2FPOA

Putative methyltransferase yhhf from escherichia coli.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
183
structure length
177
Chain Sequence
b'GQIRIIGGQWRGRKLPVPDSTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methylase yhhF
publication title Methyltransferase that modifies guanine 966 of the 16 S rRNA: functional identification and tertiary structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 56
structure length 177
sequence length 183
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.171: 16S rRNA (guanine(966)-N(2))-methyltransferase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fpoA00
3PS9A 5KQSA 5DSXA 3MCTA 1O54A 4M37A 4YUXA 3EVAA 3LKZA 2P41A 3IYLW 4U7PB 3UJAA 3G5TA 1XDUA 2YXDA 3EGEA 3GCZA 3HCEA 3P2KA 3UA3A 3P9CA 5GM1A 5T64A 1KPIA 3KHKA 3TFWA 1WXWA 5DM4A 2NXJA 2UYOA 4P7GA 3HM2A 3JWHA 5DTQA 3LGAA 4RTLA 3OFJA 2ESRA 2I62A 1R18A 2PXXA 4FSXA 3B3GA 4KWCA 2PGXA 4E2WA 5EMMA 2BR3A 2JJQA 2QE6A 1Z3CA 5E9QA 1QAMA 1KP9A 2G70A 2BR4A 4B17A 5K0CA 5U4XA 5LQAA 3TR6A 2P3QA 2ZBQA 3FUVA 5EGSA 3B3JA 3HNRA 2FRXA 3UA4A 4OQEA 1XDZA 3KPVA 1SQFA 3BZBA 3M33A 5F2OA 5EMJA 5ICFA 5K01A 3P9KA 1H1DA 2FCAA 1Q0TA 1NW8A 4BP1A 3DMHA 4AZWA 3P71T 2C7OA 3CVOA 2I9KA 2QY6A 2Q41A 5BW4A 4GC9A 5CVVA 2BM9A 4AX8A 5C9ZA 1VP3A 3HP7A 5DXJA 1VBFA 3LCUA 5K05A 3BKWA 3NMUF 3TMAA 2IFTA 1R8XA 4CTJA 4BP3A 1UIRA 2AS0A 4PIPA 3TPZA 4QTTB 4X41A 4RTMA 3A7DA 3LHDA 4LECA 3NWEA 4IWNA 1XCLA 1I1NA 4R8RA 5FUBA 2IBTA 1BC5A 4HC4A 4MWZA 3DULA 4PONA 5EIWA 5CD1A 1XTPA 1ZGJA 2ZCJA 1JQEA 1WXXA 3FUWA 3CBGA 3ELYA 2AR0A 4PCLA 3DLIA 1SQGA 3G8AA 2EJTA 4RWZA 2EG5A 3SVZA 3BT7A 1D2GA 1L3IA 3Q7EA 3REOA 3TLJA 2VDVE 4YUVA 5DLYA 3KQPA 1AQJA 3R6TA 2E5WA 1INLA 4HGYA 3PX3A 1AV6A 2OB1A 4R6XA 2YTZA 3T7TA 4GOOD 1EG2A 3TM5A 4AZTA 5EG5A 5EQJB 3C6MA 3KQTA 2OKCA 5H02A 1UFKA 4FT2A 3G2OA 2LD4A 4LWOA 5FQNA 5ICGA 2PWPA 5K0BA 3DR5A 1IXKA 4LWPA 4P58A 1FJXA 2EFJA 1NW5A 2OYRA 4YUYA 2IBSA 5KVAA 5EKXA 1SG9A 1VPTA 4IV8A 3R3HA 1X1DA 2P7HA 2DPMA 2IIPA 2XYRA 3I58A 3KPWA 5CUQA 3TM4A 3FPFA 3G88A 3OU7A 4RTKA 1IY9A 3KQQA 3A27A 4RTRA 2KW5A 2PVCA 3IEIA 2AOWA 1YUBA 5DSTA 4PWYA 3KR2A 5EEHA 4E31A 2YX1A 5EEGA 5P8WA 1QAQA 4BLWA 3RW9A 5KYGA 5K0FA 3C0KA 2V74B 1PRYA 5BXYA 4AZSA 3SSMA 4C07A 2WK1A 3FPGA 3TKAA 5DTRA 2C7QA 1ZG3A 3NDIA 5HZMA 5K0NA 2AOUA 1BOOA 5FA5A 4PYOA 3M6VA 3C3YA 2AZTA 1JG4A 4IV0A 2I6GA 2O05A 5FA8A 1TPYA 4P7KA 3UJ9A 1MJFA 2IP2A 4F86A 3CJTA 2JHCA 5EMKA 1ZQ9A 1NW3A 3BGVA 4DZRA 5GIOE 3ORHA 1VIDA 4L7VA 5FHRA 1FPQA 4E30A 3MTEA 2OO3A 5DM0A 5E1DA 3Q87B 2K4MA 4H0NA 3OZRA 1BHJA 1R8YA 4C03A 1NW7A 1TW2A 2EJUA 3ELWA 3R9XB 1EQAA 3FUXA 3KR0A 4XCXA 3U81A 2ADMA 3UBTA 1ZKDA 2P3LA 2ERCA 3BGIA 4CXMA 2NP6A 2GAFA 1L3CA 3DXYA 4ISCA 3B89A 2F8LA 4AZVA 2CMHA 4E70A 5CCBA 4A6DA 3EVFA 2JHPA 5C1IA 3T7SA 3OZTA 2AVDA 1JR4A 1P1CA 2VZ9A 2ZIFA 2OXTA 2PKWA 2Y1WA 3D2LA 3LDFA 1R6AA 4DF3A 4GF5A 2OY0A 2WA2A 2CMGA 2G72A 2G8NA 3CKKA 4EKIA 1NBIA 4RVFA 3CGGA 4OA8A 1VL5A 2QRVB 4IKPA 4MHTA 1QYRA 4M36A 5CM2Z 5DXAA 2B2CA 4BLUA 2ZFUA 3HCCA 5JUWA 4FS8A 5F2KA 1RJDA 1KPHA 2PBFA 1O9GA 2ZW9A 5EIFA 1L9KA 2VS1A 3QOWA 3PVCA 5BW5A 2ZTHA 3G8BA 3AY0A 3GWZA 3HVIA 3F4KA 3HVHA 4EQZA 4XUDA 5BP7A 4RTNA 4RTOA 4FGZA 1YZ3A 5HFJA 5HIJA 3HVKA 5T6BA 5DX8A 4C08A 1WS6A 5ICEA 3VSEA 1HMYA 3A7EA 4BY9E 4PIMA 4HH4A 3V8VA 2H11A 1G8SA 4GOLD 3MTIA 3NW9A 5GM2A 3LDGA 2ZZNA 4X63A 5CVUA 4QDKA 4E32A 1RI2A 1JG3A 1JQ3A 3KQYA 4QPPA 3KPJA 1D2CA 3KQOA 1SUIA 1TW3A 4V0QA 2VDUE 5DM1A 1R00A 5E8RA 3AXTA 2PWYA 4RTPA 4U7TB 5GIPE 2BH2A 5C0OE 4FP9A 5LQCA 2FPOA 4EVIA 2IDKA 3KU1A 2B25A 5GWXA 5EZSA 2OPBA 3UJDA 1AF7A 2ORED 5FQOA 2ZSUA 3PX2A 5K8VA 5MHTA 5HILA 4P7JA 4KDRA 5D1HA 1FBNA 4PYNA 2YXLA 2XVMA 4K6MA 3I64A 1OR8A 4PYKA 3DTNA 3FTEA 5DT2A 3DH0A 2IH4A 3EGVA 4E33A 5K0GA 2HR1A 4HTFA 5HIKA 1JSZA 2GS9A 2AOVA 3ER8A 5LQUA 2H1RA 2O06A 1L1EA 4PYLA 5EHGA 3S68A 5EHIA 5K0JA 3MHTA 2UYQA 5FTWA 2HV9A 5JR3A 1SUSA 5T67A 4RX1A 4OBWA 4PGHA 4DM3A 3ELUA 2PLWA 1YB2A 3MQ2A 4KRGA 3UJ7A 1U2ZA 3GIWA 4PNEA 4MTLA 1X1BA 3G7UA 4HG2A 2JH9A 3LX6A 3HCBA 1FP2A 3MCZA 1P1BA 4KIGA 3WSTA 1N7JA 8MHTA 1WG8A 3C3PA 5K09A 3OCJA 2NP7A 3V97A 3FUUA 5EKUA 3HVJA 3QV2A 4RVGA 5KS2A 1NKVA 4DMGA 5GOZA 1YFJA 3GNLA 4RVHA 3EVDA 2NXCA 1KYWA 2QYOA 3FPHA 4CKCA 4YMGA 4E2YA 3PT9A 5DX1A 3E7PA 2YXEA 3BKXA 2ZZKA 3EPPA 3LL7A 2AOTA 3HA5A 1JG1A 5CVEA 4EK9A 3LBFA 1HNNA 1JQDA 2DULA 3O7WA 4EMSA 2UYHA 3KPUA 3EMBA 4AUKA 5DTMA 2EX4A 3AJDA 1WZNA 5LR6A 1YF3A 3FTDA 1RI5A 2FYTA 1I9GA 3DP7A 2WA1A 4PGGA 2ZBPA 3JWIA 5DRYA 5GP1A 4HGZA 3SR4A 4YUWA 2I7CA 3BWYA 1DL5A 3EVCA 1V39A 3P9IA 1XDSA 3ID6C 5M5BA 3BWMA 5ERGB 4HSGA 4NECA 3M6UA 4PYMA 3CCFA 3AXSA 4Y30A 4HRAA 5HIIA 5LQJA 1X19A 3EMDA 4FT4A 3HCDA 4GUAA 3UWPA 3I9FA 2ZLBA 1NBHA 2CKDA 4XUEA 1T43A 4XUCA 5FCDA 5EVJA 3M70A 5GINE 5FWDA 4ER6A 3ANXA 4GBED 3SSOA 4OBXA 5EOVA 3NTVA 5E1OA 4ER7A 3PTAA 3EEOA 3AWIA 4GQBA 3B7PA 3VC1A 4F85A 3C6KA 3KR9A 2AOUB 5CVJA 1G55A 2C7PA 3G2QA 3FPJA 4DCGA 1XCJA 2ONZA 2B78A 1M6YA 3GRUA 2B9EA 3LDUA 3VC2A 2HTEA 3A26A 4O29A 2ZBRA 1VP9A 3OE5A 2PJDA 3GU3A 3FRHA 2AN4A 3DMFA 4CKBA 2BM8A 5EPEA 4C05A 3FRIA 3OU6A 3R24A 3GJYA 