2FQ3A

Structure and function of the swirm domain, a conserved protein module found in chromatin regulatory complexes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
b'SKWFNLEKIHSIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription regulatory protein SWI3
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes
pubmed doi rcsb
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fq3A00
2OD5A 1I1SA 1KU2A 2V79A 1PDNC 3GF2A 5FGMA 2RC4A 4GGGA 5DD4A 1IUYA 3QU6A 2FQ3A 3RJPA 1XDSA 4ENMA 2V6CA 4ZH4F 3CTAA 1TW3A 2XROA 1YW9A 4LLGF 2HEOA 4EJVA 5JR3A 1FBQA 3C18A 4R79A 1I6XA 4KYWA 1YTYA 4EQQA 2JT1A 1F1ZA 4UVCA 3DKWA 1XN7A 1TQMA 3S2WA 2EA4A 2BEOA 3HSEA 4KICA 2FBKA 4HF2A 3BWGA 5E8IA 4IRGA 3ZQ7A 4BNCA 1O57A 1XB4A 1BJAA 1J5YA 2HZTA 3HUGA 2L01A 1BBYA 2GIVA 2XV4S 3WGHA 2XUBA 4KFCA 4ZYDA 4HX7A 2GZWA 4KMUX 1Z1DA 3ZMZA 1KU9A 4HA8A 1FBSA 4YFXF 4AWXB 1YFHA 3EYIA 2HOEA 5A2QK 1YO5C 1RIOH 4L5IA 4MQ9F 2IVMA 1ZREA 2L4MA 2QQBA 3TQNA 4GO1A 2MH2A 2DAOA 1X3UA 3IHUA 3WGGA 4MTEA 1XMAA 4G7HF 4OU0A 4CDGA 3ZMVA 4E70A 4LLLA 1KU3A 4Q48A 1TTYA 3WG9A 3C1DA 5TRDA 3F72A 1SFXA 3JSPA 3ERED 4M9XA 1ZGAA 3HSFA 5F1RA 2XAQA 2IA1A 1CF7A 4BH9A 1J0RA 1RUOA 1PP7U 4GCVA 4LD5A 3KEOA 3QP5A 4U0WA 1W7PB 3DQVC 1BC8C 2R7FA 4G6DA 3I0TA 5LHIA 2G7UA 4L0ZB 2CSOA 1IN8A 4EJTA 4OMZA 2ZNYA 4M6YA 2W57A 2YPRA 4KA4A 2XASA 3LA3A 4ESBA 3GFLA 4K2EA 4MHGA 3SXYA 2K4JA 1B1BA 3CUQA 1P6RA 2G7HA 4CHUA 5HS7A 3TKYA 1CGPA 1F5TA 1QZYA 4I01A 4NQWA 3PQKA 2NAZA 1OYWA 3EETA 4UVBA 3R4KA 3L00A 1TQIA 3TO7A 1DDNA 4ENNA 3FXUA 1UHWA 1T38A 3HRMA 3MWMA 2O6GE 4B8XA 2FBHA 1GXPA 2YR2A 2M1BA 3E3VA 1B4AA 1HW5A 5EEHA 3DFGA 1XD7A 2BYVE 2FBIA 3OV8A 1KYWA 1KQ8A 4A5MA 2ZJ2A 5IT3A 3RYPA 3TO6A 1J75A 3K0LA 2XKPA 1Z91A 2H27A 1JHFA 2P4WA 2E1NA 4UVAA 4P9FA 1FC3A 4BHCA 1KQ0A 4S05A 2E1CA 1Z7UA 4IVNA 4L9NA 3QRFF 1T0FA 5JI6A 3COAC 1EH6A 3WE3A 2HR3A 4F7ZA 2QUFA 1ON1A 1B9NA 1RZ4A 4TV7A 3O2PE 3QAHA 2EFQA 4WF2A 1D5VA 1ZRDA 3RPQA 2CGPA 2HGCA 1HKTA 1K78B 1D8KA 3IWFA 4A0YA 3RIRA 3BPXA 3OOPA 4KIGA 1Z05A 1YQAA 4QWQA 1O3RA 1BM9A 4FX4A 1MGTA 1FLIA 3HHHA 5HVQC 2UWMA 3JAMZ 2F2EA 3CJNA 3R0JA 5HDGA 1WKMA 2VBZA 4MEYF 3RI4A 2GWRA 2P6TA 3L9FA 3WGIA 4A0ZA 2ZMEA 5CVJA 4A6DA 4LG0A 1DPUA 4M73A 3FXQA 