2FPTA

Dual binding mode of a novel series of dhodh inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
367
structure length
364
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual binding mode of a novel series of DHODH inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
total genus 137
structure length 364
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2fptA00
2ZRVA 1XM3A 2HMCA 5F2MA 3DBPA 1LRQA 3R5EA 1TPB1 5IBXA 3NA8A 3NQCA 3OBKA 2O7QA 4GUGA 3S1WA 3MUXA 2E09A 1SQ7A 4G1KA 3TNOA 4WD0A 1RR2A 2FJKA 2QCCA 1QPQA 3IIZA 2ATSA 1JCLA 2NX9A 3QF0A 1OFRA 2A6LA 4W9TA 2Q3RA 4UTKA 4FB7A 1OYAA 4RX0A 4HKPA 4K37A 1H7RA 5HINA 4MZ1A 1FWTA 3T7VA 4JTTA 1GJPA 2VKZG 4AMAA 4GUJA 1JRCA 5KZEA 5L9FA 5EMUA 2ZZ2A 3HB9A 3SFKA 3TX9A 4RV8A 2QCMA 4FHAA 1TQJA 1UCWA 2NWRA 4UMBA 5FEZA 3F4WA 1GT8A 2RFGA 4CCDA 4LC8A 5BW6A 4KFOA 4DO6A 3HGJA 3GZ3A 4B5NA 1I2RA 5LGXA 4DELA 3E96A 1LOSA 1Z44A 2NUXA 4OHQA 3W2NA 1BEUA 1EIXA 4TMCA 3C2VA 3P62A 1GZGA 4UNLA 2FPYA 4PL1A 5EA9A 4LOCA 2NLIA 5G5IA 1OG0A 1W5MA 4O52A 2RDTA 3NG3A 2ZA2A 4Q32A 2Y6ZA 1ZENA 1H61A 4EIVA 3C52A 4IUOA 1W3IA 3M5XA 1TSIA 1WYIA 2Q3OA 5A5WA 1DQWA 3PB2A 4RZ5A 1GTHA 3HPXA 1UUMA 1AW2A 3NR0A 4J9JA 4BI6A 3TE9A 1Q6OA 4NNAA 4AVFA 4DF1A 1LYXA 3MYPA 2WSYA 3KRZA 4JTIA 3OVRA 4MKNA 3TQVA 2R94A 5CZJA 1ZHAA 1TQXA 1B3OA 3TUUA 4YL2A 5AN7A 5KMYA 5HR6A 4PH6A 1I2NA 3KRUA 1F6PA 3W87A 3IGSA 3O06A 1I4NA 1LLZA 4NJJA 3UPWA 4OGZA 1H7PA 3FFSA 4C1KA 3N9RA 5HR7A 1UUOA 4JY8A 4KKXA 3LI1A 3Q94A 2QKFA 3HIJA 3EX4A 4UMAA 4GUIA 5BMWA 3KVLA 5AHIA 3UY8A 1ZAIA 5MHBA 3KFTA 4L4MA 3ABRA 3O63A 2H90A 4K39A 4CNOA 3UZJA 2EKCA 4KWVA 5G2IA 5ABTA 2GQ8A 4PFMA 2C13A 2GVGA 3MHFA 3OG3A 3BLIA 3NZ1A 4FXRA 1FWWA 5KITA 1IIHA 4LVBA 1T8XA 4MFEA 3PG9A 2ISWA 3KVMA 3I7RA 1GVSA 1RZMA 3DFOA 1KTNA 1NFBA 3GIYA 1JRBA 1EEPA 4HNTA 1TV8A 4NNCA 1XBVA 2V5LA 3PSWA 2P1FA 3BW2A 2IQTA 3LBCA 4Z1CA 3NM3A 3P60A 1X7FA 3BW3A 1F5ZA 1TPUA 5K9XA 1C8VA 1KW1A 4JTUA 4WJEA 1R2SA 1F76A 1DBTA 4WY0B 3C4UA 3TIMA 2V81A 3W83A 3G1FA 1H63A 2F84A 4LW7A 4MY8A 4K36A 4XKYA 4UXDA 3QW3A 4UCGA 4OWGA 4IX2A 4O0ZA 3EWUA 2Q8LA 4AF0B 3GVGA 2ALDA 4EF8A 2GQ9A 5J5RA 2ISSA 4LWWA 3G1SA 4JYDA 1YDVA 4X3ZA 5KTLA 1TTQA 2A7NA 3MMTA 2VFDA 1KLYA 2TRSA 5HNRA 2GQAA 1ML1A 2YPIA 5FEXA 2A0NA 4NNBA 1X1OA 4O1BA 3GNNA 4OU1A 1P4CA 1SW7A 3NQAA 1VLWA 3CEUA 3LTSA 3NAVA 4MY9A 3R8RA 1TPVA 1WA3A 4TX9A 1L6YA 4BWLC 2DJLA 3S0CA 4ML9A 3N19B 3LLDA 1NVMA 2YFNA 1XBXA 1M6JA 2XFWA 3A5FA 1I2PA 2FQIA 3Q58A 2CZFA 1YDNA 1T0OA 4BK9A 3EEGA 4QAIA 3DFNA 2Y7DA 3O6DA 4N4PA 3WJWA 5FEPA 5HUPA 5CZSA 1FWNA 5HQEA 5G4EA 1FY6A 1QMLA 1TPEA 3SY5A 1OFEA 1R2RA 3EX3A 3RF9A 4MY1A 1GOXA 2VEPA 4RJEA 4IWWA 4MIMA 3U6WA 2NUYA 2VEMA 2R14A 1FUYA 1LBLA 5U7SA 3LTPA 5LZLA 3CQ0A 1K7XA 3C2RA 4WY0A 3BLFA 1SUXA 3MI6A 2LLEA 3L5AA 4A29A 2V82A 2WV8A 4XKYB 3PUEA 3W72A 1LROA 3NL6A 3DGRA 4U4MA 3T55A 3W1PA 3R13A 4E2DA 4Y6GA 3O05A 3R12A 5AYYA 1I8JA 3LCFA 3DFPA 3UWZA 3PUOA 1HG3A 2VXNA 3GR7A 1JCXA 4R7JA 3G8RA 4XBKA 1FXQA 4FIRA 5AOUA 1IF2A 4MLJA 4AH7A 4LUJA 1GVRA 2JGYA 3P67A 3L0GA 3UXDA 1TPWA 3B0VC 4UMCA 2FB2A 2GVJA 4FNQA 2V2HA 3B04A 3QYQA 2OMAA 3ABSA 4RZ4A 4CNPA 3W76A 1OX6A 3USBA 1DV7A 1LOLA 4N9CA 1W5OA 4N6FA 4R53A 4O53A 1ME7A 3QM3A 3NVTA 5CZTA 2A4AA 3FYPA 4H3DA 3B06A 3W7RA 2FPVA 4UTMA 2C16A 3FOKA 1AG1O 3TSMA 2ZTKA 4NU7A 1KBJA 3LI0A 3FYOA 2BTMA 1TPC1 1ADOA 5AC7A 3W22A 1FDJA 4JEQA 1C9DA 1BTMA 1ZY9A 3DAQA 1JJKA 4JTGA 2CLMA 4UNKA 3THAA 1FX6A 3LCGA 4QNEA 3UWUA 2CLKA 1VYPX 2Y7EA 5D33A 5H91A 1GYNA 2X1SA 3LCWA 3TQKA 4GXMA 5DBUA 1H62A 5HWNA 2J9XA 3EX1A 3DKJA 3Q2DA 1JVNA 3ABQA 3OHIA 1EP2A 4JIQA 1GQNA 2E6AA 2JKPA 3GDMA 4Z08A 2DZPA 4AWTA 2PE4A 3PB0A 2CLOA 5F2LA 2OT0A 3HG4A 1K3UA 3WJZA 1Q6LA 1DHPA 4UTHA 3LCXA 3TA6A 3GK0A 1JUBA 4PODA 3G3MA 4JTFA 2PRLA 2X30A 3LRMA 4LY8A 2ZDRA 3CHVA 4WX2A 3B0UX 4FEZA 3W74A 2BZNA 4GRSA 1N7KA 2YSWA 3HPZA 4IPIA 4WQ6A 5CPOA 5DN1A 4JICA 3W7PA 4Q4KA 2YZRA 4HT3A 3G0XA 1TMHA 5LNRA 3VE7A 3TCEA 4OQVA 1JQXA 3IV3A 2ZQ0A 1XXXA 3W1XA 5CSRA 4DO5A 4HN4A 3L68A 3OA3A 1A53A 3EX2A 3B0PA 3NXFA 4AXKA 3G0UA 1K8YA 2C14A 3IIXA 3R89A 4JGDA 5IM51 3LOTA 1KM4A 4XTDA 4WZHA 4E38A 3TR2A 3L67A 4NZFA 4P61A 1JUKA 5DBTA 3MW7A 2I1OA 5G2HA 1QWGA 2ZZ3A 3BV4A 4LV9A 1LOQA 3GR8A 3CT7A 3G1XA 3W1RA 4XTIA 4NT0A 3W86A 3E49A 5LNUA 3TW6A 3DFSA 4IJBA 2Y85A 3O07A 5AHEA 3A21A 3W2KA 4DEFA 1LORA 3G1VA 3N34A 4O12A 4Y9AA 2E5CA 3RNDA 5LNWA 1ZAJA 1GEQA 4HPJA 5HULA 1QOQA 4UFMA 4AWSA 3HQ1A 4O8RA 4K38A 4PTNA 4UTWC 4GUHA 2ZZ1A 2YDAA 4LTSA 1TCDA 1SZNA 2Z1BA 1XBZA 3GAYA 3MI3A 4MZYA 4K7YA 3S6DA 5C54A 3WK0A 3O15A 4HSNA 3G22A 1JUEA 1QO2A 2NX1A 4JYFA 1OF6A 1M7OA 4O18A 3S1UA 1DKWA 1OX4B 2ZRWA 1AL8A 1S5TA 3SR7A 1P0KA 1VR6A 3EKLA 3W2JA 2I14A 3TJLA 3CIXA 2QCEA 4PCFA 2V2CA 2WKJA 3M43A 1SZFA 3G8EA 4AEOA 1WOAA 3TH6A 3NL3A 4LT9A 3M6YA 2QEZA 2E6YA 5K2ZA 1WX0A 4MOZA 1Q45A 5F4SA 3F4NA 1FXPA 4ZQOA 2FIQA 3RLUA 5LNSA 6ALDA 1H1YA 4DBDA 4U28A 1W54A 1CX9A 1WV2A 2H6RA 3NQDA 3KX6A 4R34A 2AGKA 2DORA 3FLUA 1PS9A 3I7QA 4LVAA 1YYAA 4FNRA 5EYWA 4RXGA 5L6UA 4NQ1A 3P80A 5A8GA 1HO1A 1KFEA 1WAUA 3BW4A 4K7VA 4ONVA 1Z41A 3DXIA 3H53A 3MP3A 