2FPTA

Dual binding mode of a novel series of dhodh inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
367
structure length
364
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual binding mode of a novel series of DHODH inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
total genus 137
structure length 364
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2fptA00
4FHAA 3TSBA 3EWYA 3B8DA 4ICNA 3FFSA 1PHWA 2JK2A 4M6VA 4FX8A 5F4SA 3P82A 2ZA2A 3E96A 3M43A 3M1ZA 3QSTA 1F7BA 1PL9A 2GVLA 2E6DA 5AOUA 1O60A 4CQ9A 5D04C 4UNLA 3S8HA 1VC4A 1GEQA 2NXHA 1GVRA 2CWNA 1HO1A 3C2VA 3GYEA 3E02A 3M0ZA 3C2RA 3BG9A 4FX7A 1UJPA 5CSSA 4QNWA 5E0KA 1C29A 1XFBA 4GC4A 1Z42A 2VFIA 1JRCA 1FCUA 2W79A 3FS2A 2VELA 4FNTA 3CM4A 1C9DA 1KFLA 1OFOA 1QO2A 3LRKA 4AMAA 4O13A 3LCIA 4A29A 2DZVA 3NQVA 4XKYA 3UNDA 4QJ1A 3O8AA 4JIPA 3W7MA 2PRMA 4TIMA 1H7OA 2UV8G 1Q6LA 3TDFA 1L6WA 4N4PA 1FX6A 6TIMA 3EXSA 3P81A 4DF2A 3HMJG 1LDCA 2C14A 4WOZA 3PB0A 4WD0A 3STGA 3VE7A 4Z08A 3W1AA 1J2WA 3W7HA 5DN1A 5D2WA 1H7RA 1SZFA 2FPTA 2QAPA 2CLFA 3OG3A 3VCRA 4WY0F 2CLKA 1FDJA 5K7JA 3JR2A 4NVTA 4UTTA 1AL8A 1GVFA 2Y85A 1MSSA 2QR6A 4N02A 3UWUA 1A53A 5HULA 3LDVA 3A23A 3EX3A 3T55A 1TYGA 5J5DA 2X30A 2EF9A 4OHQA 5LZLA 5HNRA 2A1YA 1ZNNA 2HSAA 2PURA 4CCEA 3TR2A 4DBDA 1MEWA 3PY2A 1G4EA 3B03A 3I65A 2NLIA 2TSYA 4IPIA 1TV5A 1KFEA 5FF2A 4UFMA 1RQEA 1A5AA 1CI1A 3GAKA 3DI0A 4JTJA 5AHLA 3RF9A 1Z41A 5U4NA 3W74A 3GDRA 3W07A 2QCCA 3HJZA 3B4UA 4LVAA 3M44A 2YGYA 1JVNA 3GDKA 3DH7A 3NQMA 4C1KA 3O1NA 5CZ0A 2NXGA 1P0KA 2E5CA 5F2GA 5G4EA 4CNPA 1D9EA 3M5XA 4LV9A 4TMBA 4YLWA 5LGZA 3TK7A 5FEXA 1AW5A 2VEMA 1X1OA 3IVTA 5CPMA 4NU7A 1KW1A 3QMSA 1C8VA 2V9DA 3W2JA 4B5NA 3PM6A 3DBPA 1WOAA 1KFBA 2YCEA 2QDGA 3LHVA 4ZQPA 2E09A 4H6KA 1FQ0A 2R14A 4DELA 4AH7A 4MJMA 4ORMA 4FNUA 4N6EA 4CNOA 1QPOA 1LORA 5K9CA 4CCCA 1W56A 1Q6OA 3TE9A 3BGJA 3NQDA 4Y90A 1SO5A 1SR9A 3PS7A 2Z0IA 1OFBA 4Y9AA 4K37A 2ISSA 3RLVA 1WOBA 3FA5A 4UTUA 3FLUA 2ZRXA 3LRMA 5AHIA 2GUUA 4ALDA 1OFDA 3K30A 2ZQ0A 3NPXA 1EP1A 4OV9A 3M41A 1NEYA 4AXKA 1OX4A 3W7GA 4LW7A 4K36A 1TPC1 2ZFAA 4M6QA 1X8FA 5DY2A 2QKFA 1ZAHA 3G0XA 4AHPA 4LNYA 3QMRA 4OU1A 1UCWA 5K9DA 3NYZA 3VKJA 1DQXA 3N9SA 2OT0A 3GX9A 3G1DA 3WK0A 3BV4A 4W9TA 2G97A 4N2YA 4AWSA 3W1NA 1WAUA 2VEPA 1M5WA 2NZLA 1MZHA 5DLCA 1HTIA 4P61A 3VNDA 3MYOA 4EF9A 4UTHA 2YW4A 2DZWA 4IMFA 1Q6RA 1W5MA 1B57A 1YADA 3NPVA 3QEZA 3W7JA 3QQ1A 3EX6A 4LT9A 3RK8A 3CLMA 5D37A 2NUYA 2Z6JA 4RXGA 3O16A 5L6UA 3NL2A 1FWRA 4IMGA 3ZR4A 1JCMP 1K7FA 1R2TA 2QCDA 2Y70A 4JD4A 2QJHA 4X3ZA 4O53A 2PCQA 2WSYA 3LGEA 4UTKA 4PA8A 4X2RA 1EWDA 4MPQA 1XUZA 3OVQA 4QM1A 2YW3A 3IVSA 3I7RA 3W7CA 3S1UA 2GQ9A 3LHYA 5DBUA 3S5YA 5FEZA 4IGHA 3WK1A 1LBFA 4KKXA 3UY7A 2C19A 2Z6IA 3E49A 3PSWA 4WX2A 1VYSX 1OF6A 3C2FA 1YPIA 2WSQA 2OX1A 3EWXA 5BMWA 2R91A 2YYUA 2PE4A 3KVLA 2ZTJA 3CQ0A 4RZ4A 1GT8A 2WV8A 3LLDA 3F1QA 5CPNA 3CEUA 3W7NA 4O1BA 5D2TA 3ATYA 5KZEA 1JQXA 1XM3A 1WV2A 1XUUA 3MI6A 3NNTA 4IUOA 1ME7A 4UTTC 4BWLA 2VFHA 2CZEA 3GNDA 1SZGA 5BOOA 5GVJA 4BFAA 3A5FA 5G5IA 4UTMA 2GQ8A 2VFGA 3TA6A 1IXQA 3CWNA 3BLIA 3HBLA 3N14A 5AHMA 4QAIA 5I3FA 1G67A 3M47A 4LU0A 1HL2A 1SFJA 3ABOA 4O0KA 3DI1A 3G1HA 2ZZ3A 1P4CA 4AAJA 4NJKA 4N9BA 1FY6A 1TPEA 4UNKA 2HS8A 3L9CA 5K3VA 1UB3A 4OBTA 3ZWSA 5LNRA 1GYNA 4LUJA 4RKAA 4I7WA 5DCBA 4BI5A 1TPFA 4RXFA 3O15A 1W3NA 3EKLA 4PODA 1EUNA 4KWVA 5AHNA 3L5LA 3F03K 1J4EA 3DU0A 3HIJA 3S9YA 5EMUA 3SGUA 3DXIA 1XBXA 2RDWA 2DJLA 4Y8FA 1JCLA 3C6CA 3N19B 1EPXA 1SO6A 2H3BA 1BWKA 5F2LA 2WPBA 1MO0A 5IBXC 4JYDA 4EWND 1E51A 4FB7A 1Q6QA 4IMEA 2Q8ZA 2DZXA 2V0TA 3W7IA 3GZ3A 2W0UA 3RMJA 3RLUA 2R8WA 5DCEA 1AW2A 2WOQA 4JTTA 4N4QA 3W22A 3HGOA 4JTSA 3DKJA 1JQVA 3P62A 2QJIA 3C56A 2E1DA 3BW2A 3S1VA 3TJLA 3B05A 2NUXA 4Y96A 3IVUA 2ZYFA 3IIPA 2CLOA 1VGAA 3TSMA 1H60A 3S5NA 1T96A 1VH7A 4O28A 2VFEA 4UFIA 3BG3A 3P61A 2E6FA 4HHPA 3S5ZA 3NPWA 3TSDA 4A2SA 1F74A 2JGQA 3PC0A 3LXBA 1SO4A 2X1RA 4JIQA 5CSRA 2A21A 1CX9A 2RDTA 4UMCA 4X9SA 4FX6M 4DO4A 3PF3A 1F2JA 1H5YA 1W3TA 1MXSA 2A7RA 3M7WA 3GLCA 3W2KA 2HMCA 2ZZ4A 2X2GA 5LNSA 5IM51 3FOKA 4ZQCA 2Y7EA 1D3GA 3G0SA 2ALDA 1DVJA 2C18A 3Q94A 5D09A 1L6SA 2X16A 2ISVA 4A21A 2X1SA 4CNNA 1B4KA 3GNNA 3U6WA 3MP4A 2Y61A 1XBYA 1JRBA 2ZRWA 3W9ZA 3GB6A 3W2MA 3TQVA 1G4PA 2FB2A 1OFEA 3O05A 4AEOA 5BRBA 4A3UA 4M19A 2QCFA 4H4IA 1OK6A 3G1FA 4UTJA 4OT7A 3NGJA 3SIZA 1H62A 1QNVA 4O1DA 1I8JA 2HTMA 3W3OA 1WBHA 3HOJA 4IX0A 5K9XA 4UFJA 4AHQA 3P8JA 4K8HA 1A5CA 1M7OA 3SSJA 3G1SA 2A0NA 2B7NA 3IIVA 4NQ1A 1OABA 3EWZA 5G1TA 3KFTA 3PUEA 2GPTA 4KFNA 3MBFA 4AHOA 3GXTA 2B7QA 4Q33A 2Y63A 3FKKA 5D33A 3W6YA 4MLJA 3LV5A 3GR7A 2ATSA 1OYBA 4K38A 3TIMA 3W73A 2ZZ2A 3UWWA 1QAPA 2ZCGA 1W3IA 3WK3A 4DF0A 1G6CA 3LI1A 1LYXA 4Z1CA 1IGSA 3Q58A 3CB8A 3QF0A 1K8ZA 4MY9A 2P10A 1H7XA 2QUTA 3DKLA 1GVQA 3M5ZA 3T4CA 4LVFA 5HR7A 1WXJA 1VLIA 5EY5A 1ZENA 1YPFA 3CEPA 4GUHA 5D05A 3W72A 4TO8A 3BVJA 2A6LA 1R46A 5LKYA 1ALDA 5CZJA 2QDHA 1ZCOA 3SECA 1DORA 3G18A 2YR1A 1K7XA 3H53A 2YFOA 4HKPA 4JICA 4NJHA 4QISA 2E68A 1A50A 1MEHA 5CGQA 3R5EA 3P7YA 4JDYA 2WNZA 3NL3A 1DV7A 3QJAA 4FEZA 1O95A 1KTNA 1RD5A 3DHDA 