 4RTQA 3VDMA 5F98A 2PZBA 4GBJA 4ZGBA 1L1FA 3D8SA 1LW6E 5DBGA 5ALFA 2KSQA 4S04A 3MS4A 3FSJX 2B6HA 3A1FA 4L8FA 2VCHA 1Z39A 5TF4A 4DSUA 4CKCB 2WSLA 3DNFA 3HJCA 1R0LA 4N54A 4I8DA 4LRUA 2DFKB 4OQQA 1KO4A 3N2GB 3HM9A 4TSRA 4RESA 1T9KA 1NN0A 4HXEB 3PQDA 4P3XA 4OBEA 1A0OA 3ZDYB 3AVUA 2JI9A 4F6LA 5G4LA 1ZOLA 2IOQA 5BP7A 5ALRA 3ZYCA 5FWYB 3LCJA 4NCIA 2Q3CA 2AOTB 2GRJA 1NWHA 3NTLA 2F59A 4PPYA 2OXTA 3V55A 3HCOA 4BLSA 1UMCB 2AEEA 4R31A 2Z6UA 5AW9A 1C29B 1Z2CA 3MQ2A 3RS4A 2FGJA 3JSXA 4J1SA 3GGPA 3S28A 4BFYA 4DMFA 5EQJB 4DMRA 4MQ5A 3WMEA 1PZGA 5AJXA 4FJ0A 5DO9A 3DOEA 5FFMA 2QVLA 4B3BA 4QDUA 1QFJA 4K8OA 1P7VA 4FSHA 5I9TA 4QYSA 3CBGA 3K70B 3ZV7A 5ICFA 4AJ9A 2GBGA 4IQ8A 4M1YA 2JFZA 4C06A 2OV4A 3PENA 4QUIA 1JXQA 1L7AA 2AYZA 4K9MA 4UEQA 4FN5A 4OD0A 1CQWA 4F85A 5CVUA 5JS8A 1EVZA 3BWCA 4F0JA 4D26A 3SJBA 2X9NA 3EGDB 1SZDA 4RZIA 3L0SA 3A4IA 4AKGA 3VR1A 2KI5A 1Q95A 2QTAA 4F11A 2HCRA 3AG5A 2VHCA 3TL3A 3G0IA 4P8RA 2I3BA 3VHLB 1VRCA 4FK8A 2IYVA 2UVQA 3EUFA 3H42B 4XUGB 1WW8A 4D4IA 5JOQA 2ZBEA 3VZRA 2CLIB 3DQPA 3KETA 1YS1X 3QU5A 3IUNA 4K3UA 3ZGZA 2WJJA 3BWDD 3K9NA 2BSXA 2X4DA 4HGYA 5HM8A 2JHGA 2N42A 1WKCA 1AKEA 4AMGA 1LVGA 1Q20A 2V3CC 1NVBA 2Y0CA 4CVNA 2GOYA 1OMOA 3EXG1 2W2LA 4MH0R 1O6ZA 5H81A 1PK9A 1MRZA 1F5NA 1H0RA 1LBSA 2R11A 3QTLA 4GE3A 3RH0A 3TMKA 5KOJA 1XCOA 3L4KA 1N9ZA 3IP9A 2E5WA 2XYHA 4B83A 2ACWA 2GQ0A 3FFTA 2BJVA 1TEHA 4P7GA 4P0QB 3OOJA 3IKJA 4RZXA 1CJVC 3SC4A 4YIKA 3NBYC 4N8EA 3SC2A 3L01A 5EEHA 3SSOA 2O5CA 2A94A 2GBCA 3ZDFA 2RI1A 1ZL0A 2RH9B 4GOJA 5JRJA 5JSHA 2XJ9A 4JI5B 4DMKA 1VI2A 3E18A 1VPTA 3HKBB 1RYNA 4LDNA 3SF8B 4EF4A 1YVUA 2QM3A 2BBOA 1UANA 2CV2A 2CYBA 1IHYA 2ERYA 1RACA 1PUIA 1ND6A 3HBMA 1SK8A 4W8GA 4COKA 4HGOA 4B17A 3ACBA 4FW8A 1QDUA 3M6FA 5JHGB 1BCSB 2AOWA 1JJVA 221PA 2X0JA 4ZCTA 1Z62A 5LYJA 3R7SA 4YMGA 4RMHA 2QTNA 2WIAA 4M46A 3WLNA 1H4SA 2OM2A 3AKEA 3SZGA 1LY1A 1RXVA 3KHSA 1R4NB 4F3TA 3ZHOA 1FQOA 4G67A 2Y66A 3BIOA 2BMFA 1B43A 4QPPA 1N2BA 1X1EA 5AHXA 1K8RA 3SY8A 2B3TA 3CRNA 3GQBA 4GS5A 4OH7A 4CQLA 2EFCB 1KQPA 1D2AA 2LIVA 2NAPA 5L7TA 4BB6A 1LA2A 2YV4A 5F7XA 2H4ZA 5IHXA 1QVWA 1EXDA 2HLDA 3ROZA 1GEGA 1OX4B 1JFFB 3NASA 3OQ6A 3H5VA 1FFGA 1Y5MA 1JW9B 2BD0A 2QY9A 4HDKB 4AWXA 5LYJF 2QRJA 4NL4H 4XWGA 3ZE0B 1XJ0A 1RTTA 1XHEA 3CZ9A 4N5HX 4KOEC 4QPDA 3I4LA 3AB8A 5BSFA 2OQIA 3CLUD 1NJ5A 1E32A 4KLNA 3FVTA 3AHEA 4NRDA 5JJKA 2IXTA 4WA8A 2G4CA 5I9SA 3KXIA 2JVKA 4S0ZA 4C03A 1JQ5A 4C0BA 1NJ1A 2NO4A 3UW3A 3WL6A 3R3ZA 4QXPA 1XMOB 1XZAA 3SQDA 1DP4A 4Y2RA 4MR8B 4UU0A 1PYOA 2RHJA 3DM9B 4KAJA 4QFMA 3G02A 1GL7A 5FTNA 4MW4A 1U63A 4Y0AA 1XWFA 4GI2A 5HG0A 5B1HA 4D82A 1H0KA 1E69A 2XEDA 1WULS 3RKSA 2O7SA 5GY7A 2UZ1B 3PCTA 5J63A 3HKEB 3PXXA 2NQTA 1L5FA 5B1YA 1ULSA 3FKSA 4RZ3A 4LZZA 4OJKA 2VOEA 4OHFA 2EBHX 1HEUA 1WHTB 2XT0A 2F1KA 4IOJA 1IBLB 5C4IA 4X44A 2C5EA 3FBTA 3LGSA 3OJLA 4KFTA 5AVTA 5JJ5A 2CFSA 1IHOA 2PH1A 3VDXA 2I6QA 3S2YA 3GLGE 2A5LA 4HUQA 4DQXA 5BSWA 1U3UA 1M2FA 1S2MA 1XQVA 5JU6A 1T24A 1QPGA 3FH0A 2Q7XA 1QIKA 4Z5XA 1WUJS 2POQX 4C2AA 4G2TA 1OGJA 5JROA 1GSOA 3PGA1 5BV1A 1USUA 1E6MA 2CNDA 4OP3A 4F45A 2O54A 1SXJA 2NX2A 4YR7A 4KYUA 1CUUA 4M9CA 3JD3A 2YC4C 5GQSA 3WWOA 4OP1A 5BSUA 2VATA 3CLSD 3BXGA 4EG5A 3BC1A 4QATA 5AVJA 3RCBA 3I1FA 1SVNA 1RE1A 1A2KC 1JSLA 1R9NA 4IM7A 1V1JA 3O4JA 