2CG4A 4IF4A 2VOOA 2MLKA 3QU3A 1OYIA 4ZYHA 1T98A 5LBQA 2ZMEB 2DQRA 3L2CA 3CUQC 2TDXA 1U3EM 2NYXA 5BQTA 2BGCA 4IPAA 3EYYA 5KVRA 4ETSA 2EA2A 3LA7A 2FNAA 5E20A 3I59A 1TW2A 1QO0D 4AIHA 3V7CA 1VTNC 4LB5A 4MGRA 2XVCA 3R60A 5D5UB 1XSVA 3N97A 1QPMA 3E6BA 4HW0A 1SD6A 2P5VA 4P55A 2OZUA 1G3SA 1TNSA 2E7XA 4LK0F 4OIOF 5E17F 1QQIA 2LNBA 1FSHA 4P5OA 2EK5A 3ZMSA 3KE2A 1R23A 2XKOA 4QLCU 2JZYA 1S3JA 4DNCA 1WI9A 5E1XA 2IA2A 1S29A 4BXUA 5K5QA 3Q9VA 2W24A 1HQCA 3F8FA 2PMHA 1CF7B 1MD0A 5D8KB 2Z99A 3RTRA 2FU4A 2CW0F 4CO8A 1WRJA 4YFKF 5L3CA 2QQ9A 3JW4A 1FWZA 3CUOA 1OPCA 1R58A 3WTXC 5D4SA 3P9CA 5L3EA 2DO7A 2B0LA 4KUMA 5CVUA 4IXAA 1XMKA 2HQRA 2ISYA 3BY6A 4WXDA 2EFNA 3GLXA 5ICGA 2Z5UA 4PZJA 4LB6B 3GX4X 2V1UA 3HRUA 4HV5A 1PP8F 1JHHA 5L3FA 4Y15A 2UXXA 4BYYA 1K78A 2IT0A 3DEUA 1OMIA 4PCQA 1QNTA 5E8GA 1J7KA 2RQPA 3T8TA 1G4DA 4FX0A 2VBXA 3J81K 2BBYA 1LDDA 2DFIA 4EJOA 1SMYF 1WQ2A 1IRGA 2GXGA 4LFUA 2CQKA 4G8XA 4KIBA 3TDZC 2XHKA 4A6EA 1GVJA 1FYLA 1FP1D 3TOBA 2ACJA 5LLQA 2DW4A 1EH7A 5JFRA 2M45A 1B9MA 1BIAA 4HBLA 2QLZA 5TJJA 2HKXA 2MBFA 4EVIA 5ICEA 2FNPA 5ICCA 4UXNA 1U5TC 2FRHA 3I59B 3TGNA 3AAFA 1TBXA 2M8EA 4AD9A 1XSXA 5EEGA 3T8RA 1WWXA 2MA3A 2Y0MA 2GQQA 3BP8A 2Q0OA 4EGYA 1IXSB 4OMYA 2VE9A 4KN4X 5ILUA 1RI7A 3E5XA 1ZG3A 1L3LA 3O6BB 1ZLJA 5ED4A 3M1EA 2BV6A 2Z33A 2MC3A 2PMUA 1DUXC 2KJBA 1ZH5A 2O3FA 3F22A 5HDKA 5FFXA 3EQLF 1SD5A 1FX7A 3JAMK 2JSCA 3IL2A 4G7OF 2FXAA 1KA8A 2NS0A 3F8BA 1IW7F 3HOSA 4IJAA 4I2OA 2O0YA 1ZN2A 5FO5A 4PGHA 2HKOA 1BI3A 1ON2A 1YW7A 2DBBA 4MNUA 1FT9A 3VB2A 2MLGA 3BDDA 2PQ8A 4LJZF 2VOPA 2XAGA 1IF1A 5ILSA 3KETA 2IP2A 2EWNA 3MAJA 2ZXJA 5DUIA 4U0VA 2JPCA 3SZTA 5HLGA 1Z6TA 1W7PA 1V3FA 2QYOA 2VXZA 5DYMA 2M87A 3VODA 3KP4A 1FY7A 3HSRA 2EFOA 1EH8A 4CZZA 4RB2C 3G3ZA 3REOA 1IXCA 2DT5A 4HLXA 1BOAA 1WSUA 2WV0A 2RDPA 1W5TA 3I58A 3ABUA 3LWFA 1HSJA 4L9JA 2YX7A 3FHZA 3WTYC 4NHJA 4KMFA 5D5XB 1ZRFA 4ENKA 2FMYA 4PDKA 5DDGA 3NEUA 2IW5A 3BROA 2QWWA 4AVPA 1HKSA 2VT3A 3BJAA 4NB5A 2Y48A 4BHBA 4KNYA 2HS5A 3ZP5A 2VODA 1FZPB 4G9YA 3FXRA 3ZN1A 3FMRA 3VOEA 1I1GA 1BIBA 1W7PD 1LVAA 2ZFWA 3V7SA 3RKWA 5JVTA 3D0SA 4CICA 4A12A 3IC7A 4EGZA 2KIMA 2J5PA 3N4MA 2A5YB 3F8MA 2VBYA 2KIUA 3RKYA 2NNYA 2VN2A 3LSTA 4EM0B 2M5WA 4YG2F 3WTTC 4RB1A 