4GE8A 3UXAA 5DCBA 3V1PA 1TYGA 3L21A 1QO5A 1XCFA 2R8WA 5AHMA 2YW4A 3HF3A 4DQWA 1K7EA 3AJXA 3IEBA 3C2FA 3BG3A 3P8IA 1EP3A 4LV4A 3N2MA 1VCVA 1TPFA 1BKSA 5F1VA 3L0NA 1RV8A 2GVLA 2Y88A 1AW1A 3LHVA 2YGYA 2DZWA 3P7YA 5D32A 1QR7A 3FS2A 1B9BA 3H55A 5C2XA 3F03K 1YPIA 3BK0A 4NX5A 3BLEA 4FNPA 1SO5A 3KVJA 1TO3A 2PRMA 4GFSA 1SU5A 3NM1A 2E6DA 1JCYA 3C56A 3M44A 1LCOA 3NDOA 2A5HA 1VRDA 4UR8A 3TMLA 4POCA 1OABA 1X8FA 3N2XA 5D09A 1FWSA 2EAWA 1YTDA 2ZZ7A 1W5QA 3LCLA 1TB3A 1VLIA 1Z48A 2TMDA 1BWKA 1H7NA 4JDYA 4Q33A 1ZALA 3W7EA 1GG0A 4WUIA 3UWWA 4IXXA 4LS0A 3NQFA 3ATYA 1GWJA 4MJMA 2DZVA 3NL2A 1H7OA 4UTTC 4JD4A 4O13A 3UNDA 5TQLA 1U83A 1GYLA 1VYSX 4LVFA 1J4EA 1QPRA 4GJ1A 1R46A 1FCUA 1OF8A 1DL3A 1SW3A 5I3JA 5K4XA 1Q6QA 1O94A 4UTJA 2Z2UA 5KZDA 3GKAA 5EL1A 4ORMA 3WFAA 2NV1A 3QMRA 4ZMGA 2BX7A 2XN2A 2H3BA 3DH7A 1W5NA 2QJGA 3NO5A 4MZ8A 2A21A 3A9IA 3L2IA 3RU6A 4NVTA 3SW6A 4DO4A 3WK2A 2J9ZA 1XKYA 1OFAA 2C0AA 4AB4A 3TAOA 1I45A 3P61A 3EKZA 4FIQA 3UWVA 1OJXA 5D38A 2TYSA 4DBEA 1ONRA 2QCDA 4MYAA 2E77A 2NZLA 2EHHA 4D2JA 2EF9A 4DF2A 2WSQA 1QCWA 2PC4A 3DI0A 1JCMP 3RK8A 3OIXA 1D9EA 1SW0A 3STCA 4YWIA 2NXHA 3MHUA 4C1LA 3FJLA 3LDVA 3VE9A 4LU0A 1PE1A 1A5CA 1DORA 2CLFA 4XWUA 2W0UA 1YPFA 5DCEA 3I6RA 1IXQA 5AHNA 3NQ6A 1C29A 2FFCA 3W1NA 5BRBA 1KV8A 5F4XA 3L9CA 1N55A 1A5SA 4O14A 3TQ0A 5CPNA 3N14A 5HUOA 2GUUA 4X22A 3EB2A 2RKXA 4CQ9A 3TU9A 3QH2A 3QFEA 1PCWA 4ICNA 2J9YA 5F2GA 2V30A 3LCHA 2OT1A 4JS3A 4O19A 1OX4A 1IXNA 3FJ6A 1E51A 5T26A 1OVDA 1VHCA 5D30A 4ZQNA 1IGSA 4UTIA 3JRKA 2A7PA 1VH7A 5LKYA 2E5DA 3BO9A 4ALDA 1TIMA 2H8ZA 5TIMA 3IIVA 4O15A 3S1XA 3VKJA 3PULA 4XZ9A 3C61A 1EX5A 1VS1A 1TV5A 5G1YA 5AC8A 1FCVA 2RHGA 3PR2A 4M19A 1KTCA 4JTEA 4WXYA 5HWMA 1O60A 1HTIA 4FX7A 1G4EA 4M6PA 1NSJA 3P84A 1D3GA 2VFEA 2E1DA 4CCCA 3W88A 2DZXA 3LM7A 1SSGA 2JK2A 4AF0A 1G7UA 3QMTA 4AHPA 4HNUA 3PSVA 3GAKA 2CLHA 3KHJA 4P2VA 5D2VA 1RQHA 1KM0A 3B4UA 3LV6A 1LBFA 2JKAA 3INPA 2OJPA 4YCOA 1EA0A 4Z0SA 3YPIA 3IGUA 3C0JA 1XC4A 3HG5A 4JIPA 3EWWA 3LCIA 4ZQMA 2B7OA 3LHWA 3UD6A 3E02A 5K4ZA 3GXPA 3T78A 1G7VA 3LHUA 3PC0A 3A23A 1R47A 5EBUA 5TBOA 5H2ZA 4E2BA 5FEWA 4UR7A 1RQEA 2ZRXA 3B03A 3I68A 4JTHA 1GTEA 2WJZA 3M5YA 1TRDA 2Z6JA 3VNDA 1YXCA 4NXSA 2CFFA 2A7RA 2QCHA 3EWXA 3G1AA 2GJNA 4NJKA 3MI2A 1W56A 2A85A 4O0KA 4IXHA 2OCZA 3UY7A 1GG1A 2YX0A 4BI5A 4UFKA 4YXGA 3PUDA 3LB0A 3S5NA 1YXDA 1KV5A 1BWLA 1ZCOA 1G6CA 2QCGA 1DJNA 3W23A 3PY2A 2BXVA 3KRSA 2WQPA 5I3FA 4LS1A 2DZSA 3SJ3A 3S9YA 2DP3A 1LM1A 4JYEA 3CPRA 4ZQRA 3OVPA 1S3HA 3THQA 4WOQA 4EWND 3FA5A 1TV7A 3O6CA 3T4CA 1O5KA 4K6AA 3G3DA 3EXTA 2ZRUA 1OFBA 4MUZA 1O5XA 4Y90A 4GBUA 3TC7A 4HIBA 4DPQA 2F7FA 4NUWA 4EVZA 4LVGA 3ANYA 1HO4A 5FESA 3PBWA 4E0CA 4BI7A 1K7FA 3P82A 3W2LA 1ICPA 2FB3A 2V8ZA 5D02A 5F1UA 5KSWA 4O50A 3SECA 3A24A 1H7WA 1HUVA 1WDWA 1UASA 1YTKA 4QJ1A 4R33A 1SO3A 2V5BA 3DFTA 3GDTA 5D03A 4ZL1A 1KTBA 1B57A 4QNWA 2QJIA 4X9SA 4IMCA 3TW7A 3ZFHA 3SI9A 2VFIA 1THFD 1QPOA 2QCLA 2PCQA 3QMSA 1SSDA 1JCNA 1VGAA 2QDHA 4ADSA 1TREA 4TIMA 1PHWA 3NQVA 3CWNA 1FWRA 1V7YA 2C3ZA 5EPDA 4DF0A 4QSHA 3OEXA 3Q37A 3NPVA 5AC6A 2VFHA 2EGZA 3MP4A 4I7UA 2Z6IA 1T99A 5FF7A 5U4NA 3W1AA 1KM3A 2I9EA 4JR5A 3HGOA 3TROA 1SZEA 3BGJA 2QUVA 1MEIA 2B7PA 4M7TA 3W6YA 1AL7A 1P0NA 3QPZA 3GDRA 3VCRA 4FNTA 3LXAA 4M6QA 1W5PA 3TFXA 5I3IA 2A2IA 3NZRA 4NJGA 5D2XA 2Y7GA 4ADTA 4O4WA 4WY0F 2O7SA 8TIMA 5FF0A 4NJIA 1H1ZA 1L2UA 3GXNA 3K30A 4XUGA 1H50A 1YXYA 2QF7A 2WSRA 1NF0A 1PV8A 2BSLA 3LV5A 3W7QA 3G1HA 5HMSA 3NQMA 3MHGA 1LDCA 4O10A 1GVQA 2NUWA 3LHTA 3DU0A 5GVJA 3W2MA 3M9YA 1LBMA 1G69A 1EPXA 4XBSA 1SO4A 1NAL1 3HPSA 3W71A 4TMBA 2G97A 2P10A 1ZNNA 2VFFA 4Y96A 3W7MA 2B7QA 2AQWA 3TV8A 1MEWA 2FDSA 2VEKA 4O1AA 5LSMA 4M6VA 1B4KA 3NQ2A 4UFLA 1XUUA 4ZQCA 2FPTA 4IMEA 4IMDA 4ADUA 2CWNA 2QDGA 5K9DA 5AHLA 2XN1A 2JGQA 3GX9A 3HJZA 5I3GA 3BG5A 1NEYA 2C18A 4CCEA 2ZYFA 3DKLA 2RDWA 2ZTJA 2Z0IA 1K8ZA 4H4IA 3P5YA 4YMZA 3STEA 2VFGA 4O57A 4WOZA 3G24A 2VEIA 3E0IA 6TIMA 2NWSA 4HNVA 4AAJA 4A2RA 3UYCA 1LRNA 4FO4A 3M1ZA 1VC4A 2YCEA 4YCPA 2H3DA 5I3KA 3OVQA 2WNNA 4RZ6A 2NV2A 3U2OA 4BWLA 3S5OA 1W8SA 3TFCA 2J6XA 1RPXA 1OK4A 2WNZA 4CQ8A 3W75A 1CW2A 3LERA 3W7IA 3BARA 3TK7A 2R91A 5K3VA 1IXOA 1WQ5A 1ME9A 1S5VA 3L0KA 3N73A 4JX6A 1TJRA 2ABAA 2QJHA 3D0CA 1O4UA 4OV4A 2VELA 2X1TA 4H6KA 2ATMA 4JTJA 1G4TA 3EWYA 4Z1BA 2G5WA 3I7SA 3QQ1A 2E6FA 3LLFA 3L5LA 3SZ8A 2BWGA 5C5YA 3S1VA 3VI2A 3TJXA 3QJAA 4Z1DA 3QSRA 3W1TA 2HS6A 3UPBA 2ZZ4A 3LRLA 3NEVA 1H7XA 4UTTA 1NF7A 3NQEA 3DZ1A 3QC3A 3P74A 2NXIA 1VQTA 1Q3NA 1QPNA 2J88A 3G1YA 3NQ8A 3JR2A 4QQ3A 1LTDA 5KINA 3LX9A 2WOQA 1A5AA 1EB3A 4X2RA 2CLIA 1TTIA 2Y61A 1ZAHA 3UWYA 3EWZA 1QFEA 3T44A 4N9DA 3W1LA 1OHLA 1SO6A 1SPQA 5LHFA 2B0MA 2H8XA 2YR1A 4UFIA 1W31A 3NQ7A 3HOJA 4DPPA 3CIWA 4GC4A 2NXGA 4RK8A 1QAPA 4MPQA 5AB3A 5K7JA 1OFOA 2Y70A 3M16A 3CWOX 2CLEA 2GOUA 3MWAA 1UJPA 1EWEA 5FF3A 3CB8A 1DOSA 1QDSA 3W7CA 1VZWA 3M7WA 4K8HA 2QCDB 3WJSA 3W7OA 3PF3A 1L6SA 5DXXA 1A50A 3TKFA 3SIZA 5BNKA 4JX4A 5K9CA 3KVKA 1F2JA 3NGJA 1IXPA 3PBVA 4O1DA 1G4SA 2DJXA 4PA8A 1F74A 5DY2A 3WK3A 4M7SA 1Y0EA 1DQXA 4HSOA 3PBYA 1MXSA 4LC6A 3TC6A 3NNTA 1EUNA 