5HIMA 2JH8A 2Z6QA 2O57A 2AN5A 2PXAA 3HA3A 5FWAA 4KW7A 3HA7A 5DX0A 5K0LA 3EVZA 2VDWA 3EGIA 3KQSA 2Z6AA 3HTXA 2NXNA 2Y1XA 2C7RA 1G6Q1 1RI3A 1P91A 1RI4A 3EVGA 1KXZA 4YUZA 3DXXA 4QPNA 1DCTA 3I5UA 1XXLA 5EZQA 4X60A 4ER5A 1BKYA 2ZVJA 3OZSA 3PLAE 2IH2A 1AQIA 2FK8A 3FUTA 1KHHA 5LQNA 2ZIEA 1KIAA 4RTSA 3DLCA 2PV0A 3HCFA 3GGDA 3KQVA 3IHTA 4X1OA 3TRKA 1I4WA 2ZIGA 3NDJA 5F2NA 4Z2YA 2P40A 4POOA 2AVNA 5E9WA 4M7RA 3LCVB 3X0DA 1NW6A 1G38A 1X1CA 2XVAA 3DUWA 3TOSA 3B5IA 2P35A 3GDHA 3OE4A 2YVLA 2IH5A 3BGDA 3G2PA 4MQ4A 5DM2A 1X1AA 2GLUA 3JWGA 2OBFA 4FSDA 4RSRA 3OU2A 3UZUA 3CJQA 1QANA 4LG1A 2G71A 4WXHA 3THRA 2GPYA 3KQWA 3A4TA 3T0IA 3TQSA 1YFLA 3BWBA 5K03A 3P2IA 3K0BA 3GRYA 2V7EA 2XYQA 4PINA 4R05A 5DRTA 5FULA 3RODA 5HEKA 1M0EA 5KQRA 1YZHA 1M6EX 3FTCA 3HEMA 3NJRA 5EC8A 1FP1D 4Y2HA 2YQZA 4GOND 4E2ZA 3KKZA 3SX0A 2PT6A 2FHPA 5E2AA 4YV2A 2JG3A 2OZVA 5CVDA 1P39A 2P8JA 3EVEA 3M6WA 1VLMA 9MHTA 4PCAA 3OFKA 4OQDA 5E9JA 3UJCA 3GO4A 2GB4A 5FADA 3EVBA 3DMGA 3G5LA 1R74A 4ATNA 2JHAA 3BUSA 3E23A 3T7RA 2PX2A 3LKDA 1D2HA 1ORIA 4RVDA 4A6EA 4BLVA 3O31A 5EMLA 1KPGA 2O0LA 3JWJA 3UJBA 2QM3A 2HNKA 4HTFB 3LECA 5D1NA 4F84A 5LQRA 4UOEA 5LQKA 3MAGA 4QTUB 1N2XA 4R6WA 3SGLA 3SMQA 3KQMA 5HOQA 5ICCA 4ER0A 4C4AA 4GOMD 1NE2A 4DCMA 3ME5A 5FHQA 1NV8A 2XYVA 2UYCA 4RTJA 2P3OA 5E1MA 5IH3A 1SVUA 1SKMA 2BZGA 4MIKA 2AN3A 4PYQA 3UJ8A 1JTEA 4V0RA 3FYDA 4R8SA 2A14A 1ORHA 1NV9A 3NVMB 4C06A 4KDCA 1O9HA 4RV9A 4RYLA 3BWCA 2H00A 2BR5A 4OX9Y 2GH1A 10MHA 3FTFA 3L8DA 3IV6A 2HWKA 3E05A 5G02A 1ZHFA 2ZZMA 1PJZA 2IGTA 2O07A 3K6RA 3MERA 3MB5A 3GXOA 1QAOA 5DWQA 4YV1A 3M6XA 4FR0A 5E1BA 1WY7A 2IPXA 2G1PA 3GRVA 2AOTB 2GA9A 2R6ZA 4GEKA 3TKYA 2PY6A 4JXJA 1Y8CA 2NNWB 2PX5A 2YR0A 3ER9A 1MHTA 3LPMA 3PB3A 3P2EA 1QZZA 3P97A 4YV0A 4ER3A 3UFBA 3CJRA 1EIZA 1VQ1A 3O4FA 2IDJA 4QVGA 2B3TA 2PX8A 2NYUA 3KPYA 4DA4A 2UZ4A 2OB2A 3NWBA 1JG2A 4FZVA 4P7FA 3THSA 1KR5A 1RJGA 2VP3A 2PXCA 4KIFA 3UJ6A 3M4XA 5E8JA 4C04A 3SM3A 5K0EA 3QOXA 1N7IA 1Q0SA 2ZWAA 2NXEA 4KVZA 2CL5A 4OA5A 5E2BA 2N47A 3SSNA 1JSXA 3CC8A 5DPMA 3VYWA 2FK7A 1B42A 1EJ0A 5B1SA 3I53A 3NVKI 4WVLA 3GRZA 1F3LA 2CWWA 3G2MA 4E2XA 1UWVA 1VE3A 3FPEA 2PSSA 1RJFA 3BXOA 3ELDA 2AOXA 3R0QA 3LSTA 5LSAA 3KR1A 1ZGAA 2R3SA 3PFGA 7MHTA 4QQKA 3FYCA 2PT9A 1RJEA 3ERCA 1EAMA 3B3FA 3P9NA 1DUSA 4PYIA 4G56A 2PX4A 3P8ZA 2QRVA 4CWAA 4GC5A 3LCCA 4DKJA 4QVKA 3LBYA 2HMYB 3GRRA 3PFHA 3HCAA 1JTFA 4X61A 2ZWVA 4RTQA 2XBMA 5CCXA 3A25A 3EEYA 1XJ5A 1NT2A 1G8AA 4M38A 4YMHA 2Z6UA 1L3BA 1KYZA 2ZULA 3SXJA 4PYJA 1EJ6A 2P7IA 1XVAA 3DXZA 3FZGA 3G89A 2ONYA 5CIYA 1RI1A 1IM8A 2YUIA 3E8SA 3H2BA 3MGGA 3RIEA 4CTKA 4EKGA 4CKEA 5IKMA 1F38A 3DOUA 4DQ0A 3OPNA 1G60A 4ZTBA 4QQNA 4QDJA 2P1DA
chains in the Genus database with same CATH superfamily
4GKBA 1QZTA 4YRZA 1O54A 4D9KA 1L5MA 3SIRA 4NV3A 3G5TA 2XMBA 3UJAA 1JFLA 2AG6A 1GRNA 5IAJA 4FGWA 2ZRKA 4KPGA 5AI6A 5K8LA 2DF8A 1GLVA 3DM5A 3U19A 2EEPA 1RTKA 2NXJA 2UYOA 2KJQA 2X9VA 4RVNA 3HR8A 3OFJA 3TBFA 1WW3A 1KMHB 1P6QA 3NDBB 4A9AA 5FV4A 3MGCA 1GYPA 1UANA 1Y3BE 3ROXA 2IS6A 2QTTA 5AUPB 4LYAA 2VYCA 4IR7A 1EUZA 3I4CA 1Z3CA 4ZARA 5K0CA 1P4AA 1Y5NA 2F43A 1NASA 2ZBEA 4IUDS 1CEYA 1GGFA 4E11A 2EKQA 1XEFA 3QWBA 3OLXA 4YP1A 5IUNC 3KPVA 4PZ0A 4EUHA 4DV5B 1AX9A 1E2FA 3H8JA 1H1DA 1LVUA 4RSGA 4IWXA 3U6KA 2OR3A 2DRIA 3HCPA 4PO1A 3DOHA 4OFXA 3T0FA 1JE1A 1J20A 1ORVA 3QFFA 3GAZA 4HB3A 2P91A 1XVVA 4N9WA 3KAKA 4MYCA 4QFMA 4ZAVA 4ZU1X 4JUDX 3WRYC 2GBCA 1U4NA 4N54A 1E4OA 4DE5A 2QLTA 4C0AC 1MX5A 4I2VA 1WMSA 1L5KA 421PA 2B7BA 1IL0A 3II6X 1RPAA 4Q3LA 3WQQA 2CT8A 2IUTA 1KDZA 4YR7A 2ARKA 1O2DA 3TSAA 1XTPA 4L7QA 3P4YA 4IDOA 4MB6A 3T99A 5IM4A 5ADVA 5AXCA 1FQOA 5IFLA 3JQFC 5DYYA 3K16A 4CE6A 2WAMA 3WIBA 2EFYA 5CEEA 5D8DA 3SVZA 1P8JA 2DUJA 1R0YA 1LTHR 3WDSA 1A5TA 4UUNA 3SQNA 4DS3A 2X86A 2O2DA 4DNXA 1LQ2A 4G81A 1T9KA 2H51A 4QXAA 4WXPA 3HB5X 4JSTA 3U4CA 3RM3A 1NBMD 4MV5A 1L7MA 2HV8A 2YHUA 1A7UA 1XZBA 2NZ8A 1JPNA 3G1UA 3HZOA 1P9NA 4FT2A 3AF2A 1PT6A 3A3YA 5J2UB 4AO7A 3SU8A 4ESVA 1PAUA 2PAFA 5CNKA 1F8YA 1VHDA 4ZOEA 2FJ0A 4OHCA 3BXZA 3KSUA 2IBSA 3K0KA 2O2ZA 4KTVE 4DANA 4IV8A 2DHEA 3SE0A 1ZM3A 2ANCA 1UBCA 5H4GA 2BGNA 2RAUA 3S2SA 4KFSA 4P98A 4K6KA 2WSMA 4O3FA 1E59A 2BEUB 4B8YA 4AWXA 4JL6A 4C0KA 1GCIA 2YX1A 5IMSA 1XU9A 3DONA 1XVIA 2RCYA 3MT0A 3O94A 4JELA 3PGJA 5F7JA 4R8VA 2DJIA 3TOCA 3W1WA 1KC1A 4BWGA 2QWXA 4C7XA 3PICA 5JNVA 3CPEA 1NXWA 3F5MA 4UATA 2PV7A 3DLAA 2CYAA 3RT1A 2WM9B 3F7MA 4ZOAA 3O3OB 4PYOA 2V6IA 3UJ9A 3ZDZB 1RM5A 1UOQA 3IPAA 1MJFA 3QENA 4C7VA 3JD1A 4FCTA 3ZLTA 1X92A 4GPTA 1KEPA 3K0FA 1NFQA 5AUNB 5BWNA 4B85A 1IMOA 2ZPAA 1R9JA 4Y2RA 2QG9A 3T4XA 3ILSA 4FFMA 5DM0A 2VBGA 2XUQA 3Q87B 3TI9A 3ZVLA 4C89A 4F9TA 1XLTA 4HFMA 1BW9A 1FFSA 1NUUA 4BBZA 2QLMA 2WNSA 3KR0A 1WCIB 4Y6SA 4HH0A 2QTBA 4LRWA 4K81B 4RA6B 3BN3A 1NVUQ 4X8HA 5FPPA 2NU9B 1CEXA 3KSZO 4QOJA 3U3JA 1WETA 2CMHA 4MSUA 3T9AA 5A6SB 1HZJA 4IJUA 4CKBB 1G3QA 1R4ZA 3GP3A 2F2TA 4L6IA 3Q8WA 2OCPA 4G5FA 1CNMA 5JATA 2C78A 2ZSJA 3R3SA 2JGIA 3GFPA 2G8NA 2P4SA 4Z99A 1DO0A 2P4HX 4KSYA 5DMXA 3T06B 2B99A 2GLXA 3N8HA 2H3HA 3W3AD 4HN9A 4GW3A 4X3OA 4BIIA 4M9SA 3RRNA 4BLOA 4EPXA 1CXZA 4IDBA 