5F64A 3B6MA 1SC4A 2O9JA 4JBWA 3E82A 4MW0A 1D8AA 2ALJA 4J7UA 4EELA 2ZSHA 1DEAA 1HTBA 2R751 4QTZA 3QSGA 2ZETA 3ZY4A 5JCOC 1BCRB 1TZBA 5DV9A 3U09A 2DR2A 1Z38A 3Q1LA 1T0PA 1VLLA 1RLMA 3FPJA 3ECCA 5FPYA 1SA0A 2XZDA 2K7ZA 5KAMA 1SZJG 2HBQA 3TQTA 4RSRA 1V7PC 3F46A 4M1WA 5CK5A 3WQHA 4R2JA 4CFYA 3E4DA 4BUZA 3FTCA 1AQUA 5ECGC 3R7BA 2JLYA 5TEVA 3R3WA 1TYAE 5AVXA 3DWIA 2MINA 4KV7A 2HYDA 2OSVA 1PW5A 1OLOA 4XD7D 2J7KA 2QI9F 2WUWE 4EHFA 1QG6A 3FRIA 3A3PA 1C9JA 3ETCA 3L0ZA 4LZOA 3E27A 2FSSA 2X5NA 4ODIA 4DANA 1ENYA 5IMBA 4L08A 2ZPUA 4XQ9A 1S3SA 2PKWA 3ASUA 3K4PA 4Q6BA 4RF5A 4RZSA 2GPNA 4YLEA 3UATA 4EHKA 4BAZA 5CB4B 3C8HA 1M2EA 4HADA 4GLJA 1Z4NA 1WV0A 5EXSA 4D2IA 3P4YA 1NW6A 1R7RA 1Z4JA 5JDIC 5LZ9A 3GT3A 7MDHA 2DE0X 1I5EA 1ZQ1A 2HUPA 3N86A 4I9NA 4WBNB 4OG2A 3U5TA 2QBYB 2ZFUA 4QUBA 4R5MA 3S7ZA 4RQBA 1XRSB 4NEQA 5HKAA 4Z51A 4ZT3A 3TMYA 3ZBUA 3I61A 4HH3C 5EJAA 3L0OA 5D3QA 2HHLA 1JEDA 2ZG6A 1JTVA 3A1TA 4WZ6A 3FYTA 3PV0A 5EZYB 1NU6A 3HBAA 1D3AA 2L42A 4LC9A 3ZV6A 5REQB 3H99A 4Z2YA 1HA3A 2ACKA 2PMEA 3SZOA 2IU3A 4YT2A 3GWZA 4WXRA 3HBJA 1I7LA 5B37A 1P2FA 4TS3A 2XNSA 1L3BA 1NU8A 4X6XA 5EJ7A 4IIDA 1E3WA 4H1WA 1XHLA 3QEAZ 1OXUA 4GI7A 4LJAA 1H8ED 2VDNB 1J97A 3AB3A 3B1WA 4TWJA 1HKHA 2IS4A 2PSJA 5J23A 3LXUX 2F9MA 1NDUA 2NSHA 1Z0DA 1PWEA 4ALJA 3JVIA 3ROGA 2I7XA 2GA8A 1Q12A 2W83A 4OQFA 4CF3A 1TZKA 2PS0A 2Y1LA 2C4VA 3K0CC 2FYTA 3FHLA 3ROXA 3W1VA 1U2GA 4N1AA 2CDBA 3HTXA 3RBVA 4M88A 1TDJA 4DR6B 3AKZA 5FI5A 2VRNA 2NTEA 2QX8A 3Q8WA 3M6LA 4U4AA 4HBZA 1W0JD 2WFLB 4NOJA 4Q1AA 4H7IA 5B6JA 5IT5A 1RLOA 1ETHA 3C43A 2I33A 4BKPA 1M8GA 2P8JA 3REQA 5F3RA 2C95A 2DUNA 3JALB 3Q2IA 4DLSA 4EGJA 4EWLA 1AQ6A 3THYB 2GPBA 1U2DA 2CB0A 2QV0A 2XCLA 3NCHA 3SBDA 1QQ7A 3WMGA 1L4HA 2B1GA 2ZWIA 3EW9A 4O2BB 1D6SA 4Y6QA 5JFGA 4RA6A 2I4TA 4NU6A 4QQ8A 1QWOA 1FMTA 1Q50A 2G4LA 2RHBA 3EEIA 1UFKA 3MWDB 4DEVA 3BT7A 3PYLA 4MAMA 4V0ME 3TSCA 1DQRA 3CUTA 4IIUA 1ZUHA 3PE4A 3QI7A 2JA2A 4J0IA 3PLRA 3OM9A 4J94A 3UWKA 1LDGA 2P2ZA 3C7AA 4XUCA 2IFTA 2P2DA 2X9LA 3W1EA 4EZBA 1NV9A 1RJGA 2JJMA 2JLXA 3UFBA 2DX7A 3PNSA 3HK2A 4TXHA 5K20A 2OPBA 4BUCA 1RBYA 4DGSA 2FMTA 4RDIA 3VOBA 1KJ8A 1A9PA 1LB1B 2CY0A 5CGQB 3OQIB 3IHWA 3CEAA 4EF5A 5I7EA 1QH0A 2JAPA 4DA6A 1K97A 3GIDA 3LW7A 2H5LA 4ES6A 3FNQA 4V0QA 4MCJA 3W5BA 1XWIA 4NAVA 4F12A 1KY3A 5ALIA 1MEJA 4TROA 5JLAA 3PL1A 1H2XA 3I2YX 4MDEA 3CLRD 1V96A 2C4TA 5DM60 4OQLA 4N9QA 3T9DA 3GRYA 2XDWA 4WX2B 3V97A 4AY4A 1RI4A 1V3VA 2I34A 2P9ZA 1PWYE 4TTRA 4GKVA 1OH6A 3U3KA 4WRRA 1FS4A 3VPCA 1X42A 3B2QA 4O59O 1EE2A 4FI3F 4XX1A 3R7WA 2OGUA 5C1OA 2QMYA 4DFDA 4TMFA 4UTNA 3DTNA 4AJ2A 3FDZB 2ORIA 5LP6A 3DZ8A 1NBEA 4F1KA 2IBMA 4PG7A 1BVUA 1NMZA 1DUVG 4ZVSA 1DTWB 2BH9A 4O5AA 4FXPA 4IIJA 1RVV1 3ZCTA 4K9DA 1N5OX 4AJ4A 3G88A 4PHGA 2I65A 5KNCA 2XCRB 3FDIA 1CDEA 4ENWA 2R0QC 2JD0A 2OD9A 1KZ4A 2QK4A 3NHLA 1Q2XA 3KR2A 1QTIA 5IHPA 1RWXA 5F9FA 5C1IA 2JDID 2KMLA 1L8LA 2NVUA 3NBKA 3L18A 1QCCA 1X1AA 4LXUA 1IY1A 3CA8A 4F86A 3DBRA 3COJA 2EP5A 1RCFA 4E4TA 1Q77A 4GW3A 4B47A 5AM0A 3IJEB 3Q7SA 1BFDA 4OU4A 1SVSA 5CMLA 5CU7A 3JD1A 4BEVA 2BOVA 2X14A 2HBYA 3WO0A 1A9SA 1QZUA 4MS1B 3C6YA 4B2LA 5EHXA 3IS3A 1G20A 3B3QA 1IPFA 2I3AA 4AG5A 3LGAA 4XGKA 3RNOA 3DE2X 3ZIDA 4BFLA 4ER0A 5J43A 1EVIA 1H5UA 2W2KA 2WF5A 4URFA 3EEBA 2RH4A 4PS0A 4OJMX 2OORC 