1GPWA 3EXSA 3L65A 4JN6A 4JXCA 2EPHA 3NOEA 4EF9A 3E9AA 3VFLA 3CM4A 1FCQA 3IVUA 3ZWSA 5HJLA 4QISA 3F1QA 2P0OA 2CZDA 5CPLA 4Z1AA 3PVFA 2DZUA 3KXQA 2JKEA 4FNUA 3WJYA 5BMXA 1FBAA 5BOOA 1OK6A 3M5ZA 3NYZA 1K03A 4MVAA 5FF2A 5IBXC 5CSSA 1VPXA 5AYXA 2VOMA 3SSJA 4LNYA 1G67A 3TAKA 1ZJIA 4JTKA 3W7DA 3WK1A 3V75A 2YW3A 4BF9A 3IRDA 4RKAA 4MYXA 3S5ZA 1YTEA 1F7BA 2OZ0A 2QAFA 4ORIA 1JR1A 1KBIA 3QQ0A 1KM6A 4CLMA 4EOUA 3RFAA 1G4PA 3GB6A 5D05A 1EWDA 4Y8FA 5E1QA 3TDFA 3PS7A 4S1FA 3STGA 2CU0A 4IX0A 1KFCA 1XDMA 3HBLA 4L4LA 1DVJA 3W1QA 1O95A 5SWUA 2Y62A 3L5MA 3FEMA 1GVFA 3M41A 5D2TA 3GLCA 3BVJA 2TSYA 2ISVA 2X1UA 5DCDA 2YFOA 4JTLA 4JTSA 1GVOA 2QAPA 1PHQA 3MJYA 1KLZA 3P81A 1ZFJA 1AW5A 1ICSA 3DHFA 4I9AA 2DZTA 3DI1A 2C1HA 1YADA 1CI1A 1TPH1 3QEZA 5AYZA 1VHNA 1R30A 1P5BA 3G18A 1TJPA 1XFBA 3W70A 3W7NA 1HL2A 2CZEA 4RLIA 2GPTA 3WJXA 4O28A 5DXYA 3CU2A 2UV8G 3STFA 1UBSA 1M7PA 2ABBA 2GJLA 4AHQA 4FX8A 3N9SA 5CZ0A 4OBTA 3W07A 3PAJA 4RXFA 5CPMA 4UFHA 5D2WA 1W3NA 4FX6M 3M0ZA 1JQVA 1TTPA 3A5VA 4TO8A 4QM1A 2ZRZA 1VCGA 3QZEA 1U5JA 4ZQPA 5FF4A 3ZR4A 2E5BA 1WXJA 4NJHA 3BG9A 3TSBA 3W7LA 3IIPA 3LHZA 4IGHA 1PVNA 5F2IA 1R2TA 1ME8A 2C6QA 1H5YA 3L66A 2B7NA 3E12A 3FKRA 1XBYA 3HG2A 3NPWA 4JY9A 3CEPA 2FLIA 2VENA 4O16A 3A22A 4GWEA 1XL9A 4MFDA 3IVSA 1D3HA 5DELA 4N02A 4N9BA 4O17A 3W9ZA 2C19A 2FTPA 2XN0A 2HSAA 1AMKA 3DHDA 1K8XA 4O4VA 3SGUA 3GNDA 2QR6A 4I7VA 3CTLA 3M47A 5G1TA 1TTJA 3CLMA 3R2GA 1WBHA 3NPXA 2W79A 3ZS4A 4N6EA 4O11A 1TPDA 4GNJA 2WPBA 3UWQA 3W1UA 1X1ZA 4UIOA 2Y89A 3LTYA 3C2EA 3UQNA 5CG7A 1W37A 5LNVA 4ZVJA 2Y63A 4LRSA 3C6CA 1K02A 3QW4B 4I7WA 5I3HA 1L9WA 4RCXA 3W7GA 4DXVA 1Q6RA 3PWAA 5D2YA 4N2YA 4HPXA 5G2WA 3B05A 4AWUA 4UTUA 4YLWA 4K8EA 3CC1A 2TPSA 4JNMA 2V2DA 2QUUA 4S2BA 3HO8A 3EX6A 3S42A 1KM1A 4UUIA 4IMFA 5F4WA 2G95A 3JS3A 1QNVA 3C8FA 5DY3A 5EY5A 1P1XA 4NZJA 1OYBA 4UTLA 2G96A 2KZHA 4FF7A 5AFDA 4OE7A 3DENA 1PCKA 1UB3A 3FKKA 1RD5A 3O6YX 2OX1A 3B8DA 3LBMA 3ABOA 4IOTA 3C2OA 4NX0A 1VJIA 5G4WA 5KZMA 1J5TA 2HS8A 4UTWA 1H60A 3TXZA 2Q8ZA 1SFJA 4UC5A 1OYCA 4LUIA 3PBUA 3TXVA 1OX5A 3ELFA 3HGRA 7TIMA 3MBFA 1N8FA 2ZCGA 4OT7A 2PRHA 4PEKA 1VYRA 2V0TA 3P8JA 1YLVA 3C3NA 2CW6A 4Z0JA 3SGZA 3I65A 1LZOA 1A5BA 4IMGA 4OV9A 3EXRA 1JULA 2NX3A 1MEHA 3W1MA 1FDZA 4QIUA 2J27A 5D37A 1V5XA 2ZZ6A 2X2GA 3ATZA 4JX5A 1FQ0A 4LS2A 5E0KA 3G0SA 4XQ6A 3FIGA 4O1CA 2A1YA 4QITA 4A3UA 1XUZA 3NPUA 5LHEA 3GDLA 1I2QA 2AAMA 3QSTA 4CQAA 5CGQA 1HFBA 4CNNA 5CKSA 1KFLA 4BR1A 3LXBA 3MO7A 2C15A 5D04C 3GKFA 1LP6A 1EUAA 3BPWA 3IGXA 1VCFA 3UZ5A 3NL5A 1MO0A 1F6KA 5LGZA 1I2OA 2B4GA 2QUTA 2WO5A 5FI8A 3O1NA 3G1DA 3S8HA 4KFNA 3N3MA 3LGEA 3QRHA 4O54A 2ZA3A 3BGGA 1XI3A 2RH9A 3PM6A 1RVGA 1OFDA 1LRTA 3O16A 3S5YA 1S5WA 2A6NA 4TR9A 4KWWA 2YYUA 5DLCA 2ZA1A 2X16A 2CZ5A 3MYOA 3W84A 3LHYA 1JCJA 5C55A 2E68A 4IQLA 4GUFA 3PG8A 3MP5A 1FCBA 3DFQA 4M5PA 2X1RA 1X6UA 5AHFA 4A2SA 1YDOA 3TSDA 1XDLA 4PC8A 1B4EA 2HTMA 5J5DA 3M5VA 1H51A 2Y7FA 4BFAA 1AK5A 3HGSA 1PIIA 1TRIA 2DU2A 1KA9F 2ZZ5A 4FXSA 2WNQA 2V9DA 3W73A 1J2WA 1QOPA 2YYTA 1SR9A 1WOBA 4KFPA 1M5WA 3NQGA 2ZBTA 1MZHA 3IVTA 3W7JA 3W3OA 1OFPA 1L6WA 2J24A 4FNSA 3RMJA 4UFJA 3O8AA 4AHOA 1ALDA 3EWBX 3T40A 2D73A 2VC6A 1EP1A 1KFBA 1LLWA 3HG3A 1FDYA 3U8GA 2CLLA 1SFLA 1DJQA 1MSSA 1T96A 3P5ZA 3ZWTA 2ZRYA 2QCFA 2BLEA 4MJZA 4TU1A 1W3TA 1KM2A 1F05A 4MLRA 3W7HA 4A22A 4NXKA 3W85A 1RQBA 4ZZ9A 1W1ZA 3IIOA 1ICQA 1Z42A 4RR4A 1KFJA 3LXCA 3W7KA 3AO0A 1SZGA 2JBMA 1F73A 4N9EA 5E93A 1WBJA 1KFKA 4PL2A 2YXGA 1KM5A 4S2CA 3RLVA 2RDUA 5HWJA 3QPYA 3GDKA 2ZFAA 1PL9A 3KAOA 4HNNA 3MBDA 4JDBA 3GXTA 1OFQA 2QCNA 3KOFA 4HHPA 3LRKA 3TMQA 2PURA 3H54A 4IPJA 4LVDA 1W0MA 4N4QA 5EKYA 2W6RA 4LRTA 5C6MA 3GYEA 3W2UA 4WXZA 3HMJG 4A21A 1IIGA
chains in the Genus database with same CATH superfamily
2ZRVA 4ZE5A 5F2MA 1MMFA 3N2BA 3CZJA 1UWSA 4C6KA 3OBKA 5CPSA 5C7VA 4BS0A 3F5KA 1Q63A 3KUMA 3S1WA 3MUXA 4MMWA 1SQ7A 4J40A 3GIPA 1SYTA 3AS1A 1P0BA 2ATSA 4Q8VA 4J3UA 4GZ7A 2NX9A 5C8BB 2NW0A 4DYJA 3L2LA 3IACA 1C92A 4HNLA 1TWZA 2QGYA 4ZR8A 3T7VA 2HDJA 4HTBA 2VKZG 5D9NA 6XIAA 4AMAA 5L9FA 4ZFCA 1KWKA 2ZZ2A 2ACQA 1NWUA 2RGMA 3SY1A 3TX9A 4RV8A 2QCMA 1TQJA 1LL6A 1FWCC 4IPPA 1GT8A 4YJ5A 1NTHA 4CCDA 4F9JA 4B90A 4GYFA 3HGJA 3OBAA 1JI2A 1QI5A 4OHQA 3W2NA 3EWCA 3C2VA 3P62A 4DWSA 3KCOA 4TTGA 4PL1A 4RDZA 3VD7A 3B8UA 2RDTA 3WF3A 3H12A 2Y6ZA 1H61A 3AZTA 4EIVA 5E0CA 1BAGA 5A5WA 1GPFA 3PB2A 4PBEA 2JIEA 4H19A 1EJXC 5HMDA 1NQKA 1XCXA 3TE9A 1TV2A 1LYXA 3AMDA 2WSYA 3KRZA 3K8KA 2X7VA 1JL8A 4OKDA 3KS5A 4B5TA 1EC8A 1JPKA 4NAEA 3B4YA 3BCJA 4JPGA 1NWSA 3TUUA 4HSHA 2YLLA 5CC5A 4JIEA 1PTAA 1L2QA 4CU7A 3W87A 3UPWA 1H7PA 3LNPA 3SUWA 1UUOA 4IZGA 3C8NA 2XINA 3VKDA 2HRWA 1AZ2A 3B9EA 1I1XA 2D0HA 4CNOA 4KWVA 2CHNA 2GVGA 4N7QA 1CCWB 5DT7A 2PDUA 3WQ6A 5AY7A 4DN1A 2HQAA 4ERGA 4ZFMA 1ITCA 1UKOA 3KVMA 1RZMA 3B8WA 4IGMA 4GACA 2JQXA 3A9BA 3WLRA 4HYWA 4YIWA 2P1FA 1BSIA 1DJGA 4Z1CA 3P60A 3BW3A 4JTUA 4GNVA 1OD8A 4WY0B 3C4UA 2WMGA 3TIMA 2V81A 1HQTA 3RLGA 3G1FA 3U9IA 4UCGA 4OWGA 2IPFA 5JUVA 4US5A 4EX4A 1XYCA 3AS0A 3TLQA 3KEHA 3G1SA 4GC3A 4N0RA 2TRSA 1ZS2A 2GQAA 4Q8OA 1F8MA 5CC7A 4LYQA 1XYBA 3NO1A 