5UKDA 3VXKA 2DFDA 2DC1A 5DP1A 2WJGA 3CCBA 1OY1A 4KIJA 3LWBA 3TBKA 4AKEA 1C30B 2REQB 4DR3B 2HCFA 4Z9YA 4CLHA 3K7EA 3WB2A 1Q0PA 1ADFA 3OOWA 4RSMA 5F76A 1YVDA 2PQ0A 3ENNA 2FW8A 4R2WA 2FOLA 3V8VA 3L06A 3OZFA 5FNVF 5HDQA 1UKBA 5B7PA 3RAGA 1JG3A 2YXNA 1SWWA 4OGKA 3KOXA 3CF2A 2O19A 4YCLA 3T5MA 2W8ZA 4MV7A 4UCXA 5DM1A 1R00A 2HJSA 3E5RA 3IRVA 3MTJA 3VJKA 2R6R1 3LX5A 4QOHA 3PI6A 4Q9NA 1OAOA 4HTAA 1I7LA 4BV8A 5JH7B 1F20A 3DVAA 3TE6A 3IMFA 3OOEA 3AILA 3UO8B 2XZLA 2Y0PA 2ZIUB 4XD2A 3KQUA 5K8VA 1OT3A 2YIVX 3V1YA 2E7ZA 4EKNB 1EFLA 2CUKA 1FA9A 3OJXA 4NV0A 2Q62A 1NP3A 4NPCA 1OR8A 5B1HA 3FTEA 1ML3A 3AR5A 4MW9A 4BJ3A 3HJCA 2JLAA 3AFIA 3AESB 4OHMA 2XTZA 4NE2A 5CFRA 2QQ0A 5K0GA 4MH0R 3AM3A 3HK2A 2HRQA 1SRQA 1Y7LA 3P0JA 3QPAA 1W8DA 4UFPA 4B2YA 3DEYX 3EIWA 3AI1A 5LP6A 4DLXA 3VH2A 1L1EA 2O9JA 3JU3A 1Y4AE 4C78A 1TEVA 3ASVA 3UUFA 2X7XA 1IY2A 3IDOA 3O73A 4IIYA 4B80A 4Z49A 2BDEA 1ZXLA 5JJBA 1HM5A 3DTVA 5EKTA 4J16C 2ORIA 2HMVA 1W581 3Q0TA 5K6AA 1M1XB 1PJ8A 1V0JA 4DPLA 5TGDA 3M89A 1GGKA 4RDXA 2HU8A 1DQYA 2CMDA 3LPNA 5T4FA 1CX9B 3V97A 5L53A 2VQDA 3IDFA 1B8OA 3AR6A 3QV2A 4CHTA 1CUBA 1OLUA 2RARA 3FNEA 4E03A 1NKVA 1P5ZB 5EFOA 1ULTA 3PUIA 1NM5C 4XCVA 3U3RA 5D3MA 2J9GA 2ZTVA 5ALYA 2CLOB 4LMPA 2D2XA 1H93A 2ZE7A 3KE9A 4GPAA 1HDGO 3I2FA 2DT8A 5CVEA 4EYSA 5J4HA 1Z38A 3OCWA 1RAAA 2BAGA 2PKYX 5D7NA 3WKDA 1ZD3A 2BN4A 4RKYA 5AW4A 2K2WA 5M04A 2R4QA 1AE1A 3QXJA 1RI5A 1FLAA 4R83A 4E5KA 4M8KA 5BUCA 5EJ6A 3IIEA 3TL6A 4D9FA 1B0AA 1I8TA 1Z45A 1YAJA 3W90A 1TRHA 2ZXFA 3GPIA 1G19A 4A10A 5J47A 3KALA 2ZR9A 3OQMA 3ONEA 1G21B 2XLBA 4DR6B 4I36A 4JJZA 1I94B 2PZGA 2B5WA 1OJLA 1XQ1A 2GN8A 2J32A 3PEYA 4IILA 1D4AA 3ZBQA 1W0KA 4AJ9A 1BXZA 1BQ4A 1UXJA 2PPLA 2WKQA 2OGTA 4K05A 2BHRA 1P7WA 3NTVA 1NNSA 1XDDA 2ATEA 3OPYA 5FUVA 1XLUA 4QTYA 1GPKA 4YC7A 4BNDB 3K70B 1QIJA 5NLLA 2F3UA 2VT2A 4MDHA 1RHQA 2JCBA 2WSSD 1M34A 3QPWA 1GQOA 4ZQBA 4RPLA 1SZDA 3DFUA 1SCDA 2IODA 4R0MA 5B2ZA 3EN0A 2LZ0A 3PEEA 4V38A 2PXHA 4MJ7A 1PCXA 3F6YA 4R3WA 4KQ6A 1GSHA 2AN1A 1NJ2A 1UADA 3AINA 4BMYA 4DJFC 2P4QA 3FMOB 3ZE9A 3UQYS 3HKCA 4N03A 4H18A 2QNIA 4A7PA 1RE1A 4X90A 3DZJA 3E58A 5EINA 3ZU6A 3I5UA 2I4OA 3IQZA 2PFSA 1SCNE 1SC3A 1TKCA 1VKNA 4P8RA 3MG9A 1PJ4A 5AKHA 1F17A 4AXXA 5I5EA 5KU1A 4MUXA 1W94A 3KD3A 1E61A 1E7YA 1SMKA 4REQA 1ZICA 4I55A 4KKXB 5K51A 1M1ZA 1XN1A 4YCSA 2CJWA 2XI4A 3EXIA 3WAKA 4F6CA 4QEDA 4PHTA 4B87A 2CXRA 2PS1A 1NNI1 4POOA 4E5YA 3I2HA 3PIDA 5REQB 4FUQA 2REXB 1X1CA 3DUWA 1JIIA 1G98A 2F9LA 2P9QA 2P79A 2R8ZA 4BP9A 4C0XA 1SUEA 2K87A 5DHPA 4JUFA 2WQ6A 1X1AA 4OHBA 2J7KA 4Q4AB 1GV1A 5L3VA 2J85A 3OU2A 3R5HA 5TDHA 1JR2A 2GK6A 3B2EA 1ACLA 1Y3CE 3G49A 2GPYA 3RSQA 4Q9HA 4EGQA 1U9ZA 1PYGA 2OBYA 2RGNA 5JAMA 4FN4A 3ZIAD 4NS4A 2WD7B 2QTVA 2X5JO 3CB2A 4PINA 4IUCS 4DZZA 2GVNA 5JJLA 1IDN1 1OPXA 4F5ZA 3I5MA 5AJVB 5JU6A 4LNHA 4WZAB 2YXPX 2RSLA 5TGTA 2DQKA 2J7PD 4JL8A 1XPUA 5JAZA 3WRXA 1JWAB 2OZVA 1O87A 2XMPA 3H2KA 2WKWA 1P39A 4OHUA 9MHTA 1AK9A 4FC7A 5FLKA 4TMWA 2I9PA 3HHPA 3VR0A 4DIUA 2RHHA 3UJCA 1U2EA 2P9GA 4NMHA 3GO4A 4KV7A 5FADA 3RYCB 2W7TA 4BC1A 1TA4A 3T7KA 4EFKA 4GPBA 4WTOA 2IYUA 4WAUA 4U6QA 2VJMA 4LJAA 1YZKA 4O0LA 3AKEA 4W6QA 4C87A 2B2NA 2V7BA 4BZZA 2R8RA 4W82A 1ORIA 1E92A 1STOA 2MYTA 3EGDA 4AJJA 1W76A 1V8OA 2OYCA 2F4NA 3ZGLA 2HNKA 2PRIA 4JU8A 1DC3A 1QORA 3EFOB 2YC2C 2YW2A 4D3YA 5F23A 3V42A 1A9TA 3M6MD 4B47A 2B8JA 4WCFC 3WICA 4F2GA 3A32A 1XA4A 1PFUA 1YVRA 1GPH1 3IAS1 5DI3B 3WJ1A 4ENWA 5DHTA 6ABPA 4W5TA 2UYCA 3E8XA 5JADA 3I1FA 4LRUA 5H80A 3A6KA 3SAJA 3U26A 1IEWA 1Z4IA 3BQNB 3T4UA 4AWAA 4NYIQ 1BWQA 1Z83A 3K5HA 1TA0A 4Z9XA 3TZBA 4AD8A 2CHVA 4M55A 2MMCA 4NU5A 3QX9A 3LUBA 4QYMA 5JS7A 3FTFA 3L8DA 4R2XA 3IV6A 3M3HA 5G02A 4KYVA 1T0IA 1ZA1A 2IGTA 4ZALA 4NMLA 3O8CA 2QRJA 5AOVA 3WB1A 5LIPA 2MINA 4NBKA 1AS2A 2WWHA 5T8KC 4LI3X 4FE3A 3TZKA 4KDEA 5G3YA 4EYGA 1XXHB 4RZ2A 2A0FA 1C1XB 1E9VA 3PCXA 4CM8A 3V8RA 3GJ5A 1N5MA 5K3FA 4QD3A 4RF5A 2EJBA 3L5OA 2XB9A 3RS8A 1M5TA 2WF7A 4LE1A 4WHMA 3AR8A 3CY6A 2DWCA 2WMNB 2YRWA 3ABIA 4OXYA 4NESA 5AVYA 2B3TA 4IBOA 3G9UA 1F8GA 1KFCB 1TYDE 3HJGA 4WVFA 5K3SA 5L8VA 5FTMA 1WU8A 2GD1O 4JY7A 3SZLA 3VU3A 1TMGE 2PH3A 4F38A 3V2UA 1KERA 1NZJA 2J0VA 3B1VA 5DZSA 2IOFK 4RAOA 2NU7B 4B76A 2EYUA 2WJYA 4L2IB 2J59A 1FXUA 5D51S 4FR5A 4LYGA 3ROEA 3GT4A 1M2HA 1WZIA 1CRWG 2GASA 1KIMA 2JEOA 1JSXA 2WTBA 3GUZA 3OTWA 1GQRA 3UHAA 1X8KA 5J58A 2BLLA 4B35A 5B1SA 5IHXA 1JHMA 1JFFA 1H2HA 2ZE6A 4MQ6A 2HLNA 4NEHB 4ZMRA 5KYNA 1F48A 2GF0A 1S96A 1AKWA 2EERA 1RJFA 2BTQA 4D9IA 4Z1MD 2I4TA 4FDUA 4XAQA 2HYDA 1M54A 3LCJA 4ASUD 3IUYA 5BNFA 4ZVNA 4I99A 3H2ZA 2CSUA 1I5OA 3OKFA 3UF0A 4B6QA 3UAVA 2NO5A 3N75A 1EEHA 4OQFA 2Q7OE 3S7TA 2Q0HA 1U2RA 2G1UA 4RBNA 4UAUA 1NT2A 2JK0A 4OXRA 2GN0A 5BSUA 4JROA 1DFHA 2IUYA 1G5IA 2IYLD 2V8BA 4R1LA 2XWSA 4DR7B 2ATCA 3RRMA 1MT3A 1LSJA 1TDJA 5J4KA 4NE7A 1U4OA 1OZFA 2WWFA 3O2NA 4LZPA 3TB4A 3RUCA 4NG5A 3SQMA 1J23A 4XOUA 4EH1A 2OSVA 4F2DA 1FJHA 1EP1B 3AV0B 1EFDN 2IYTA 1CUHA 3ZS8A 4W63A 2DKOA 4O08A 3DCJA 5B6IA 4MI9A 4PR0A 4A36A 5H59A 3QXHA 3VAAA 5KHAA 5C8YF 3F0TA 1QRUA 1NMZA 2AFHB 3TIFA 4EFLA 5AKJA 4A2WA 2C1EA 1YKFA 4K0KB 1V43A 1YS4A 4IG4A 