2XWSA 3SDSA 4B33A 1XZEA 1VSQA 2F3QA 2OLKA 4MV1A 4NE9A 4RDHA 5JCXA 2V45A 3ZD9A 2FLWA 4UDYX 2FSVC 1ODFA 2YZKA 3NH9A 3D2CA 4R6XA 3TRDA 4EI8A 5A1JA 4GUAA 1GNRA 5DM1A 4OLBA 3M6VA 4HK4A 2F00A 1Y81A 2P6UA 2E5LB 2R7KA 3SD7A 1WD7A 2XBLA 1ZC3A 3O95A 5JYDA 4Q4CA 2W6CX 1XYGA 4ZOQI 1CERA 1DVRA 1KO5A 4FD3A 4CIXA 4M0EA 5MN4A 2LD4A 4U3JA 1E1QD 1ORTA 2CBXA 2GT1A 3G2JA 3MGBA 3ZJ4A 4BB5A 5BWNA 1L8OA 3Q4GA 3FLEA 4RWZA 1SOUA 3S99A 4CCAA 1SCUA 3D6HA 4L28A 4FCVA 2B4AA 5A7FA 1X1DA 2DY1A 1LPBB 4FR0A 3U37A 4D9IA 2JZNA 3KFVA 2VJLA 3TEJA 2UUAB 3QX3A 2VDQB 1PFQA 4FEEA 4FT4A 3V3KA 3GRAA 2HAEA 4NQZA 4DUGD 1UBCA 2VTBB 1T6BY 3EH2A 4JUDX 1UEJA 1M1NB 3H86A 3N8IA 1AKRA 2RHLA 4E70A 4ZKDA 5C80A 5JMTA 1O95C 4YACA 1XKLA 4DQLA 1Q74A 1Z33A 4MQMA 5KYTA 4WCFC 2QROA 4D5EA 3LZ6A 1Y8QB 1FL9A 1D4OA 2LZ0A 4RVSA 4WZBB 1I4WA 2NO0A 1SC9A 3PIDA 2IJGX 2PZAA 2BSAA 3UUEA 2BGJA 3ZX4A 4ZMRA 1A8UA 2IDJA 2ZDHA 5LWQA 1DXQA 1Q44A 1ZGHA 4HH4A 5EMHA 4RTJA 1SXPA 4LWZA 2Z43A 2RMKA 2VWPA 4U2BA 3WGHA 2XGOA 1I7NA 1Y4SA 2XJ4A 1NZJA 1M2GA 5EHGA 3SM3A 1FDTA 5AVYA 2R6GA 5A6VA 1PG0A 2EJBA 3SQOA 1TXGA 2YV5A 2I71A 5FX2A 1EK6A 1AGYA 1QHGA 2C9CA 2ZIAA 5KYXB 1S2NA 3QV1A 4I55B 2ZJAA 1S3IA 1NM5A 5AVQA 1TRHA 1FC0A 4Z53A 3IVGA 3PR3A 4JYCA 3CZMA 3O83A 5DULA 4CDNA 2KWIA 2ZXFA 3VI4B 2F62A 4RENA 4JR2A 1GRNA 2HDHA 4LE2A 3OX2A 5G3YA 1EX1A 2C7RA 1WB9A 5C51B 1FFCA 2QXTA 2AUMA 4L2IA 4MP8A 2RJ3A 3QYFA 3RRYA 2QPTA 3BTSA 1TU0A 3ZNNA 3WV4A 3EUWA 2QS9A 3JWIA 4O1MA 4MVJA 4YJGB 3PNLA 4PG8A 1AXEA 4ZV4A 4DV0B 5AD1A 5DM70 2PV0A 4CQMD 5BN3B 5FAKA 3QU4A 4F3YA 1ZM3A 5TJ9A 3FNRA 2OILA 4WY5A 4Q3AA 3JQCA 1OLUB 2NU7B 3LXMA 4E32A 2GH1A 3F4KA 3VNVA 1S5PA 1RXIA 1QJ4A 3DBIA 1IK4A 4ZALA 2ASEA 1SUDA 5TQ0A 4OLHA 3VR0A 1KK1A 4I5EA 4BCDA 4XW2A 4QGSA 1QHFA 1M33A 1V5WA 1PHRA 1NF2A 5AXAA 2HXSA 1NUSA 4BNZA 3HCWA 1IEWA 3EYAA 4US0R 1ZH4A 3I23A 2DH6A 3F6PA 1HE5A 2RE8A 3MMSA 1H05A 1GKLA 3CU5A 1NF9A 1O54A 3OC6A 4LDJA 1J9EA 2PR7A 5K0BA 2VXCA 5GONB 2WLTA 4PN7A 4XSVA 4KSBA 2EX4A 4BQSA 5A5GA 4YMVA 1W88B 3CPEA 3CZPA 2VYNA 3MILA 4NPCA 5JYEA 1YR1A 4F9EA 2XB8A 5LP1A 5THKA 2VYCA 2BONA 3GRKA 1Q1QA 2XGGA 1D7OA 1N6HA 1DDGA 1TQ4A 1WPRA 3TXXA 2P3SA 1VXRA 1JEOA 1CETA 3NYIA 5K3EA 1M6NA 1P5FA 2F1RA 4RVFA 1NJGA 5EIAA 5MFZA 1PV4A 3OLZA 3MS7A 4JLJA 4BLQA 5KYUA 1VB5A 2FK7A 4IX1A 5JO0A 1WS6A 1XALA 3RAPR 5HFAA 3SEQA 2QRMA 4G0PA 1OB2A 1E77A 5G0VA 4KE6A 4QYIB 4MHSA 1J8MF 1KYXA 2I2DA 3N75A 2AMYA 3OUTA 1KEZA 5SYAA 3RU3A 1U1EA 2JKZA 2W22A 1AQYA 3A3KA 2X0IA 5FPKA 1PFKA 4QRHA 2SKDA 3ZJ5A 1LK5A 1ZBQA 3GBVA 4K6OA 4NBKA 4TYWA 1DC7A 1OA1A 1OHHA 5HKKD 3O4VA 5J2TB 4X0EA 3IE2A 1T4BA 1DEKA 1QVVA 3QKSA 2DSTA 4G6ZA 3BMCA 4NDZA 1OASA 4OYHA 1L1QA 4Y2JA 1RTKA 2UDPA 1PFWA 3UTDA 2XSZD 3QBDA 3TW6A 1PLJA 1UAGA 3PNMA 3PFGA 5LQJA 2ZI3A 3FUVA 3NBAA 2ODEA 4MEJA 4NARA 4Q9LA 5EP4A 5HF9A 3WB2A 4D02A 3VH1A 4UNRA 5CEEA 3ZDZB 4J16A 4B82A 3TFQA 2ZW9A 1I2DA 1JDPA 1GCAA 2FB9A 4K9RA 2J59A 1XROA 3DCIA 3ABZA 2YOFA 2PGDA 4IVQA 2V5UA 3RYTC 2PS3A 1L1RA 3EDYA 4ENRA 5LWHA 3MGCA 4PTYA 1H42A 3VDRA 2QRHA 2XI4A 3K2IA 3ML1A 4RDXA 4HNTA 2CC2A 2R2GA 1Y7PA 3BHMA 3P5SA 2IUYA 1F8YA 2WD7A 5EKTA 3ZE8A 1ZITA 5B4VA 1Z0JA 2W98A 4WCVA 4GMDA 2YMPA 5GVSA 2D0DA 4DNPA 2D62A 4V0RA 3RVKA 5DCUA 4DIDA 4J0QA 4DCPA 4HAIA 1P9NA 4PWYA 2GBFA 2SECE 1L9KA 4FGZA 