1MW0A 4OU1A 1SW7A 3NQAA 2PGWA 3B3DA 3LTSA 2Z25A 3B8IA 1WA3A 5DEZA 3S0CA 4ML9A 3R94A 3A5FA 4GYPA 4BK9A 4H6QA 3O6DA 3WLOA 5FEPA 1S2VA 3RRAA 1DJXA 4HD5A 2VEPA 4RJEA 4Q4MA 4B16A 3U6WA 2F6UA 2NUYA 2V6AA 2XZ9A 1LBLA 2BY2A 3LTPA 4G7EB 1RA0A 5LZLA 1YIXA 2CC0A 4B9ZA 3L5AA 3H23A 1V3LA 2V82A 2WV8A 2GGEA 4XKYB 2CERA 3W72A 3DGRA 4XD5A 3MUY1 2YBUA 2YCKX 2YZ5A 1LF1A 1XJBA 5AYYA 3GNRA 1WDQA 1VAHA 3WNLA 4FIRA 4US6A 1IF2A 1FWIC 4MLJA 4AH7A 4H9YA 1UJQA 3FAXA 3QLLA 4C5ZA 3L0GA 3UXDA 3QV6A 4IIGA 4OVXA 4C6PA 4FNQA 2EKGA 1AQMA 3APTA 2V2HA 1C7TA 1R7AA 4CKQA 1FTXA 3DN5A 4G7FA 1DV7A 4N9CA 3QOMA 4R53A 4FAMA 3NVTA 5CZTA 3FYPA 1S5MA 3CAQA 3FOKA 1VFFA 3FYOA 1TPC1 1ADOA 3WEOA 1NOWA 5AC7A 1IR2A 1FDJA 4JEQA 1C9DA 4I5RA 3DAQA 1JJKA 2B81A 2CPUA 1LWJA 3E2SA 3V18A 1VFMA 1FFRA 1UD3A 2WXDM 2CLKA 4Q7IA 2Y7EA 3ARPA 2POTA 2PDQA 1J01A 4PTMA 4FLQA 4B4FA 3LN3A 3Q2DA 3QR1A 1XCWA 3D3AA 3VUSA 2J25A 3NGFA 4M29A 3GDMA 5EMYA 1E4NA 2DZPA 4XX6A 1KXQA 4AWTA 2CLOA 2QJJA 3ITCA 1KRMA 1I6NA 3WJZA 1Q6LA 3S47A 2OODA 4PODA 1DIKA 1S2TA 1SR0A 4LY8A 1PWLA 3AIRA 2BZNA 4FXFA 4CD8A 5M2FX 2YSWA 4WQ6A 2ZX9A 4C91A 4YS1A 2RUSA 4IHCA 4IIEA 2OELA 1Y5VA 2FH6A 4DO5A 1A53A 2OKTA 1HP4A 1ESWA 3FCPA 3NXFA 3GH5A 4WDTA 3V7PA 3BJFA 2SFPA 3A12A 4JGDA 2XUCA 2NQLA 4XTDA 5MKGA 4E38A 3TR2A 1F3TA 4P61A 2Z27A 2NQHA 5EMMA 1QWGA 2HBVA 5DMNA 5CG0A 3KCJA 3BV4A 1LOQA 4JL1A 1WUEA 2BGSA 1M03A 5I06A 4HPNA 3IK2A 4PCPA 1EJUC 5LNUA 3AIWA 2Y85A 2DSZA 3A21A 4OFCA 5A6TC 3GTFA 4UNIA 3A4JA 2E5CA 4JHOA 5LNWA 1ZAJA 4RNHA 1XV8A 3OP2A 4GNKB 2FKPA 1QOQA 4UOJA 1JYVA 1VIZA 2ZZ1A 3MTWA 4W88A 2QZRA 1QI0A 5C54A 1QNRA 3ANVA 4HSNA 3FYYA 3G22A 2E9MA 4RV3A 1QO2A 3QQWA 3OB8A 1QNOA 4JYFA 1OF6A 4O18A 3TYBA 3QTPA 4CNUA 3V5CA 3N6HA 3CMJA 4LAZA 3UU0A 1P0KA 1VR6A 2I14A 3LK6A 3GUGA 3CIXA 2QCEA 2V2CA 2WKJA 4ML4A 1UA3A 4S3KA 3M43A 3TH6A 3NL3A 4AX6A 3ARYA 3CQJA 1WX0A 2DT0A 3H70A 2ZUNA 1Z9AA 1FHVA 3DERA 4L9ZA 3N4EA 4ZQOA 2FIQA 3RLUA 5LNSA 5BRQA 1IYXA 1W54A 4CU6A 3UXIA 3FLUA 1M1BA 3K1GA 3QGAC 2ZC1A 4TQTA 5EYWA 5L6UA 3E2QA 3D47A 1HO1A 1DIOA 2CBJA 1WAUA 1H2JA 1CEOA 4DZIA 3UXAA 5DCBA 4ENLA 5CXPA 2WVVA 1QO5A 1XCFA 2R8WA 4WKFA 4DY1A 3K46A 4FLOA 5JVLA 4KIEA 1OB0A 1OBAA 3LYEA 5A8NA 1JZ4A 4KF1A 3QKZA 2XZ7A 1D8CA 3C0QA 4KWSA 1BKSA 4IFRA 3DHUA 3H2CA 2GVLA 1FH7A 1AW1A 1XW8A 3WD0A 4GOAA 3AI0A 3LNMA 3FS2A 1B9BA 3H55A 2BXYA 5C2XA 3F03K 4NX5A 4CD5A 4LUTB 1SO5A 3GHSA 1TO3A 1V6TA 1XISA 2W9MA 2A5HA 1JNDA 4PTXA 4UR8A 4RL3A 2O9RA 1AH3A 1DQUA 2J7HA 3OLGA 4L7ZA 2GVEA 3TA9A 1GKRA 1YTDA 4BEUA 3LCLA 1TB3A 3URAA 3AWNA 1U5HA 1H41A 4Q33A 3TLLA 1ZALA 4A05A 4AUBA 3MKKA 5JBFA 1XYAA 4HYRA 4U3AA 2DSKA 4WUIA 4XG1A 3UWWA 2XDFA 4IXXA 4PCNA 2EPMX 4AD4A 2CKRA 3NQFA 2HVNA 3VM7A 4IIDA 4V1YA 2PS2A 1KRCC 3R7MA 3LSCA 4MJMA 1QHZA 2BG5A 4ZO7A 3RR4A 5ABFB 3AYRA 4UQCA 2XIQA 1VYSX 4LVFA 1J79A 1R46A 4G7EA 1QBBA 1YBQB 1Q6QA 3R1ZA 2R82A 2A3BA 5EL1A 3FK4A 3GIQA 2XN2A 2H3BA 3Q4DA 3WIJA 3RU6A 4NVTA 2ADAA 1CPUA 1RBLA 5I78A 4PCSA 3TAOA 3NURA 3E5BA 1HP5A 3SFWA 3KL5A 1K70A 1OJXA 3F4CA 3VKKA 2TYSA 2BOFX 4MWAE 2XH0A 2EHHA 1Q2SA 3OW1A 1BQGA 2PZ0A 1SW0A 4FP1A 4YWIA 1YHTA 3FJLA 3PJXA 1PE1A 1DORA 1R6WA 3I6RA 6ENLA 3GY1A 3NQ6A 3L7RA 5HMFA 5F4XA 1A5SA 3DFYA 3TQ0A 1CLVA 5CPNA 4DRSA 5HUOA 2GUUA 4X22A 1JFHA 4FXJA 3EB2A 2RKXA 5DT5A 3QFEA 3AROA 4ICNA 2WSKA 4I9TA 2DW6A 4JS3A 1VJSA 3FJ6A 1OVDA 5D30A 4ZQNA 2GJPA 4PUNA 3PK7A 1C8QA 1TR1A 2YKKA 1DIDA 4AY8A 2H8ZA 3PZTA 5TIMA 5J04A 3IIVA 3M0KA 3VKJA 3S46A 4XZ9A 2OEKA 2WWCA 1EX5A 3EMZA 1VS1A 1U5VA 1DXIA 4B2DD 1KTCA 1F07A 1NSJA 1X1NA 2E1DA 4CCCA 2IW0A 3LM7A 4LX4A 4AF0A 1BTCA 1W9UA 3GS6A 2E28A 5D8ZA 2HK0A 3GAKA 3WSUA 1V8EA 1K1DA 3ITOA 1EA0A 1EEXA 2VX6A 1XC4A 2QT3A 1US0A 4JIPA 4NKCA 3UD6A 3QPEA 4AXNA 4HHLA 2VEGA 1WKEA 7REQB 1KXHA 3N2TA 1G7VA 4DUOA 4E2VA 1NDZA 4JTRA 1QJWA 3A23A 4GGBA 3MANA 5IHSA 4JTHA 1EIBA 1GTEA 2WJZA 3M5YA 4F2UA 1TRDA 1UYQA 4C6LA 1YXCA 2CFFA 2G4FA 2A7RA 3G1AA 1EO7A 3KP0A 4GO9A 1Z8AA 1ITXA 1XGEA 3KTCA 1GG1A 1PPIA 4BI5A 3MZ2A 1K77A 3VC5A 4YVVA 4UQBA 1DJNA 4MJ2A 1JPIA 1XIIA 3W23A 1QATA 3PY2A 2OZ3A 4AWEA 1PWMA 5I3FA 2DZSA 1ZJHA 2DP3A 4JYEA 3L4WA 3S2JA 4E6MA 4WOQA 3GHTA 1TV7A 1JZ7A 1E6QM 4ES4A 1O5KA 2Y2WA 2ZRUA 3VGBA 1OT2A 2PBOA 3ITXA 1LL7A 2R1PA 1Z32X 4GABA 3ANYA 2VYOA 1VEOA 1MFUA 4BJHA 4AY1A 3EAUA 4BI7A 1K7FA 4RDVA 1UOZA 3W2LA 2E1WA 1L0PA 1ICPA 2FB3A 5TD4A 1OSEA 1AQ0A 5KSWA 3WQDA 2HISA 4R33A 1GOOA 2VUNA 3M0JA 5JU6A 1B57A 4X9SA 3ZFHA 4GFIA 4IPNB 2AL2A 2IXVA 1HGYA 1V93A 2W4XA 4ADSA 2PBGA 1PHWA 2AQOA 3CWNA 3VC6A 2YXXA 1FWRA 4YTSA 1OCJA 3SCUA 4QSHA 1W3LA 1WPCA 3NPVA 2EGZA 3MP4A 4LYPA 1P7TA 2UY2A 3QXBA 3ZT7A 6CGTA 1KM3A 5CH9A 3TROA 2NT0A 1SZEA 3BGJA 2QUVA 1FKXA 3W6YA 4M7TA 5PTDA 2Y8VA 3BZGA 1AL7A 4CVUA 4M6QA 5I3IA 4IM4A 1AFSA 4EPBC 5HQMA 8TIMA 5FF0A 3WO8A 4JFWA 3MUAA 1W9VA 2QF7A 1WKFA 3AZRA 3LV5A 3PTMA 2POZA 1G94A 3G1HA 5HMSA 2ZUSA 3R79A 4E8DA 2NSXA 3VIFA 1LDCA 4O10A 1XIEA 1GVQA 1QW9A 3LHTA 3DU0A 3W2MA 2GSJA 1EPXA 1UP2A 5I09A 5CC6A 4XBSA 1SO4A 2G8ZA 1XHGA 1CGVA 3EPMA 3LS9A 1ZNNA 3H26A 4S3CA 2GOKA 3TYEA 3REQB 4CVWA 3TV8A 2ZUUA 5FAJA 4Y9MA 4B3KA 1E0TA 1NJJA 