3E97A 1SFUA 2COMA 1GXQA 3ECOA 3DP7A 3F23A 4L0YB 2HQNA 5LRRA 4XLNF 1H9TA 3ML6A 4EV0A 5D6FA 4AIJA 3KCCA 5JHUA 4RB3C 3NQOA 5A2QZ 2A61A 1BN5A 1FPQA 1LNWA 2ZO4A 3GUDA 1IAWA 5KK1A 2P6SA 4WX9A 5BPIA 4YIIA 5L3GA 2LDUA 2R3SA 3HYIA 2PN6A 3M8FA 1R1UA 1YS6A 3EUHA 5D6EA 1ZRCA 3HOTA 2IPQX 1S7AA 3WE2A 3GVAA 4HV6A 4N9HA 4Y13A 1XCVA 2QENA 4I09A 5AONA 2L4AA 1T39A 1FSEA 3CUQB 1REPC 3W6JB 3GXOA 5DCFA 2QBYA 1LDJA 2PEXA 3SFZA 4ZZLA 1MDMB 4HAMA 2OQRA 4D0PA 2RGVA 3HRSA 1BI1A 3P7NA 3H3ZA 5CYVA 3TDUC 2J5OA 1ZHFA 1ZARA 2A68F 3SZPA 4OIQF 4UHTA 2VONA 4M74A 3F6OA 2DTRA 2H09A 3E6DA 3LAJA 4A2UA 2CYYA 2E7WA 5F64A 2GA1A 2HTJA 2Q2EA 1TQPA 1YIOA 3LAPA 2FE3A 5ICFA 1B59A 1S6LA 5CVVA 1XSDA 1IN7A 2MH9A 1YYVA 4UNOA 3I53A 4EJUA 3MEXA 5K5RA 4P9UA 1C0WA 2HTSA 1YG2A 4ENJA 3KP5A 2AXLA 3R6SA 2LF8A 3BZ6A 3WTVC 1SD4A 3QPHA 2VE8A 2HDCA 5HS9A 3T5XA 1HKQA 4RB0A 4BHPA 1K79A 2EV5A 4PGGA 1T2KA 5FLXK 3D5LA 3FWEA 1R5HA 5K1YA 1MDMA 1KU7A 3NRVA 1RUNA 1MJAA 4U7DA 4A0XA 5DUKA 1YLFA 1FYKA 1H9GA 4L18B 3VEPA 2XRNA 1O3TA 5D8LB 5DCMA 1W4MA 2EFPA 1U78A 4M71A 4WCGA 3HTSB 1MZBA 4L9TA 4Y17A 1O3QA 2R7DA 5HS8A 4IHTA 3U2RA 3JSOA 3LFKA 2P5LC 1IZ1A 5L3DA 1FBUA 5D5WB 1ZGJA 2P8TA 1SFEA 2ZNZA 4JK1X 3ZN0A 2IJLA 1V4RA 1IRFA 2P5KA 1XGMA 5BMZA 2FF4A 1P4AA 2IRFG 2VT2A 4G6QA 2FA5A 2W25A 3ELKA 4RGSA 3BPVA 3BJ6A 1SAXA 1QZZA 4HQMA 1XGNA 3FX3A 3GYHX 2WC2A 3SQNA 4IRIA 2FMLA 3KEQA 4I02A 4WXHA 2DPUA 4FHTA 4XSXF 3MCZA 5LGUA 3HIFA 4L9VA 1B6AA 2D1HA 3DXJF 1ZG1A 3J7AO 5K5OA 1IN5A 3WTZA 3LQRA 2K02A 2OQGA 2KJCA 4HX8A 1IN6A 2OU2A 1J9IA 4Z2YA 3WTSC 5E1WA 2XIGA 1O3SA 1UHMA 2RN7A 3J80Z 1R36A 3E5QA 3FZVA 1T6SA 3H92A 4BAYA 1SD7A 1U5TB 2VC0A 5HOOA 3GZ6A 4KN7X 3KP3A 1LJ9A 3FM3A 1DP7P 1GHCA 4OOIA 4JQFA 3IKTA 2A07F 4WWCA 1G6NA 2VC1A 4RGRA 3SHFA 1HW2A 2GA2A 3DPTA 2PBIA 5H20A 1FP2A 2UXNA 2F5CA 2HYGD 3GEZA 2LF7A 1LQ1A 1AWCA 3I64A 2QM3A 1G3TA 4IRHA 4CGZA 2W85A 1JE8A 3DF8A 1EV7A 4CXFA 5FD5A 2DLLA 5DCMB 3J81Z 3B02A 1RNLA 2OAZA 4ESJA 1R5GA 4P96A 5HLHA 2K27A 3I5UA 3CO6C 4CYDA 2FEZA 2C6YA 2DK8A 4H0EA 6PAXA 2GAUA 2WWYA 1YS7A 1R22A 3LA2A 1DPRA 5D4RA 2EV0A 5LGNA 5FB2A 3TO9A 4U0YA 1W5SA 1G3WA 2DI3A 4I0BA 1QGPA 3GWZA 3K2ZA 2RNJA 1I5ZA 3WU1B 2ZKZA 3T0YA 4ZYEA 4LK1F 3ABTA 2NNNA 3IWZA 4Q4ZF 4XSZF 