1K8QA 4PW0A 5T7BA 2X40A 3F7MA 4FFMA 1CUIA 1JJ7A 2ZUWA 4RE6A 2PX3A 4RORA 4Y8VA 5TQ2B 3PPXA 4BJ6A 3CPHA 4AN0A 2JFNA 3EBOA 4HDCA 3DT9A 4KXVA 4UU7A 3OHPA 2XRMA 1J09A 1ZICA 1E89A 1YH3A 1YQTA 1Z12A 2IIQA 4HXGA 4JUCA 4KRGA 5CTJA 2H29A 4DNOA 4EHBA 4ZYXA 5LPNA 3ZY6A 2GR9A 3U1TA 2K7FA 2EWVA 3V4LA 2EW8A 3A4MA 3O73A 1UODA 3GT0A 4L3OA 1KOFA 4RQUA 4RTSA 2QQEA 1XD2B 4RD1A 4CQMB 3PSAA 4CJXA 4OA5A 3BGVA 1ZM2A 5JBNA 1CRZA 1T6ZA 2D4HA 3GLHB 1S0UA 1JBQA 2GJ8A 2QM0A 4W8HA 1TIBA 3IMFA 3WMXA 4BEWA 3F2VA 3QOXA 2O50A 3N8HA 4BVEA 5ALPA 1YQDA 3OE7D 3H11A 3CF6R 2C9BA 1CS0B 2OP0A 3I12A 4OHVA 1M0TA 2R97A 1ZVMA 4F93B 3QU2A 3IQWA 2LUOA 3WOHA 4MGKR 1ML4A 1AURA 4OQEA 1ZZEA 3AI7A 3U7EB 4XPZA 2G82A 2HRCA 3AEKA 3EZFA 4REOA 2XXAA 2FPOA 4B3XA 5JXIA 2A9PA 1JPJA 1TIPA 4S24A 4TYQA 1RU3A 1CDZA 2BM8A 1EE1A 2H1LA 3EFOB 4GM4A 5AOVA 1T9AA 3SCZA 3WDSA 4DJJA 2QMOA 2COEA 3Q8XB 1P0PA 1FYXA 4WOBA 4PAMA 3GB9A 5EZ6B 3W8DA 2JKYA 3GRPA 4B73A 3OEYA 5KSYA 5JAUA 1XKXA 4FFRA 4LMPA 2FP4A 1OPXA 3MJHA 1GU7A 5AKLA 1UWKA 3CX6A 2DKOA 4PFSA 4OXNA 4YX9A 1H85A 2FW6A 3TQFA 1CRPA 2CUTA 2HO5A 3LLVA 2Q49A 4GWLA 2OFFA 1QGED 3EXEB 4ZCMA 3K72B 2GVZC 2WIGA 1O96B 4MQ4A 1U9IA 3IEMA 4B8WA 1Q6ZA 1TM4E 3AHHA 4K5QA 4D80A 2Q5LA 3HP7A 3BUSA 3VC1A 4TV9F 4RK1A 2C4NA 3K0EA 3OD5A 1QHXA 3EIHA 4L4RA 3LTEA 3U7QA 2A9KA 3L1IA 4TM7A 2OAQ1 4WOKA 4FFNA 3L1KA 2WWVD 1MABB 2QJRA 4LE1A 4D6YA 4PFKA 4CF6A 3HCEA 4R83A 3ZLBA 3TX6A 2XOKA 3S2IA 1HFEL 1JXAA 4Q66C 1H8HD 2ONZA 4BDSA 2Q5EA 3VKFA 4OHPA 5JDIA 3U4QB 1KMMA 3ACCA 1IONA 3FGPA 2VTKA 3I9KA 1P8JA 2JS7A 4YJ2F 2C78A 2BDUA 3JWEA 3L5OA 3DZDA 3VVBA 5B53A 3IAEA 3C39A 3H18A 4P1ZA 1DO0A 5J59A 2VRBA 2ZJZA 4RS3A 5TS2A 5E95A 1F6BA 4ETIA 2BE7A 2JEYA 1W94A 3A4TA 1VYVA 3GYBA 3WXMA 5L9AA 2W2PA 1PUJA 4N4AA 5CEFA 4CM7A 1GG2A 3KCNA 2XMSA 4IF6A 3TZQA 4ZI7F 1QPBA 2OC4A 1LH0A 2ZVPX 5MDHA 4ILEA 2PUBA 4CM5A 1C9DB 2LTAA 1YOBA 2Q62A 2JCVA 3EGXB 3MWYW 4HB4A 2J5KA 4LZWA 1X1SA 3VO2A 1RRFA 2I6FA 1ZI9A 1H4QA 5LBIA 4FOTA 1AVTA 2XUFA 2BFWA 1PJ3A 5FO1A 1DEOA 5LQUA 2R8OA 1PGOA 1LDYA 2PK3A 2VN8A 3WGVA 1EPUA 4YRIA 1TW3A 5KQLA 2WAXA 1W44A 2KLHA 1VSUA 1Y9ZA 2WPDD 2RG1A 3H5RA 1NQWA 3HRKA 2NW6A 5KQRA 4GOLD 1X7XB 4L51A 3EAQA 1V6SA 3NV7A 3FW1A 2C98A 4CKEB 2Z08A 3MWGA 4LRYA 5CW2A 3STYA 1SCDA 1C81A 5K8UA 1GZVA 1YRYE 4G07A 2WYWA 4R8MA 4Q34A 4Y2XA 4KL8S 3EVTA 2F6RA 4LJ7A 2EYUA 2LKDA 2YOGA 4GKBA 4GX5A 3CNNA 1XZBA 4DSOA 3CT6A 5EWJB 4GZLA 3ROPA 5JLJA 1NTRA 1KMQA 1KYQA 2GK6A 2HF2A 4UZEA 2Q28A 3DBVO 4EDHA 4H4DA 4YRQA 4RD2A 3WSWA 2ZWMA 4M1QA 2FETA 2H2HA 2Z9CA 3SHVA 4BNFA 4CKZA 2PSDA 1XZHA 3IOEA 3OI7A 5K45A 3AM3A 4HNVA 3HNRA 5AI0A 4EITA 3AX6A 2W71A 1SQ0A 3ZE7A 5FORA 4LKOA 3NYQA 4UFNA 3UQZA 1DAEA 1D4AA 1TC1A 1N2GA 3H8JA 5SZIA 1USGA 4BWGA 3EB9A 2F48A 1K7YA 3GRUA 2OESA 1ISRA 3CW9A 3LV8A 1FP4B 3ESCA 1QMPA 2A30A 1LWOA 1VLZA 1XEAA 2UYYA 1NI5A 2F3UA 3FR7A 3NI2A 4C9BA 4NIMA 4ZAFA 4CCYA 5CFLA 2E4XA 1PBNA 2D5BA 3F8SA 4GBMA 1GTRA 3I28A 3IO5A 2H7YA 2HA3A 2XZPA 4TMZA 1E1KA 4CT0A 3SDZA 1GL3A 3IJRA 1BMDA 4FSDA 2JFYA 4U5XA 2AZXA 1NYQA 1XZLA 3EVDA 3HB1A 1S6YA 4HN9A 1AUPA 1UZLA 1WUKS 2YVAA 1NQTA 5EE1A 3V1YA 1KOLA 3D6UA 3NTRA 4C0SA 4FFBB 1EVEA 4MS4A 4OMFG 4RETA 4CYMA 1CEYA 3BG5A 4RVUA 5KSPA 1V7CA 2C5LA 2DTDA 2R8BA 4G0QA 5EIHA 1K1EA 2VHYA 2W2TA 4N3CA 4CMAA 5EJ2A 2Z5VA 