4ZO9A 2WBGA 4M6VA 1ZB5A 4TX8A 2FPTA 3WBXA 2CWNA 1R3QA 1XR2A 1DWGM 5K9DA 1CXFA 5A2AA 1ZUAX 4ICMA 4QXIA 4CCEA 5CLWA 3DKLA 4AD3A 2ZTJA 4YMZA 3KOXA 4ZODA 4WOZA 2VEIA 4IIFA 4LJ3A 4ZOEA 3KHDA 3UYCA 2H3DA 5I3KA 4ZTYA 2WNNA 4WSJA 4L1XA 1MW3A 3ORWA 3TONA 5MKGB 2J7CA 4CQ8A 3WNNA 2X42A 1WQ5A 1S5VA 3BQ6A 4HBKA 1EZ2A 2ABAA 1V6XA 3WLPA 4JTJA 3KBWA 4ZOBA 4IT1A 3GXFA 4OOUA 4F2TA 4Z2LA 3TTEA 1QW8A 2HS6A 1EOMA 2F38A 3M0HA 1XRVA 2QW5A 1H7XA 1NF7A 1NWTA 3W0KA 3DC0A 2NXIA 3CHCA 3NQ8A 3JR2A 1E15A 2WOQA 1A5AA 1EB3A 1JDDA 2J8GA 1E72M 4F0KA 3EWZA 4N9DA 1MNZA 1VD6A 5RUBA 2FVLA 1LG1A 1OHLA 1SO6A 3RN6A 4GY1A 4KEUA 1SMDA 2H8XA 1OIMA 1W31A 1UWIA 2V3EA 3NQ7A 4DPPA 4ROQA 4RK8A 4MPQA 3CV7A 4J2PA 5FIPA 3UA4A 1OFOA 3M16A 3CWOX 1TA3B 2PSNA 4R3UA 3MWAA 1UJPA 1DOSA 2NQ5A 4G1NA 2HK1A 2VC9A 3M7WA 4KRUA 1XH1A 3SIZA 3BAJA 1OT1A 4QLKA 3PBVA 1G4SA 2DJXA 4PA8A 3RCYA 4K3ZA 2OQLA 2PFHA 2ZUTA 1QRQA 1X7IA 4GIYA 3UZZA 5A6AA 4AY7A 1Y0EA 1RJQA 2IKIA 4H6EA 4HSOA 2VDGA 4JFTA 3R6IA 3NNTA 1XD1A 1EUNA 2OWXA 3NOEA 4EF9A 3TR9A 3E9AA 3SY8A 3VFLA 3GW0A 9XIAA 1AH0A 1FCQA 4QISA 3ITLA 3OPSA 3PANA 2PDJA 4Z1AA 2DZUA 3DG3A 3AISA 3KXQA 2JKEA 2GQ3A 3NYZA 2D2GA 3ABZA 2W27A 2DZBA 5M17A 5E9XA 1Q66A 1UHVA 3SSJA 3POCA 1HKJA 8XIMA 2OEMA 4JTKA 3W7DA 2YW3A 2HPIA 2BASA 4I6KA 4J35A 3I3EA 1B5TA 1VRXA 4RKAA 4X60A 1PO9A 4F0LA 1YTEA 1F7BA 3GU9A 2QAFA 2BBFA 3HPFA 4ORIA 1YRRA 1JR1A 5A69A 3AWOA 3GB6A 2DW7A 1EWDA 3AHTA 5I6SA 5DMMA 4KPLA 4ATDA 1XX1A 1XRSA 1CXHA 2HV5A 1Q7MA 1O95A 3ZJ6A 5SWUA 2Y62A 1H0IA 2BHZA 4JTSA 1E56A 3BAWA 4XZHA 5DMLA 3UF9A 3P81A 4CN1A 1ZFJA 1AW5A 1O6IA 1JNEA 3H4GA 3ZOAA 3CT2A 3CH0A 1FH9A 1OIFA 1X8CA 1Z6KA 3LBOA 2ZUMA 1TJPA 1MRAA 3PTKA 2AL2B 1HL2A 1ZTVA 3IJ7A 3LA4A 4WGXA 1PXGA 4RLIA 4O28A 4GI9A 5DXYA 3STFA 1M7PA 2ABBA 2GJLA 4H9TA 3N9SA 4MWAD 3W07A 4RXFA 3R4IA 4I90A 4MF4A 4P5UA 2WWDA 3IARA 5CPMA 4UFHA 1W3NA 5CQ1A 3M0ZA 1ECQA 1IEIA 4TO8A 4QM1A 3TWAA 4I6VA 1VCGA 1WNOA 4GQGA 5FF4A 1NDWA 3IJQA 2PDIA 8CGTA 3DIPA 3TCSA 4AVOA 3HURA 1ZRQA 4BF7A 2DSWA 3LHZA 3F2CA 2X2YA 4H6RA 4E3TA 3BV7A 3LZ5A 3L66A 2FTWA 2B7NA 1ZSXA 1EBHA 3GNOA 2IMRA 2FTYA 1RP8A 3NPWA 4YYFA 3F4VA 1IQ8A 4GWEA 1XFCA 4JBRA 4QROA 5I3DA 4N9BA 3MSGA 2DUAA 2GUBA 3WENA 2HSAA 5LYRA 4PUMA 3SGUA 2HVMA 4W7VA 3M47A 2Z00A 2ZKMX 1TTJA 3EA3A 3SRKA 4KIRA 1XYFA 1K9TA 3UG5A 1X1ZA 4UIOA 2QVHA 5FACA 4MB3A 4PSRA 1W37A 4LRSA 4NI8A 3C6CA 1DTUA 1DWJM 3MKVA 2XGBA 3RX3A 3MUZ1 1ZQ5A 3GG0A 5I3HA 4DXVA 3GNPA 1XICA 1Y8BA 3F4DA 1S1PA 3R0UA 5G2WA 3B05A 3B97A 4UTUA 5B7ZA 3WNKA 3NSMA 1VFUA 3N12A 4JNMA 3ZYZA 4S2BA 4UUIA 4IMFA 4PYSA 3WDPP 3LEPA 2G95A 5EY5A 5IFPA 4JN8A 4A8LA 4NZJA 3WNMA 1JYWA 2P8CA 2KZHA 3WBYA 5AFDA 4OE7A 1UC5A 1AZ1A 4MWAA 3FKKA 3OYXA 3O6YX 3LBMA 3SN4A 3C2OA 4TXEA 1VJIA 4REQA 1DWAM 3FJNA 1H60A 3TXZA 1OG6A 4MNMA 1EKOA 2J79A 2CHRA 1Q65A 3PBUA 1ISWA 7XIMA 1MWOA 2BDQA 3R58A 4D1JA 2PRHA 3SCRA 1VYRA 1K9FA 3WH8A 4YN5A 2J62A 4Q8UA 2OKOA 4KWOA 1PTDA 3CTTA 3I65A 3LD5A 1A5BA 1EJTC 4IMGA 1QI4A 1JULA 2NX3A 4NF7A 3WEMA 1DPMA 3A3WA 3MV01 3UNTA 1E6ZA 2QIWA 3BLPX 1V03A 1OZQA 2X2GA 2ZICA 3PZ9A 1X38A 4XQ6A 4H9ZA 4A3UA 3GC4A 3ZT6A 5LHEA 4MUPA 3KL3A 3GDLA 2P76A 1YQ2A 4CQAA 5CGQA 4GIRA 1J8VA 1HNYA 3VX0A 1KFLA 3G77A 3WBAA 4LEFA 5D04C 3GKFA 5HDRA 1IWBA 3IGXA 1OC6A 4FSAA 3UZ5A 4CQDA 1R3SA 4DBWA 2P53A 1MO0A 4FZIA 4QSFA 1ISYA 1BD0A 3S8HA 3AUOA 3LGEA 4O54A 1XI3A 2RH9A 5ECVA 3PM6A 4CCZA 4EPEC 1OFDA 1LRTA 3HQPA 3S5YA 4CGTA 2YYUA 4D8LA 4H8NA 3W84A 2YIHA 5C55A 2E68A 3PBMA 1TMLA 4JQ4A 3GC2A 3PG8A 2WKLA 5AHFA 3PFMA 3R25A 1XDLA 2HTMA 1J11A 3AIEA 4TX6A 4AZ5A 2Y7FA 4BFAA 4PUEA 1AK5A 1O5RA 1UR2A 2J7DA 2CLPA 3KDNA 4DXXA 2WPGA 2WNQA 2EPOA 4IH3A 4H8UA 4PB5A 5IXEA 2EXOA 3K8LA 4L4OA 4Z17A 1KRAC 1BQCA 3WMLA 2E40A 4ZTXA 1IWAA 2DT1A 1TVLA 3N15A 4XZWA 3W3OA 2OG9A 1L6WA 3UCCA 4RDYA 3O8AA 4RUBA 3G6MA 2D73A 5BCAA 2IKHA 1KFBA 1LLWA 1X97A 3HG3A 1LUCA 3U8GA 1SFLA 1T96A 4B5UA 5E0FA 4I9MA 4ATLA 1W3TA 3P3BA 1F05A 3ZJKA 4A22A 4H83A 3UJRA 1ICQA 4Q7BA 4RR4A 4HJFA 3KBJA 5DRCA 2J8TA 2ON3A 3EPNA 3JVAA 3GZAA 1WDPA 1WBJA 1YPXA 2WYSA 4GVFA 1CIUA 2DGAA 1WXZA 2NQJA 1GQIA 4KEMA 3RLVA 3N17A 4J3TA 1WE5A 3QPYA 4RE4A 3GDKA 1D2KA 4BQ3A 2ZFAA 4RW3A 1DIEA 3CO8A 4PSPA 4ZB5A 3WY1A 1TE1A 3UZWA 1OFQA 3DGBA 3LRKA 2Z1SA 3V5OA 5BOEA 1W0MA 4N4QA 2W6RA 4LRTA 3W2UA 3QFWA 2HNHA 4BCEA 4A21A 2Q6ZA 1IIGA 3ICJA 1XM3A 1P0DA 2ACUA 1LRQA 3DBPA 3R5EA 3BJSA 1TPB1 2FMNA 1F3EA 2D3LA 3MB9A 1B9ZA 4YWSA 3RX4A 1UKTA 3WF2A 2XVKA 1J5SA 1OCBA 5A6LA 2XGIA 1E9YB 4WD0A 3IIZA 3CNYA 3MCOA 1U1HA 4MPKA 5IOBA 2ZDSA 3QF0A 3VNYA 4H7ZA 2WW5A 4UTKA 4PE8A 1GUVA 1TJ1A 4BQ2A 5HINA 4MZ1A 1GJPA 3PHAA 3CYJA 1JRCA 3L23A 1XKJA 3AMGA 4EXBA 4OBRA 3T2QA 1DWFM 4FHAA 2NWRA 3M64A 3OVGA 5FEZA 3F4WA 2RFGA 2D24A 3SIMA 2X7WA 5BW6A 3WBWA 3KE0A 4AD1A 3P2VA 4WSHA 3G5EA 1GZJA 5LGXA 4DELA 3E96A 3RM9A 2VT0A 1AVAA 4D6JA 1I0BA 4JNZA 2PDWA 3N13A 1VJZA 1Z7AA 4ACYA 5EA9A 4IQJA 5E70A 5G5IA 3KTXA 3WL1A 5CC3A 3NG3A 6REQB 3TJ4A 4HN8A 3M5XA 1H3GA 1DQWA 4KS0A 2OGJA 1GTHA 3HPXA 2XFFA 3AXIA 5FJJA 1C8XA 1AW2A 4TV6A 4AVFA 2FZBA 2UY4A 3MYPA 3DC8A 4Q4SA 2DH2A 4XD4A 3TQVA 5CZJA 4HP5A 4IP5A 1Q13A 