2AAMA 5K4ZA 3WJYA 1W31A 1HFBA 3PULA 1HG3A 3G8RA 2ZA1A 4AWUA 1TCDA 4HNNA 4ZZ9A 2VC6A 1KM4A 1OX4B 4C1LA 4IX2A 4JTFA 5FF7A 1LLWA 2RH9A 3P74A 4KWWA 1QFEA 3ATZA 5CZSA 1TMHA 1LBLA 1TV8A 3T78A 3O6YX 5E93A 2YZRA 5HINA 4MZYA 2C15A 3L0NA 4LWWA 1K3UA 5C54A 5U7SA 1P0NA 1XI3A 3OHIA 3QM3A 3O6DA 4TX9A 4XTDA 1QWGA 4FNRA 4RCXA 1FWNA 2BZNA 3TJXA 4EF8A 1FCQA 1F73A 3QPYA 1FWWA 4R33A 5LSMA 3SR7A 1ME9A 2CU0A 4FIQA 4RZ6A 3CHVA 3P8IA 5AN7A 3OVPA 1WA3A 3LBMA 1LROA 3NZRA 1TPDA 2CLEA 4QITA 4M6PA 2FPVA 3UXAA 1JUKA 5D30A 5D2YA 1EWEA 2XFWA 4Y6GA 2V82A 3QC3A 1I4NA 2X1UA 3TX9A 3W7LA 5K4XA 4TMCA 3PAJA 5LNWA 3TQKA 1W8SA 3FYOA 3S42A 1UBSA 2FTPA 1TRDA 3EB2A 2Y7GA 3PBYA 2C16A 3WK2A 3TXVA 5TIMA 3ZWTA 1NVMA 3G1XA 3LTPA 1EX5A 4PCFA 3LBCA 1H61A 3IIXA 1OFQA 3P5YA 5G4WA 1SU5A 3INPA 4JTKA 2VXNA 3HG4A 4UTWA 3KVJA 1T99A 1ZJIA 1F6KA 3SW6A 4FF7A 4DEFA 3LCHA 4NNAA 4O50A 4LOCA 3N2XA 3W2UA 1GG1A 3C3NA 1VYRA 4GJ1A 3VI2A 2OZ0A 4PEKA 1WQ5A 2H8XA 4MVAA 3PSVA 2CZDA 1GPWA 5F1UA 2EHHA 4GUJA 2DJXA 5HR6A 3W86A 1J5TA 1JR1A 1SW0A 4PFMA 1GG0A 1VR6A 2ZA3A 1YXDA 1W5OA 4L4LA 1S5TA 1N7KA 4AVFA 4HN4A 4JTEA 4BK9A 4MZ8A 3RU6A 1OX5A 1H7WA 2VKZG 4UTLA 5I3GA 4M5PA 2VFFA 2E5DA 2Y7DA 3UY8A 2A5HA 3GDMA 1OJXA 5HUPA 1KBJA 5LNUA 3GK0A 2A7NA 3UWZA 1OHLA 2C6QA 3EXTA 1EUAA 1Z48A 4OE7A 4GBUA 5CPLA 2ZZ1A 4Z1DA 4NJJA 1TO3A 3ELFA 1GQNA 5KMYA 2QUUA 3NQAA 4JN6A 4NX0A 1JCJA 1MEIA 1Q3NA 4XUGA 1AMKA 3L5AA 3H54A 1YTDA 3GDTA 4IOTA 3ZFHA 2QCEA 3EX4A 2J88A 3FIGA 4MIMA 3NL5A 1UUMA 2H6RA 2C0AA 4MFDA 4DBEA 3G24A 4G1KA 2YFNA 3TV8A 5F4XA 4CQ8A 1F5ZA 3NQFA 5A5WA 1JUEA 3Q37A 1QOQA 1K03A 3NQ7A 4RK8A 3HQ1A 3BK0A 3SFKA 1W0MA 4PL1A 2V8ZA 2BLEA 1KFCA 4JEQA 4IPJA 3EWWA 2J9YA 3PUOA 5BNKA 2V2DA 3M6YA 2JKEA 3I7SA 3T44A 1K02A 4RZ5A 1DQWA 1R30A 1OFPA 1A5BA 3IEBA 1LTDA 3TMQA 2XN2A 3MHFA 1IIHA 2ATMA 2YYTA 1YDNA 1O94A 4UTIA 2BXVA 3PUDA 4HPJA 5I3JA 1LBMA 4Z1BA 3IGSA 1QMLA 1KM0A 1NAL1 3S1XA 2QUVA 5D38A 2E5BA 2GQAA 3G1VA 2GJNA 1D3HA 2QCLA 5D03A 3LLFA 1BKSA 2QCMA 3TFXA 2FLIA 3NO5A 4YWIA 5G2HA 1F76A 3USBA 4UMAA 3E12A 3W7RA 4A2RA 5LHEA 3OIXA 3W1RA 4ZQMA 3LTSA 4O18A 4MLRA 3M16A 4YL2A 1LM1A 1TB3A 1DL3A 2YX0A 3DFOA 3W2NA 4YCPA 1PE1A 5D02A 3QW3A 3EWUA 4WQ6A 4ONVA 3NR0A 4MKNA 3C52A 4JR5A 3W7DA 5EL1A 1LOSA 4Q4KA 4N6FA 3W1QA 5LNVA 3W76A 4LC6A 4JYFA 2P1FA 4MZ1A 3AO0A 1LCOA 1TPUA 3NEVA 2FDSA 5AC8A 3KRSA 1GTHA 1NFBA 1L9WA 3TXZA 3MMTA 1JULA 3NQCA 2Y7FA 4UR7A 1R47A 3HF3A 2GJLA 4HNVA 5FESA 5CKSA 1KM6A 5FF4A 3BPWA 4LY8A 3LV6A 2Z1BA 2WNQA 3B0PA 2FJKA 1GYLA 2AGKA 4LVDA 1VCGA 2J27A 4POCA 4UUIA 4O17A 5ABTA 1DJQA 1TPVA 1LRNA 4MYAA 3GR8A 4GFSA 1KTCA 3IRDA 1I2OA 2CLHA 1PS9A 4ZQNA 3W85A 2PRHA 5DELA 3TMLA 1OK4A 5DBTA 4GUIA 3STCA 3BARA 1KLZA 2Y6ZA 5HMSA 1G7UA 4O4VA 3LI0A 4Q32A 5HUOA 4XTIA 5DCDA 3BO9A 3P67A 1TTIA 3W70A 5KITA 4KFOA 5K2ZA 3KHJA 2LLEA 2NX9A 1RZMA 4IXXA 2OJPA 3MW7A 2V2HA 3NM3A 1FDZA 3SJ3A 2CLMA 3KXQA 4D2JA 2BTMA 4MOZA 1ICQA 1RV8A 1TPWA 2B4GA 3PBUA 3Q2DA 1XCFA 5KSWA 2Y62A 2JGYA 3RFAA 3KVKA 3DAQA 5SWUA 3M5YA 1XBZA 3KRUA 4MY1A 4UXDA 4MY8A 3W87A 4ADSA 5CPOA 1NF0A 2BX7A 4O4WA 3YPIA 1TJRA 4ZL1A 4BI6A 1FUYA 1SO3A 3VFLA 2WJZA 3L2IA 5AYXA 1TV7A 1K8XA 3PBVA 4M7SA 5IBXA 4R53A 1EP2A 1XDMA 2I9EA 1IXPA 3QZEA 3S1WA 3MUXA 2Q3OA 1GVOA 2TMDA 3L67A 3V1PA 1X7FA 4IQLA 5AFDA 4YMZA 3W1XA 1VPXA 3MHGA 2DZPA 3KAOA 1X1ZA 3MBDA 3TCEA 1XDLA 3V75A 5HWJA 4O8RA 2X1TA 4UC5A 1W5QA 3DZ1A 4QIUA 4U4MA 4XZ9A 5EPDA 3GXPA 2OMAA 1O5KA 2JKPA 4NZJA 2A6NA 3BLFA 4HT3A 1FXPA 2G95A 3G1AA 1WDWA 3DFQA 3NOEA 2QCGA 4UFLA 2XN0A 2C3ZA 2NV1A 4FO4A 3UXDA 4AF0B 1IIGA 3LM7A 2A4AA 2A2IA 3NA8A 3G1YA 5F1VA 1T8XA 1M7PA 4K39A 3THAA 1LOLA 4JY9A 1EA0A 2FQIA 3LHTA 4GE8A 2NUWA 4QNEA 4WXYA 4GWEA 4QSHA 1VCVA 4MUZA 3U2OA 3PBWA 1XC4A 3A5VA 2I1OA 2AQWA 1RPXA 2ZTKA 3LCXA 3G3DA 4JXCA 1A5SA 2ABBA 1F05A 4PH6A 4JYEA 1ADOA 2EGZA 1L6YA 1QR7A 5G2WA 4FNSA 3EXRA 4LS2A 4O10A 1V5XA 3DFSA 3UZJA 2VFDA 1RR2A 1W5PA 1FXQA 2Y89A 1H7PA 2CW6A 1TPH1 1WX0A 1SZNA 1FCBA 4ADUA 1PCKA 1N55A 1OG0A 2C1HA 1T0OA 1TTJA 2H90A 4R7JA 1I2RA 4JX4A 3UZ5A 1XXXA 3LHUA 2DP3A 3LCGA 2DZTA 4GUFA 3DFNA 2E77A 4JTLA 1B9BA 3ABRA 3LOTA 4CCDA 3BW3A 1LZOA 4MYXA 1TTPA 1KTBA 1RQHA 3HPXA 2FIQA 4I7UA 3P5ZA 5LGXA 1AK5A 4O15A 1TQJA 1DHPA 3JRKA 2V30A 5FI8A 5I3KA 3O06A 4LV4A 4NXKA 1OF8A 1ZALA 2KZHA 3QSRA 4OQVA 2FPYA 4S2CA 4UCGA 2O7SA 3O63A 3GVGA 1QPQA 3HB9A 4LVGA 2C13A 4IXHA 3E9AA 3NDOA 3B06A 4IWWA 3KX6A 1ZAIA 1U83A 3TROA 3KVMA 1ONRA 1M6JA 1K8YA 3S0CA 2WNNA 3M9YA 3N9RA 2VEIA 8TIMA 1V7YA 2NV2A 3MI3A 2F84A 1VRDA 3UQNA 2DU2A 4RJEA 4Z1AA 4LRSA 3O6CA 3CTLA 3NZ1A 3G22A 2TPSA 1TRIA 2W6RA 4IJBA 3C4UA 3EX2A 4KFPA 2EAWA 1KBIA 5AHEA 2ZZ7A 1KA9F 1RQBA 3B0UX 2J9ZA 1ICSA 1EEPA 1GVSA 2ZDRA 3D0CA 4L4MA 4WY0A 4RLIA 4O1AA 3S6DA 4E0CA 4CQAA 1FDYA 1TREA 4JNMA 5AYZA 3PG9A 1UASA 3L68A 3CU2A 5C2XA 2YSWA 2DORA 4X22A 3STEA 1KM1A 3E0IA 5HWNA 4FIRA 1PIIA 4RX0A 1TTQA 4EVZA 3P60A 3QYQA 3S5OA 3CT7A 2YXGA 1VHNA 2ZBTA 3LTYA 4QQ3A 3LHWA 3BGGA 3LCLA 2V5BA 4CLMA 2HS6A 1LP6A 3WFAA 3R13A 1SQ7A 2QCHA 3TKFA 1EIXA 1EB3A 4JX6A 3U8GA 1AL7A 3DFTA 5FF3A 4O12A 3TC6A 2R94A 3N73A 3UWQA 4ML9A 4JTIA 3UPBA 3EWBX 