3LNCA 5LFAA 1G3IA 4RBNA 3T3OA 3FOZA 4Q05A 1JR2A 2J3IA 1NXQA 4IIHA 3TJZA 1QS0B 1JYFA 1H0SA 4QSHA 4HYEA 1K9SA 5CA0B 4X84A 5HSGA 1YV9A 2ISQA 1VMKA 2XDQB 3H1AA 2OO3A 2Q3FA 5AHKA 5EYPB 2IIPA 3KOZA 2ZI6A 2ZE5A 3NZEA 4O4HA 4EG3A 1GCOA 1J99A 1JKIA 1UJ2A 3JAWB 2QJWA 2ZB4A 2WAMA 4GHWA 2XR1A 3RT1A 1NN1A 4ROTA 1BE8A 2RSLA 1P31A 1KYTA 2W2LD 2VFAA 4MJ3A 4N5LA 5P21A 4NJEA 4CT4B 3VH4A 3MYRA 4B4OA 2AFIE 2QLNA 1JQAA 1OI4A 2VHTA 4KO4S 4JA0A 1AXRA 2B4YA 2X5KO 4CNBA 3PSHA 3TK1A 1G59A 2AWOA 2EX1A 3BKWA 2E4AA 3GG9A 3KIPA 4QIHA 1V35A 4AP6A 2NYUA 4GM1A 3ER6A 3VR6A 3C1AA 1XLWA 3R7NA 2ZRIA 1L5YA 4Q4JB 4IJVA 1TI7A 3H1TA 1WMBA 5C8ZA 3FPFA 1KY4A 1P9OA 2F67A 3OF2A 4PANA 4Y1GA 4AG6A 4M9QA 3ASVA 2B78A 4LYYA 4BU0A 5AFSA 1JMVA 5FA6A 1IEQA 4QREA 2IP4A 4PSVA 3ZQUA 4GL2A 3EBLA 1CY0A 5I7UA 3ES9A 2HN9A 2AC7A 1KQNA 3S27A 4JYZA 1X74A 1KP3A 2J8ZA 3VPFA 4UDNA 4CL3A 1OGIA 4MJLA 1OI3A 1V71A 2V9PA 2JGDB 4L22A 2FW7A 5TPWA 2FH5B 3MCUA 3GRFA 1N5LA 1AGRA 2ZVDA 4KX5A 4Q9KA 2ZJOA 3C5CA 3ZLUA 4DCVA 2ZI5A 5GJBA 5DHAA 1YJBA 5CVCA 3DMFA 1WUIS 3FCSB 3W06A 5KJCA 4C3UA 1RRKA 2WM9B 4M54A 1NP6A 1JFRA 4HLDA 1ZCJA 2RHGB 2F4VB 1IM2A 4UTRA 3HADA 3KJIA 4G5RA 1B0AA 1WW2A 5JH7F 1G8MA 2YRFA 4R05A 3KZCA 3UW1A 2PGIA 4C1NA 5LBTA 3SI7A 3CKMA 5TVGA 2FG7C 3GLQA 3FVQA 3FUTA 1ZKDA 2DPGA 1XLTC 3E9MA 3R6TA 2G9VA 2MMCA 4R1PA 5FBVB 1C30B 3G3EA 1CPYA 5NLLA 2VT2A 4BJ5A 1Y0BA 1IUOA 3F6BX 3LCRA 2HLDD 4X54A 4X66B 2IS1A 1BGWA 1MG0A 2QSYA 4HOYA 1JU3A 1EHCA 4EUFA 5H4HA 3L7BA 5EE3A 4PAOA 1I0ZA 1HDGO 1XTVA 5KEIA 3UMJA 3T7DA 1CQJA 1J33A 3GGDA 4IGEA 1IM8A 1ZGBA 2J3KA 2PUWA 2I66A 3CY6A 2XHEA 1CG6A 3B6JA 3TD6A 1YR3A 2XRFA 1JYSA 4CLOB 1ECPA 2Q5HA 1M7GA 5PGMA 2FKAA 2Q3MA 4OB7A 4MVJG 5JXHA 4KNVA 1H2HA 4XD2A 3JYPA 2DF8A 4CQJA 3P5BA 2PMDA 4TT3D 1GTMA 1WW3A 2WFAA 3ENKA 1KE2A 3BH6A 5KVAA 5KYWB 5LJLA 3JATA 1QBGA 4AQDA 4DSZA 2W93A 4CUZA 1A8QA 2NXNA 4DBVO 2GWRA 3D7RA 1H2RS 5K0LA 4OIFA 1SVUA 3FKSD 4GGMX 1FOEB 1D8TA 3PG5A 1CEEA 2ONKA 2RC5A 5CX4A 1AKQA 4WFJA 1SBTA 2OBMA 1SRQA 4H1TA 2PH5A 3QMMA 5D7BA 1X94A 1LSOA 2VJPA 5K0NA 2CVQA 2E18A 2IDZA 2WSMA 2XA1A 3GGOA 1VCOA 3FNBA 1AN9A 1JQDA 3UMMA 4G5YA 1QGYA 1QIDA 3F6SA 1ZU5A 2NV2B 3EWIA 3NOOA 4TVOA 1C1XA 2JPDA 1EBFA 1EUYA 1U31A 1GNQA 4QBHA 3A4LA 1OVMA 1HYQA 4IFTA 2QLJA 2I4LA 2KLBA 1ISPA 4GKAA 3QFSA 2FQ1A 5KOJB 1LNQA 1GAJA 3G8BA 1L7QA 4JKOA 3WY9A 1YA4A 3ZI0A 4MW5A 3PUVA 3HYSA 5C52B 3KFLA 1N34B 3P9KA 1SXJD 3WWYA 2C7BA 5K0CA 4Z8YA 4F91B 3LF1A 3SC2B 1XRPA 5LCXA 1W0CA 2QN3A 1LLCA 2EWWA 3AOGA 3BDIA 2G1AA 1ZAKA 1XTZA 3RUFA 5AJTA 2YJTD 4URXR 4LRQA 5CLJA 4J6FA 3LA8A 2GZDA 1QH1A 2PSHA 3DB2A 2Z8ZA 3C8UA 2ZM5A 3SBOA 1QVZA 1ACLA 5I48A 5AUNB 2NXEA 3L4BC 2RK4A 4GMHA 3T95A 3UFXA 5KREA 2JFHA 3Q8LA 3BGIA 3E7XA 1JSZA 3AESA 3KLNA 3N05A 3T7AA 3A9SA 3PC2A 2Q0HA 1N3BA 3B89A 4KQKA 1CY2A 3ESZA 5CA1F 5HJEA 5M29A 3E8SA 3ZJUA 2L69A 3H8VA 4LOLA 1JIUA 4V3CA 1S7GA 4HVCA 4CMCA 2XUDA 1T34A 4UNNA 5K8IA 4X7RA 4DJFC 1FU4A 1UM8A 3SDBA 4Z1MA 1QAMA 5LYJB 1OXBB 5L8VA 1L4BA 1YZQA 2EDAA 5L40A 1W4BA 1VGQA 4YCBA 1UZUA 2QUZA 5EIXA 3SE7A 5LUBA 5C1BA 1NE2A 4Q3NA 2B9EA 1IHUA 4N18A 1XRRA 5C0OE 4FYIA 1EGAA 1UKBA 1ZW1A 3C7TA 3JTEA 4FILA 2C9YA 1BE6A 4OAPA 5B7PA 2EQAA 3QHQA 5LJIA 2I87A 4V0OA 3GQBB 3P9SA 5JQWA 3ADCA 2BDTA 2HMVA 2Q45A 1J25A 4CQLB 4DDWA 4EEZA 