3VKCA 3AMLA 4C5YA 5HR6A 4PH6A 1HVXA 1I4NA 3VILA 4R27A 5HNUA 3N9RA 5JIWA 3ARTA 3Q94A 4JQAA 4Q8TA 3EX4A 1PKMA 4UMAA 4WGHA 5AHIA 3UCDA 1B0IA 5MHBA 3KFTA 3ABRA 2D2JA 1XGDA 3CBWA 3APYA 2EKCA 5ABTA 2C13A 5CGMA 1NM9A 1UC4A 7REQA 3AXHA 1GQLA 2PD9A 2VRJA 4Q22A 4LVBA 4MFEA 2Y5JA 2ISWA 2FZ9A 4FK9A 3I7RA 3EOEA 3DFOA 1KTNA 3GIYA 4S23A 1JRBA 4HNTA 1TV8A 3OU8A 1Q85A 5EMJA 1X7FA 1TPUA 1U1UA 1IHIA 1HN1A 1XLEA 3OZYA 2PDCA 3XINA 4LCQA 2VX7A 3W83A 4L56A 1BG9A 1H63A 2F84A 2HJPA 3LPGA 4LW7A 4XKYA 3T81A 2X0HA 3WUEA 4UOZA 3QW3A 1R87A 1Q5MA 1IZCA 4O0ZA 3EWUA 2Q8LA 3WLQA 4AZ7A 3UJEA 3D46A 3N4AA 2ISSA 3BJTA 1VBHA 4H1ZA 4JYDA 1YDVA 4Q4QA 3MMTA 2BFGA 4LAUA 2PTZA 5FEXA 1OCQA 3PPGA 4NNBA 3WDQA 3EDJA 4I8DA 3LM3A 1VLWA 5D9OA 3GE7A 1ZU8A 2NV9A 4MY9A 3R8RA 4DUVA 1TPVA 4TX9A 1L6YA 3ZR6A 3DECA 2DJLA 2WZIA 3LLDA 2YFNA 4AIEA 1XBXA 2XFWA 1YDNA 4QAIA 2VUYA 4GJIA 4DAFA 4B3ZA 4N4PA 1UQZA 3PPHA 5HUPA 1JDEA 1XWYA 5HQEA 4AZBA 1FY6A 4IGSA 4ZE4A 3SY5A 1OFEA 5JBEA 3RF9A 5GNZA 5EU9A 3T42A 3VOFA 1J93A 2PDBA 4MKSA 2V5DA 3CQ0A 1K7XA 1UW9A 2G3JA 1GOWA 2P3ZA 4WDUA 5HMEA 2R24A 3QBUA 4A29A 3H2AA 4GVHA 3CL6A 4U4MA 2XH2A 3T55A 3EB3A 2EPLX 3W1PA 3R13A 4E2DA 1CZ1A 3O05A 3R12A 5BXTA 4W4QA 3SCPA 3UWZA 2QUNA 3PUOA 1JCXA 1KQYA 2OTDA 3S1GA 3UYIA 1GVRA 3RITA 2XIMA 1A3XA 1S2UA 1JIBA 2GVJA 3MSYA 3LG3A 2DDXA 3QYQA 3O3RA 2VC5A 2OMAA 1XIMA 3C0SA 4X61A 3W76A 3VO0A 3H4WA 2J7FA 4C6QA 1OX6A 1LOLA 1ME7A 4HZ6A 3FGCA 3QM3A 1W32A 1P43A 4KWUA 2A4AA 4F9DA 4H3DA 1XLDA 1XYLA 2FPVA 3VZYA 2BTMA 5XIAA 5T8GA 2A3CA 3BGAA 1ZY9A 1CGYA 1EJWC 2UWFA 4UNKA 9CGTA 3S6TA 4HCDA 1HKKA 2OO0A 3UWUA 2WMFA 4ZXLA 1VYPX 1XRTA 1EF2A 9XIMA 1GYNA 3VDBA 1EJRC 3PTQA 1E6SM 1H62A 2J6VA 5HWNA 3DKJA 4L1WA 1F8IA 1EP2A 2WVVB 4JIQA 1Z89A 1V3HA 2E6AA 1XLIA 1W6TA 2PE4A 5E6YA 5F2LA 4E5TA 1S2AA 2OT0A 3CUXA 1K3UA 3HG4A 1DHPA 2PLKA 3TA6A 4DYEA 4ASTA 4FEZA 4K1GA 4HGXA 1KXVA 4IPIA 3HPZA 4CQBA 3W7PA 1TMHA 1JGMA 1US2A 2OU4A 4GIEA 5LA1A 2PTDA 4LUSB 3GTXA 3W1XA 5CSRA 4HN4A 3L68A 3EX2A 2XH4A 3GU1A 3WX7A 3CV2A 1K8YA 2F6KA 5IM51 1KM4A 4LCSA 1A3HA 3VOIA 1RSCA 2Y5EA 1J0ZA 1ONWA 2J78A 5E6ZA 5DBTA 3MW7A 1BVZA 3RLHA 3HA1A 3QR0A 2HCVA 2ZZ3A 4LV9A 2OWCA 2E9BA 5KZ6A 5J8LA 3CT7A 5A94A 4U10A 2WHJA 3W1RA 1XINA 1W1YA 4OOZA 3TW6A 2NQZA 3DFSA 5C9WA 4DEFA 3W2KA 3G1VA 4Y9AA 3OZPA 1E5NA 4IFKA 4OJYA 1QU4A 1R9ZA 4GUHA 4PRTA 5IHRA 1JPDX 1TCDA 4D8AA 1CB2A 3GAYA 4MZYA 1RLDA 3GXMA 4NL1A 4B4HA 3O15A 1JUEA 1NELA 3S1UA 1R3RA 1KD0A 2WZTA 8A3HA 3W53A 4J28A 3IJ6A 1K6AA 1XGZA 3GTNA 4GVIA 4NZ1A 4AG0A 4QJ3B 3M6YA 5A6SA 1JPMA 1Q45A 3OG2A 4C6MA 3U5YA 3F4NA 3BANA 1WB0A 4C65A 7CGTA 1XLKA 1H1YA 4DBDA 4U28A 4C6NA 4PGLA 5CJNA 4R34A 2DORA 3NOYA 2Z4GA 3GVQA 4RXGA 4FLSA 5M3WA 4NQ1A 2J7BA 5A8GA 1EFZA 1KFEA 3IV8A 3BW4A 1E43A 4K7VA 4ONVA 1GKPA 4GE8A 5FJPA 3V1PA 1TYGA 1QW7A 1V02E 1XIBA 2YA2A 4J3ZA 1IWPA 3ZVHA 2BY1A 3AJXA 2G3FA 3BG3A 1LUCB 1EP3A 4WRHA 4ZCWA 4JCLA 3N2MA 1PEZA 4PTWA 2V3GA 3ANUA 4LUTA 1RV8A 2Y88A 3LHVA 3V4BA 4OTKA 3UBPC 2YGYA 4IFOA 1C8YA 3FW6A 3AXXA 2GWGA 2GDUA 3KVJA 4QDMA 2PRMA 1J6PA 3VGFA 5C0QA 4XVDA 5CPQA 3BSMA 3VNKA 3WH6A 1JCYA 1SJAA 3M44A 1LCOA 3NDOA 2JEQA 4DBUA 4POCA 4E8CA 1X8FA 3CS2A 5D09A 3GFZA 2EAWA 3VPLA 5I03A 4QDWA 1W5QA 2Y0FA 3MMWA 4R88A 1VLIA 3A64A 4V28A 1BWKA 3GC5A 2FHBA 3H7VA 2QVNA 2C91A 3O6AA 4ACZB 1O12A 2AL1A 2XIOA 4LS0A 3HV8A 3S3GA 2OSWA 3TQPA 3EGJA 1V0NA 1A0EA 5C2CA 1H7OA 3CH9A 3LMYA 4JD4A 1SJDA 3UNDA 3VOHA 2CNCA 1G01A 4MNKA 1QPRA 3QY6A 3XISA 1SW3A 4Q8MA 5I79A 3ZR5A 5I3JA 3OZOA 1YE6A 2XHYA 4UTJA 3EDDA 3GKAA 3CMGA 2DH3A 5H6HA 2BX7A 2WMHA 1UP3A 1EDGA 4HZ8A 3DH7A 1W5NA 2QJGA 2FH8A 2A21A 3A9IA 3L2IA 3SW6A 3BLDA 3CL8A 1XKYA 2C0AA 3CHFA 3RXZA 1I45A 4R7WA 5H8UA 1RPKA 3KOYA 3SURA 3UWVA 3RRXA 1YE4A 1PKYA 2NZLA 3NSXA 2EF9A 4DF2A 1QCWA 2QJNA 3RK8A 3OIXA 1D9EA 3STCA 1LLOA 4S3FA 5FJIA 1VF8A 4C1LA 4GHRA 4V1XA 3E0LA 1R7OA 4Q8NA 1YPFA 3N1AA 4WLCA 3DHPA 1TUXA 5BRBA 3GHUA 4O14A 1S39A 3GVVA 5H8PA 3TEVA 3VOCA 3QH2A 1PCWA 3AQUA 4QP0A 4WJ8A 3GR4A 2QMKA 4L6OA 4L4PA 3TZNA 2FVKA 1E51A 4GISA 2A7PA 5CPTA 4ALDA 1UIOA 4PUUA 4HNOA 4O15A 3S1XA 3PULA 3K4AA 3C61A 1TV5A 2X1IA 1NFGA 5AC8A 1FCVA 2RHGA 4M19A 1EGZA 3UXLA 1XIDA 2J75A 3BSHA 4XB3A 3VMOA 1VPQA 1G4EA 2WJEA 4M6PA 2UY3A 3OGRA 4AQLA 2VFEA 3MKCA 3UR5A 1OD0A 1RUSA 1SSGA 4PMXA 1G7UA 3MVTA 3QV8A 1ZP3A 4MAVA 4RDWA 1QPKA 2BNJA 4HNUA 1ZJBA 1UR3M 4P2VA 3U2CA 4BF5A 1KR0A 1VBRA 2Z1VA 4GKLA 3EWWA 1YNQA 1WCGA 4AEFA 5K4ZA 4QG9A 2WMIB 5KEZA 3UESA 1B3YA 4QLLA 3PC0A 1BLIA 5EBUA 5TBOA 5H2ZA 4E2BA 4FOJA 5FEWA 1RQEA 2QHAA 4HQVA 3I68A 2A3AA 1ZBVA 3VNDA 4NXSA 2QCHA 3WD2A 4QQUA 4NJKA 1W56A 2A85A 3WMBA 2O9PA 2OCZA 4JIHA 4H8HA 1OGSA 4UFKA 4YXGA 3AHZA 3I3BA 4UR9A 3WLKX 1SMAA 5XINA 1ZCOA 1G6CA 3N18A 2WAGA 1J0HA 2ODOA 3UR8A 3KRSA 1BXBA 3FVDA 2VGBA 4US5D 5I5RA 2IXUA 5CGTA 3S9YA 1AJZA 3THQA 1S3HA 3W27A 3FA5A 3T4CA 3S9IA 4QG6A 4C7DA 4GO8A 4JNYA 2VZTA 5KETA 1OFBA 3E0WA 1DJYA 1T7LA 1W3JA 4MUZA 4GBUA 1QTWA 2F7FA 3S2LA 4DNMA 4DZ5A 3A3XA 1RJRA 5ENLA 1GYMA 4NZCA 4RPPA 3EOLA 5TF0A 4F66A 1PYFA 1O5QA 4TUFA 2VVSA 4KCVA 1DHKA 5D02A 3NVDA 4CEXC 1H7WA 1WDWA 3KW3A 1UASA 1YTKA 