4ZMGA 4Z0JA 3GDLA 4O0ZA 5G1YA 4S2BA 4JTUA 4UR8A 5AB3A 3PWAA 1S5VA 2G96A 3SI9A 5KTLA 1BEUA 1ICPA 1S5WA 1OFRA 4RV8A 3GIYA 5I3IA 3TNOA 2DZUA 1LLZA 4WOQA 3HGSA 2Q8LA 1ME8A 3BW4A 1BTMA 5KINA 3LHZA 3EEGA 2QCDB 3PG8A 3N3MA 3AJXA 3B04A 3ABQA 1THFD 2VOMA 4LUIA 1UUOA 3SGZA 4BF9A 4XBSA 3R8RA 1Z44A 1PV8A 3I68A 3PR2A 4O16A 2B7OA 4K8EA 2RFGA 4DO6A 3W2LA 5DY3A 1HUVA 3FJ6A 3LX9A 4JS3A 4N9EA 1VYPX 1GJPA 2ZRZA 4FXRA 3UYCA 3NG3A 3T40A 1OYCA 1SFLA 4XBKA 4DQWA 4E2BA 3SZ8A 2NWRA 3FKRA 2ZRUA 1QO5A 4E2DA 3TAKA 2E6YA 3W23A 1RVGA 2GVGA 4WXZA 4S1FA 1G7VA 3MO7A 1L2UA 5AC7A 3A22A 3O07A 1GWJA 2I14A 3OEXA 3VE9A 3TFCA 1KV8A 1YYAA 1SZEA 7TIMA 4JGDA 2QF7A 1W37A 2VENA 3FYPA 1AG1O 1X6UA 3C0JA 4NT0A 4HPXA 3FJLA 2RDUA 3PB2A 2CZ5A 1N8FA 3WJZA 2QEZA 3IIZA 4K6AA 2V81A 4EOUA 3IIOA 2TRSA 3P84A 2CLLA 4O1CA 1VJIA 4LC8A 4DPPA 1FWSA 2QAFA 1W54A 1PHQA 4FXSA 4DXVA 4ORIA 1GTEA 1EP3A 3QW4B 1VZWA 3C2OA 4O11A 4J9JA 1VHCA 1KFKA 3TU9A 2F7FA 4OGZA 2J9XA 4UMBA 3WJWA 2O7QA 3PVFA 4PC8A 3EX1A 5C55A 4BI7A 3GKFA 4UTWC 1KLYA 3TC7A 1H1YA 4FNPA 1FCVA 1W5NA 2QJGA 3CIWA 2QCNA 1K7EA 4ZQRA 2Y88A 3DGRA 5I3HA 4JTHA 3RNDA 2E6AA 3OBKA 3W84A 1GOXA 3N34A 2EPHA 4JDBA 1TJPA 3NQ2A 3P80A 3QPZA 3MP3A 5F4WA 1KM3A 1SSDA 2CLIA 4K7VA 5FEWA 1SW7A 3UWVA 4OV4A 4U28A 1JCXA 3C8FA 3W88A 3DFPA 1G4SA 3MI2A 2P0OA 4NUWA 1B4EA 1IXOA 4I7VA 2B0MA 2IQTA 3W7OA 4IMDA 3CWOX 3CIXA 1YTEA 3NQ6A 4LS0A 1JCYA 3W71A 4AWTA 4HSOA 3IGXA 2A7PA 1YXCA 5EA9A 3W1PA 1ZHAA 4HSNA 3W7KA 2V5LA 1ZFJA 1H51A 4TU1A 3C2EA 4XWUA 5D2XA 4ZVJA 1JJKA 3QQ0A 1S3HA 1KM5A 3F4WA 2ISWA 5T26A 2A85A 3W1TA 3G3MA 1YXYA 1TPB1 2YPIA 4TR9A 4OWGA 4I9AA 3T7VA 1P1XA 3OVRA 3L66A 1SUXA 3H55A 3KOFA 1GZGA 3TAOA 4AB4A 4AF0A 2JBMA 2PC4A 5TBOA 4N9DA 4O57A 3NPUA 4WJEA 5KZDA 2D73A 2GVJA 1YDVA 5C5YA 5BMXA 3L5MA 3NL6A 5MHBA 4ADTA 4A22A 1WYIA 5AHFA 3NM1A 3NXFA 3W7QA 1I45A 3STFA 2G5WA 1WBJA 2WSRA 4UIOA 3IGUA 1QPRA 3WJSA 2ABAA 5EKYA 2JKAA 3THQA 1OFAA 4LRTA 4MJZA 2GOUA 1TQXA 4IMCA 4P2VA 4BR1A 1XKYA 5AYYA 3GXNA 4YCOA 2WQPA 1DJNA 3LCFA 5L9FA 3HG5A 3MP5A 2ZZ6A 5AC6A 4GUGA 2OT1A 1H7NA 5E1QA 1R2RA 3LXAA 5F2IA 2FB3A 1QCWA 3QFEA 2J6XA 3G8EA 4O54A 3MWAA 2WO5A 3A9IA 5HJLA 3BG5A 5CZTA 3G0UA 2FFCA 1O4UA 4XQ6A 5D32A 3HGJA 4H3DA 5FEPA 6ALDA 2EKCA 1KM2A 3W1MA 3R12A 1NSJA 2NX1A 3NVTA 1OYAA 2Z2UA 3SY5A 4YXGA 4R34A 2H3DA 4UFKA 5DXYA 4NNCA 3L21A 4NX5A 3W7EA 2DZSA 1DKWA 4JY8A 1KV5A 3KRZA 2ZZ5A 4WY0B 3UPWA 1IXNA 3ANYA 2VEKA 3NQEA 3MJYA 2BSLA 1FBAA 1QOPA 3A24A 1F6PA 3N2MA 1I2QA 5LHFA 5EYWA 1H50A 4GRSA 2H8ZA 3W83A 1I2NA 1HO4A 3GAYA 4JTGA 5TQLA 1VS1A 2ZRVA 3MHUA 4NXSA 1NF7A 3F4NA 1SSGA 3QMTA 3HPSA 3W1UA 1R2SA 1PVNA 2NX3A 2CZFA 1Q45A 2J24A 5G2IA 3L0KA 1OVDA 4WUIA 1IF2A 2TYSA 4PTNA 4DF1A 1YDOA 3ZS4A 4GXMA 1ML1A 5H2ZA 3UD6A 2V2CA 4MFEA 3TH6A 3WJXA 3TUUA 5HWMA 3IV3A 4NNBA 2CFFA 1LOQA 2Q3RA 3L65A 4UFHA 3HPZA 1U5JA 3LCWA 3QH2A 1ZY9A 1W1ZA 2RKXA 1TIMA 3FEMA 3I6RA 1VCFA 3LERA 3LRLA 5C6MA 2BWGA 3DHFA 1BWLA 3NQGA 3R2GA 4RR4A 4LVBA 1QPNA 4HNTA 3TW6A 3NQ8A 3UWYA 1H63A 5BW6A 4K7YA 3HG2A 5EBUA 5KZMA 4O14A 1CW2A 3JS3A 1VLWA 1PCWA 5D2VA 3TQ0A 4WZHA 1P5BA 3W75A 3I7QA 1G4TA 4EIVA 3NAVA 4O19A 3HG3A 1OX6A 3C61A 1AW1A 5CG7A 3A21A 1JCNA 2RHGA 1LRQA 3L0GA 3TW7A 1XBVA 3BLEA 3LXCA 1VQTA 1SPQA 3CC1A 3HGRA 3EKZA 4BWLC 1DBTA 1O5XA 4LS1A 5F2MA 1JUBA 3HO8A 1FWTA 2OCZA 3CPRA 5DXXA 2WKJA 4HNUA 4O52A 2NXIA 4NZFA 5FF0A 4NJGA 5J5RA 3QRHA 3GKAA 3OA3A 1SW3A 4PL2A 2ZRYA 3ABSA 3R89A 1YLVA 5HQEA 1YTKA 4HIBA 1LRTA 2XN1A 4M7TA 3MYPA 4XKYB 5H91A 4NJIA 1Y0EA 2YDAA 4GNJA 4JX5A 4DPQA 3LB0A 1G69A 4FNQA 3DENA 1B3OA 4LTSA 4DO5A 3W7PA 1KFJA 3M5VA 2NWSA 3W1LA 5A8GA 4ZQOA 1QDSA 4E38A 4N9CA 4Z0SA 3B0VC 1I2PA 1DOSA 1XL9A 1TSIA 1ZAJA 1H1ZA 2B7PA 2PRLA
chains in the Genus database with same CATH superfamily
3TSBA 3EWYA 4L6DA 4H2CA 3MZ2A 4BJHA 3E96A 3M1ZA 3QSTA 1F7BA 5AOUA 2E6DA 3N17A 4DNHA 1GCYA 3L4ZA 2BGNE 5J04A 3MS8A 2DGAA 5CPQA 2X05A 1EIBA 4ENLA 3BG9A 4F2UA 4QNWA 1C29A 1XFBA 4GC4A 1X8CA 3P2VA 1FCUA 1M03A 1DJIA 3TWAA 1C9DA 1QO2A 2DV0A 3NQVA 3TZFA 5CLWA 4Z2GA 5B7YA 2WMHA 4QTGA 4GXPA 3MDUA 1Q6LA 2XSBA 4GGHA 3P81A 1LUCA 1J0HA 3JZEA 3SDOA 1W2PA 1EQCA 4D72A 4LANA 1V3JA 4AVNA 3D6NA 1CLVA 3OG3A 4IL2A 5JIPA 2VZOA 2YB4A 2D1ZA 5K7JA 4OBRA 4UTTA 1OT2A 4RPPA 1GVFA 1ZL1A 4N02A 2J47A 4PMVA 3LDVA 3EX3A 2QNEA 1HKVA 2X30A 3KOYA 2PURA 4CCEA 3I3EA 1TIWA 4M6UA 3PY2A 1Q6FA 2XFYA 2NLIA 3ICJA 1FP8A 4YYCA 3IJ6A 2VZVA 1KFEA 1HP4A 5FF2A 3N4AA 3U7BA 4XV0A 4GY0A 5AHLA 4F8XA 1Y65A 3GDRA 3K4WA 3W07A 2QCCA 3HJZA 4GVFA 2YGYA 2GYIA 3NQMA 4C1KA 4PMXA 5CZ0A 4S3CA 1VAHA 4BA0A 1ZP3A 3MC5A 4LAMA 3LN3A 3IVTA 5LYRA 4CEXC 1ADSA 2V9DA 3W2JA 1PX3A 1WZAA 3BC9A 4HHLA 1E0TA 3DBPA 1EJTC 3AIWA 2QDGA 1QI2A 3CMJA 1I0BA 1T7LA 3DECA 1Z7AA 2E09A 1KC7A 2V3EA 4HU3A 3AIQA 4LF1A 3VD9A 4MJMA 4ORMA 4N6EA 4PRTA 4HMEA 4YTTA 1UD5A 2PB1A 2QW5A 4Y90A 1SR9A 2Z0IA 1VBJA 2A3CA 4RDWA 1V6TA 4DJFC 5EU9A 1RPKA 2R1MA 2ZRXA 3PPCA 4QEHA 4GO9A 4OV9A 4K36A 4RE3A 2V5CA 4HNCA 2VMFA 2X0YA 1UD3A 2QKFA 4WHBA 4XBJA 3TLQA 3Q65A 4DJFA 4DY1A 5K9DA 3R8GA 3WUGA 3H7VA 3IRSA 3N9SA 4JFUA 4A35A 3VD7A 4Z17A 4V33A 3UR7A 1HXJA 2YXOA 2G97A 