1PI3A 2CFSA 5HM6A 4NQZA 1GFSA 1ZMBA 1N0WA 2BEWA 2XDQA 4KWCA 3QEMB 3FFAA 5HKOA 3COVA 3F7OA 1KFJB 1HE3A 2QM7A 4JP1A 1U1DA 1QO0A 5CB6A 4RGQA 1M6VB 5CURA 1XROA 1A9YA 1OLXB 1QKIA 1KNXA 4HDKA 1DAGA 4JI0B 5FAKA 3KCQA 4JYPA 4P92A 2LDBA 4M1MA 2G25A 2GM4A 4UTPA 5JW6A 5JXGA 3ZY2A 4KAJA 4S1TA 1DFIA 5ALSA 3UFXA 3ZU2A 3S55A 5DNVA 2VNIA 4ACBA 3F2VA 1K7CA 4FKBA 5FIUA 2NZ2A 1NY6A 1X7YA 1HORA 2HF2A 3W5BA 1VP3A 1FDSA 4TYPA 1VIVA 2XTMA 4CTJA 1NQAO 3GFRA 1KZYC 2V7TA 4JITA 2WEKA 3AR9A 4LHYA 3KEGA 1CUWA 2F48A 2QUKA 3LHDA 1W48A 4AMUA 3JQ6A 3TGLA 1NXVA 3TBHA 2QUIA 2J4CA 3EOBI 3QUTA 4MO9A 2MIIA 1EH5A 1LSOA 4HC4A 4MWZA 3DB1A 4RK4A 1TZKA 3EF0A 4M8LA 5H70A 1UMCB 1JFVA 4OXKA 2Q46A 1KAQA 1CUCA 3UV6A 1F2TB 3WWYA 2VP4A 1XPJA 2O23A 1A50B 3X1MA 5AUOB 3QTBA 2OSBA 1TVEA 4LI0A 3ZKAA 2ZT7A 1GA1A 2XKKA 2D8MA 3ZWOA 4ZP1A 3SNHA 2IV7A 1U0BB 4HV4A 2H1OA 1K06A 2VAXA 1KEVA 4WXYB 2OO7A 2HWWA 2JL1A 3NHKA 1ZZGA 4WESB 3GL9A 2HLHA 5TF4A 4BAUA 4WY2A 3T5CA 4J9VA 3ZCXA 3AF4A 3EIFA 5ETJA 4P58A 4AZ3B 4PG8A 3NKVA 5HKKD 2XOEA 1SG9A 1T6BY 2GEJA 3L77A 1L7EA 3NVAA 4KXFB 4U9IS 5GZ1A 2RKWA 2EVWX 5JRJA 4DNPA 4NENB 1X15A 2OKGA 5HX7A 1HRKA 3KIPA 4ZYXA 4XLTA 2Q3FA 1G63A 1SOWA 1YV9A 3KR2A 4X7BA 3BGWA 1SVSA 1QP8A 1RMTA 3K5IA 1HURA 4LDRA 2NTNA 4ZC1A 5BSFA 3NIDB 3LXUX 3C0KA 1X1QA 2VHXA 4AZSA 4OJYA 1KQPA 5DTRA 2X8JB 1QJ4A 2FPPA 3K9FC 3EUEA 4H7IA 2O20A 6YASA 3AVPA 4Q66C 1TNDA 4YXWA 2FVYA 1F6WA 1QHHA 1QH1B 1SG6A 4FEGA 4GOXA 4ZVUA 2VPXA 4XTCS 3ITDA 1OBVA 4O8ZA 1YU6A 4D74A 5I7AA 2NUPB 3ET5A 3QFTA 4DQUA 2BFBA 4PM4A 5A9SB 2WINI 3K6SB 3F6EX 3N2YA 4R7TA 4DUPA 2FFQA 1WRBA 1SXJE 3UENA 2O6HA 3AUTA 1GUYA 4LKOA 3S29A 2A59A 1XAJA 1Z5GA 1ACMA 3P9RA 1E9RA 2M6RA 3DMTC 4HHEA 3RV3A 3IVXA 1NUHA 5A6VA 1HT2E 3CX3A 4BVJA 1K0FA 4U8GA 4OK3A 1OI3A 1W36C 3S70A 5BSVA 2YW9A 1PE0A 4NZOA 4MW2A 3LZCA 1BDJA 3SICE 3C3AA 1JDZA 2VHVA 2ZDGA 3FR8A 1W4BA 3WK5A 3B2NA 3I0MA 3AHJA 3QU9A 1DADA 1SC6A 1MKYA 1S8OA 2QL9A 2Y71A 5G41A 3T7SA 3ZGVA 3DFZA 4BO8A 4CUZA 4QDZA 3O84A 1SHUX 2OYSA 4JI6B 5F2EA 4XFDA 5IAEA 3RFUA 1OB5A 3ND5A 2IKQA 1YIAA 2GZMA 2OGWA 2ISQA 3MWFA 3F5QA 4AZ0A 4XIJA 5AOAA 5KWIA 1VGVA 5TARA 4PAOA 4J2OA 2H2AA 4CCYB 1QTNA 4DC9A 1G5QA 2IUEA 1GPWB 3MMPA 1CUYA 4MCAA 5JV5A 2IU3A 2X8LA 1QK5A 3ICQB 3T1OA 2XB2A 4BVGA 1T0PA 1QFZA 2FY8A 3F4KA 4LGVA 4QEKA 4H1VA 4XOIA 1MU0A 4IIUA 1AM4D 3ADCA 4B33A 4R0NA 4FGZA 4DA0A 2FZ5A 1K4YA 4G1VA 3BMCA 3MYYA 3ZWDA 5ICEA 1MQSA 2WW8A 1ZK0A 5HTOA 4BY9E 3A9TA 2BEVA 3CWCA 5KO2A 4RY0A 1ESCA 2QMUA 3MTIA 3GA7A 3NW9A 4KQ9A 3UIEA 2OXRA 3H0EA 3E7XA 3OBIA 3S3TA 4BWVA 4XSGA 2XCRB 1L9XA 3S2ZA 4Q1FA 4X1YA 3CEPB 4QDTA 1VGRA 3GLQA 3AVUA 5DB4A 1IG0A 1FEZA 3EWNA 2DFTA 4U7TB 1KMQA 1JEAA 5C0OE 2ZG6A 2ZUCA 3GVPA 4DCJA 2ZIAA 2W8BB 2PWAA 1WXDA 3EIXA 4IGEA 1Z34A 1EKXA 5HK9A 1ISRA 1W73A 3KX2A 4PBSA 2Z43A 3VZDA 3LOQA 2MDTA 1GXSA 1T3ZA 4G24A 4P7JA 1NBMA 4L08A 2CJXA 3P27A 1N1MA 2ERXA 3S8MA 1FFAA 4CIXA 2Y93A 4PZCA 4DCOA 1TQ4A 3ANLA 3H05A 3Q3IA 1M10A 2EKDA 2OESA 4H59A 5AK0A 1E94E 2NVBA 4G0NA 1KZHA 1JI3A 3SYLA 4BJHB 4ZHQF 2WU8A 4X8MA 2HK6A 1WX1A 5KYWA 1CIJA 3IALA 4WOKA 1U31A 2ADFA 2W6OA 2VK1A 2IYWA 3LUCA 3ZGNA 2AOVA 2YWGA 1FYDA 3RS2A 4DUGA 5BWMA 2Y76A 4N5IX 2FOXA 4L4XA 3LY8A 3RYFA 5ALPA 4GMFA 3FCUB 3N2NA 1WO8A 4MV3A 1WULS 4MVJP 4KVFA 2ZSHA 2R1VB 3WL4A 4WZBE 2VWPA 3QWIA 4IW3B 1MPTA 4UEKA 4DA6A 2QV7A 3WSTA 1SVNA 5BV8A 3LD9A 5K09A 4RIEA 1XQ6A 2IVZA 4DYDA 3O1IC 2V7WA 2NACA 5DM60 3D8UA 1G6OA 5HA5A 1FYFA 1W4AA 2YWCA 2ZGVA 4H17A 3OIYA 1F4PA 4RVHA 2PBZA 5AW0A 3BD6A 3AVTA 1EVKA 5HF5A 4EUKA 2VQFB 4G26A 1G4HA 1GUDA 2V7QD 4UNPA 1EXMA 5DBIA 2D00A 2IE0A 2VDJA 1JQLB 5IXJA 5H1YA 4PPGA 2FQWA 3GJ8A 2DULA 1W4LA 2XXAA 2BELA 2BFDA 3U7QA 2NZJA 3PCRB 4DV7B 1HR0B 1F12A 4U7HA 1YHNA 2X0KA 2EKPA 2R2GA 4YJDA 2EX4A 4AMVA 1SUPA 1YF3A 4YCMA 2VNAA 4U2BA 1HMPA 2H48A 4FYHA 3TRDA 1A9OA 5GVRA 1K5DA 5FUMA 3W9YA 2G9VA 1H3EA 1EDZA 1ZOIA 3ZE1B 4Y30A 4ONEA 3MWDA 1T6NA 1D7OA 1U7HA 4HXYA 3ZQKA 4CMIB 3NIBA 1T6ZA 4Q7LA 3VQTA 2CDAA 4AY2A 3GLGE 5TQ2B 1Y8RA 4K9PA 2GJ9A 3M70A 3MTDA 5JLAA 1Q3KA 3NHPA 5GINE 1LDMA 1TKBA 3OKAA 2I4LA 1SD1A 3RANA 1QGAA 1P19A 1RT9A 5GOTA 3W3AA 2BGMA 1FFDA 1PEAA 3K35A 1GNQA 3L7IA 4BVEA 4O2BA 2WJ4A 3K71B 2CXPA 4C43A 3VH1A 4JYZA 5EIHA 2HWYA 3DW3X 5JD6A 3H65A 1N6LA 4PLYA 4Z0PA 1EFAA 3IP3A 1M8KA 3T3DA 3EGXB 1E2IA 1KVRA 3G2QA 3L8GA 4QXRA 3O4JA 5LKRA 4ZTUB 2QORA 1EESA 1E0JA 1ZRHA 4CYMA 1NTOA 8LDHA 3TRHA 1D1TA 4R0VA 4DWVA 2RGCA 3EEQA 2YDXA 3I73A 1BS9A 1WMBA 1BROA 2XCQA 4GG1A 1T4GA 4O29A 3AJRA 3PE3A 1F4VA 1CQJA 1TT5B 2ZAMA 1WPXA 2QL6A 1NY5A 2ES4A 1UXOA 1M1UA 1Y3FE 2NLOA 2PT5A 2ZBGA 1RZUA 3CNQS 3GJYA 4MGZR 1M73E 1ZJ6A 4YJ3A 7MDHA 3LUHA 3OOYA 3T5BA 3SJCA 3CRMA 1RPTA 3UYLA 3TXAA 3D54D 4DT1B 3ROTA 4IZOA 2Y1XA 1XZNA 3QNMA 2PRYA 3HGMA 3L9WA 3FGZA 3NRBA 4PFJA 4MS4B 4B6RA 3L7YA 4TS1A 2XUIA 4NULA 5EQDA 3B82A 2QN6A 4ER5A 1VL0A 1NC3A 2JDID 4NS1A 5CLGA 4PO9A 3SSAA 2IYQA 5MGNA 4XDGA 1AKQA 1RADA 3ELBA 2XUOA 4KUHA 1DXYA 5CXSA 3WLSA 4AULA 1SAYA 4DCSA 2EBWA 1E1DA 3BDVA 1LI5A 5FPSA 3HCFA 3MBOA 3OZEA 2OZKA 3GGDA 3SNKA 3JATB 3H11B 3OH8A 4EHKA 2ORVA 2P40A 4YT5A 3SJBA 4Y2JA 1O89A 1TUGA 3AHGA 3GMSA 