4OINF 2STWA 4EMSA 5ILVA 3GO5A 5CVRA 3QPTA 2D2WA 2Z9OA 4XRFA 2EJRA 2K4BA 1D3YA 1FOKA 1TLHB 3DV8A 2H6CA 5BS6A 3ZPLA 1OKRA 1U6GA 1E17A 2XAHA 4OIRF 3P9IA 1LEAA 5J8FA 3ULQB 3HHGA 5H6RA 5IT9K 2LKPA 4OIPF 2XGXA 2PFBA 2YX4A 3F8CA 2JPBA 4FT8A 3RDIA 1LB2A 3Q9SA 4ZZDA 2F5EA 4GYGA 4ZYGA 3I54A 2CWEA 2A6HF 2EV6A 3KZYA 3J80K 4R8HA 2Q8KA 5E1ZB 3KP7A 2A69F 2YSRA 5E18F 2KRFA 1U5TA 2VBWA 3TOAA 1LEBA 5D5VB 1S7OA 1XCBA 4M6XA 4LLNA 4HLYA 4N0BA 2DU9A 3R61A 1K6OA 4EM2A 2XAJA 2O03A 2V9VA 1ZG5A 3WTUC 3F6VA 3V4GA 2ZCWA 4U88A 2O61A 1SMTA 1IN4A 3IKVA 3RPUA 2EFWA 3Q5FA 2ESHA 4HF1A 2STTA 5DEQA 4EM1A 3RYRA 1F9NA 2Y75A 1XGSA 4UV8A 1ODDA 1P4WA 1BI2A 5LHGA 1KGSA 2P7VB 3M9AA 4M9ZA 3ISPA 2FSWA 4I0AA 4HDVA 1PUEE 2G9WA 2A3SA 3WU0A 3GFMA 4HQEA 4HZFA 1R1VA 4O5VA 3GFJA 5CVIA 3MQ0A 3K1NA 5LHHA 1STZA 3ZMTA 1HSTA 3K69A 1BI0A 4RGUA 3CDHA 4U7BA 2L02A 1MJBA 2P7CB 4M72A 4JBAA 5LEJA 1KQ9A 3KLOA 3U1DA 3V8JA 5HDNA 3K9TA 3G73A 2ELHA 2FOKA 3MFKA 5CJ9A 4MQVA 2EB7A 3PFIA 3L7WA 1AOYA 3K1MA 2Z3YA 4HYEA 2ZBKA 1P92A 1NHAA 1P4XA 4A5NA 3GW2A 3HRTA 2X4HA 3ROUA 4G7ZF 4KIFA 5L3BA 3M8EA 2HWVA 4WXCA 2PJPA 4HX4A 3C7JA 3H3UA 2QBYB 4DQ2A 2RVCA 3R0AA 3GZ5A 1MJ9A 1KYZA 3F21A 4R1HA 3E6CC 1MKMA 3VFZA 2HFHA 2O8XA 3V7RA 3IRQA 2ETHA 5J8CA 5IT9Z 3QOPA 4O3MA 3I71A 3F8NA 5FD6A 5CLSA 2D45A 3V8KA 3F3XA 1R7JA 4HOBA 1Y0UA 1J59A 2HYFA 4Q5SF 4RAZA 3PQJA 3KLNA 5DD8A 3WODF 4RS8A 4N9IA 5BPDA 2BE5F 1Z6RA 2K86A 3JTGA 4LGWA 2QZ8A 4I98B 4YFNF 2X0LA 4ON0A 1USTA 3I4PA 4O6JA 1ZYRF 2JTVA 2IA0A 2QQAA 3ZMDA 5BOXA 5LEKA 2MD5A 2OA4A 1USSA 3B73A 3KP6A 1E2XA 1G3YA 2RKHA 2RV8A 2OBPA 3RKXA 4S04A 2H6BA 1UB9A 5F6FA 1J2XA 5ERIA 3ZMUA 3E6MA 4GXOA 3O3KA 3FM5A 1YW8A 2DQLA 3CLOA 1QBJA 5AIQA 4Q47A 2KIFA 4HF0A 4EJWA 1OR7A 3KZZA 3ECHA 4B09A 5DV5A 5J6XA 2L54A 2F5DA 2ADUA 2ESNA 1OYYA 4UV9A 2V1DA 2W84A 1U2WA 4BQAA 3M7GA 2CO5A 3L09A 4G94A 2NRAC 4RAYA 2V1XA 1U8RA 2M30A 3MZHA 3V8LA 3BJOA 2OZ6A 3C3WA 3FMQA 4XLPF 3GFIA 1P2FA 1BC7C 3EDPA 4L5JA 5FFZA 1UCRA 1H0MA 2AS5F 2PG4A 4AIKA 3QP6A 5H6QA 1I27A 5HLIA 3LQQA 3KP2A 3BOQA 1A04A 1LDKB 2L3DA 1IXRC 3E5UA 2F5FA 1HW1A 1FNNA 1UFMA 1XDUA 1Z9CA 2ISZA 1D8JA 2D1VA 2KKOA 4LG0B 3U9GA 4KT5C 1JXSA 1L0OC 3KFWX 4UUVA 4IHSA 1R00A 3WTWC 4ESFA 2DK5A 4ASNA 1XGOA 5LRSA 