1B5TA 2BY2A 4AWSA 3W1NA 5DX7A 4U3CA 1M5WA 4LBRA 4EACA 4IIGA 3WUBA 4A8IA 2EPLX 2Z26A 3VNDA 1R6WA 3MYOA 4EF9A 2YW4A 4J2PA 2YB1A 1Q6RA 1B57A 4J4KA 4MDOA 4NI8A 1MYRA 2ZUWA 4LT9A 3XISA 3CLMA 5D37A 2NUYA 1CEOA 2PSNA 3NL2A 4IMGA 1PZ1A 4GBDA 1GJWA 4X3ZA 1BHGA 3SCTA 1DJZA 4RE4A 2PCQA 1Q2SA 4XZWA 3LGEA 2O9PA 2PLKA 3KZPA 4ATLA 3IVSA 2B81A 4HNLA 3BANA 2AL1A 3U3HA 4EE9A 3WO8A 1OF6A 2OWWA 3HJEA 5BCAA 1K1DA 1L8PA 1XYFA 3KVLA 3M0IA 4D8ZA 2DSUA 2WAGA 4OUEA 2CPUA 3VZZA 3T0TA 2WV8A 4DX3A 1OBAA 3BDKA 3WSUA 3W7NA 1N8IA 4L6OA 4EKJA 5KZEA 5D4YA 5GJMA 4IUOA 1XM3A 1XQLA 1SZGA 2GLKA 2X7VA 5G5IA 1B3WA 3LPGA 3CWNA 3GVVA 3HBLA 4GIEA 5AHMA 5CPSA 5IFPA 4BZYA 3DHPA 1RBAA 4O0KA 2D3NA 4Q4QA 4GO8A 2HJPA 4N9BA 3GSMA 3L2MA 2Y8VA 2HS8A 2IXVA 2J77A 1UB3A 5HXMA 4LAUA 3UU0A 2YJQA 4PODA 3EAUA 3F03K 5TNVA 5BXSA 3BE7A 1NJJA 1TE1A 1WNOA 5JUVA 2DJLA 2YBTA 1U30A 3BOXA 1SO6A 2H3BA 3CB3A 2DQWA 2FTYA 4JYDA 4EWND 1AUSL 3WBEA 1J0JA 3WDRA 4PUEA 3W7IA 3VIPA 4WLCA 3RMJA 3RLUA 5DCEA 3RO6A 1HKWA 3UG5A 4JTSA 2YA2A 4K1WA 4ZGYA 2QJIA 3S1VA 4ZOEA 1J0ZA 4Y96A 1Q13A 3UERA 1VGAA 3OZYA 3B9EA 1A49A 1T96A 4MWAE 4UFIA 3BG3A 1ECQA 2E6FA 3PC0A 1SO4A 4FX6M 4UCFA 1H5YA 1LLOA 1W3TA 4FP1A 3M7WA 1WAWA 1K6AA 3UGVA 1OWQA 2CC0A 4HYRA 3W2KA 2X2GA 5IM51 1D2KA 1S2AA 1E6NA 3UR2A 1IGWA 2C18A 1DVJA 1H1NA 2WHLA 3CAWA 3ZM8A 1L6SA 2JE8A 4M8UA 4PTMA 2X16A 2ZKMX 1QT1A 1CWYA 1IZJA 3SADA 4OTKA 3ZSTA 3TQVA 3O05A 4A05A 4AEOA 4A3UA 3UJEA 2X0SA 4M19A 1XKJA 4H4IA 2OG9A 4CGTA 4EXQA 4UTJA 3NGJA 3VDBA 1B3VA 1I8JA 5H8PA 2WW5A 4CKQA 1JAKA 3WF1A 1XIBA 4KEZA 5K9XA 3P8JA 2VGGA 3R25A 4K8HA 1A5CA 5IDIA 3H12A 4K3ZA 3SSJA 3G1SA 4GH1A 3AIUA 1OABA 3PPGA 3ZLHA 4PRWA 4K1GA 2CYGA 1KXTA 4X2PA 2B7QA 4FR1A 1A3XA 2VX7A 2Y63A 3FKKA 4BQ2A 1GZ1A 4WDWA 2DDXA 5BZAA 4MAZA 1XLLA 2ATSA 3IK4A 4I3GA 4NRRA 3H2MA 3R6IA 4XZNX 3WUFA 1TWSA 1PO9A 1XYLA 3CB8A 1Q7MA 4LVFA 2ZUNA 2BG5A 4NZ1A 1VRXA 1B1YA 4GYFA 4TO8A 5LKYA 5CZJA 1IR1A 1MW2A 4GGBA 4ZSTA 3G18A 1XLEA 4HKPA 4JICA 4IUGA 3RO8A 5I07A 1MEHA 5CGQA 3P7YA 1LG1A 3S5SA 2V3DA 1V6UA 3STPA 4GYPC 1HJWA 3K4DA 3DHDA 2AAMA 5K4ZA 2H9AA 2FZMA 2ZXAA 2BVDA 3QYSA 1XG3A 2DZBA 2EJ1A 1QFEA 4ZO8A 3URAA 2X40A 3ATZA 5XIAA 2DH3A 2PDWA 3O6YX 2YZRA 2W4XA 3L0NA 3PHAA 1P0NA 3BQ5A 1J0KA 2Y24A 4FNRA 1QW9A 3T07A 3QPYA 4R33A 3VA8A 5LSMA 1JZ2A 3QY8A 2CU0A 1Q8AA 4RZ6A 4R3UA 4XAFA 1V3KA 5CC5A 3CHVA 2DSVA 3NZGA 4WVXA 4MGGA 4IFKB 3NZRA 3PZNA 1YX1A 5D2YA 3SCNA 3VMPA 4CQBA 3G2GA 2J4GA 3QC3A 4KRZA 4UQDA 1FH7A 1Q6CA 3PAJA 3S42A 4HVXA 2QULA 1JYVA 5ECUA 2AAAA 1XISA 1TRDA 3EB2A 2Y7GA 5C9XA 1TV2A 3WK2A 2DT1A 3N13A 5IDZA 3BURA 2YA1A 3B40A 5BYWA 2BOFX 3PZUA 1W8GA 4D8LA 1BXBA 1SU5A 3INPA 4JTKA 2VXNA 4PMOA 3VD5A 5IRPA 4MB5A 3KVJA 4MHBA 4DJDA 1IZCA 4FF7A 3VGDA 1DIDA 2IPFA 3LCHA 3AICA 2VT0A 4O50A 4IMAA 1EGMA 1X6LA 5EFDA 3RCNA 3K1GA 1UZ4A 3M0MA 3FXGA 2OZ0A 2I56A 1WQ5A 1P48A 3PSVA 2XSAA 5F1UA 2EHHA 2DJXA 3W86A 4PFMA 1GG0A 1SGJA 1HZYA 1HIZA 4HGXA 4L4LA 1EH9A 2POZA 4JTEA 1Z69A 5MF5A 1EDQA 3U9IA 4KRTA 4QCFA 1UWUA 4HBKA 4M5PA 4MWAD 1LT7A 2E5DA 3UY8A 3VUSA 2PGRA 5T8GA 3GDMA 1ZUAX 1HVQA 4A3HA 5A94A 1DXIA 1D8WA 1VFUA 2C6QA 2OQLA 3RITA 2WXDM 4GBUA 5CPLA 2EG7A 2EPNA 2VD8A 1TO3A 1UMYA 3VNMA 2QUUA 3WDJA 4NX0A 1Q3NA 4GIRA 5DRCA 5C2CA 3UEQA 1YTDA 3ZFHA 1HW6A 1PZ2A 1FKWA 1CXEA 1OT1A 4L9ZA 4MFDA 5D9NA 1QBAA 2D22A 4CQ8A 3KS6A 1TWZA 5CSYA 5A5WA 1WPCA 2OSYA 1FWCC 3HQ1A 1M3UA 2OOFA 4NYYA 3SFKA 1CGUA 1W0MA 2OPJA 2V8ZA 2C91A 2IPGA 5LXXA 3L23A 1JPIA 3SRDA 2PODA 2Z1WA 3ABZA 1BYCA 3T44A 5E9AA 4FPSA 1DQWA 1OFPA 3UNTA 3RYSA 1A5BA 4OJYA 2XN2A 3TN3A 3MHFA 1YDNA 1O94A 1W9DM 3PUDA 3LU2A 3EPOA 5I3JA 3IGSA 4IZGA 3RHGA 4CEUC 1IT8A 3F5JA 3S1XA 1CCWB 1Z8AA 2QUVA 3DOPA 2GJNA 4GMEA 1AMYA 1UWSA 2O56A 4G56A 1DHKA 3WLKX 2ZUSA 3NO5A 1F76A 1JZ6A 3WG6A 3II1A 3E12A 4NAFB 4ZQMA 4PB4A 2XG9A 3TYAA 3VC6A 1V51A 4YL2A 2YX0A 4NP7A 5D02A 4B92A 2CBVA 4QBXA 4WQ6A 4XVEA 3A9BA 1LOSA 5EMJA 2FVMA 3W76A 4CVWA 1UWTA 3AO0A 1P0EA 1XIMA 4IF2A 3DYPA 2Y7FA 2V69A 5HNNA 4GABA 2DUAA 1QVBA 2E7FA 3WFLA 2FZBA 1P0DA 3U0HA 3B0PA 1OG6A 4HOXA 4UZSA 2X7WA 4O17A 1TPVA 3VPLA 5JQ9A 4LY4A 2E28A 1XYCA 2FYMA 2R6OA 4XD6A 4ZQNA 2PRHA 1MW3A 2OZ3A 4GUIA 2XVPA 1RJQA 3BARA 4X60A 1C8XA 4O4VA 4X63A 4ECLA 5HUOA 5DCDA 3RDKA 1TTIA 3W70A 1XCWA 1B9ZA 2FZ8A 3SIMA 3A64A 5K2ZA 2JF6A 3WIJA 1SJAA 1R0MA 3QTPA 3E2QA 3SJ3A 2CLMA 2BTMA 3URNA 1ICQA 1XLKA 3PBUA 1EPVA 4JCLA 1JF6A 4HP5A 1XCFA 3HQPA 2V5JA 3WQVA 3OLGA 1WDPA 4QLLA 1JIBA 1XD1A 3QR0A 2GSEA 2V38A 4MY1A 3GXMA 5CPOA 1G9HA 3YPIA 4BF5A 3WNKA 3N6QA 2IKJA 1SO3A 4EK7A 3VFLA 1VD6A 2NW0A 1R87A 1TV7A 2YBVA 1K8XA 1KNWA 4ACZB 3BAWA 4R53A 3KL0A 4K8GA 4WEVX 3OZMA 3QZEA 3AMKA 1PKMA 3MUXA 5IHRA 3L67A 3V1PA 3W1XA 1BPLB 2DZPA 3MV11 4O8RA 4GYPA 5EMMA 1JPDX 1X38A 1F6YA 3VMNA 1W5QA 3WLTA 3RAOA 1O5KA 3KTSA 1VPQA 6XIMA 4XO7A 1OC5A 4G6CA 4H00A 4OECA 3IUDA 1TMQA 2QCGA 5DFAA 2C3ZA 3UXDA 4K39A 2DSKA 4B9ZA 4D6GA 3F4CA 2ONEA 1J10A 4J40A 4C6EA 1OZQA 1V08A 4Q4RA 4WXYA 4J7RA 1VCVA 4MUZA 3SRKA 1S39A 2AQWA 1QUMA 4EPBC 1E6RA 1DE5A 1KBLA 1A5SA 1E72M 2G3NA 3BUVA 4JYEA 5CC7A 2XDFA 3EXRA 4L5ZA 1UWIA 1JNDA 1AZ2A 2Y0FA 