2WWXA 4MVJA 4BNLA 1R0BA 1UBRS 2ALJA 5I7OA 1LDNA 2QGNA 5IM4F 2I87A 4XB1A 1O96B 4O4IA 3N0RA 1TCBA 2P9HA 1XMXA 3KFVA 1CF9A 1ZMRA 2BWJA 2WLSA 4EHAA 5C1DA 3AOGA 4V3CA 2BCEA 3R7BA 3PX7A 4OH7A 2B1QA 2XNCA 3KT6A 5BRAA 1XNGA 2QX8A 2XA2A 3B5EA 3BQMB 4FCCA 5DISB 3HCNA 3DMRA 1BU8A 1TQHA 3PNVA 4UFOA 3AF6A 3STYA 3H17A 2Y2VA 4JLMA 2X9QA 4Q4CA 1JFRA 2HK9A 4MI3A 3IESA 3C8DA 3PLNA 1S3FA 3UMFA 2ZETA 1UZNA 3GF4A 4GZ3A 1Y4UA 4Z51A 3MFQA 5MFZA 2H9IA 5BY2A 2PJRA 4B75A 4RANA 2JG3A 4MVWA 3LSYA 3PTLA 2FN7A 4AYTA 2BPOA 5D87A 1DLJA 4JLNA 1REQB 2VTEA 3GNQA 1HQYE 1BQEA 2ODQA 1ISJA 3CNOA 3LVFO 1RRGA 5FPHA 2EU8A 4CQNA 2GB4A 3H1GA 3EVBA 3GLFA 4ZQCB 1O6FA 1RHJA 2WIAA 5LJLA 4I3FA 1Q7CA 2WHRA 2FRDC 1UCFA 3UV3A 1JTVA 4R2HA 2J5QA 3SHFA 4PHGA 1OGIA 2DUUA 3BIWA 3GOQA 4J1TA 4XD7A 3VHRA 5I9IA 3ADKA 5AICA 1PZEA 5A7GA 1JHXA 4LMAA 5AHRA 1HDXA 1TMYA 3EXG1 1ZLXA 2PQ2A 2MSKA 1CY0A 1V11A 4HTFB 1NUAA 5D1NA 1FS6A 2CYCA 3I6YA 5ICCA 3BXPA 4M0PA 4ZI7B 5JWRA 2G8LA 1E2DA 3AYZB 3ME5A 4EP1A 3ZI0A 2IELA 1IOLA 4JLAA 4HS9A 3NHMA 3NAQA 1ODJA 1UJCA 3SX4A 4DRYA 1GTJ1 4LZJA 4KDCA 4MMXB 1C9DB 5DYNA 4XYEA 2ZR0A 3FDZA 4LN1A 3CX4A 4RV9A 5BOSB 5KQMA 1QMPA 3KTDA 2BR5A 3CLVA 2CDBA 4J2HA 4A1FA 1IEVA 2EFHB 3A0UA 2WU4A 3WJ2A 3OETA 3E9YA 1HE1C 1U5CA 1FMFA 3ZUPA 5HR5A 4FLFA 1JBQA 1S4MA 5KDDA 1T4CA 3K1JA 3K6JA 4RKFA 4HJXA 1YS1X 1C14A 2FKNA 2WSSA 3PFNA 3ZDRA 3N6XA 4DCVA 5INTA 1TEHA 1CLUA 3I2GA 4C5CA 4H6PA 2XCIA 3AVQA 2VA9A 3WA6A 2P67A 4N5NA 4AVYA 3D2BA 3MGAA 5E0KB 1FIUA 3D2CA 4YRRA 2F59A 5CA0B 1OI7A 3KWMA 4UPEA 4I9HA 1AU9A 4FYIA 4DVJA 1N9GA 2J3IA 3N8GA 1MB9A 4YA6A 1VQ1A 3B1JA 3IO5A 2Z3WA 4KI7A 1Z5ZA 1YVUA 1MV8A 3EXEA 3LC2O 3O4FA 5L3QB 3KPYA 4LPKA 4I6EA 4X8LA 4N48A 2HK8A 1T1JA 2J3JA 3BIFA 4V0MA 2VJQA 3UAGA 3F3KA 5BYAA 2Q2WA 3K30A 4A0FA 3ZWWA 3N87A 1G64A 1NVXQ 4FHCA 4CT4B 4L5AA 3SKXA 2ZWAA 3RYHA 3I9NA 4GI7A 2FPXA 3H6KA 2AEFA 2OP1A 1V8FA 2PKQO 2Y0EA 4JN6B 4KQCA 1MMFB 2QENA 1GZ5A 2RH8A 3H5WA 1Z08A 3IUNA 3NKFA 1X77A 2HHCA 4FQ5A 4NQRA 4S0ZA 1XTQA 1P80A 2EWVA 1RRFA 1ZIPA 1UWVA 1XZFA 1YOVA 1D8AA 1NL3A 4JCCA 3B6MA 5HPYB 1H22A 1RNLA 2D1YA 2EFDB 2RGDA 1E6WA 1Y1SA 2WFLA 2Z56A 4IH4A 5DF1A 1DBRA 3RS4A 1JIUA 2BUBA 2YVKA 3GMTA 3WQHA 5BUZA 1V1MB 1BX3A 4EEXA 3VAZA 1CJVC 3QVGB 4HDAA 5EE1A 3WDMA 4E4TA 3EEBA 3PI7A 4GC5A 3LGSA 3PFKA 5HOEA 4GZ6A 1A95A 3NVDA 3OOHA 3QUBA 3E03A 1PT9A 1IZ7A 5IEBA 1DEAA 3WWEA 2N0SA 4QT0A 2O1WA 2FFRA 4PQGA 1C3VA 3W5JA 1CIPA 4MCIA 4QQRA 5BORA 3ZIAA 1RXCA 4RACA 3CWQA 3ODPA 1V26A 1HE5A 2IIQA 3F97A 1ECLA 1UF9A 3T6KA 3SXJA 2NZVG 1PW7A 2Y99A 4KAAA 1V95A 1FDVA 2J7PA 2ZUUA 4GL4A 3TNLA 5LP6F 1U3DA 1ND6A 1FTSA 5AHOA 5IKMA 4GNKA 4XJVA 1K8YB 1C1HA 2PR7A 1TKAA 3NORA 3HUDA 3PS9A 1F3OA 2P6UA 1MFPA 3NHUA 1ZISA 3OECA 2YXDA 2ZSDA 4BMSA 3UA3A 3UGTA 4X44A 1HL7A 3FWPA 4OKNA 1JHZA 2B92A 3TFQA 3DZGA 1MPXA 1NBAA 4OJTA 3W5CA 1R4MA 2B1GA 2PGIA 4QIHA 3SC4A 1KZ7B 3KLNA 3RTBA 1Q2XA 3HJNA 2ZROA 4HDRA 2Q8NA 1T6XA 2OV8A 2YICA 3G79A 3K1TA 4WOCA 3KJXA 5FNZA 1R0SA 2FEOA 2MSWA 5E9QA 3HYRA 4KFUA 1N78A 1IIBA 2B8EA 3NT2A 4A91A 1E9BA 3JZMA 3UGKA 4WJLA 4LMRA 1XDZA 3EIOA 4H27A 5AR1A 3ETGA 3PUWA 4B45A 1N3YA 4UE6A 5D6NA 1KYQA 2VL7A 1N1EA 3FDJA 5FORA 3S40A 1YZFA 2O8BB 3WRXC 3DDWA 1VA4A 3D6TB 5DULA 1KZGB 2RAVA 3QF7A 2OBMA 2XSZD 3QXCA 3N2KB 4GC9A 4L4ZA 2I6FA 4R98A 5KWJA 4YR9A 1RKVA 3MWGA 3ENKA 4TWJA 4NCJA 3TMAA 4NY1A 3O3MB 1RBMA 3SHTA 4QE3A 4HVCA 4YRPA 1EGQA 1C4XA 1XE3A 2BFEA 3U0VA 4PX5A 4ZVLA 3V4ZA 2ZU0C 5EXTA 5I3CA 4L3VA 1QHEA 3TLKA 4C2TA 1F9AA 4NHOA 3E84A 1RYHA 1MO4A 3RS3A 1JQEA 1AD2A 5BMVA 1IB0A 2GSDA 4AY3A 2W42A 4GLJA 5BYKA 5AVQA 1XRLA 5JMPA 4Z9BA 2EG5A 3DQZA 1YJ5A 1L3IA 3REOA 4YYZA 2ODNA 4FTWA 4KITB 1E4EA 3R6TA 4A3SA 5LZ8A 2HADA 5TMBA 5F77A 1EP2B 4D1YA 3D4PA 3QVOA 4RA9B 1OF1A 5CJ2A 1PK9A 4DB2A 2XT6A 4F3NA 1QB7A 2OKCA 4FFWA 2CDRA 5C8XA 1MJGA 5ITWA 3S2YA 1JLLB 2QVCA 4D0RA 1LGYA 4D0GA 1KQ3A 4XYLA 1N5KA 1QFSA 1XKXA 5DTEA 1V96A 4FZJA 2ZSEA 3PPXA 3W6UA 2YL2A 1NN0A 2QLNA 1I3KA 1DTEA 2B34A 3R3JA 4Q4HB 3F7TA 3FVWA 5FR2A 1CY2A 2AX3A 2A7QA 4FVTA 1E1MA 3WHIA 4I19A 3CRNA 4P5PA 4WNYA 2FMXA 1LC0A 1QFJA 1JAZA 2XE7A 2C83A 1YUBA 2Y1DA 2AYYA 3FSRA 4KL8S 3RRXA 1UP6A 4N0QA 1P74A 4ASUA 4GDFA 4QUGA 1DRJA 2XADA 2CFCA 1YMUA 2VHWA 4HR7A 4IJKA 1IN7A 3VGPA 3A1TA 4PCVA 5JDCA 4I55F 4ZHQB 3G9QA 2ZREA 1FRZA 3ODGA 3VYUB 4E5SA 3NDIA 1T36B 1TF2A 1PZFA 1SBNE 2FAXA 2XTAA 3QFHA 4NEGA 4Z4IA 2H1CA 3M6VA 1JG4A 4EEZA 3QY9A 4JBLA 3AKCA 5CFMA 4BU1A 4AKGA 4OD0A 4R9VA 3W9BA 4UULA 5GIOE 1GRCA 1O97C 3GX1A 3C14C 4FU0A 3AJAA 1PG2A 1UKAA 4QWMA 1EM8A 4YMSA 2V0GA 1IMJA 5TMPA 3KB1A 1JXQA 2B7CA 5LA6A 3UY4A 4CLOA 4HN2A 4OGGA 1GAJA 1IVNA 2BISA 1KYIA 3C3CA 1T0JB 5LNK1 3JZIA 5B37A 3RBZA 3ELWA 3MWYW 4IDNA 4BTVA 3UJNA 5A0VA 3N2GB 4ND8B 3U81A 3X1YA 3S99A 3ZU4A 4BX0A 4EHFA 4X7MA 2DPLA 2FJPA 2XD4A 1TVCA 2JLRA 3INRA 2JFWA 1FYEA 5EP1A 2QZSA 3NBFA 4JZKA 2IU4A 4L75A 3DKVA 3SWWA 3HKEA 2OM2A 2QYSA 1M8FA 1H2YA 3U61B 2D0DA 4II3A 2V4ZA 1OC4A 1LS6A 4OUKX 2P11A 2XJ9A 3AKZA 5F3DA 2XECA 1K86A 1N2CE 2A67A 2EJWA 3SJUA 3BSWA 5EJEA 3EPRA 4RNCA 5CM2Z 4OP2A 2AZ4A 4JIMA 2GPJA 2ZFUA 4N8SA 1EWKA 2MCFA 5JUWA 1TUIA 2CDNA 4F1KA 1L7XA 5BQ5A 