1ULYA 4YIFA 2LSOA 1ONVA 3T1BA 1JGSA 2PLYA 2CFXA 2WTEA 2A6EF 3FF5A 1FYMA 3P9KA 1R1TA 1O7FA 3K1PA 2DPDA 3CO7C 4I7HA 2YU3A 2QVOA 3IRRA 1HXDA 2JRTA 4M9SA 2XAFA 2H94A 4MTDA 3HTUA 5FLXZ 4RGXA 4WK8F 1O7LA 4LMYA 5LGTA 3FMSA 4MEXF 3JTHA 2GXBA 1ZAOA 2UZKA 2PI0A 2K7LA 3W6KB 1ZLKA 1HBXG 1S8NA 3MZYA 1TNTA 1F4KA 4XBFA 1K7AA 4HDUA 1Q1HA 4KDPA 4GYIA 5AIPA 3DPLC
chains in the Genus database with same CATH superfamily
2OD5A 1MNMC 1I1SA 3DLAA 1KU2A 2V79A 4V2GA 1PDNC 3GF2A 1JKRC 2XF5A 5FGMA 2L9SA 2Q1ZB 3CZ6A 2VUMJ 2RC4A 3CMMA 4GGGA 2HQ5A 5DD4A 1WHUA 2HOSA 1IUYA 3QU6A 2FQ3A 4IX7A 4PFPA 1E3HA 1Y8QB 5F1JA 3GTQJ 1ENHA 5EG0A 3RJPA 1XDSA 2X6OA 3MKWB 4ENMA 2JA6J 1TWCJ 2V6CA 4ZH4F 3CTAA 1TW3A 2XROA 1YW9A 3TEDA 2NS8A 4LLGF 3CCRI 3OS0A 4PUSA 2HEOA 4EJVA 5JR3A 4AVZA 4BGDA 5EG0B 1FBQA 1Q1VA 3C18A 1FTZA 2LP0A 5LFAA 1RKWA 4R79A 1I6XA 4KYWA 1YTYA 1UJ8A 5EZHA 4EQQA 2JT1A 1F1ZA 4CA0A 4UVCA 3DKWA 4X1EA 3K4BA 1POGA 1XN7A 1TQMA 3S2WA 1OFCX 1LKXA 5GAGJ 4V19K 2EA4A 4QTRA 1K4TA 2BEOA 1BJZA 3HSEA 2W82A 4KICA 2FBKA 4HF2A 1I50J 2XB5A 3BWGA 5E8IA 2LR8A 4IRGA 1YRNA 3ZQ7A 4BNCA 5FKNA 3NARA 1O57A 2ECBA 4F55A 1XB4A 4I6ZA 1BJAA 1SANA 3UKGA 1IGNA 1J5YA 2HZTA 2VJ4A 3HUGA 2DFFA 2KPMA 2M2EA 4PK4A 2L01A 1JT6A 1ORKA 1OCOH 1BBYA 3H9JA 2GIVA 2XV4S 3HKZA 3WGHA 2DOEA 2XUBA 4IQJA 4KFCA 4ZYDA 1OR7C 2K9QA 1E0EA 2ZSIB 4HX7A 5IP7J 2GZWA 4KMUX 5F08A 3Q0UA 1Z1DA 2ICWG 1Z67A 3ZMZA 1KU9A 2XB0X 3PIPF 4IO9F 3LOCA 3G71I 1VQLI 4IZZA 4HA8A 2KQRA 1FBSA 4YFXF 2XAUA 2LBFA 1SVOA 1VQ7I 3EUKL 1VI0A 3H0GJ 4PSWA 4AWXB 4A3FJ 4CCOA 1YFHA 2BOLA 3EYIA 1KZHA 2HOEA 5KAFC 3BG7A 3H5RA 5A2QK 1YO5C 4L5IA 1RIOH 4MQ9F 2IVMA 1ZREA 2L4MA 2EZKA 2QQBA 2W4SA 3TQNA 3L2WA 3S14J 4GO1A 5FRNA 2MH2A 3GTGJ 2DAOA 4LIVA 1X3UA 3IHUA 3WGGA 1X1PA 3TBIA 1MMAA 4MTEA 2V4JC 1XMAA 2KL4A 4G7HF 4UY8I 4OU0A 2HXOA 4CDGA 4RDUA 3ZQQA 3ZMVA 3CCJI 5CQEA 4E70A 3A01B 4LLLA 3HZJA 4E7LA 1KU3A 2E2HJ 4Q48A 1TTYA 3WG9A 3C1DA 5TRDA 3F72A 1SFXA 2F48A 3GLLA 2GOMA 3JSPA 3H1CA 3ZOBA 3ERED 4M9XA 1ZGAA 2Q2EB 3HSFA 5F1RA 2OCEA 3BZCA 2XAQA 2IA1A 1CF7A 4BH9A 1J0RA 1RUOA 1PP7U 4GCVA 1A6IA 4LD5A 3FDYA 1W5CC 3KEOA 3ONQA 3BQZA 2GIZA 3QP5A 4U0WA 1W7PB 2A6TA 3DQVC 1BC8C 1JJ6C 3RZDJ 2R7FA 2ME6A 4G6DA 3I0TA 2HVQA 1HDPA 