5AKZA 1GQQA 2Z4SA 1FTWA 5A5VA 1Q7TA 4EW6A 2AFHE 1NVWQ 5FTKA 5HCNA 2H54A 2V4MA 2P4HX 4RMNA 1IK6A 1JLKA 3R24A 2DPXA 3IQDB 4G9GA 4KRXA 4MQEA 2ZAOA 4JY7A 2IA5A 1VI5A 2RD2A 4C2TA 3BMQA 4TV8F 2WQ7A 4RV5A 4E2FA 3QK7A 5DHUA 1IWPB 5F1PA 3TTYA 2WD8A 4A5OA 3WIDA 1JZTA 3DZJA 2J6BA 1R0WA 2W2XA 2EZ9A 4EMTA 1QRUA 4EDFA 2Z3ZA 3AO0B 1ULBA 1GNLA 1KBOA 2MIIA 1Q1NA 5IJZA 5IVHA 3KEFA 3BDVA 2WTUA 1O94C 1T25A 4H15A 2P4EA 1CFJA 4XA8A 3THSA 4E7OA 4D74A 2AF3C 1T5TA 4MW2A 4M0UA 2HEGA 2GPAA 4JZYA 3ST7A 3O4HA 1EWVA 1RWPA 2FSHA 2O20A 4BN4A 3BQMB 1Z4PX 3U4HA 4BWFB 1IMOA 2O3SA 5DX0A 1QH9A 1DKQA 2V5AA 3NC0C 3VHXA 3NJ4A 5KMGA 3RLFA 4EF6A 1Z88A 4C7XA 1XUOA 2JLWA 1XRJA 1Y8RA 1VSBA 1DJPA 3EY9A 3LJKA 4OKSA 2EF1A 2HF8A 4EECA 1TJ3A 4NHOA 2YVLA 4YAJA 4P0TA 3SQNA 3ZZ1A 3NHMA 4XFJA 4MHTA 2BY4A 4HUQB 3LHFA 2FZGA 1O0BA 4DJAA 6Q21A 1OQAA 1M2WA 3PE3A 3Q6NA 4RD3A 2OXIA 4E5SA 3Q9UA 5HP4A 4KO1S 4MP3A 3KX2A 2O0LA 4PFJA 4Q9NA 3WGUA 4HRXA 3IPCA 1Z0FA 1T3ZA 2ZI9A 1J56A 1F3OA 3GNTA 5JD5A 3FMVA 3A1VA 3J81A 1Z22A 2CMFA 2HRDA 3C6ZA 3P9CA 1E3JA 3K32A 4IHQA 3ZX5A 3U44A 1JG1A 1YACA 2YCLA 3GRRA 4DYDA 1I36A 5SV2A 3P7MA 1JLSA 3OFVA 3D3EA 3W77A 1FDRA 1UK9A 2AR7A 3MHPA 1Q17A 3L7DA 1LU9A 2C88A 2X8JB 1Q11A 5EIOA 1OIXA 5CNIA 1OI2A 3ZPXA 4EX7A 4BIIA 1XMQB 1IZZA 4QOHA 1DRWA 1Q0LA 4YQZA 5B4TA 3ETDA 1NJ6A 1VYTA 3O7MA 4G2NA 1N5DA 3GFFA 2ZUFA 4YRRA 1MB0A 1EFPA 4YFVA 5FWAA 3QSYA 5I3CA 4KK3A 1KFKB 1QOZA 4C43A 1M0EA 3RFTA 3LDFA 3NWJA 4I5FA 1AE1A 5KHLB 1SA0B 3PQ7A 3RJ5A 2V03A 3B7WA 4QGGA 3S3TA 3V80A 3DAOA 1G3RA 4LK3A 2C7PA 1YDMA 4G0NA 1GQ2A 5HRAA 3T1YB 4GQIA 2W90A 2A84A 4RO0A 3I73A 3U3DA 3AJAA 4CFZA 1SZPA 3RJZA 3IYLW 3EGVA 3FOFC 3VR5A 2H51A 2MINB 4L5JA 1L2TA 4ZD6A 2JLBA 3VO9A 1DAPA 3TMAA 1YCGA 2SKCA 3A58B 2HV8A 5P8WA 1SKQA 1HRDA 3QKRB 5G1NA 5BWLA 1C8BA 4ZO9A 3LLCA 3LVQE 1OXSC 3AHIA 3KB2A 1NVMB 4I46A 3OAAA 4CRWB 1I14A 2J9GA 3BCSA 3OMLA 3CVXA 5KTKA 7MHTA 5CVJA 1Q3KA 1GZDA 2FG5A 3DEAA 3KVOA 2NSLA 1W7AA 3PNVA 4JVSB 4AXBA 3U2QA 4WJKB 1Z6AA 2FN8A 3ETJA 4ZKEA 2VNKA 1I4OA 4HDRA 4C76A 3MJVA 3IVAA 2ISCA 5BXYA 3JVUA 3NTOA 1HG1A 4F4HA 1ZR2A 4MV4A 4OXKA 3KPWA 4XQCA 4DJ5X 1BW9A 1IJFA 1NKVA 3L4EA 5ETJA 5IANA 3QKIA 3CNOA 4JQCA 1LPMA 2VDVE 3NT5A 3F3KA 5C32A 1Z34A 2VP4A 4YRDA 5SY4A 2O0HA 3R3YA 4YA6A 3AF5A 4U2CA 1VJRA 3D3QA 3EDRA 3BJIC 4M9ZA 3NAQA 4IIXA 4KXQA 2FSFA 3BE8A 5AI9A 3TDMA 4QT0A 3V00A 4PHFA 3RW9A 2NTNA 3WISA 5I9LA 1WX1A 4L4ZA 2X2EA 3LBHA 3F5SA 1E3WB 1UBMS 4LZAA 4DWVA 2VP6A 5D5HA 5CDGA 3C3YA 2AZ4A 3EYWA 3G5UA 1Z18A 3D5TA 3QF7A 4LVCA 3TQSA 1DKRA 5JZMA 1L5NA 3ZLJA 4PBTA 3K20A 1O9HA 1PT6A 2HT6A 1G3MA 3O82A 4U7TB 2FFHA 2R2AA 3OZTA 2AUTA 4N3BA 4UHFA 3ZDCA 3W3AA 3THOA 3L0CA 4BQQA 4XWWA 4O4JF 2ORWA 3JQAA 5L3SB 2CFTA 2WMYA 1WBJB 1Y9JA 3LQKA 2J48A 2VK4A 1YJCA 1Z7EA 2DY0A 2I80A 1NXOA 5IKEA 3FPSA 3BWMA 1USIA 1D2MA 1VQ1A 1QRTA 4RH3A 3OIYA 4C2BA 1F6WA 1UP6A 2Q9CA 2P9TA 2WSIA 4WFKA 1DRJA 3HCFA 1TCAA 1YFZA 3K0BA 4DIEA 1PR1A 5EWMA 4RAQA 3UPDA 4E6PA 3U6KA 1AO3A 2XMZA 3PDIA 4HN4B 4MULA 2XTNA 2GF0A 1G21E 2MYUA 2D0IA 3EWAA 3HR4A 4IWXA 4D8XA 4Z2AA 1A76A 2FXVA 3AVQA 4JD5A 4GVLA 4UHDA 3HACA 3WRVA 3IMCA 4FYYA 4MKRA 4TUYF 3SVTA 3KFXA 4YUZA 1JP7A 2DG2A 3DV9A 2ZR8A 2JIRA 3CXRA 1L6IA 1K6JA 4B6EA 2ZSAA 4KLCA 2XKJE 1DUSA 1I2CA 1IUNA 2V1XA 5AW7A 5LU8A 2IW3A 1IJKA 