1MEJA 2ZW9A 4XI9A 3PVCA 4OMUA 3ZS9A 3DEJA 3HVIA 4B2LA 2RGGA 2FFAA 1TD1A 4FW9A 4BQEA 4D0LB 1KQOA 5DP2A 1RLTA 1F1BA 1R6DA 1WS6A 1DTSA 2JGDA 3A7EA 3NNSA 4M88A 2UZ1A 4FGLA 2NTYC 2C3YA 3ZDAA 2I34A 2WSIA 1PL8A 4QUBA 3ZCRA 4TLAA 1JU4A 5A06A 2EAUA 1P5RA 3UAWA 4E32A 1BG6A 4I9FA 1QV9A 1CQIA 4UTRA 4D43A 2B2XA 3SEFA 1QV7A 4RKEA 4FXOA 1MF7A 1MIHA 4JJAA 3KYDA 1B6RA 4IXNA 4YFVA 3W79A 4FNGA 1J2YA 4DLAA 3AUKA 3VC7A 2B98A 4FFSA 4JJ7A 4J94A 3IEUA 3L3BA 3L4BA 4WGGA 1VHLA 5HFNA 2Z5FA 2B25A 1SR8A 3NYIA 3UJDA 4BKOA 3H42B 4ZXPA 2XUPA 3R7LA 5ITZA 4FLEA 5BVGA 1M2EA 1T2VA 3PQ6A 4TRRA 3W06A 3QYPA 4EMTA 2VTKA 2HK7A 2A5LA 2HQRA 3GYBA 4O63O 4B0PA 4YGXB 2HB6A 2FLKA 3PVSA 1SEVA 2QN3A 1D4FA 2QBYA 2J6CA 4C7JA 3GEEA 1XU4A 1YBFA 2GM9A 3D7LA 3MJVA 2XGJA 1ZMTA 5K0JA 1B2RA 1IM2A 4JBYA 5IT0A 1WBDA 5CLQA 1M83A 1YK0A 1BCSA 1JDNA 3GJ4A 4MS3A 1GG8A 4G97A 4JLUA 4ENRA 4XVCA 2ZAYA 2FR1A 3IAS6 4QPCA 3IQHX 1G4UR 4JP8A 3R77A 3LX6A 5EL0A 4XIYA 5JG7A 1YFKA 4E15A 1NIJA 1DGQA 2O2XA 2GHQA 4FOSA 3SJAA 4M0DA 3VNUA 4GS5A 5HGJA 4NU8X 4A2QA 3IR7A 3OWHA 1UT6A 5LD2B 1MNQA 1GV0A 3PK0A 2XHEA 3EG9B 1DOHA 1ESNA 1VLVA 5CDHA 5T3YA 3MCAA 5FUWA 1U2DA 1Q1NA 1SUCA 1I7SB 3CTMA 3BKXA 1LQTA 1BE0A 3EG5A 4V0LA 4QZVA 2Z2KA 4ARIA 2VSNA 1EYZA 3H2GA 3I0NA 3IIKA 4RE6A 2QUJA 3WYGA 3IQEA 3RR2A 5WRFA 1KY5A 4B7UA 1CG6A 3EXHC 4YRIA 1LNQA 1Z0AA 2H17A 4HH1A 3RS9A 2AI1A 1U1CA 3OD1A 3N39C 5EJFA 1QF6A 1MJ5A 1SXJD 2E9SA 1RHUA 3BWYA 3WL8A 4R69A 1XDSA 2H31A 4IINA 4ENQA 1CS0A 1ZWLA 4CMEA 1H5NA 5DOVA 5HRUA 2W70A 1VJGA 4UEQA 5BXQC 1M0SA 4TROA 1UIMA 2GUGA 1MQ9A 5TPWB 3TW8A 2W93A 5FLEX 2JKYA 3H4MA 2F8MA 4NP6A 1S8FA 4PC2A 4DVGA 5HUQA 2YYAA 3FYUA 1FXWA 4GBED 5J4LA 1MEEA 3FPCA 1TXGA 4FD2A 2IYYA 3GLTA 1XFDA 2X77A 4W5RA 2HA3A 3LP6A 3D7KA 1JR3E 4A92A 1DAMA 2QRUA 3P96A 4F60A 2V7VA 1I5RA 1NN1A 3TE7A 2QLBA 3R0ZA 3SMVA 3UN1A 1OXSC 3R6DA 2OCXA 3FOFC 1PG0A 4DFDA 4YRKA 2HPAA 4UHKA 1F2UA 3MILA 4KRFA 2ZTMA 3K0FB 2FR0A 1LRKA 2XZOA 4XM0A 3ZDDA 2VF8A 1Q0RA 2ZBRA 4BFTA 1MC8A 2PJDA 4HADA 3H5OA 4BVAA 1H6BA 4AMZA 2BF4A 2IEZA 3R24A 4EHHA 3GGJA 5HIMA 5B2FA 1BW9B 3DOOA 1K9VF 3LF2A 5DYWA 4BMNA 4FC6A 2HEIA 4DJJA 3HTXA 2Z1NA 4HZGA 1IAQA 4F8EA 4ZKDA 3ZJVA 4B4KA 4DSUA 3KRTA 3WLTA 5B7GA 1JIQA 1RC8A 2OK8A 2XD9A 4MXDA 2N46A 2P9BA 3NLLA 2HXGA 2V7UA 3MWJA 3ESCA 4BEWA 4F5WA 2LCFA 2DBYA 1XSEA 1BMTA 3D8RA 4PG7A 5TV2A 1Y9DA 5JAHA 3VR6A 4EA6A 3AVVA 3SBOA 3TLEA 1J2EA 1XA0A 2G88A 1XHEA 3ZBTA 5CVTA 3RK0A 2P2NA 2H18A 3LCVB 1WVGA 1OT5A 3HHEA 1EHYA 2CLLB 5H0IA 4DWOA 3GDHA 1QFMA 1G0NA 1VPVA 2YVLA 3W6OA 4F5EA 3KZKA 5DM2A 1IVSA 2WM8A 3ZKWA 4DDMA 3HDTA 9LDBA 3GT3A 3WLAA 3BGSA 4NDAA 3L07A 4H4CA 4ZT3A 3IXMA 1I2CA 1PDOA 2QGZA 3TJRA 4X9XA 1G42A 4KGXA 3W8DA 5LQMA 5CTJA 1FUYB 2E2WA 2HCRA 1IEQA 3S1AA 5F9MA 3VJLA 4R9RA 3VOAA 2ZB8A 1G3IA 1EWQA 4ZQEA 1TRKA 3QVUA 5JD5A 3FUCA 3KYIB 4HNRA 4RORA 1R37A 1WHTA 1XJ0A 1I6KA 1E3IA 3K1ZA 1EUCA 1YH3A 2NPOA 2AGVA 4PS0A 1T2NA 2JFZA 3E0QA 4D3FA 1JIJA 2CNOA 3T34A 5CA1F 2ID8A 1HYHA 1CY7A 2FHPA 3BZUA 3HA2A 3OF2A 3ZHYA 3AR4A 5CVDA 4QJ4A 1A8PA 1FTWA 1K0UA 2N42A 1A1VA 2P8JA 1B8PA 1B6TA 3DVAB 2H4YA 2V7QA 5FUYA 3SZUA 4Z7QB 4JMLA 3EDQA 4Q00A 1IZZA 1P3Y1 3JAMA 1M33A 5F1PA 1SQ5A 2JJ2D 1GTG1 1BKSB 1YS9A 4G0MA 4DR2B 5C3MA 2OHFA 4I1PA 3TTTA 3F3MA 2OCIA 4A8JA 2Y1FA 4DADA 1ZLYA 3H8VA 1GOTA 2C3UA 2HFJA 4YI3A 4B6JA 4F46A 3NCTA 4FIZA 4F84A 3QYAA 4PAWA 5ALEA 2PUEA 1T3HA 4UOEA 2A6PA 4P7BA 2HQOA 3MAGA 5LP6B 3SG0A 2CEAA 1M2OA 4NH0A 3M9LA 1R0RE 1W5SA 3PEFA 4N82A 4OGFA 4WXRA 5CVJA 1D0SA 2H16A 2HXSA 2LWIA 2PT7A 2UVDA 2QE7D 3EUWA 3F98A 4BS9A 2BZGA 1FW6A 2AN3A 3DTVB 2QVBA 3M49A 3CLSC 1A27A 3GROA 1NVFA 4K5QA 4KQ1A 4LVNA 3M81A 4HLUC 1Q19A 1PUXA 3AF5A 4RYLA 1KAGA 3H75A 2P30A 3HPQA 5EIAA 4B8WA 2GH1A 4G9EA 4HYYA 3OLWA 5DCWA 4LOHA 4XDZA 1K6XA 4RK1A 5JPIA 3AFOA 5M7EA 1KRXA 1OLUB 1PW5A 5FOXA 2BV3A 2VK8A 4N4AA 5ES3A 1QAOA 1XCMA 1P4SA 2JFPA 4W5JA 1KEWA 5D3MB 3PC6A 3GRVA 1C9YA 1V48A 1QQTA 3ZI7A 3HPRA 4BECA 3TSWA 3IDQA 3F8TA 3P97A 5BQFA 1YS6A 2X0DA 3P2OA 1Y98A 3U40A 4ZOCA 1Z6TA 5TPZD 2QRNA 1MENA 1OI2A 1RD4A 2OCYC 5L51A 1E96A 1GCAA 2NYUA 1XT6A 2R8PA 1D09A 1GFZA 2OB2A 3CNBA 3FOWA 4MDYA 3ZE8A 4W9NC 1H2FA 5DWVA 1Z75A 1KR5A 2VP3A 1UK7A 3VVMA 5ALTA 4JS0A 3M4XA 4PSDA 1YRBA 2JDIA 3VZBA 1T25A 1QK3A 3IE2A 4XJSA 3QOXA 1WKVA 5A9RA 3MMSA 5EJ5A 1GVNB 2W2LD 2YOGA 3HV2A 2GVDC 3K0EA 1QE0A 1V1RA 2V0CA 4WA7A 5AJXA 5BNZA 2H9AA 5BVHA 4QEZA 4AQYB 4YO7A 2QX7A 3I9KA 4AIRA 5EZYA 2WJAA 5EJ7A 1Q11A 5JYBA 2JIZA 3LE8A 1WUHS 1T5BA 1BJRE 1F3LA 3BTSA 3CT6A 3K6KA 3OPYB 1KO1A 4LRTB 1FB5A 3MRTA 1IJFA 1ZIOA 2VRWA 1SKYB 3CW2A 3BXOA 4UTZA 5A4DA 4DARA 4TZ6A 1WUKS 3QJGA 3KQKA 3CBQA 1RFGE 3N86A 2IYXA 1G8MA 1TU0A 2FGKA 1NJ6A 3ILYA 1Y1LA 1TX4B 4FB5A 3LCCA 1OKKA 1YZNA 3OSZA 4UMVA 4CM4A 3TQRA 4F6RA 4BNHA 4X61A 3ORFA 4RPIA 3QLVA 4D4HA 3KQNA 2VYND 5B3AA 1UJNA 3AVYA 2WG2A 1CU1A 4H08A 5THKA 3WMXA 2XBMA 3EDRA 2YZGA 3A3NA 4Z2AA 2IITA 2LPMA 2QS9A 1JDSA 1WVIA 2C2BA 2AF4C 4NOMA 1IOWA 2FW1A 3SM9A 1ZK4A 3U4AA 3EDCA 1B00A 3C8HA 3HKCB 4NZNA 3MMXA 3ADBA 3MF4A 1KJ8A 1XAIA 1ZA2A 2DHQA 4RQAA 1HT0A 1K6JA 1S6YA 4P83A 3USZA 1YZQA 1EE9A 4XQ9A 4EKGA 2H4WA 3TD6A 5ER9A 