5LHIA 2V26A 2G7UA 2I5UA 4RAFA 2CSOA 4L0ZB 1IN8A 2DA5A 4EJTA 4OMZA 2ZNYA 3PO2J 4GRIA 4M6YA 1D0ZA 2W57A 1AKHA 2XGEA 4XLFA 3RPUD 2YPRA 4KA4A 2XASA 3LA3A 3IH3A 5F0CA 4ESBA 3GFLA 4K2EA 4MHGA 3SXYA 1YJWI 2VLAA 2K4JA 1APLC 1B1BA 3CUQA 1P6RA 2G7HA 4CCKA 4CHUA 4G6TB 5HS7A 3TKYA 3HOYJ 2BW3B 1CGPA 2O5RA 1F5TA 1QZYA 4I01A 4NQWA 5GTIC 3PQKA 3ABMH 2NAZA 3EETA 1OYWA 1S7EA 2DTZA 4UVBA 3R4KA 3AL0C 1MMNA 3K7AJ 3L00A 2JA5J 1TQIA 2N8GA 3TO7A 3WG7H 1DDNA 4ENNA 4B47A 1XPXA 3FXUA 1U9OA 1ZK8A 1UHWA 2VJJA 3DU5A 2M4KA 2BVLA 4PJJA 4XORA 1T38A 3CJRB 3K4KA 1WJDA 3AG1H 1PYVA 1V54H 2IBDA 3HRMA 3MWMA 2O6GE 3HL2A 1TWHJ 2DYSH 4B8XA 2FBHA 2ZJQF 2QSGX 5HNFA 3E3VA 2M1BA 2YR2A 4ZYAA 1GXPA 1B4AA 1WJFA 1HW5A 4BUPA 1QHGA 1Y39A 2VQLA 2I10A 1YRNB 5EEHA 2DYRH 3DFGA 1JT0A 1MW7A 3BR5A 1XD7A 2VKHA 2BYVE 2QSHX 3BTLA 1ZGWA 4MFDA 2QSFX 3FIWA 2OC6A 2M0MA 2K85A 2FBIA 2PMZN 3OV8A 1KYWA 3MKYB 1KQ8A 1HF0A 3BR6A 1MH3A 4A5MA 1RC9A 2R7TA 2FD5A 2ZJ2A 5IT3A 2PX9A 2XPWA 3RYPA 2RNGA 3TO6A 2KIQA 3ZRGA 3MKLA 3KIOA 1J75A 5K7ZA 3K0LA 1MH4A 2DA3A 1I39A 2XKPA 2VPLA 1U9NA 1Z91A 2H27A 4ZDLA 1JHFA 2HZDA 2P4WA 3OYLA 2E1NA 2E36A 2VIXA 3FBNB 4UVAA 4P9FA 1FC3A 4BHCA 1KQ0A 4S05A 3AG3H 1X2MA 2E1CA 1Z7UA 2IXSA 4IVNA 3V42A 1VQNI 4L9NA 3QRFF 3NWTA 1T0FA 4J00A 4BE2A 5JI6A 4MFEA 3COAC 1EH6A 3WE3A 2HR3A 5JVGF 5GAEJ 4F7ZA 2QUFA 1ON1A 1B9NA 1FOWA 1RZ4A 3JRCA 3DTKA 3CDIA 3S93A 2LY2A 3HOUJ 4TV7A 3O2PE 1TZLA 3QAHA 2EFQA 4WF2A 1X3WB 2WY8Q 1D5VA 3OIOA 4FTHA 4CYCB 1YIJI 1ZRDA 4HSRA 3RPQA 2CGPA 2HGCA 3H3VK 1Z3YA 4HNUA 2CRGA 1HKTA 1K78B 1D8KA 1X58A 2LFBA 3IWFA 4A0YA 3RIRA 3BPXA 3OOPA 3UR3C 1IG7A 3M4OJ 1T95A 1A36A 4KIGA 3FXKA 2QGUA 2K9LA 3GZNB 2BY2A 4AU7A 1Z05A 1D1CA 1YQAA 4MLOA 4QWQA 1WPKA 4BJTA 4HNTA 1O3RA 1BM9A 3M07A 4FX4A 3CD6I 1MGTA 1FLIA 3HHHA 5HVQC 2UWMA 1S9HA 3JAMZ 1JUSA 2F2EA 4A3LJ 5E3LA 3CJNA 3K4NA 3CLQA 3R0JA 5HDGA 1WKMA 2VBZA 3G2BA 5KAIC 2CU7A 3S17J 4MEYF 4LITA 4BS9A 3OYGA 3RI4A 1BW6A 3X2QH 3HPHA 2YS9A 2GWRA 2CUFA 5IOZA 2P6TA 3FHNA 1TT0A 2DJNA 3L9FA 4EATA 2GM4A 3WGIA 1OCTC 3QYEA 3IH2A 2DT6A 2LK2A 4A0ZA 2ZMEA 5CVJA 4A6DA 4LG0A 2FJ1A 3O8HA 3RKQA 1WJBA 2XPVA 4M73A 1DPUA 3FXQA 2NVXJ 2CG4A 4W97A 1P9QC 4V2FA 3VSLA 4IF4A 2VOOA 2DMPA 2MLKA 1KONA 1OYIA 2OV7A 3H5AA 