3HM7A 3FDGA 3UZJA 3MKKA 1RR2A 2PPGA 3QOMA 2P3EA 4DUWA 2CCRA 3GU9A 1TCMA 2NT0A 4MB4A 4HK5A 1MDLA 5A1AA 1N55A 2BMBA 2EPKX 4Y8EA 3IJ9A 2GQ3A 1EFZA 1TTJA 3TA9A 2PC8A 3BOLA 6TAAA 1I2RA 2W5FA 3Q67A 4JX4A 4KT2A 3ZT6A 4Y2WA 3PJTA 5FJUA 2DZTA 5FA5A 1ZJBA 3ITYA 3DFNA 4JTLA 3W28A 1U33A 3LOTA 5A8NA 4MYXA 4F0SA 2PDPA 4C90A 1AK5A 4R5EA 2BHUA 1TQJA 3WLNA 5I3KA 5FI8A 4UNIA 1OF8A 3NJ3A 2ICSA 2J7BA 5B7ZA 4S2CA 1MW1A 3S2JA 4UCGA 3O63A 2WJFA 5JIWA 3RRAA 2GJXA 3HB9A 2C13A 4IXHA 3GC4A 2UBPC 3FSTA 3B0XA 2VR5A 1K8YA 3N9RA 3UGRA 1KQYA 4HJWA 3MI3A 3OODA 1CT5A 1D8CA 2DU2A 4AXNA 3N3TA 4Z1AA 2J13A 5HJYA 4LRSA 3SCVA 3BSGA 2TPSA 1EO7A 3UWEA 3H7RA 1ISWA 3EX2A 4P7RA 2WWCA 3PTKA 4RDVA 2VC9A 4JHOA 1KBIA 4W84A 4E8GA 1QI0A 2OELA 1XYAA 1H11A 1V0MA 1Y5XA 2WMJA 1V6WA 3D0CA 4EPKA 4AUBA 2ZC1A 4WY0A 1TZZA 2VQTA 4PTDA 2JIEA 4HMNA 3BJSA 5FCZA 4O1AA 3BMWA 2PU1A 1NP2A 3CU2A 3M4HA 3DERA 3FVDA 2VR4A 1UYQA 1KM1A 4FIRA 1PIIA 3HURA 1BF6A 1U1HA 2CZVA 4QQ3A 4O8AA 3H8AA 3UJSA 3IAPA 5IXEA 4P5UA 1S2TA 4JIHA 4DZAA 4TUFA 3WD2A 3WQ6A 1EB3A 5HMFA 4UB9A 1OY0A 4B9YA 3W38A 4ZMGA 4Z0JA 3WF4A 3GDLA 2I17A 5G1YA 3HTWA 4HQVA 1PXGA 3T0DA 3GIYA 2P8BA 5I3IA 3TNOA 2IPWA 3FN9A 3WH9A 2A3BA 3HGSA 2NVAA 5KINA 3G6LA 1AJ0A 3N2TA 2QCDB 1GNXA 1SVDA 3GHTA 1JYXA 2C79A 4XBSA 3LG3A 4JBRA 2UZ9A 1JD7A 1PV8A 3I68A 3PR2A 1KBKA 2J7EA 5FL1A 4D6FA 2WZEA 5DY3A 3VZYA 1HUVA 3W6LA 2XM2A 3FJ6A 4N9EA 1W1PA 1GJPA 3BLPX 1E0UA 3KLLA 3UYCA 3ME3A 4NZ5A 3NG3A 3T40A 2QPSA 4WSJA 1SFLA 1US2A 4UWMA 2NWRA 1QO5A 4YTQA 2R1PA 3GW3A 4E2DA 1EHNA 4S3DA 3W23A 1RVGA 4Z42C 4S1FA 1PTGA 3MO7A 5AC7A 2PDFA 1UZ1A 3WYZA 4IG2B 2PDNA 3QOKA 2VENA 3TN4A 4S3AA 2DFAA 4K6AA 3CHDA 5GNXA 3ZSSA 4GH3A 1XS2A 2GFTA 4HJFA 1FFRA 4ORIA 1U22A 3M46A 4C1NA 1VHCA 3OQ8A 4H6QA 3WJWA 2O7QA 4GXWA 5FJOA 3DFYA 4LUSA 1OSEA 2W66A 2D2JA 1ITCA 7ENLA 2PDHA 4TTGA 2QCNA 1XX1A 1VIWA 2Y8KA 4H9UA 2E6AA 4FI4A 3W84A 1GOXA 4JDBA 3N34A 3NQ2A 3QPZA 3RIKA 3L4VA 1BYDA 4BQ5A 1DEDA 1Q66A 1JAEA 4OV4A 4U28A 1GOQA 3AYRA 3NSMA 4MNLA 3PFMA 2P0OA 3MCMA 4KETA 5A6LA 5E9XA 3K2GA 3CIXA 4JCMA 3I4KA 1PEZA 1OCBA 4AWTA 2A7PA 2FGZA 3PTDA 3W1PA 1QBBA 5FJIA 1B90A 1ZFJA 4W85A 4TU1A 3C0QA 4RUBA 1B3ZA 1BXNA 4ZVJA 5CZKA 4A3RA 1S3HA 2P76A 3F4WA 4QDMA 5T9BG 3KDNA 5T26A 2A85A 3HFYA 1OGGA 5EB8A 4OWGA 2DH2A 4I9AA 3GXIA 1JZ4A 2FVLA 1SUXA 3DGBA 3EOOA 3H55A 3KOFA 3OGVA 1IEXA 2DT2A 1BGGA 4O57A 3OIHA 5KZDA 4IIFA 4AZ6A 2JF7A 1R3TA 4PBFA 4PUDA 3PZOA 3T42A 1YDVA 3NL6A 2BHYA 3I3DA 3NM1A 3V5OA 3FHQA 3NXFA 4ZE5A 1I45A 4KS0A 1P43A 1DIOA 4LCSA 1DIEA 2WSRA 1UA3A 2VR2A 3SCUA 3AXMA 4Q3MA 4C7GA 3M0HA 4CN1A 3WJSA 4F40A 1AJZA 4LYPA 3IJIA 1C91A 2XVNA 4GI4A 2GOUA 4IMCA 5AYYA 1EQPA 2XYLA 3TONA 4IT1A 3H24A 1DJNA 3HG5A 4R7OA 4HNOA 2VEFA 3FGCA 5AC6A 3CASA 2RGMA 4H83A 1AH0A 1PAMA 4PULA 3G8EA 1XYZA 3VILA 4D6JA 3UBPC 5HJLA 4LUTB 5G4HC 3V16A 3PZMA 4H3DA 1M41A 2WPGA 2EKCA 3W1MA 3TNBA 1YMYA 1W9XA 1JI1A 4RE0A 3G77A 1NSJA 1U1UA 4PN2A 4C6CA 1BVNP 1ZBWA 3SY5A 3MCNA 1TVPA 2H3DA 3C8NA 5DXYA 3N4EA 1TWWA 1RAKA 2DZSA 3BJFA 4H1ZA 4DI8A 3ITXA 1IXNA 3KZSA 2D2OA 3NQEA 1QOPA 3A24A 3EMQA 3S2CA 2WHKA 4N42A 5EYWA 3ZT7A 3VZXA 3FA3A 1POKA 1E1EA 5A95A 3LSBA 4JTGA 4PBEA 1ZGDA 3MHUA 3BQ6A 4HPGA 3W1UA 4X61A 3M64A 1FWJC 3VOHA 2O9OA 1IF2A 3VYLA 5H2ZA 1JPHA 4KPLA 3J7HA 5DT5A 1M7XA 1XP3A 4MFEA 2HRWA 1UR9A 5AY7A 4US6A 3UETA 4DXXA 1VEPA 4YYFA 4UFHA 1DTUA 3LCWA 1ZY9A 1W1ZA 3I6RA 5C6MA 1UD6A 3JUGA 2QPUA 4PUJA 2IKGA 3R2GA 4YHEA 1TA3B 2YL8A 4M24A 5BW6A 1M9HA 3PNZA 4H8VA 1F3XA 4JEJA 1VLWA 3VGHA 3C2YA 1P5BA 3I7QA 1G4TA 4TVDA 4O19A 1OX6A 3C61A 9RUBA 2XH2A 1WKEA 5CG7A 1Q7ZA 1RP9A 1LRQA 2W3ZA 1FWFC 3WNOA 5FAGA 3LXCA 1FHVA 1REQA 5KZ6A 1CLXA 3WL0A 1O5XA 4L1WA 1ZSXA 1LQ0A 5F2MA 1XIJA 1YHTA 2ZADA 2FMNA 4A6GA 3HO8A 3CPRA 2Z1XA 4ZSUA 3IS4A 4O52A 2NXIA 3WNMA 4L6HA 5EMKA 5J5RA 1RUSA 4MG4A 1LUCB 1R7OA 3AHZA 1ZRQA 1GUVA 4DJEA 3ABSA 3R89A 5BXRA 1YTKA 1IQ8A 1ZS2A 3MYPA 4C6KA 1JPKA 3T08A 1UOKA 4Q8OA 4Q8PA 3ITTA 2OWCA 3UYIA 2YDAA 2VCAA 3CL6A 5BOEA 4PCPA 3W1LA 5A8GA 2J8TA 1E9YB 1I2PA 2VURA 4CVUA 2GGIA 3SRHA 1DXEA 4ACYA 1TSIA 4PCSA 3WLJA 4X0NA 3CUZA 2P8CA 2TAAA 4H9ZA 1NTHA 1PHWA 3FFSA 4M6VA 4FX8A 5F4SA 3P82A 4ICMA 2NSXA 4C6JA 3M43A 1J0YA 1E0WA 3RG6A 1EGZA 4J5NA 5FSEC 1O60A 4HPHA 4CQ9A 5D04C 3S8HA 1VC4A 1GEQA 3GYEA 1GVRA 2OXNA 3ALFA 3DX5A 3FHAA 3M0ZA 3C2RA 3R0KA 5GNZA 1LWJA 2QMKA 3LNPA 4W87A 3HMCA 1JRCA 1I75A 2W79A 3WLOA 1QI5A 5CQ1A 4FNTA 1KFLA 4QFUA 3S2NA 4AMAA 3UNDA 3O8AA 1X6NA 2HVNA 4JIPA 3VOFA 4TIMA 1DWGM 4D6IA 1UWQA 2F6UA 1L6WA 3B8SA 3ZR5A 1FX6A 2BGQA 2PFHA 3KBNA 3CBWA 2VRJA 3FCPA 5M5DA 4WD0A 1CZ1A 1H7RA 1SZFA 3VCRA 4QS6A 1GQKA 5HBFA 2E4TA 4NAEB 3JR2A 2Y85A 2QR6A 1W1TA 4EXBA 4KCTA 5HULA 1A5OC 1TYGA 1VEOA 2BY0A 1J12A 3U2CA 5T9CE 3OW1A 1A4MA 1NWRA 2TSYA 1P7TA 4IPIA 1TV5A 3GH4A 4UFMA 2ACRA 4PUNA 3EPNA 1A5AA 3KDOA 1TV4A 4JTJA 3GAKA 4I9MA 5U4NA 5C2GA 4LVAA 3M44A 2I57A 3BZJA 2ZC8A 3DH7A 1WP6A 4J3SA 4E3TA 3O1NA 4W5ZA 1P0KA 4FF5A 1RA0A 5F2GA 1POJA 1MI3A 1FWIC 1W6TA 2F6KA 4A4AA 3TK7A 1YW1A 1LL6A 1AW5A 4FZIA 3GM8A 5CPMA 4NU7A 4NAEA 3EEZA 1C8VA 3V5FA 3PM6A 3CAQA 1WOAA 1KFBA 3VD4A 3ZLFA 3GZAA 