2JFHA 2Y0CA 1J42A 2C4KA 3AU9A 4WZZA 4GDMA 5AKEA 3A9VA 4CODB 4HX9A 4MJLA 1I2AA 1PR2A 5DVZA 1GL7A 4REQB 4YUXA 3EVAA 1Y1KE 1D9XA 2FG5A 3EGEA 3HCEA 4QWWA 4YECA 3ZHBA 4JJEA 1RWQA 1KPIA 1UM9A 1YDHA 2CJWB 3EXIB 3RDPA 1FS4A 1JJFA 3AKDA 5AM3A 4HY3A 4CQLA 4ZU3A 5T3UA 4N3BA 3TAHA 3VO2A 1R18A 2Y0DA 5DCUA 4CI0B 4QBKA 1F0NA 5G0TA 2D7DA 3EC1A 2PVSA 4NIMA 5AVXA 1OWOA 2X0NA 4IIFA 2V54A 1OX6A 3NPMA 1E3QA 1OD6A 5JOQA 1YO6A 4QKQA 3I9MA 2CLSA 1QZ3A 3CISA 4BVKA 3O4GA 2P0YA 3U2QA 3UT0A 2RHMA 4WLFA 3TDKA 1NR1A 2BY4A 2FCAA 1I2DA 3AJEA 1HYGA 3GHHA 4V0KA 2ZTUA 3CZRA 2H92A 1M76A 2Z4RA 4J3NA 1QKKA 2QTVB 3FIUA 5KVQA 1JF8A 1F6DA 5C4MA 5IEJA 4NFHA 1N0UA 5ADHA 1RWOA 5F1KA 4C6HA 3C16C 1XUOA 5J4YA 4F71A 3Q10A 1BOFA 2FU5C 1KU6A 4URUR 3NMUF 2E3JA 4IWYA 3U5TA 1R8XA 5A5FA 4BP3A 3X1WA 4B73A 4S2UA 4AY5A 3CNNA 1TMKA 4C7MA 5JZSA 1YASA 4D5EA 3M4JA 2DQZA 2W2OA 1JXMA 3C41J 3LQ2A 5ESWA 1PUJA 3BMXA 3BWEA 3DV0A 4UHBA 4QT4A 4Y0NA 2FQYA 3LQ4A 1MB4A 1VSUA 2PCLA 4ENSA 1I6WA 1PZXA 1ADBA 5K8IA 1I80A 1F7VA 2FWJA 1MVLA 1Q83A 1Q22A 2YS6A 4O2BF 2QGFA 2XEDA 4YRAA 4CGYA 4MP8A 3B9PA 3FWKA 4PRLA 2NO6A 2RCNA 4R6XA 1XL0A 1WZUA 1K6EA 1UBUS 1M9NA 1E3LA 2GRUA 2JGEA 5EG5A 3SC2A 3U3MA 3UAYA 3ZE2B 1T5LA 4P4UA 1RAFA 4X71A 3CSSA 1T10A 2FWBA 2P9ZA 4GBGA 4LGMA 1QH8A 3M2TA 3H13A 1IE3A 2AC2A 1VTKA 1UDXA 1G2OA 1CUJA 1L1FA 2HHLA 2OEPA 1E58A 1K7YA 1YA4A 2F7SA 3HN6A 2C20A 3EIHA 5KVAA 5TLSA 3FG9A 3BIOA 2H7YA 1J07A 3INTA 3N58A 5IULC 3ICWA 2D1TA 2MYUA 1BN6A 1EDOA 2VT7A 3B8HA 3L7DA 1QNFA 1ZYUA 3OESA 2KW5A 4QUDA 4F9EA 2ZM6B 1ZO8A 1QB8A 1QCYA 2ZRLA 1E1QD 1P7CA 3CFYA 4PWYA 4Y2PA 3U4QA 2YWHA 1VMDA 3UMMA 1SK9A 5LCXA 4F7WA 1QAQA 3WNZA 3IP8A 5IAOA 2MINB 4EGSA 2V74B 5BXYA 3ILVA 1GLNA 1KMIY 4PC6A 4TSKA 1ESDA 3HVRA 1G2QA 4RSHA 3T61A 1ZG3A 4CM8B 3M0EA 3M2PA 3EZLA 4I5IA 5K3FB 3TSYA 3VYRB 1WTCA 2YHIA 1E1YA 3KYBA 3G82C 2YASA 2QDXA 3KSRA 2G80A 1WMDA 5B7QA 4K6FA 3HSSA 2RJNA 3TQOA 4F86A 2AKEA 1E5DA 5EMKA 3V1MA 1VKHA 4MVJF 4EG5A 2KLHA 2IHTA 4HDSB 2PUFA 2PRJA 4PZDA 1GPNA 3T3EA 3V3KA 3ZDYB 2MTBA 5GJVC 4O4IF 2XTNA 3N05A 2ACEA 5H81A 2DZDA 1Y8AA 1PZMA 3FKSA 3OIVA 1NDHA 5L6MB 4CEHA 1P45A 4MJ3A 1T1IA 2DPYA 2J31A 2VDRB 4YQEA 3NU1A 2E1RA 3KEMA 3MMZA 5DYTA 3IGFA 1P2TA 1CF2O 5AVJA 1ZVMA 1XYGA 1RBZA 1Z29A 3CX8A 4YHHB 3HM9A 1V37A 2J4FA 2P6MA 4FHDA 1M3SA 2FV8A 3U7RA 1JFFB 2GERA 3B6JA 5C18A 4BPBA 2WYHA 2ZUDA 2QMYA 5AM4A 2BTQB 2WFAA 4P3PA 2NPIA 3GB9A 1AURA 4MYHA 4FYJA 2IHVA 2NUTA 2DKFA 1VI6A 3SBEA 1KETA 3F4BA 3WZMA 1LW6E 3Q5EA 4GVLA 4LQLA 4UCFA 2Q5HA 3HO1A 1IWPB 4G36A 3GVIA 3PZRA 4EVRA 4ITUA 1SZPA 2FA9A 5HDBB 4IJQA 1U3CA 1ENOA 1GUFA 1KPHA 1K89A 2PBFA 2V5UA 5CHEA 3W4IA 4DJEC 5HUJA 5AW7A 4JDUA 3IPRA 1NATA 4E14A 3QP9A 4F72A 3U6BA 2A33A 1J9ZA 1I3NA 2C2YA 3FVTA 1OFHA 3L5KA 4TLEA 1TEXA 4XFJA 3BAFA 3T0GA 5ADWA 4RTOA 2XSZA 2CV2A 1ID8A 2VUHB 4KH0A 5I9MA 3HZZA 1HMYA 4Q7KA 2QKYA 2QSZA 2Z08A 2J9RA 3HVUA 5AXBA 2YOHA 3S2FA 3LDGA 1RE0A 1PNRA 2VPQA 3L0SA 1ZWKA 1E9AA 2VRCD 3WK6A 4DCTA 3ZDBA 2ZJZA 1LLDA 1Z88A 2VDNB 4S05A 4EAQA 4QC2A 1GTL1 1HYEA 1O6CA 4K03A 4BCCA 3F6RA 3AEQA 3N59A 1H5UA 3WOHA 5ALOA 4D9NA 2HPZA 2Q2VA 3JASB 3F9IA 4JEIA 2OPBA 1IOVA 3CH4B 1EVQA 1PSWA 4PPQA 3WGLA 3ZXIA 5EHQA 5IJXA 2BEWB 2XDQB 5LN1A 3WIDA 1FBTA 2OBBA 2FQ1A 2WMDA 2R66A 1JLKA 3B1FA 2VHTA 2HC9A 1UDWA 3CINA 3CWZA 4EYOA 4ESHA 1C80A 2R5WA 3C6YA 3DTNA 3R8XA 4PPYA 4L4RA 3VSAA 3ZY3A 3RGWS 4FE7A 4HDKB 4LXXA 4CKWA 3UB3A 3DBRA 6REQA 1LC3A 1ACJA 3N6RA 2HMUA 5DNDA 1N57A 4MR7A 4YJ2B 2Z2JA 2J08A 1H4TA 2QT0A 3JCZA 3KB8A 1OILA 2HGZA 5EHGA 1X7YB 3H83A 4WK4B 3NBMA 2PX3A 4FDMA 3AV3A 3EZXA 4ZODA 5ECWA 2FPWA 3RC3A 4YY3B 2AJ8A 3QLTA 4C4RA 1Y6GA 1ZDMA 2ZB7A 3WC4A 3MRVA 3BE5A 1NLYA 3G7UA 4XWGA 5C8VA 4DR5B 5KAMA 3LYUA 2OILA 3C3PA 1J1ZA 1I0LA 2PUWA 3GQBA 2HOQA 5DJ5A 4Y2XA 1TF5A 4TSFD 4DIEA 4ME6A 1PHPA 3A2LA 5HG0A 1I4EB 4LK3A 3IIIA 1VKRA 2QL7A 4X92A 4MQEA 4RLHA 3WS7A 2YJZA 3FMGA 1YZGA 4UZFA 5D84A 4CG3A 4ZCRA 2ZDHA 3H19A 3TEFA 3PNKA 2A30A 2AOTA 3IXLA 5B1IA 5CDFE 2NT4A 4G2TA 2J4DA 4AM8A 3DDUA 2X22A 3FNQA 1EP3B 1HQCA 2JAXA 2Q6IA 3PP8A 4AO8A 1L0BA 1AH2A 1LJUA 1V47A 2GT1A 1RBYA 1T8UA 1V4BA 1PNTA 3H3JA 3P9SA 1XHFA 3WX0A 2EP5A 5FLXA 1MDFA 3K92A 4XGNA 2IT1A 1PWEA 3ID6C 4JX9A 3SCZA 2D0PB 2X2PA 1DUIA 1JJBA 3EDOA 2DWQA 3AXSA 3ET4A 4TXMA 5JQGF 2A84A 1XZGA 1Q44A 3UMBA 4D3XA 1JEYA 5T6MA 1XZDA 4JUAA 2OHXA 4W7SA 2F9MA 2R96A 2WIJA 5JDCC 3AIOA 3QE4A 2BMWA 4HUQA 4NZ9A 1D2RA 2GEVA 3M1AA 5FWDA 4TMXA 3SC3A 1E6CA 2YZ7A 3M6LA 1R9GA 4QHTA 3HXLA 1I3OA 2YMPA 2JEZA 4MW6A 3PTAA 1N2IA 2BZSA 3PC3A 1A5BB 3BS4A 5TQ0A 3C3WA 4TMFA 4NAVA 3SEQA 3KWFA 4V24A 2P27A 2IUFA 3NAZA 1TL7C 4X6YA 5I5GA 1CQXA 4D3SA 3PRKE 3E8MA 4OXIA 1G18A 1QHHB 1YULA 3A2MA 2HQSA 2XE4A 3CO0S 2GKSA 2XKAA 3DJFA 3I01A 2BFBB 2H2HA 2HTEA 4ENUA 2AUTA 3WA7A 3DNMA 2BM1A 4RHEA 4MUHA 3V2IA 2W6JD 2X0FA 4AS3A 1I0IA 4LBZA 3SIWA 4MW4A 5JFTA 3GZTB 4C05A 2KSQA 3MUOA 2SHKA 1U1GA 2EZ4A 3MZ0A 5AJZA 3FSEA 4ZYYA 4HRYA 3BTUA 1EFVA 2BGJA 4RDCA 4MUFA 4C14A 1NGSA 2VDWA 2HSDA 4ZFNA 4X66B 1USKA 3FLAA 4N18A 3C45A 3KHUA 2ZRDA 4DXAA 4ZC8A 2NG1A 3DXXA 1UPAA 5B1DA 1TIBA 3LPAA 4MUYA 1GQSA 5PNTA 4F06A 5T57A 1RQ7A 4MW7A 