3OIQA 1T98A 3QU3A 4ZYHA 5LBQA 4PFOA 1VQMI 2DOAA 2Z16A 2ZMEB 4NC8A 2DQRA 3L2CA 3K70D 3CUQC 3MVPA 1FMWA 2F4OB 4UUSA 2TDXA 2XF7A 4BL0B 1SFKA 1U3EM 1VQPI 2NYXA 5M5WJ 2IGOA 4UB6C 1RKTA 5BQTA 2JN6A 2BGCA 4IPAA 3EYYA 1ETWA 1FMVA 5KVRA 4ETSA 2EA2A 2JSPA 3LA7A 2FNAA 5E20A 3I59A 3E1SA 1JTXA 3CCLI 1H89C 1FOYA 1TW2A 2M0CA 1QO0D 1N78A 4AIHA 3V7CA 1VTNC 4LB5A 4A3MJ 3JRDA 1K61A 4MGRA 4CSWA 3OSFA 1FJLA 3KX2A 2XVCA 3R60A 5D5UB 1XSVA 1SC7A 3N97A 2KT0A 1QPMA 4FQGA 3E6BA 4X6AJ 4HW0A 4FCYA 1Z3XA 1SD6A 2P5VA 4P55A 3QPLA 2OZUA 1G3SA 1TNSA 2LOOA 2E7XA 3Q0VA 4LK0F 4CYCA 2PMZA 3LFUA 2E34A 4OIOF 3K4MA 1GV2A 3SDGA 1Y1VJ 4B3AA 5E17F 1QQIA 3DCFA 2LNBA 3ZQLA 1YX3A 2DA2A 4AYBN 1VQ6I 2LY9A 2MD0A 1FSHA 3CF5F 4P5OA 3PL8A 2EK5A 2K5CA 3ZMSA 3DWLE 2ID3A 3KE2A 1R23A 2XKOA 4B3XA 3TL4X 4QLCU 3I4NJ 2JZYA 4YIRX 1S3JA 4C3HJ 4DNCA 1WI9A 2E60A 5E1XA 1UG2A 2IA2A 1S29A 4BXUA 1HA8A 5K5QA 3Q9VA 1D1AA 1PJRA 2W24A 1HQCA 2W1OA 3F8FA 2L5QA 5EJCA 3OOUA 2PMHA 5B1AH 1CF7B 1MD0A 2LVSA 5D8KB 3BG3A 4XKVA 2F4MB 1N25A 1YITI 2Z99A 3FXOA 3RTRA 3A02A 3HGYA 2FU4A 1V5FA 2M4GA 2CW0F 3FKJA 4H4KC 4CO8A 2R5YB 1R49A 1WRJA 4YFKF 2GBYA 5L3CA 3OIPA 1BA5A 3E7LA 2QQ9A 3JW4A 3A01A 1FWZA 4S0HB 2HU9A 3CUOA 1OPCA 3Q0WA 3I9V2 1R58A 3WTXC 1GVDA 3K6GA 5D4SA 3LL7A 2QKMB 3P9CA 5L3EA 2DO7A 2OPTA 2B0LA 5LD2C 4KUMA 1LFUP 1NG7A 5CVUA 1R71A 4IXAA 1X4PA 1XMKA 2HQRA 2AXTC 2ISYA 4GFBA 3BY6A 4WXDA 3TW6A 3PNTA 4BQOA 2XRLA 3BG9A 2EFNA 5GPCA 3GLXA 5E79C 5ICGA 2FX0A 2Z5UA 2HOTA 4PZJA 4LB6B 3GX4X 3H9QA 1YI2I 2V1UA 4XONA 4F91B 3PSIA 5FROA 3HRUA 2X1EA 3U1KA 4HV5A 1PP8F 1JHHA 5L3FA 4NDLA 2LY1A 3BG5A 4XKCA 3NAUA 4Y15A 2UXXA 2E2IJ 4BYYA 1K78A 2IT0A 1X3ZB 2E1OA 4ITVA 3OYEA 3W2AA 1M1EB 4XOPA 3DEUA 3JRIA 1OMIA 4N4NB 4CCLA 4PCQA 1QNTA 5E8GA 1J7KA 1GT0C 4D5CA 2EINH 2RQPA 3JR9A 2R7XA 3H9GA 2R5ZA 3T8TA 1G4DA 4FX0A 1K6YA 2BVMA 2VBXA 2XGCA 3J81K 2BBYA 4LOCA 1NH3A 1LDDA 2DFIA 4FASD 4EJOA 2K9NA 5CQGA 1SMYF 2R0QC 4HEA2 3G1LA 1WQ2A 4BJ5C 1IRGA 2GXGA 2XC7A 2CV2A 3TMOA 4LFUA 2PJRB 2CQKA 2WAQN 3S15J 4G8XA 4KIBA 1RR8C 1I6HJ 3TDZC 2LBFB 4RLQA 2XHKA 5HODA 4IQ4A 3HJEA 3OYAA 4XR6A 4A6EA 1GVJA 1GV5A 2R7ZJ 1A5JA 1FYLA 4JYKA 4RAGA 1FP1D 3TOBA 2ACJA 4NC6A 5LLQA 2DW4A 3H36A 1YX5A 2KHMA 3RQIA 1EH7A 3LSKA 