2FPIA 3ND6A 4M98A 1LUAA 2IE0A 3LMKA 4PQFA 3Q8MA 1W59A 4P93A 4ZZIA 3DOJA 1T0HB 2IY9A 3GN2A 2WSSA 3DDHA 1YMUA 2WIFA 1WUHS 2C5BA 5LA6A 3LFTA 4JKYA 1Z4LA 4RCZA 1ZP6A 1DV2A 3DL2A 1IQUA 3NQ41 4JLWA 4S2EA 1YQEA 1K8ZB 1P44A 5EQFA 4M9XA 3LC0A 5AVSA 4ZO6A 5C7IO 3I64A 1IY9A 1K4YA 4ZRMA 1RXEA 3B13B 4OI2A 1GN8A 1Y7HA 2WG0A 2IITA 2VHXA 1TCBA 2CFOA 2Y8EA 4X1IA 3QVSA 4X7BA 3VU8A 2D1RA 2H1VA 3LWDA 3D9QX 5ARBA 1CV2A 2FEAA 2X22A 2P9FA 1C9KA 1NY5A 1OD6A 5DCLA 4LRTB 1FX1A 1QB8A 2ZRJA 3JARA 3O3NB 5KX5A 4R8VA 2JH3A 3ZJTA 5I4KA 2QVZX 3SF0A 1C41A 3ADKA 3FWPA 1N2IA 4KGZA 1T13A 2GCIA 5BVHB 5LA6F 2AZDA 4MYRA 4TSKA 4XARA 3C6MA 4OH1A 4Z99A 2A2ZA 3C74A 5KO2A 2OCYC 2B8TA 5G0WA 2F8LA 2B1JA 1QIJA 3K4HA 4Q16A 4UFPA 2ADOA 5A9RA 4WLOA 3R7WB 4DQUA 2B9VA 4GP9A 4MPTA 2P5YA 1JXMA 3H75A 3GMTA 5EUQB 4CIDA 1W4ZA 1W581 1GZ6A 3KJHA 5IAJA 3SR4A 4LJRA 1E7RA 1S2IA 3DZHA 3FCEA 3L7AA 4JFRA 3W90A 1PEDA 3P94A 4NDNE 4IIJB 3DEFA 3ETNA 1DGQA 1C2TA 3B20A 3SQLA 2O8FA 3H6KA 2Z9BA 3CUWA 4J3FA 4OQYA 1OAAA 3B5IA 4LOAA 4OMDA 2YNMC 5CH3A 5DT2A 4INOA 3KSZO 4MVJD 3VYRB 4IZHA 1RT9A 3IA2A 2I99A 3QTTA 4EPXA 4W5JA 2B61A 3QOYA 1XQ1A 3AFGA 4NC9A 5ECDA 3V1KA 1OAOC 4YGXB 5BN4A 3RAGA 2CFIA 2NO7A 1SUAA 3KAQA 5CVVA 1SC6A 1MJFA 5M3BA 2O0JA 2NVUB 3K5IA 2ZJ6A 3RQIA 1KE1A 3FPEA 4FGLA 3R4CA 3K7EA 2V74B 1OFIA 1R0KA 3BREA 1MP0A 3DBRB 2P6PA 2FWMX 1VOTA 4FINA 5D3ZA 5THQA 4U02A 4JUFA 1KA9H 4AMUA 2TYSB 4I6EA 3VPAA 1RRMA 2W2VA 1LI5A 4JX9A 3W5HA 3OSZA 3L7CA 3PQCA 3KLOA 4BB0A 2YKGA 1QANA 2FR0A 1GYQA 3R09A 4O1IA 4QDXA 2BM1A 3RRJA 4C4AA 1MB9A 4G5XA 2IHVA 1G20B 1GNPA 4MGHA 4H35A 4ZMSA 3ITKA 2SBTA 1G38A 4UPVA 4F9FA 3KELA 2W2KB 3TR0A 3PPVA 1J2EA 3G5MA 5ICEA 1U0JA 2E89A 3IR5A 4NOMA 5DYYA 3O84A 1MB4A 3LKBA 4JH0A 1KWKA 1ULTA 4IUDS 4Y0VA 5JMWA 1NMEA 4H3HB 4Q7MB 4QL3A 4AIIA 1OILA 5BWMA 2VYND 4L8LA 4B9AA 3O2QB 4Y2UA 3BWBA 2QTFA 4BLOA 2JK1A 4ETWA 5CXQA 3FF1A 4A26A 4R1MA 1CJKC 1VSVA 4YMLA 3AFNA 1WQ1R 1G2OA 3RVQA 4HNHA 1M1ZA 1S4MA 3UMRA 1UK7A 2GCOA 2Y4NA 4J1TC 4Q4AB 2FJ0A 2YN0A 3WK5A 2DHQA 1NVDA 4IZOA 4KVGA 1Z5WA 1LDBA 4U3JB 4L8WB 4AS1A 1N0WA 1UWVA 4E11A 2NZVG 1ZK2A 1K7FB 5AK5A 4R4JA 1RC1A 7ADHA 1RXCA 4Z4FA 1PQ4A 3BK2A 3DZIA 4BTLA 3K73O 1U0RA 3VNAA 4UVDA 4C21A 4WZAE 3EDQA 1YZVA 4EQ6A 1M5RA 2WU8A 2J0SA 2UUBB 3WK4A 2EXXA 1OCEA 4WY8A 1JQKA 4YDQA 2I1QA 4P98A 2VWQA 3VO8A 1X92A 2O2SA 4YV0A 1OHHD 3WHKA 1NT4A 1GKYA 4UPEA 1VKZA 1XLTA 2BZGA 4RXMA 5LMCA 1YAHA 4JWKA 1RHUA 4ER6A 2G9QA 1J0CA 2NUAA 3QLTA 5U4XA 4UD2A 3TBFA 1SBYA 2F3PA 3CW8X 3KXKA 1KORA 2AIRA 3ME5A 3D3WA 3NXSA 4MKHA 4Y7DA 1ODKA 2P91A 3RVLA 2DWOA 3E8XA 3G9QA 4EZIA 4EMSA 1E9AA 1H2EA 1PYGA 2H7XA 2A9QA 1WDMA 4KEAA 2X1MA 3ONDA 4GZ6A 5IUNC 4NHEA 3CRQA 1C7EA 2BF4A 3FBGA 3V1TC 3ZDDA 2H0AA 4YV1A 3UJDA 3DQQA 1E3QA 4J7XA 3ET5A 3R6WA 3AWIA 3A0UA 4XJXA 5IAEA 3ET4A 3KDSE 2WJVA 2RGYA 3W6ZA 4OX9Y 4LBZA 2QJFA 1JIIA 1M2VA 4AO6A 1QE0A 2Q46A 2VH2A 3MOGA 2X19A 1KDRA 4MAAA 5EQDA 4CR8A 2YQZA 3QWBA 4IDGA 5CLHA 1ZR4A 1DBVO 3IALA 2ET6A 4PNPA 4K0RA 1WVMA 4KR2A 1KYIA 1P1IA 1QTRA 4L27A 4J3NA 4P22A 5ALWA 2ONJA 2FFBA 2E2WA 2BR5A 4WQMA 2XGSA 3P9ZA 5FUYA 1DX4A 2G9NA 5A6SA 1GGVA 3SIWA 1RPZA 4ZU1X 1PVDA 2O7VA 4ZYZA 2XTZA 5HQTA 2P1DA 4M8SA 4CU2A 3X1DA 4UNQA 2PIAA 1DLJA 1F48A 1C7RA 1UPTA 3N76A 4I8XA 4J6EA 5DB4A 4DAOA 2AJDA 4RANA 