1EHIA 3SD7A 1ZD4A 4Q05A 1ORDA 2PZLA 4C0BA 2HI0A 2WNIA 4Z53A 4E12A 4EI8A 1JEDA 3AFHA 2IX3A 2A35A 5C7IO 2BEKA 1BEZA 3MUEA 4AZ0B 1MRZA 1GVHA 2ZKLA 1BE1A 4F5YA 1QU3A 1I4WA 1PL7A 3FMIA 3OCUA 5I01A 4IMPA 2JLXA 4TTRA 1D6NA 1AG9A 3O8DA 4JBGA 4US2R 1G38A 5A05A 2R25B 1ATZA 3U80A 3ZHQA 1P77A 1UFRA 4NJMA 2INGX 4CMCA 3HKBB 3J7AC 1DKUA 3BGDA 4IEEA 4Y2YA 5DW3A 1XDBA 5BUQA 1WB4A 1P18A 3UZUA 3BMCB 3H5RA 3JQ8A 3KLBA 2Z2IA 1NYLA 2BMAA 4WLOA 2BEVB 3FF1A 1E3MA 3FFWA 3WY9A 3JVEA 2YJGA 4PNPA 2PRKA 1NJGA 1VG1A 4X1YB 1ML4A 3IQXA 1KDTA 3L4BC 1NXQA 5HMLA 2WM2A 2YV4A 2X76A 2E4XA 4G3XA 1N7HA 1Y0BA 2BFMA 4GLLA 2B8NA 2BUCA 2XHZA 1QQ7A 2BLNA 3KV3O 3L0PA 3RUFA 3RT7A 3VUFA 3NRJA 1URPA 2Q3BA 3C6BA 1IQUA 3DZBA 3EVEA 3GLKA 5JSKA 3WDKA 4AN1A 1ES9A 2Z8ZA 1DC8A 2EW8A 3FNRA 3QA3E 3FZNA 5K4AA 5A4KA 2BHNA 4D92A 1SCQA 2ZQ5A 3A4IA 2V03A 4J0IA 2YOFA 4M46A 3DMGA 3P9ZA 2QRKA 4C0JA 1GXSB 4AK9A 2KQUA 4LV6A 4NNPA 4X6UA 4KXVA 4DMHA 5JISA 1DS6A 3RCBA 2ZUVA 2YKGA 5CBKA 5KPDA 2HJ9A 3JWJA 2JIPA 2X5XA 3PPIA 3SLKA 2HAEA 4OQ4A 4YMTA 2VNJA 1T8YA 1Z33A 2WIBA 1P7YA 5C5CA 2GPSA 1UKYA 4NK4A 3LXXA 3AKYA 3UJ3X 1NE2A 4MKHA 1ATIA 4J0CA 4GKJB 1YR6A 3C1UA 4JVOA 4X8OA 5EY5B 3RYFB 3SBXA 3DPIA 3UK6A 2JZOA 4LKRA 3A1SA 4ND7A 1L4UA 3FYDA 5LA6F 2I80A 5BR1A 3W78A 1NVKA 3TUIC 5AVTA 1GZ3A 3WGHA 1A96A 4F3RA 1M7GA 3ON5A 1A7AA 1Q1BA 4I1SA 4KWHA 1J8DA 1B43A 1HYBA 2QTAA 4HUJA 1YJCA 1PYDA 1VECA 4DWWA 3MERA 1HE8B 4QO8A 5AKYA 1OWNA 3UVEA 4DEXA 4HZUA 4JYAB 4WLEA 3M6XA 3NBQA 2P8SA 3NYQA 1JR3D 5EERA 4COKA 1OYVA 5BSKA 4D8XA 4HAYA 4JXJA 4C21A 3K72B 1E3WA 2XXAB 3AL3A 5A7HA 1P2VA 1LFDB 1XK7A 2RBGA 3A3OA 3OEEA 4K28A 2C00A 4XGQA 5FV7A 3AY3A 4CMEC 5JBNA 4G09A 4UBOA 2JAHA 4AUMA 1GGHA 4ND2A 1QIDA 5KQLA 1FDOA 4HNQA 1VMKA 5COBA 5CYFA 4H16A 2O8DA 3V00A 1N5DA 1Z7EA 2LRHA 4GYWA 4HMOA 4P4SA 5FTKA 1TM5E 3RJMA 1ZSYA 3ZWVA 2VZEA 3CZCA 3MWDB 2DYKA 4OXQA 3D6JA 4PX3A 1XNRB 1ILEA 4OIFA 5A1JA 4Z4EA 3SQWA 5EJ4A 5LNK6 1T4MA 1Y8RB 2CL5A 2F17A 2VH1A 5BT9A 1SELA 5KYVA 2X40A 4JUCA 4M0LA 4OLFA 4DMMA 3IVCA 5KTPA 1W1IA 1M5UA 4QX6A 3UYKA 1YGYA 3ZU3A 3ISJA 5BO5A 4AUNA 3PXDA 1MRNA 1PX0A 3G2MA 4O2BB 3SDSA 1H8ED 5KOIA 2LCQA 5DCLA 3QW2A 4M1EA 1G9XA 3L1IA 3P2MA 3AM1A 1ZX1A 1RXYA 3DMDA 1WIWA 5FTJA 1AZSC 1GQQA 2H1WA 4YCDA 4OGWA 3BL6A 3GRRA 4ZVPA 1VBMA 4WLVA 4EUFA 4CV3A 4IDGA 4Y6LA 2BMFA 4UC0A 2I7VA 2VLIA 1CQJB 1LD3A 1UXKA 3B2QA 4FEEA 5DOZA 1H3NA 4P2BA 4XQ0A 4XIIA 5KYYB 2V6MA 4YJ3B 2BDUA 1P1RA 4UEOA 5BSRA 4PYJA 4K9RA 2DFPA 1ND5A 1T9BA 1X6VA 2I0FA 2ZUWA 3JZAA 3GCXA 4GO1A 3UW1A 5LQSA 4L3OA 1PHRA 2AD1A 4H15A 4UNRA 2HBRA 4YP5A 3O03A 5EPEA 1ADYA 1BHSA 2FMFA 3AERA 4QJ5A 1OIWA 2G63A 4RXMA 1EE1A 1NYQA 3B3AA 3F2IA 3HUUA 4MVCA 1MFZA 4U7PB 3WMEA 1U8FO 4H77A 2VPWA 4EYEA 3PQDA 3FLMA 5LUBA 1KO5A 4B79A 1VFPA 1YQTA 2JJ2A 1C1DA 2Q28A 3T1YB 1Z4NA 3JPWA 4I50A 4QU5A 4UXHA 3IP7A 3K53A 1AO0A 2J5XA 1EGHA 1ZH6A 1VCIA 2PXXA 1C4KA 3O6VA 2H08A 4YBZA 5IN4A 4FWTA 3IT3A 1CUEA 1GG9A 4O4IB 1L7AA 4WBNB 2BR4A 4UD6A 3W7BA 1JIKA 4U7FA 2QG6A 3U7IA 4ABYA 1C9EA 1B0PA 2XA1A 5FOTA 3TGWA 1BJTA 4PZAA 4C01A 1AHPA 3MJRA 1AO3A 1KO7A 5F2OA 2GZ3A 3F3YA 3KDSE 3UATA 4KE7A 4BGIA 4D82A 4G0WA 1QC5A 1T9ZA 1HFKA 3MGBA 4PHHA 4JSYA 4XIGS 5FT9A 4OHZA 4OJMX 3CVOA 1T24A 3GOHA 4GECA 3VFDA 2Q41A 2EGUA 2I8AA 2ZYHA 1XVTA 3LCRA 4YJKA 5H16A 3S8YA 3AUFA 4AX8A 5JI3E 3KJQA 3W7VA 5CG2A 1J90A 2ZI5A 2P2YA 4YQZA 3HS3A 1ENZA 5TEVA 3PJRA 2IXEA 3PQFA 2AEJA 4TN5A 5IBQA 4YT2A 3PGA1 2PL5A 3Q2OA 4AW9A 4D9MA 1WBBA 1P0CA 5T4BA 4W5QA 4EFNA 1DIRA 4IVQA 2HJRA 3GFSA 4UXIA 3BFKA 1YJBA 3E5HA 4RD4A 3GLFB 4EECA 2BEJA 1FXWF 3DBHA 5TB5A 3JY6A 1V2HE 1FRFS 3RVDA 4ARCA 4Z4GA 3MC1A 3CBGA 4UBIA 5FOSA 4W1RA 3AI7A 3GEPA 1JJIA 2Q5JA 3WSWA 1N2SA 1D2GA 2B4KA 3KTFA 4J1SA 3UK1A 4KFCA 1GM5A 4EHIA 2W00A 5HF6A 2ZYDA 4B3HA 1V11B 2QT1A 4II7A 2YTZA 2R7NA 1EQUA 1I10A 4KR0A 2ZATA 2HTFA 3RFCA 5JO0A 1X7ZA 5TF0A 3T8YA 2H4XA 4PTZA 2JZNA 2EDCA 1GIAA 4EY6A 2W2LA 5DASA 1C4OA 2QTGA 2VN8A 1CR6A 3R1IA 4UZSA 4PNEA 3PD7A 1B8VA 4LVOA 3K9GA 4CGZA 2ZSAA 3FDZB 3DAYA 4UUQA 1WW8A 4YRGA 4G4IA 1Y5LA 2DPMA 4EL5A 2O4CA 1DO2A 4OBEA 1XKLA 1D6MA 2QLFA 3A27A 4MARA 4KRYA 1IU9A 2NZXA 5TMDA 4OLJA 5FKJA 3V2GA 1AV7A 3A70A 1SGWA 2DUMA 1OV6A 3WZLA 1W0JA 4H3VA 4JKYA 4DCNA 4JGBA 2JAPA 3A2KA 3CH5A 1KE1A 3MPUA 3K96A 3RLFA 4M54A 3MPOA 4CR7A 5TGZA 1KH2A 3AYXB 3M6AA 2ZK7A 2HHAA 1W30A 2QTHA 2VYNA 4MQFB 3REFA 4D56A 4FW8A 2AOUA 3RKSA 3PGMA 4BB0A 3FPBA 2FZKA 2XVXA 1N9GB 4P7KA 1DX6A 4AO6A 3QBDA 5FB3A 3A6LA 4FBLA 1U7ZA 1TJ4A 5A2QA 1Y6RA 4EI2A 5CXUA 2VEOA 2X9LA 3EXEB 1WNTA 3FTNA 1JRLA 3GYGA 4IGAA 4WKOA 3KXIA 3VO8A 2NU8A 4QXPA 3S5JA 4IXTA 2CC2A 1N75A 1DINA 4FHEA 3PL1A 1UKCA 1Z5WA 1Z4OA 1T5TA 3QKSA 1NNEA 3ZVMA 4F8YA 3GHYA 3A05A 4LF4B 1DOZA 2J9FB 1XRQA 2SKCA 3RYHB 3UUEA 1Z7WA 2C03A 3I12A 4LZAA 1JGTA 4MV0A 4MQBA 4P84A 4RE5A 4U8HA 5IUKC 3U39A 4CXMA 2HHHB 1C1YA 5CGQB 2WQZA 4RHFA 2LUOA 3GV0A 4R31A 4E70A 3AHHA 3ZJTA 4FIDA 5JNWA 3N53A 2F64A 1YVEI 4RL4A 1QO7A 2FWMX 4Y1RB 3UQZA 1YOVB 1ZK3A 4NAHA 5JVDA 1DX9A 1R6AA 4PQRA 2WFLB 1FVHA 4REMA 4XVQA 3MQ4A 4H6XA 2CVFA 3TIGA 2ODWA 2ZQZA 2X8BA 3RF6A 3VKHA 2VHUA 3DS8A 1P6XA 3U16A 4LJ7A 1HNZB 4QTXA