3GDTA 1KTBA 2W63A 4O1FA 2W5FA 2F61A 3AJ7A 1V7AA 4IMCA 2VQTA 3DUGA 4Q6JA 1THFD 1QPOA 1JD9A 3UVIA 1JCNA 1N8IA 2QDHA 1TREA 3WELA 3T08A 3NQVA 1R9XA 1V7YA 2YDRA 2W66A 1XIGA 4HZ7A 3OEXA 5AC6A 3FV9A 4ZBCA 1T99A 4FOUA 4HK7A 4V33A 1IR1A 2I9EA 1BPLB 2XM1A 3CZKA 3HQNA 1ZBWA 3T8LA 2ASHA 2WCGA 4FNTA 4J5NA 1B31A 4JIRA 1W5PA 2A2IA 3M6DA 4AMCA 4JZ5A 3CUIA 4HMCA 3ARQA 2ZXDA 2HPMA 3MSDA 2ZADA 2O55A 5HATA 1H50A 4EPDC 1PV8A 4B91A 1RBAA 3W7QA 4OUEA 4WF7A 1GCYA 3MHGA 3MU7A 3LENA 5TAOA 1GW9A 3T6CA 3W82A 2E4TA 2NUWA 4DWSD 5B7YA 4G9PA 2BHUA 3VOGA 3WF4A 2HZGA 3W71A 2GJRA 1S3TC 2P10A 3W7MA 4Y96A 1HKWA 1JDFA 1JF6A 2FDSA 3D5HA 1QUMA 1NY1A 5TNVA 4KW2A 3IRSA 1KCKA 4XAYA 4DI8A 2BXZA 4JTAA 2GSEA 2OYMA 2ZYFA 4FALA 3II1A 3KBSA 2VFGA 4O57A 3N2CA 4HNVA 2YDSA 4A2RA 4FO4A 1XLHA 3GTHA 2ZVRA 3OVQA 4AIOA 2OO6A 4RZ6A 2NV2A 2AOSA 4KGLA 3N2OA 5A6KA 1A5OC 2ZXQA 1S46A 2J6XA 1RPXA 4J4KA 1BXCA 1IT0A 3T0AA 2KAUC 5K3VA 1ME9A 2Y4SA 4GKTA 4PULA 1FWEC 1N82A 3L0KA 3N73A 1PDZA 1TJRA 1E9LA 2ZX7A 1JZ8A 2ZWZA 2VELA 4OV4A 1UWQA 3EWYA 4PUJA 4Z1BA 1KCZA 2G5WA 3QQ1A 3L5LA 5HNNA 2BWGA 3DDMA 3VI2A 4C90A 1MW1A 3B8VA 3QJAA 4GQQA 2BVTA 3QSRA 2XM2A 2XVGA 4FR6A 1DE5A 4JFVA 4ECLA 1E9ZB 2DVXA 1POJA 3DZ1A 3U7BA 3QC3A 3IS4A 3BAKA 2NLYA 3ALFA 1VQTA 3G1YA 2VRQA 1GKQA 3F5JA 5HA7A 4GX8A 2FGLA 1TTIA 3P14A 3UWYA 5REQA 4A35A 2P0IA 2I16A 1SPQA 5LHFA 1X96A 2YDQA 3VNJA 4W8LA 4HNCA 3P6LA 3CIWA 1QAPA 2F6XA 2IQ0A 3IJIA 3G1RA 5FF3A 1EWEA 3CB8A 2XFYA 3W7CA 2HXTA 1VZWA 3PN8A 4CNSA 4K8HA 2WMIA 4WVXA 3WJSA 2XSXA 2PWGA 3I4EA 2X09A 2GYIA 3KLKA 5DXXA 1EDTA 1A50A 4L65A 3TKFA 2OZTA 3W24A 4HPHA 3V1HA 3K13A 2YJQA 3C3UA 4NAEB 4MB1A 1SFSA 4DIAA 4E4FA 1WXYA 4W89A 3RMEA 4D6HA 4IPLA 1YW1A 3AC0A 1PYMA 2TAAA 2PCEA 1R9YA 1ISVA 4WHBA 3WK3A 4M7SA 3OLIA 1XLMA 3SUUA 1TA3A 1MUMA 2XVPA 1I0DA 3TN5A 3PBYA 2PEVA 3EXSA 2VCAA 1CWYA 3L65A 4JN6A 4JXCA 1ISZA 3BC9A 3ZWSA 1XSIA 3O0FA 3CAWA 3AXMA 3U4FA 1OK6A 3K8MA 3ITGA 1EH9A 2QDDA 1K03A 3E2RA 3BSGA 3C0LA 5FF2A 1VPXA 5AYXA 2Q71A 4IP4A 1HKVA 3GG1A 1OC5A 3BE7A 1ZJIA 3GO2A 4EWJA 3WK1A 3U5UA 1J96A 4LF1A 1WP6A 3GRIA 4MYXA 2XWDA 3H7RA 1UWUA 1WAWA 4C6IA 1VEMA 2AKZA 1KBIA 1DEDA 1KM6A 4EOUA 3RFAA 3CYVA 1G4PA 1M41A 4CU8A 5DFAA 5E1QA 1FP9A 4DJEC 1FH8A 1I60A 3PS7A 5IDZA 2C0HA 1C91A 3B0XA 3VIPA 3VIIA 2CU0A 2V68A 4IX0A 3NJ3A 3UZYA 3W1QA 1M01A 2YA1A 2O56A 1UMLA 3W28A 3FEMA 2PD5A 3GLCA 3BVJA 5A6BA 4GZEA 1T41A 2X1UA 3LGGA 4Q6XA 1I9CB 1PHQA 1KLZA 3BOXA 4MAZA 2V69A 3DHFA 4I9AA 1XSKA 2DZTA 3DI1A 1TPH1 2ZUVA 4HA1A 1KWGA 4A4AA 3W70A 4A3RA 4JTDA 3W7NA 3BMXA 1T6MA 3AAMA 2E67A 3BWWA 2QPXA 1CGUA 4ZENA 5D4YA 4FX8A 4OBTA 3PAJA 4FX6M 1W2PA 3HFYA 4GA8A 5ABEA 4XO7A 5C9ZA 1DJIA 1TV3A 4MWAB 4QJ4B 2WZEA 5I2UA 4XD3A 3ZR4A 2E5BA 3BG9A 5HAOA 3TSBA 3W7LA 4HA4A 2MNRA 2CHOA 3PZMA 2DVUA 3W81A 3D3FA 3IIPA 2D3NA 2ALRA 1CXLA 5H1WA 2GJXB 1PJ9A 5F2IA 1ME8A 2C6QA 1H5YA 1JDAA 3WFLA 4DWDA 1BWVA 4MNLA 4JY9A 3B0YA 3GTIA 1J12A 1XL9A 3IVSA 1D3HA 2WJFA 4PRRA 3CXOA 2CCRA 1DJZA 3GD6A 2XN0A 3G6LA 3DHDA 3FHAA 2WVSA 4JKMA 1NOUA 5GNYA 2QXWA 5HXMA 4I7VA 2XIBA 1HXJA 3CLMA 3WF0A 3R2GA 1WBHA 3QTGA 4AD0A 1Q7QA 3QVQA 4Z2GA 4N6EA 5C70A 2EJ1A 4IQEA 4JAWA 2WPBA 3W1UA 3T8QA 3C2EA 3UQNA 3W6MA 5I0DA 5LNVA 1EYWA 1Q6EA 2PF0A 4ZVJA 4Q8QA 1K02A 1W1A1 2PGEA 1L9WA 4RCXA 5E9AA 4Y9OA 1FHUA 4UWMA 3A3HA 4LGXA 1QVBA 4N2YA 3UT0A 3QV7A 4YLWA 3WQWA 1V3MA 4K8EA 2TPSA 3OHMB 2QUUA 4ERIA 3NDZA 4PN2A 3BXWA 3JS3A 1QNVA 3B8TA 1P1XA 5CZKA 1ADSA 3CQIA 1OYBA 4YYCA 2G96A 5CAKA 4FF7A 4J3SA 2OX1A 3B8DA 3SQMA 2OSXA 3A4AA 2HS8A 1HF6A 3MZNA 5HBFA 3OGVA 3CAVA 1SFJA 4UC5A 1OYCA 1UQYA 4LUIA 2INZA 4J2MA 1DJHA 3W26A 7TIMA 1D3CA 2O4MA 1JZ2A 1N8FA 4GYKA 4PEKA 1LWHA 1M65A 2CW6A 3SGZA 2WANA 3EXRA 4N42A 2INEA 1MEHA 3W1MA 3K1DA 1FDZA 4QIUA 1RLCL 1IEQA 2C1IA 1KKOA 2ZZ6A 3CZ8A 1KGUA 4LS2A 4XAGA 2A1YA 2C1GA 1OEPA 2VP8A 1FOBA 1F4AA 1ELSA 4OZOA 1PZ1A 4F0HA 1GGOA 4CNNA 2DT3A 3LXBA 2DVTA 2C15A 1IV8A 1MFVA 3BPWA 1QWKA 3H24A 2XVNA 3NWRA 4AZCA 5LGZA 1DWHM 1VPYA 4R9OA 3KL0A 4PB4A 2QUTA 2VCBA 5AECA 3KWSA 3KBMA 5JXQA 3QRHA 1EO5A 3FA4A 3FX4A 3QHMA 3KS6A 1PZ2A 1RVGA 3SSZA 3O16A 1KCLA 4DM1A 3QHNA 3K5XA 1AUSL 2ZA1A 2CZ5A 5AC4A 1PZ3A 3W02A 4IQLA 1W1B1 4I5XA 4K2SA 4GUFA 3DFQA 2NVAA 3ZVHB 4DZAA 3LPOA 2JIWA 1S38A 2BY0A 4DJED 5J5DA 3M5VA 2BODX 1H51A 2G0WA 3HGSA 3PTDA 3WF1A 2ZZ5A 4KT2A 1B3XA 3URNA 3AIUA 3ZSSA 1JZ5A 5A6JA 3W73A 1QOPA 1AA1B 2YYTA 1SR9A 4ATWA 5FOOA 1DJWA 1BRLA 3NQGA 1D8WA 4E3VA 4UFJA 3EWBX 3RAOA 3MV11 2OB3A 3SDOA 4XIMA 2PDGA 1W3KA 4G5DA 5T9CE 3MPGA 4YTQA 3MDUA 4MJZA 4TU1A 1KM2A 2WCSA 5FL1A 4MLRA 3E6EA 1QNPA 1W1ZA 3IIOA 3S5SA 3TW9A 3LXCA 3LU2A 1BYAA 1JFXA 1KFKA 3FXYA 2YXGA 1V79A 1XLJA 5HWJA 3F5LA 5FJUA 1EQPA 5JH1A 2VR4A 4JDBA 4D8ZA 3GG8A 1QHOA 4GIAA 2IKGA 4HHPA 2D1ZA 2J8FA 3BCFA 4IPJA 4LBUA 4LVDA 5C6MA 3AU2A 3RCMA 1XRFA 3T1GA 2HMCA 3SCSA 2BGQA 3NA8A 3V16A 4J3XA 4UBPC 4ZA0A 3WLTA 1E4LA 4X63A 3M0VA 2PODA 4S3GA 1RALA 2FJKA 5AKQA 2QCCA 1QPQA 3WFZA 4PBGA 1RXOB 1SVDA 5GNXA 2VD8A 3L12A 3NFUA 4W9TA 1UKPA 2Q3RA 4FB7A 2WZHA 3BICA 4K37A 1H7RA 2UY5A 4TVDA 1Q7ZA 1W91A 3UJ2A 1CDGA 2RAGA 4I8YA 4BA0A 5JBDA 5EMUA 3S2CA 