3GJ6A 3VAAA 3BF7A 2Y0BA 1L9XA 2C5FA 4R54A 2PHZA 4TKMA 1J20A 1FXWA 3GMSA 4K0KB 1CR6A 1MOPA 1UR5A 2HCTA 1ZIOA 3N3AC 1PYDA 4GZMA 4MRVA 3GCZA 3S2EA 4I2VA 5BURA 4B3DA 2PLRA 2X41A 2DT8A 3R3SA 2BFCA 521PA 2WQ6A 4TRJA 2WI8A 1VFNA 4CM1A 5C4GB 2ZROA 4M1KA 4RSHA 5CNJA 5U1PA 5TQ0B 4XWKA 1WIWA 2PY6A 1ANKA 4Q02A 1VPWA 2YWDA 1PJSA 1LRKA 2XYPA 2B1RA 4X85A 1XQYA 3H1PA 4HXYA 2G06A 1TYDE 3NWBA 1C3VA 4JLNA 1U8ZA 1RVDA 4P81A 3ZS8A 1MTZA 3DAFA 3EG5A 1ZRSA 3GBPA 4PSDA 1JHYA 2PL5A 4FJ2A 1HWYA 1AKWA 3TR5A 3WL8A 4CM9A 3Q1KA 4XJVA 3OFKA 4NMMA 1Z17A 4LFCB 1KL7A 1ZS9A 3GNLA 5HOQA 2A9JA 1PNTA 2NVBA 3E3MA 4FCWA 4HXFB 5KYKA 2JCBA 1VP9A 2OFXA 4PLCA 2JIPA 1N7JA 1X0VA 2CLDX 5HTOA 5J2UA 1G9XA 1Z6PA 2IYXA 2JBHA 2VKQA 3L4BA 3OM8A 5H3HA 4BKMA 2VUTA 3PRJA 2Q5JA 5B2EA 2DU8A 1APBA 4ZN6A 3BORA 4PG6A 1PWXA 1QFYA 4WGFA 4G8JA 1SQFA 2ZATA 1XRQA 3CR3C 2TRSB 3LQ2A 3DMDA 4Q1DA 3AR7A 5TJHA 1HNZB 1CQXA 1L8AA 5KYUB 2DVMA 2W0MA 1H1DA 4WK2B 2I78A 3MTEA 4F5DA 5FOTA 5AKIA 4BLWA 5DGHA 1MO6A 3A06A 4W1PA 3JAKA 1DFHA 2A5FA 2R8YA 5JPCA 1Z8FA 3BH0A 4LYHA 3DE7X 2V0GA 1PJQA 2HDOA 3H2ZA 2HFJA 4LRWA 4PC7A 1CLUA 2N1BA 3NCTA 3IP7A 4EUEA 4NOLA 2HLPA 2QV7A 2XOKD 3TB4A 2DWPA 3CF2A 3H8WA 1NNSA 2OLEA 3DGEC 3N2KA 4I1YA 4M0KA 4OK5A 1JQ3A 1ZSVA 1BAPA 2WLSA 2RK6A 3AJDA 4AO7A 4BNLA 5CFRA 1SOVA 1X1RA 2B35A 3V8VA 5CDHA 1R4MB 3LZDA 5I8PA 2FPGB 1KNQA 2XCIA 3NRJA 5CCEA 1ECLA 2L17A 2ROQA 4CZ2A 1S2DA 2ZYVX 4HB3A 4R7ZA 3JASA 4M86A 4RSGA 3WIBA 1QQTA 3TUIC 2YV2A 2IEIA 1IG3A 4H7HA 2JIBA 4DG5A 3O91A 3C6XA 4JCCA 1SXHA 2DP4E 4ZMBA 1VP3A 4DNQA 5EXEA 4C6TA 4MK4A 1F8UA 2W70A 4D4MA 1BDBA 5C7LO 1TFUA 2NOAA 1E2HA 3ONFA 2WD7B 1R6XA 1KI3A 1SHLA 1O94A 5BV0A 2ZWAA 2BHSA 4F5YA 2EF0A 1U2ZA 1YRAA 2EL9A 4BV2A 2JLVA 2RH5A 3H4TA 3K0AA 1TF7A 4H31A 3TZ6A 2IOFA 1EWKA 3MOIA 4XQGA 2CFRA 1XMJA 4AJ1A 4AAYA 3GL9A 2GSWA 1NQXA 1T43A 1YO6A 4HDMB 4HQOA 3PT9A 4IV5A 4KDFA 5H68A 5JD4A 3LHIA 1EUDA 2Q6OA 3ERCA 1PGQA 3QUBA 1ZC4A 4MQ6A 3MWLA 4YBRA 2CF5A 3NJ8A 2X3YA 4DLUA 5IXJA 3ANYB 3TFWA 1JILA 4IFEA 1OFGA 1UPXA 4K7JA 3SFVA 2OGTA 3LPAA 4MVJH 5LSAA 1HYHA 1H94A 2YH2A 3QFCA 4MGZR 4RVDA 5FKJA 5H4GA 2ZIVB 4XLZA 4YUWA 3O92A 3DP9A 1P4JA 4QQFA 2PD6A 2Z3WA 3PXEA 5FUXA 3UV7A 2DXIA 1H22A 1GTSA 3QKWA 4O0MA 2XD9A 4MV6A 2QMHA 3CEHA 2RIPA 3RIHA 3I5MA 5AUOB 2ZRLA 4CODB 1KZ7B 3DOFA 3HCPA 4HLQB 3UGTA 1RLIA 3H11B 2J45A 1WJGA 3L0IB 4Y6RA 4ZQHA 5I51A 3PNPA 5MN6A 1FVXA 2XWJI 4MKXA 1Q15A 3NBZC 5H0IA 2DUJA 2OWEA 3B1YA 4KXNA 3K1AB 2RAUA 3E0XA 4BU1A 3H97A 4NNOA 4ETMA 2EZ4A 4X8MA 2ZXEA 1KZ6A 2XZLA 1WHSA 421PA 3ZWVA 4N0MA 2XXAB 4MV5A 3D6TB 4KIUA 3PEUA 4K26A 4RCVA 1N5IA 3EVZA 1B1CA 2OCKA 4MCHA 3D6AA 3V7YA 4EG6A 2I67A 1EFVA 4G4JA 4EGQA 5KJ6A 3T7JA 3T1QA 2JGMA 2V0CA 3VH3A 4RYLA 4H6WA 3O8QA 3ZLTA 5CYPA 3DDCA 4B5KA 4EOGA 4HLNA 1A98A 3BCHA 1WUTA 4LBYA 3FN4A 1T5OA 3OICA 7AT1A 1QYXA 4PZYA 5DEIA 1DX6A 1Q0ZA 2UVDA 2I4NA 3ILSA 4XX0A 2ZE6A 1DJLA 1LCIA 1BA3A 1T6YA 2Q5OA 4YJ2B 2JGAA 2HTEA 2HF9A 4INPA 3SSMA 2AR9A 4UUOA 2LW7A 3V7NA 1LI7A 1QHSA 4I5GA 4OHUA 1S9DA 3LT2A 4E5VA 4TT8A 1E4VA 1L5MA 3C1OA 3ZE6A 4MWDA 3CFYA 4BVBA 1P1RA 1P7WA 1L7DA 3Q87B 4DA7A 3MZ0A 3OCUA 1B6GA 3D4LA 2OB1A 1DO8A 3GUZA 2C8KA 2IKSA 3UBMA 1OE0A 1Z5VA 3E70C 4KJXA 4YTEA 1QHNA 5T4BA 2ZVJA 2QUJA 1H1TA 1D0VA 2C2WA 4FYMA 1YF3A 2ZUVA 4BNJA 1OA0A 1QOQB