3TYUA 1Q6EA 2D20A 5BROA 4DELA 5K9CA 3V0UA 4LB4A 1ZP4A 1V03A 2A79A 3BGJA 2OTDA 4QDPA 1HVXA 4NI3A 1IE7C 1CLKA 3ZO9A 3ZVHA 1OFBA 3CPUA 3QVQA 4Y9AA 4DAFA 3RLVA 3H70A 3GFYA 4UTUA 4QJ3B 3CH0A 5F7UA 4W88A 1XC6A 2QZRA 3WBXA 3LRMA 3NUKA 4LFYA 3SUUA 1BF2A 3KLKA 5LA0A 4P7LA 1EP1A 1H49A 2VL4A 5A2CA 1OX4A 3W7GA 4IQJA 1TPC1 4M6QA 2O55A 5DY2A 4UQBA 3BJTA 2HPIA 4RDYA 2OKTA 3G0XA 1OCJA 1UMLA 5I06A 3ZJKA 4HOZA 1UCWA 3N6JA 3NYZA 1PDYA 2OEJA 2OT0A 4ZO6A 3U2ZA 3G1DA 4W9TA 3HV8A 4DWDA 3S47A 4CU6A 1CGYA 4R88A 3WD0A 3WH6A 1BSLA 1I1WA 4J35A 1XLGA 3APYA 1HTIA 3GW0A 4P61A 1EKOA 4ZO9A 4IMFA 2NQ9A 3QEZA 1BG4A 3ABXA 2WC3A 3EX6A 4Q8MA 1EXBA 1SM9A 3LYEA 2GDVA 3U2EA 1UIOA 1K7FA 1R2TA 2QCDA 4JD4A 2QJHA 4HU4A 3LEPA 3VVGA 2WSYA 2YOCA 3I3BA 4PA8A 3KWSA 2YCJA 3L4WA 3W7CA 4JTRA 4FA3A 4HYVA 3E5BA 4HK6A 4KKXA 4KRUA 4V2XA 2DW7A 3UY7A 1J6PA 3RPDA 1VYSX 5A6AA 3WLMA 2WLYA 3EWXA 3UFYA 1KRAC 1F4AA 3U5YA 3E38A 3RM4A 3LLDA 3BICA 4C65A 3SQMA 5D2TA 1WV2A 1XUUA 3NNTA 4PGLA 4S3FA 1ME7A 4BWLA 1PPIA 4YWSA 5TD4A 2V5KA 4LNCA 3ONBA 1BWVA 1FFQA 1IXQA 1W1B1 3BLIA 2OEKA 3R11A 4W8AA 4B16A 2VWSA 1HL2A 3DI1A 3VIKA 1RLDA 4LALA 3W24A 4L80A 4NJKA 4H9MA 2Z29A 4B3KA 1FY6A 2D0GA 3OOQA 3DEQA 2HEJA 5TF0A 3ZWSA 5LNRA 1GYNA 4QAWA 4IFRA 4BI5A 1S5MA 2XH7A 1NDYA 3O15A 1XCXA 5H1WA 2V6AA 3VIIA 3GS6A 1E4NA 2GVYA 1BXCA 1XBXA 2RDWA 4Y8FA 7REQA 3AMDA 4H6RA 3ZZ1A 2WPBA 2W62A 1XF0A 4FB7A 1Q6QA 3IANA 4JQ3A 2XZ9A 4BKNA 2Q8ZA 2DZXA 4BEQA 3DUGA 1HF6A 2R8WA 1AW2A 4NY2A 2YL6A 1JQVA 4GLEA 3P62A 5B80A 2QJJA 2HCVA 3B05A 1K70A 3O9NA 4I5XA 4BS0A 1VH7A 3FX4A 2VFEA 3P61A 4KGJA 1F74A 3AAMA 4JIQA 3VOCA 4FLOA 1CX9A 5LA1A 4GVIA 2ASHA 4UBPC 1F2JA 1MXSA 3RJYA 3GLCA 4H8NA 5LNSA 4JPGA 7A3HA 2Y7EA 2CLPA 3CZJA 4PUUA 2YA0A 4GQQA 1E4IA 1RY0A 1GKQA 4NL1A 5C70A 5D09A 2FHCA 4NG3A 1FRBA 1WUEA 1B4KA 2X1SA 3WQCA 1NFPA 2DPEA 1QXLA 1A3WA 3IJ7A 1OFEA 3RMEA 2QCFA 1OK6A 2WCGA 2XUCA 4O1DA 3TN5A 3EOSA 3W3OA 1WBHA 3CV7A 1QNQA 1Q7QA 4AHQA 4U5IA 1N8WA 2A3AA 3ES8A 1X7IA 1O6IA 2ON3A 4I9TA 2B7NA 2XWEA 4NQ1A 1ZLPA 3KFTA 1J8VA 3MBFA 1EHAA 3BCDA 1ZPTA 1I9CB 3W6YA 5D8ZA 4MLJA 3LV5A 5LXEA 2DSWA 3P93A 1OYBA 4DYEA 1TX0A 1U2YA 3W73A 3UWWA 1GOMA 1QAPA 1W3IA 4EP8C 3PP7A 5C9ZA 2P10A 1H7XA 4KF1A 1GVQA 4JOMA 3ZR6A 3WQ4A 5HR7A 2FGLA 1WXJA 3DDMA 3TTQA 1O1HA 3W72A 3BVJA 4URIA 3W53A 4MB1A 1ZCOA 2R1NA 3EMCA 4XO6A 4MDPA 3OO2A 4AEFA 2G4FA 4U3AA 5C9UA 1A50A 3R5EA 1YBQB 4G7EB 3R0DA 3AIBA 3IV8A 1AA1B 3NL3A 3AROA 3QJAA 4P7OA 1SFTA 4AIUA 1YKWA 1W31A 1HFBA 1E9LA 1JDFA 1EJSC 4WCJA 4ZZ9A 1OX4B 4C1LA 3C5QA 2KX9A 4IX2A 4QSFA 4WRHA 1LLWA 3P74A 5KEZA 3C0LA 3RLHA 2C1IA 5CZSA 3OPSA 1A5NC 5REQB 4RW3A 1TV8A 3THCA 4B2DA 2GVEA 5U7SA 4XTDA 3PBGA 4RCXA 1P0BA 5E6YA 2HISA 2VVSA 3PWGA 3R10A 4B3ZA 2FMOA 1ZQ5A 3SR7A 4L65A 2GL5A 1QK0A 3OVPA 2QIIA 3NDYA 2VQUA 4QITA 4M6PA 2I5IA 4CUCA 1JUKA 5I09A 2XFWA 1I4NA 5K4XA 4C5ZA 4TMCA 2XVGA 1W8SA 1UBSA 2GJXB 4ZB5A 1V0KA 5IHSA 4H19A 5HANA 4IFOA 4XAGA 3IUHA 2C16A 2PWHA 1QPKA 4PCFA 3LBCA 1CBGA 3UCCA 1H61A 3IIXA 3P5YA 5G4WA 3GVQA 1UC5A 1HJQA 5CGTA 3QV7A 5JH2A 3NXLA 5FL0A 4F0KA 3WX7A 4DEFA 4LOCA 1EO5A 3MUIA 3W2UA 4JFVA 5FKYA 1GG1A 5FJJA 3WDPP 3O6AA 3W0KA 5C9RA 2AMGA 2PDQA 4PEKA 1ODUA 2H8XA 5ABHA 4MVAA 3RLGA 3WY1A 4IGMA 1JR1A 1A5KC 3FDKA 1JXJA 1Y5VA 1VR6A 2ZA3A 4MM1A 1WKDA 1W5OA 1E56A 1E55A 3QXBA 4BK9A 2E8ZA 1OX5A 4TX8A 4S3EA 2QF8A 2WB5A 1OD0A 4UTLA 4YJ5A 2CWXA 3PJXA 5LNUA 3GK0A 4GYKA 1OHLA 1CXLA 1HN1A 1Z48A 2WM1A 4OE7A 3E0VA 4XAPA 1PUDA 3OVGA 1C8QA 4DZHA 3NQAA 3AHTA 1AQ0A 4XUGA 1AMKA 1XV8A 4Q8TA 2J88A 4LUSB 3WLPA 3VTRA 1MQRA 2MNRA 3NL5A 1CENA 3H21A 3TYEA 2C0AA 1IZKA 3G24A 1CXKA 5F4XA 1F5ZA 1JUEA 3HA1A 1KKRA 1UQZA 2PLJA 5E70A 1KFCA 4IPJA 5JMUA 3AUOA 1XRTA 2HE5A 1K02A 4RZ5A 2PGFA 4Z2JA 3H26A 3MZNA 4C6NA 2PZNA 1LTDA 5A6KA 2YYTA 3R94A 3IUIA 1QNPA 4MTVA 4LEQA 4JAWA 3G1VA 4ZOBA 4EANA 2PD9A 2QCLA 1IEWA 3ZOAA 4W86A 3VU2A 1E71M 5D03A 2QCMA 1G0CA 2FLIA 4KGLA 5G2HA 4RNHA 4UMAA 5JBEA 3W7RA 3QGKC 4AZ7A 4A2RA 1EX1A 4FS9A 2YXXA 2CIPA 2PWVA 3LTSA 1Y7VA 1E1CB 3SN1A 5H8UA 2E40A 3M16A 4BHYA 1YEYA 3VUPA 1YDYA 1KXVA 3CO8A 5LIXX 4ONVA 2WSPA 3KBMA 4JR5A 4JKLA 4Q4KA 3CZGA 4ZCWA 2D2HA 3CPGA 1IEVA 1LF1A 3L7RA 3NEVA 1UPMB 3KRSA 1E6ZA 1GTHA 1OZMA 2HWGA 3P14A 2VDGA 3AQUA 1C90A 4GPNA 1XIIA 3AYTA 4KCVA 4LH8A 3F5KA 2YKKA 4GINA 1GKPA 5FESA 3EDDA 1UD4A 5CKSA 2J75A 3BPWA 3CV2A 4D1IA 3WD4A 4LY8A 2ACQA 1BVWA 2WNQA 1GYLA 1XWYA 4LVDA 1P6WA 4KWUA 4GCAA 4P8WA 4UUIA 2EBNA 2Z7GA 4Q7NA 2BNJA 4H9VA 1XLAA 1KTCA 3N11A 4Q7BA 4C7DA 3AS1A 1PDZA 4JHMA 3G6MA 4A8LA 1E0VA 1OK4A 3STCA 1R3VA 2Y6ZA 1LWIA 1MVYA 1KRBC 3LI0A 1HL9A 4DAIA 4XTIA 3BO9A 3P67A 4JZ5A 3MY9A 1NARA 1VJZA 5KITA 5A8MA 2LLEA 2NX9A 4NASA 2ZXBA 4PB3A 5KETA 1EJVC 3SN4A 1FDZA 2PZ0A 1GJUA 3LMYA 3MANA 4J3UA 3PJWA 3Q2DA 3IACA 1WDSA 4G2DA 5CEWA 2PDCA 1MW0A 3RFAA 3DAQA 4GHRA 2GGGA 1V3IA 2EEXA 2QS8A 3GG0A 4UXDA 4NAFA 3D3AA 4MY8A 3W87A 1NF0A 2WHJA 4O4WA 1TJRA 4I9JA 2DUZA 3F4VA 1XH1A 2BVYA 1C93A 1U5HA 3ITCA 2I16A 2FGBA 2WJZA 5AYXA 5JBDA 1UA7A 3PBVA 3AFBA 1OGBA 4IPLA 1EP2A 1XDMA 2I9EA 1IXPA 4MSSA 3S1WA 5GNYA 2AL2A 2Q3OA 2TMDA 2PF0A 3AS0A 3VGGA 1VB9A 