7TAAA 1UCWA 2VC7A 4U5KA 4J3VA 4UMBA 1WZLA 4KFOA 2OPJA 2I5GA 3GZ3A 3VDGA 1LOSA 1M7JA 2ZWYA 4TMCA 3FVMA 3WQPA 4UNLA 2FPYA 2VR5A 3CQHA 1GEHA 3DFHA 2NLIA 2WQDA 1KBBA 1OG0A 1W5MA 4O52A 1TG7A 1ZENA 1MNSA 3HJEA 3GU2A 2Q3OA 1VB9A 4HHMA 4RZ5A 2ESCA 1OCNA 1Q6OA 3ERPA 3COTA 4NNAA 3QHOA 3WDRA 4MWAC 3WQFA 4AD2A 4EPKA 2DT2A 3V0TA 4EP8C 2PDYA 1TQXA 2WLZA 3PJUA 4P8WA 1P6CA 1I2NA 1F6PA 4NJJA 3W38A 4I9JA 1HJXA 2FGZA 1VBJA 2PPGA 3EA2A 4JY8A 3MWCA 3HIJA 4TV5A 4GUIA 5BMWA 2ZXAA 3KVLA 7PTDA 3AMCA 1ZAIA 4M3PA 4L4MA 3AU6A 4K39A 3QC0A 2KX9A 3RYSA 3UZJA 5G2IA 5HANA 4FA3A 3MHFA 1E4MM 1PX3A 2YA0A 3BLIA 4FXRA 1IIHA 3ONCA 1GHRA 4XIAA 4ZEPA 3BH4A 3PG9A 1Q8AA 1TCMA 4WDWA 3OTRA 1XLGA 2WVUA 4DJFA 1NFBA 3BAXA 4BQ4A 1EEPA 5FJOA 1UZDA 3UERA 1XBVA 2V5LA 3PSWA 2G41A 1CGWA 3LBCA 3WG6A 3NM3A 4RE0A 3VIGA 4L61A 4ZSUA 5K9XA 2YL8A 4REQB 1A0DA 1C8VA 1K8CA 4RPQA 4V15A 1F76A 3WQGA 4QEEA 3GFXA 1LG2A 3I6EA 5CSYA 1TKKA 1HL9A 2WC3A 4C6DA 3URQA 4K36A 1SFTA 1MRQA 2O92A 4AF0B 4DNHA 1L8NA 3CAKA 3GVGA 2ALDA 4EF8A 2GQ9A 5J5RA 4TVUA 1QK2A 1YDYA 4IGNA 1Z69A 4X3ZA 5KTLA 4B15A 3UW6A 1KLYA 4V2XA 5HNRA 2YPIA 2A0NA 2XIIA 1X1OA 4O1BA 3ECQA 1P4CA 2IPGA 1US3A 3CEUA 3PZQA 1XD0A 4LANA 4D6IA 4XKMA 5EBAA 1GONA 2NT1A 3SCTA 4YVPA 2ZIDA 1NVMA 1M6JA 2FQIA 3Q58A 1FA2A 4R9XA 3EEGA 4M6UA 5HPOA 1TWDA 3IUHA 4OIFA 1RCOB 3WJWA 1AH4A 5G4EA 1QMLA 1MDRA 1XLBA 1TPEA 1VBGA 3M7SA 4MY1A 4NILA 1FWHC 3PZVA 4IWWA 4MIMA 3V35A 1J9YA 1BHGA 2R14A 1FUYA 1W2VA 2YCJA 1D7FA 2E25A 1W9BM 1QBAA 1H11A 3MI6A 2LLEA 2FFIA 3W6LA 3RILA 3PUEA 2FHCA 2J7GA 1GOKA 1LROA 3NL6A 2WJDA 4UQEA 1GW1A 1E55A 4XVEA 3AXKA 1J2BA 3GBDA 1XYMA 4KCTA 1IEXA 2VXNA 3GR7A 2OYLA 1RY8A 3BCDA 4XBKA 3MDWA 5A8MA 4B5SA 4LUJA 2HEJA 2JGYA 1K4HA 4KMQA 1JGIA 1TPWA 2YB1A 3WQCA 3M46A 3B0VC 1EXBA 4H9UA 3CB3A 3CPGA 3LZ3A 1GHSA 1ZCCA 1BXNA 4LALA 3KLLA 2YL6A 3GDBA 4AIBA 4Z2JA 3USBA 4X0NA 4AC1X 3MMDA 4N6FA 3LSBA 4O53A 1H0GA 3B06A 3W7RA 3SRFA 4UTMA 2C16A 4H8VA 2ZTKA 4NU7A 2W91A 2GLKA 3LI0A 2REQB 4W5UA 5LXEA 1BTMA 2D0FA 1NFPA 1JZ3A 4JTGA 4XZIA 3THAA 1ZLPA 4PMUA 3LCGA 4KEVA 3VABA 2FDMA 4EKJA 1TX2A 5M03A 3HN3A 5D33A 4PMDA 5H91A 2X1SA 3TQKA 3WKZA 3VINA 4GXMA 5DBUA 1AJ2A 2J9XA 3EX1A 1GOIA 2G3IA 2A3EA 4QEHA 3FNDA 3PB0A 2O9OA 2E0PA 4W86A 1PSCA 4H9XA 3LCXA 4HK6A 4KBXA 2X30A 3LRMA 3ITVA 3WEZA 3CHVA 2WSPA 3FJ4A 4QR6A 1YX1A 2PDLA 5DN1A 2YXOA 1TR9A 4Q4KA 2YZRA 1OGGA 3FDKA 3G0XA 5LNRA 4A6GA 1J0IA 1REQB 3VTRA 1FVPA 3VKBA 4OQVA 3IV3A 2ZQ0A 1XXXA 8XIAA 3TN3A 4JKLA 3OA3A 4AXKA 5I7GA 3G0UA 2Z26A 1M3UA 6PTDA 1LT7A 3H22A 3IIXA 4PMZA 1VKFA 1CXIA 3LOTA 4LCRA 2ACRA 2DEPA 3VXGA 1V02A 5HJXA 5I02A 3L67A 3DX5A 4NZFA 5C9XA 2FZNA 3TN4A 2I1OA 5G2HA 3RUBL 1AD1A 3H7UA 1AQHA 3GR8A 3G1XA 1E6NA 4XTIA 4NT0A 4IJBA 1B3WA 3QY7A 1D7KA 3AIBA 4O12A 2VX4A 4FR1A 2BHYA 1V6YA 5GJMA 4QE5A 4HPJA 5HULA 4AWSA 6REQA 4J1OA 3HQ1A 4O8RA 4K38A 4PTNA 4UTWC 2YDAA 3JUGA 4LTSA 1SZNA 1W1IE 2Z1BA 3OA5A 3U57A 3WK0A 1GVIA 5LIWX 4PTDA 1FRBA 1AL8A 3FXGA 3H6OA 1BYCA 2Z29A 3EKLA 3W2JA 3TJLA 1HGWA 4PCFA 4HJWA 4B5VA 1Q6CA 1SZFA 1WOAA 3B9DA 1DTNA 4LT9A 4PCTA 2QEZA 4LUYA 5BOFA 1U2YA 4MOZA 5F4SA 5BROA 1TUFA 5ABHA 5LIXX 1FXPA 1E1CB 3VOJA 6ALDA 3UGVA 3RG6A 4BZYA 3T05A 1CGTA 2PLMA 1PB0A 2H6RA 3NQDA 3KX6A 4A8IA 2AGKA 1PS9A 3I7QA 4HU3A 2OSYA 4FNRA 4MB4A 1V0KA 5DANA 3P80A 3HTWA 1Z41A 3H53A 1G9HA 3UPMA 1EX1A 3L21A 3BLKA 3CUGA 2YB4A 2YW4A 3HF3A 3SBFA 1K7EA 2Z28A 3P0WA 5I77A 1ZL1A 3IEBA 4PMJA 2ZX6A 3U0HA 3C2FA 3P8IA 5DF0A 1UR8A 5ABFA 1MZRA 1MW2A 2DQWA 2AQVA 2CWXA 1R8LA 4U33A 4PMQA 3TNBA 1KBLA 2REQA 5LIKX 2DZWA 3P7YA 1QR7A 4AZGA 4GD0A 1YPIA 3HFTA 3BK0A 3I4KA 3BLEA 4FNPA 1UD2A 1Q4WA 5HQLA 1SU5A 3NM1A 2E6DA 1SJCA 3VZZA 4J7RA 1XSJA 1VFOA 1OABA 2QV4A 3RCNA 1MDLA 1FWSA 3H2EA 3KWXA 3BAYA 4R5EA 1R3YA 2BVDA 1JDCA 4W87A 1Z48A 4FOKA 2QS8A 2QQ6A 3DG7A 1VFTA 1H7NA 4JDYA 4QCFA 4E4UA 3T9PA 5GJPA 1B3VA 1CBGA 5A6BD 4UZSA 1GG0A 4JL2A 3UG3A 3KP1A 1V6WA 4AEEA 2Z1XA 3ATYA 4XSMA 2DZVA 5LA0A 3NL2A 1NU5A 3W4RA 4PBFA 1GJUA 5TQLA 1U83A 1GYLA 1FCUA 4XSLA 3K2GA 6A3HA 5K4XA 2GK1A 3THUA 1O94A 3VDHA 5KZDA 1A5UA 2NV1A 3W00A 3SQSA 2FGBA 4FLRA 3NO5A 4GZJA 1TWSA 4ZB0A 4DO4A 2J9ZA 4MNJA 1OFAA 3P61A 3Q65A 4DBEA 1MUWA 1EXPA 4P8VA 4FF5A 4D2JA 1TMQA 2WSQA 4BY3A 1JAKA 3CHEA 3DI0A 3IAQA 4Q4PA 4PR4A 1JCMP 3RPTA 4GQRA 1E4IA 3AIVA 3PPCA 3MHUA 5HOSA 3LDVA 4LU0A 3VVGA 5LIUX 2R1NA 4XWUA 2W0UA 4GK8A 1FKWA 3RM8A 5AHNA 4GLEA 1C29A 1EHNA 2QPUA 3SB0A 1KV8A 2FMOA 1F3WA 2OEJA 3ZZ1A 4QAWA 1T8QA 1P6BA 5REQB 1WZAA 4B9YA 4AFYA 3ARXA 3TU9A 1A47A 3L4YA 2D69A 2CYGA 3H21A 5F2GA 1DP0A 2V30A 3LCHA 3AALA 4XZMX 3AYTA 4O19A 1OX4A 3R11A 2OQHA 4MHBA 2VWSA 4UTIA 2WHKA 3JRKA 1VH7A 3BL3A 5IDIA 5LKYA 2GL5A 3GBEA 2L5HA 1ZJAA 3WMCA 4F0SA 3BMWA 4MSSA 4DWSC 1E1CA 1P6WA 1YNYA 3IJ8A 1M9HA 5DMYA 7ODCA 3E38A 1O60A 4RW5A 2D23A 3KZPA 4WJXA 3P84A 3AHYA 2E8ZA 2DZXA 2JK2A 1E0XA 3RJXA 2NQ9A 1VFHA 4RNFA 1AODA 3W29A 4AHPA 2CLHA 3KHJA 2CITA 5D2VA 1RQHA 4LF2A 3W37A 1ZBKA 3CZEA 3INPA 4YCOA 2IUZA 3IGUA 3C0JA 4LAOA 1HKIA 5LA2A 1NWRA 4ZQMA 2Y1HA 4W84A 4DVOA 3GXPA 3T78A 3O7UA 1FHDA 1EA9C 4UR7A 3B03A 4J27A 2DUZA 2Q02A 1DE6A 1E40A 2Z