5AFDA 4YMZA 3OGSA 5M1TA 2PDIA 3MHGA 4I8DA 4RNIA 1T6MA 1X1ZA 3RR4A 3KL5A 1GQIA 2X1TA 2ZUMA 1N82A 3ITLA 8RUCA 1T5AA 4P8XA 3FAXA 4HT3A 3OG2A 2G95A 2XN0A 4AF0B 3CUFA 2A2IA 3G1YA 5F1VA 1T8XA 3MKCA 1VFHA 1VFFA 2FZ9A 1LOLA 1OIMA 2Y5JA 4D6EA 1EA0A 1XDJA 3LHTA 4GE8A 4AY1A 4QSHA 3ARPA 3V3WA 4G5DA 2VEGA 3A5VA 2I1OA 4JN8A 2VCCA 3E3HA 5AZ0A 3IK2A 4WF7A 5M2FX 4PH6A 2CHNA 2MUCA 1ADOA 1A5MC 2EGZA 1L6YA 1FHUA 1QR7A 4WIWA 4FNSA 3L12A 4Y9NA 1GK8A 3DBNA 4LS2A 1V5XA 4B4HA 2VFDA 2E0PA 5HK4A 1GHRA 1W5PA 3H4WA 3LPFA 1RH9A 5A8PA 4TVCA 3GXFA 2CERA 4GA8A 1FCBA 4ADUA 3RILA 1PCKA 2Y5EA 2J7FA 1T0OA 3T0CA 4CD4A 2H90A 4R7JA 3ZIZA 3UJFA 5ABFA 1GPFA 4GOAA 3LCGA 3LGDA 2EO7A 2OZ8A 3M7SA 4ZXOA 3ABRA 1W3KA 4Q8NA 4CCDA 2J7GA 1LZOA 1TTPA 4AZIA 4OIFA 1UWRA 1RQHA 3HPXA 3O0FA 2FIQA 4I7UA 1MNSA 1UR0A 4O15A 4I6VA 3GRIA 4HU8A 3JRKA 2ADAA 3BAXA 3NVDA 3QSRA 2R82A 2FPYA 3VGFA 3TTEA 4HD5A 4QG9A 2O7SA 1R3WA 1IR2A 1QPQA 4LVGA 1H09A 3NDOA 1IEIA 2VGBA 4XVDA 3KX6A 3ARXA 1U83A 3TROA 3AMLA 3S0CA 3TYBA 3SCWA 2F84A 2Z25A 1ISXA 3ZYZA 3WF2A 1JXKA 3WMLA 3G22A 2EQDA 3QHOA 4KFPA 3V18A 4UR9A 4H04A 4IP5A 2HBXA 3SBFA 1RQBA 3B0UX 2YCKX 3POCA 3MUCA 2PWFA 4ZOCA 2ZDRA 3N18A 1FOBA 4L4MA 4GCXA 1F3WA 3AWOA 3N1AA 4RLIA 1CGVA 3A3HA 5E0CA 4E0CA 1UASA 4GIYA 3L68A 5C2XA 4C6PA 2YSWA 2ZXDA 1XH0A 2DORA 3STEA 4DLMA 3VX0A 5HWNA 1E43A 3SCSA 3OA5A 3S5OA 3KBWA 3LTYA 3BV7A 1OINA 3BGGA 3LCLA 2V5BA 2HS6A 1LP6A 2QCHA 1EIXA 3MCOA 1AL7A 1JYNA 1AVAA 1ZU8A 4QEEA 3ZLGA 2R94A 3WLQA 1TJ2A 5A8OA 3UWQA 1WO2A 4JTIA 3UPBA 3EWBX 2BVTA 1DJWA 1WDRA 4GISA 1W3HA 4O0ZA 4S2BA 4JTUA 1IV8A 3NFUA 3PWAA 1Q2RA 2ZVIA 8XIAA 2D23A 5HMEA 5KTLA 1BEUA 1ICPA 4RV8A 2DZUA 4H01A 6CGTA 2YZ5A 1ME8A 3BW4A 1BTMA 3MB9A 5CLTA 2CESA 3AJXA 3B04A 3ABQA 4DHGA 3DYMA 1THFD 1VIZA 3SURA 3SGZA 1MXDA 4BF9A 3R8RA 1H5VA 3W02A 1YQ2A 4FOUA 2B7OA 1XRFA 2D2GA 2O4QA 3MSRA 4J28A 4P8VA 2ZVRA 1VYPX 1NELA 2ZRZA 2WZMA 5CJMA 1F3TA 4UOZA 2EXOA 4GI9A 4DXKA 3SZ8A 3DFHA 3FKRA 4A3QA 2DT0A 1YPXA 2OYLA 2GVGA 1L2UA 4U2ZA 3S83A 4HOWA 2ZX5A 2PP0A 4AYSA 3VIOA 3KBSA 1SZEA 4JGDA 1MMFA 1DP0A 2W67A 4J3TA 1B3XA 1X6UA 3EKGA 2PDJA 1PTAA 2PDYA 3E0WA 2AOSA 2TRSA 4GX8A 5A2AA 1NQ6A 4O1CA 4OVXA 3CZKA 2E1WA 4UTFA 4DXVA 2GDQA 1EP3A 1VZWA 3BLLA 4O11A 4CU8A 2XINA 5I5RA 1DWAM 4H41A 1S46A 3EA1A 4PC8A 3BMXA 1KB3A 5C9WA 3S2MA 3NOYA 4UTWC 1KLYA 1H1YA 1K77A 5M03A 3WH5A 3FA4A 3DGRA 3QZ6A 4IJCA 4IICA 5D8WA 3ITGA 3RNDA 2OSXA 3TJIA 1J18A 2EPHA 3BTNA 1TJPA 1KGXA 5F4WA 1KM3A 1EDGA 1US0A 2F38A 3AU6A 1ONEA 1V3MA 1RA5A 1JCXA 3W88A 1DQUA 4DM2A 1CECA 3CT2A 1BRLA 4NUWA 5CG0A 1B4EA 2J8FA 3VIMA 2PAJA 3UZXA 2J7DA 3CWOX 1YTEA 3NQ6A 2DQXA 5M17A 4HSOA 1AH3A 5DQPA 1BYBA 1YXCA 2AL2B 2PDGA 4RPQA 1S1RA 1DJHA 3C2EA 4H2HA 1VFSA 2NQJA 1OADA 1CXHA 1K9FA 3GG1A 4MWAC 3W6MA 2HXTA 3ITVA 4AD3A 2YPIA 1S5NA 1A5UA 4TR9A 3WQ8A 3T7VA 4GZEA 2G50A 4CNUA 1GZGA 2A3EA 3LGGA 4AF0A 3VNLA 2VZUA 4A3YA 3WNNA 3KE0A 3NPUA 4WJEA 3UZYA 1MWOA 3B8VA 2GVJA 3BWWA 4C6LA 4DYJA 4A22A 1L8NA 1WYIA 5AHFA 1HGWA 1H41A 3S9IA 3UCDA 3W7QA 2DVUA 1QI4A 3KOXA 3STFA 3ARYA 1GGOA 2G5WA 4AG0A 4IISA 3M07A 1V6XA 5HNUA 1KGUA 1XD0A 1X39A 3QBUA 2PBOA 2JKAA 2QV5A 1OFAA 1E40A 4LRTA 5A6TC 4DWSA 1ISYA 3LCFA 1TR1A 4KESA 1C7SA 2YCLB 2ZZ6A 4D1JA 3SB0A 4BQ4A 1K9TA 1H7NA 2GWNA 5E1QA 3LXAA 1B2YA 4OFCA 1E9ZB 3AI0A 3B9OA 4Q7IA 2J6XA 5DMMA 3MWAA 5A8QA 3K8LA 5AECA 3A9IA 4C60A 5D9PA 4HZ8A 4LBSA 5FEPA 1ITXA 1KM2A 4HZ7A 3NVTA 3AU2A 4AVOA 3APGA 4R34A 3C0SA 4UFKA 3VKBA 1AODA 3MUZ1 1QHZA 4EAMA 1KV5A 2ODOA 1E6PA 2BSLA 3CQJA 4N0RA 1I2QA 5DRIA 5LHFA 5I2UA 1XSJA 2Q8XA 3BAIA 3GY1A 4GRSA 2IW0A 1UR1A 1VS1A 3EA3A 1XGDA 2ZRVA 4NXSA 1NF7A 3F4NA 3HPSA 3QMTA 3XINA 1R2SA 1PVNA 4Y7EA 2CZFA 3A3XA 1Q45A 3NSNA 4Q8VA 3EA2A 1OVDA 3T8QA 4WUIA 3UVAA 1YDOA 1ML1A 3ZJ8A 1DPMA 4AD5A 2Q02A 3B8IA 3TH6A 3TUUA 5HWMA 1LOQA 3K1DA 1XPGA 3HPZA 1FWHC 3CTTA 1FHDA 4F0LA 4Z1YA 3LERA 4F79A 2BWGA 2O9RA 1BKHA 1BWLA 4RR4A 1TA3A 4LVBA 1QW8A 3NQ8A 4J2MA 4INFA 1XG4A 1KD0A 2OODA 4MNMA 5EBUA 3HG2A 4K7YA 5KZMA 4DWSB 3JS3A 3TQ0A 1TKKA 4WZHA 1WKYA 3T0BA 3HG3A 1XRVA 2O4MA 4YNGA 3WDIA 4GNKB 1XIEA 1C9WA 1JCNA 1JCTA 3TW7A 4D8AA 7XIMA 4L9YA 2FKPA 2L5HA 1FWDC 4L64A 4HZ6A 4LS1A 1SMAA 4DBUA 5A6BD 1JUBA 2OR2A 4C6DA 3O0KA 2OCZA 1TMLA 1OCNA 1QW7A 5CC3A 3GNRA 1V6VA 3TTSA 1L6GA 3QRHA 3APTA 2VRQA 2Y4SA 3OA3A 4A8NA 1SW3A 4XZIA 2WBKA 1YLVA 5HQEA 1LRTA 4CNTA 4M7TA 3MKVA 4TOQA 4AZHA 3WD1A 4XKYB 2FH8A 5H91A 4NJIA 1Q4NX 1Y0EA 3H2CA 4GNJA 4JX5A 4DPQA 3T05A 4FNQA 1G69A 3DENA 1RJPA 1B3OA 3A47A 4DO5A 1KFJA 3SRFA 2NWSA 1ESWA 4G7EA 3O3RA 5GJNA 1QDSA 3IWPA 1EGVA 3EDEA 4DZ5A 3AHVA 3WUEA 1ZCCA 2PRLA 1EC8A 2W92A 3NIYA 2QGYA 2JK2A 4L7ZA 2ZA2A 1PL9A 2GVLA 3UG3A 3SCRA 2G3FA 4UNLA 1UKOA 4HB7A 2CWNA 1HO1A 4HA4A 1W3LA 1KWKA 3AJ7A 5E0KA 2WZHA 1K8CA 2VFIA 1RY8A 3FS2A 2VELA 3CM4A 3LRKA 3OBEA 3AC0A 4O13A 3LCIA 3FSUA 4A29A 2DZVA 4L1XA 4XKYA 4QJ1A 3KRBA 3U57A 1JL8A 1H7OA 3Q4DA 2UV8G 3AZRA 4N4PA 3U7VA 4LXFA 4YHGA 4PMNA 2OLSA 8XIMA 1LDCA 2Y5SA 1QNOA 3AYVA 3PB0A 3STGA 3VE7A 5DN1A 1J2WA 2FPTA 1RHCA 2QAPA 2CLFA 4WY0F 1FDJA 4NVTA 1AL8A 3UWUA 4MKVA 3A23A 5BU6A 2JIWA 3MTWA 2EF9A 3TR9A 1ZJAA 3H6OA 4DBDA 4NHVA 2NV9A 1G4EA 4E2VA 3IAQA 1RQEA 1HJXA 5DO8A 5CAHA 4AX7A 1JZ7A 3DIPA 3B4UA 1G94A 1DXFA 1EZWA 1JVNA 3GDKA 1H4PA 2RDXA 3AHYA 3ALGA 3QLDA 2NXGA 5D9OA 3IGHX 4RL3A 4MAVA 4AZCA 4KIEA 2E5CA 3N15A 2GGJA 4AEEA 5G4EA 4CNPA 1E4MM 4TMBA 5LGZA 3OTRA 5FEXA 1PJ9A 3CYJA 2VEMA 4I5RA 3KUMA 2WMGA 1X1OA 3QMSA 4XUYA 3CUJA 2PF8A 2XIQA 2ACUA 3LHVA 1PZ0A 1TVLA 1VKFA 3VDCA 1SFSA 4F66A 4H6KA 5C71A 2R14A 1YE6A 4Y9OA 1G1YA 5A69A 4AH7A 4FNUA 4CNOA 1QPOA 1GVYA 1LORA 1S2VA 2CHRA 4CCCA 1W56A 4GKTA 3B97A 1AH4A 1XRSA 3TE9A 3FXYA 2VWTA 1SO5A 1SMDA 1O1ZA 4KW2A 3TOYA 4K37A 3KS5A 1HL8A 1FP9A 3SAZA 3KP0A 4L1GA 4L9XA 5AHIA 3ARSA 2GUUA 4ALDA 1OFDA 3K30A 2ZQ0A 3K5XA 4DJED 1H3GA 1NEYA 4AXKA 4GACA 4YTUA 4LW7A 3KTCA 3CNYA 3CMGA 1GZJA 1M68A 1X8FA 1PWMA 3ARVA 8A3HA 4AHPA 4ILSA 4Q8QA 3QMRA 3FVMA 4QJ5B 3LD5A 3GX9A 1EF2A 1PZ3A 1ZBCA 2UY4A 4M1BA 4AIEA 3WK0A 3PANA 1BSIA 1WUFA 3IJQA 4N2YA 4M3PA 2DIKA 1XGZA 2VEPA 3B9NA 1YNPA 2C8NA 1MZHA 3FJNA 2BV9A 5I0DA 3JW7A 1EEXA 4UTHA 4H8HA 3USZA 3G1RA 1KXQA 1W5MA 1YADA 3QQ1A 1VPYA 4LX4A 1R38A 3RK8A 4RXGA 3O16A 1X96A 1EJWC 3ZR4A 1SJBA 1JZ5A 1S38A 2IKIA 2Y70A 4O53A 1E0XA 1W91A 3HQNA 1QK2A 1EWDA 3OVQA 1J93A 4QM1A 2JQXA 4NILA 4S3KA 5AZ1A 1J11A 1E3ZA 1FH9A 5DBUA 3S5YA 1A4LA 3PBMA 5FEZA 4IGHA 3REQA 3WK1A 1LBFA 2DSZA 1JF5A 2Z2BA 3E49A 3PSWA 4WX2A 2PUZA 4YPJA 1ZTVA 2OX4A 2WSQA 3N12A 2MANA 2R91A 4REQB 1CGXA 5HATA 2PE4A 2ZTJA 1PYFA 4XD5A 7REQB 3F1QA 4PTXA 3CEUA 3WLRA 4O1BA 2QT3A 5HOSA 5I23A 1JQXA 3MI6A 4UTTC 2NSOA 2CZEA 2GZXA 3BSHA 4AWEA 5BOOA 1GHSA 3A5FA 4UTMA 4E5TA 5DEZA 1LG2A 5I3FA 1ZBKA 5C0QA 1G67A 3W01A 4LU0A 1SFJA 3ABOA 1XYMA 7CGTA 2OO6A 1P4CA 1QU4A 4F0HA 4AAJA 5AYIA 1PKLA 3PWIA 4G7FA 1TPEA 1DJXA 4J3ZA 1NFGA 2PTYA 6PTDA 3U5UA 3UXIA 1MFUA 4LUJA 4I7WA 4IP7A 5DCBA 3RPTA 1TPFA 1V77A 4OKDA 2HQAA 4AFYA 2Z2AA 3EKLA 2FHBA 1F8IA 2NVCA 1MRQA 1J4EA 4X9YA 4D6HA 1XYBA 2PD5A 3DU0A 3HIJA 3S9YA 5EMUA 3SGUA 3DXIA 2RUSA 1JCLA 3C6CA 1TZ7A 3N19B 1EPXA 2WK2A 2BDQA 3N6HA 5A6JA 4DJFD 4XIAA 1BWKA 5F2LA 1Q5MA 1EZ2A 3W29A 3QFWA 3EDKA 4MB3A 4IMEA 4M51A 2QUMA 5G1MA 2WOQA 4N4QA 4JTTA 3S6TA 5JVLA 2WVTA 2E1DA 3BW2A 3IIPA 2YL9A 4H6EA 5MKGB 2CLOA 3TSMA 3S5NA 2GWGA 1MUWA 3JZUA 4HHPA 1UP2A 3TSDA 4GX9A 1DIKA 3BLOA 2X1RA 5CSRA 2INEA 4DJDD 4GVHA 4F0RA 3R7MA 9XIAA 2OSWA 4X9SA 3EDJA 4DO4A 3PF3A 2E67A 3EWDA 2A7RA 1KGWA 1AQFA 4MWAB 3H7UA 4UOQA 5FIPA 2HMCA 2ZZ4A 3L4UA 2Z27A 4TV6A 3FOKA 4ZQCA 1GYMA 4AW7A 3G0SA 3GTIA 2OO0A 1RSCA 5FACA 2ALDA 3Q94A 1OGSA 3WQOA 4M1RA 2WZTA 5HPCA 1X97A 2ISVA 3GBEA 3URQA 1EYEA 4IHCA 1Z3NA 2RJHA 4JIIX 4FOKA 3GB6A 3W2MA 1G4PA 5BRBA 3G1FA 1FH8A 3RU8X 4KEUA 4OT7A 1H62A 1QNVA 2V67A 2HTMA 3SJNA 4JTCA 1XLBA 1FTXA 4IX0A 3V0TA 2INZA 5LA2A 4UFJA 3QTGA 4XZLX 1SJDA 2OQYA 4KWSA 1M7OA 3KP1A 4V15A 3EWZA 5G1TA 3PUEA 2GPTA 1N2VA 3ARZA 3GXTA 3EBVA 3GTFA 4Q33A 3V35A 1KR1A 4XB3A 5A2BA 5A6BA 3C3UA 4K38A 1QJWA 3CK5A 3UA4A 4I8YA 2C1GA 1ZBVA 4DF0A 1G6CA 3LI1A 3MMDA 1E70M 5DMYA 1ECEA 3E1F1 4Z1CA 4R9XA 3Q58A 3QF0A 4H7ZA 4MY9A 3WQGA 2QUTA 2YLLA 3DKLA 1MZRA 3GH7A 4ZFMA 3RX3A 1VLIA 5EY5A 3CEPA 4GUHA 4DWSC 1C92A 4QCEA 1AJ2A 2QDHA 2DZAA 1UH3A 1NY1A 4GD0A 3KCLA 1G5AA 1CTNA 3VDGA 2NT1A 4LAOA 3EYPA 3OU8A 4QISA 2E68A 1US3A 1NQKA 4JDYA 1R9ZA 3ARRA 2WNZA 1DV7A 4FEZA 3ZVIA 2X42A 1O95A 3UA3A 2YBUA 1RD5A 1SR0A 3F5LA 4C1NB 3WJYA 1UW9A 1WXYA 1HG3A 1RBOB 4CQDA 2ZA1A 4HNNA 2VC6A 1KM4A 4JTDA 1HP5A 3K13A 4JTFA 3VABA 5FF7A 3L4TA 2HXUA 2ZIDA 2RH9A 3R0UA 3A13A 4P7NA 3AUJA 2Z1KA 2PA6A 5REQA 1LBLA 2WJEA 1WZMA 2ALRA 3BAJA 3UR5A 3GNOA 3T78A 4PSRA 2HBVA 4MKSA 4LWWA 1K3UA 3A4WA 4B3LA 3QM3A 2HDJA 3OHIA 4J3XA 2YIHA 4FLRA 1CPUA 2Y8UA 4TX9A 3ID7A 1QWGA 1UZDA 2PLMA 3IJLA 4G8TA 1FWWA 4WSHA 1XQKA 4FIQA 2D69A 5AN7A 1OM0A 4AY7A 4GI6A 4XZHA 3CMFA 1S2CA 1F9CA 1PKNA 3CZ8A 1TPDA 2CLEA 2VVNA 2W91A 2WLZA 3UXAA 5D30A 4WJXA 1EWEA 4O1EA 5JXQA 3TX9A 3W7LA 3EGJA 1MRAA 1XLCA 3SUSA 2OFJA 1SYTA 3FYOA 4E4PA 2FTPA 1KBBA 2P3ZA 2B31A 2POTA 4K2SA 1KWGA 2BS9A 1OD8A 4ICCX 3TXVA 5TIMA 3ZWTA 2F2KA 1NVMA 3G1XA 2A3LA 4IQEA 1NDWA 4S23A 2FZNA 2BY3A 1OFQA 3HG4A 3VKCA 3KOWA 3WH7A 4BCEA 4UTWA 1UZHA 1T99A 2Z24A 4KERA 1ZJIA 3ARUA 2EG8A 3MSGA 3WQDA 4NNAA 1KCLA 2GJPA 3N2XA 2GOKA 4FLQA 6XIAA 1MDRA 3C3NA 4GJ1A 3SCPA 3SQSA 2R9RA 1WXZA 3RGTA 6A3HA 3CHCA 3LPPA 3VDHA 3MUAA 1GPWA 3WL1A 1EA9C 4GUJA 4CU7A 5HR6A 2WVUA 1J5TA 2PP1A 3UF9A 3LM3A 3NSXA 1EL3A 1V7AA 2R1LA 4CN4A 1HJVA 3N25A 1N7KA 4AVFA 4HN4A 4DJEC 1W1IE 4MZ8A 4PCTA 3IARA 4PMRA 1AFSA 3H2NA 2VFFA 2Y7DA 3QGAC 3GUWA 1OJXA 5HUPA 1KBJA 1JZ8A 2BASA 2A7NA 4PTVA 3CV1A 3EXTA 3U48A 2GSJA 3OBAA 4QLKA 4ROPA 4N7QA 4XD3A 4NIRA 2ZZ1A 2CKRA 3MVTA 3IPWA 1YBQA 2XPKA 3ELFA 2DVTA 5KMYA 2WSKA 4WR3A 4JN6A 4IM4A 3FGCB 3L5AA 1BG9A 3ITOA 3UZZA 2VM8A 3GDTA 1A0EA 3MMUA 4IOTA 3SN0A 2QCEA 3FIGA 4MIMA 1UUMA 2H6RA 1PX4A 1AD1A 1PIFA 3TV8A 2GK1B 4RK8A 3Q37A 1QOQA 1K03A 3VM5A 3KW3A 3VGBA 1O12A 4H9TA 2QDDA 1DWFM 4JEQA 4E8DA 1JDDA 3C86A 2J9YA 5BNKA 2V2DA 3M6YA 2JKEA 3CQIA 1HNYA 3VO0A 2NVDA 3IEBA 1PWLA 4K68A 3DG3A 3TMQA 1E6SM 5BRQA 1LWHA 5CSUA 2BXVA 1LBMA 4Z1BA 3SSZA 1KM0A 1QHPA 1QI3A 3SCQA 2UWFA 3H4GA 3C