1JJ8C 5JFRA 2M45A 1B9MA 3DBRB 2Y31A 5GP9A 3SEQA 2CQXA 3I4MJ 1BIAA 4HBLA 2Y30A 2QLZA 4D9JA 3GBGA 3GTMJ 5TJJA 3E0JB 2HKXA 2MBFA 4EVIA 5ICEA 2EIMH 2FNPA 2CUZA 5ICCA 4KISA 2CW7A 4UXNA 1U5TC 2FRHA 3PUFA 3I59B 3TGNA 1W1WE 4BDZA 3AAFA 2QEXI 1TBXA 2M8EA 4AD9A 3L2RA 3S8PA 2IAIA 5EYRA 3M3YJ 1XSXA 5EEGA 5GPAA 3T8RA 4IHVA 1WWXA 3BCBA 3CP8A 2MA3A 5H2FC 1D1BA 2Y0MA 2I8DA 4JX5A 2GQQA 3BP8A 2Q0OA 4EGYA 2CMPA 1IXSB 2Z1DA 2JMWA 4OMYA 2VE9A 4KN4X 2VKEA 4BU2A 5ILUA 1ETOA 1RI7A 1MSEC 1MMGA 3E5XA 1ZG3A 4BJ6C 2JA8J 1LPQA 1G2HA 3HOXJ 1L3LA 1B8IA 3S2HJ 3O6BB 2BY1A 1ZLJA 3I55I 4HNVA 5ED4A 4B1RA 3M1EA 2M8GX 3S1QJ 3BT9A 3VPRA 1AU7A 2BV6A 2LKSA 3K4CA 3VWBA 2Z33A 2MC3A 2IS4A 2PMUA 2ZXWH 4LIUA 5IYBJ 1DUXC 1MBKA 2KJBA 1ZH5A 5E3OA 2O3FA 3D1NI 3F22A 5HDKA 3ZQIA 5FFXA 1X1CA 3EQLF 1SD5A 1FX7A 5B3SH 3JAMK 2JSCA 3HUGB 2QA4I 4BEHA 3IL2A 4G7OF 1Y8RB 2XPUA 1KA8A 2FXAA 2NS0A 4E7SA 3F8BA 5E3NA 1VQ4I 3TP3A 3OYNA 4KT6A 1IW7F 3A4CA 1WI3A 3K4JA 3HOSA 4IJAA 5TISC 4I2OA 2O0YA 1ZN2A 2K9SA 3B6CA 4M3FA 4ZTJA 5FO5A 4PGHA 2HKOA 2O8KA 2ME0A 1BI3A 4II3A 3AL0B 2KZVA 1ON2A 1Z77A 1VQ8I 2DA1A 1YW7A 4RLFA 3DEEA 2DBBA 2R92J 4MNUA 2HPIA 1Y6IA 3P5JA 1FT9A 3VB2A 3OYDA 3LSRA 2MLGA 3BDDA 2PQ8A 2ZJRF 4LJZF 2L9VA 2VOPA 2XAGA 2Y2ZA 1IF1A 3FK6A 5ILSA 3KETA 2IP2A 2EWNA 3MAJA 3EUHC 2MFZA 2VKVA 3OWTA 2ZXJA 5DUIA 4U0VA 3GTKJ 4FISA 2JPCA 4DBRA 3SZTA 5HLGA 1Z6TA 3PNYA 4PJMA 2DDAA 1W7PA 2WV1A 1V3FA 2QYOA 4NUBA 2VXZA 3H0DA 2JA7J 3J7AY 5DYMA 4XMYA 2M87A 4ZDPA 4XRMA 3VODA 4XRSA 2JWTA 4YEJA 3KP4A 1FY7A 3QYBA 3HSRA 1MIJA 2EFOA 2E19A 1OCPA 2ZXHA 1EH8A 3OYHA 1U8BA 3PFYA 1HC8A 1NK2P 4CZZA 1MNEA 4RB2C 1TT5B 3JRFA 1H8AC 3G3ZA 5F27A 1ZR4A 3REOA 1FIPA 2CFOA 2JUCA 3HXLA 1IXCA 2BW3A 2FUG2 2DT5A 4HLXA 1ITYA 5EGOA 1BOAA 3OSGA 3CCVI 1WSUA 3KZIC 3LSIA 1JUMA 3FK7A 5F0HA 3DTEA 2WV0A 2RDPA 1W5TA 2M7BA 3I58A 3ABUA 4I99C 4M3DA 2M7AA 3LWFA 1HSJA 4L9JA 3BR3A 4DYQA 1T33A 1EF4A 1Y56A 2YX7A 1X19A 3CMEI 3FHZA 3WTYC 4DZJA 4NHJA 4KMFA 4CH7A 5D5XB 5C4XJ 1ZRFA 3OYIA 2X85A 1LE8B 4BQQA 1BR1A 4ENKA 2FMYA 1FOXA 4PDKA 2LH9A 3RQ4A 5DDGA 3NEUA 2IW5A 3BROA 2QWWA 2JK3A 2EZHA 4AIDA 1TWFJ 4NQWB 4AVPA 1HKSA 2VT3A 3BJAA 3ABKH 4NB5A 2Y48A 4BHBA 2JUGA 4RA2A 4KNYA 2HS5A 2CQQA 3G1MA 1X1AA 3ZP5A 2VODA 1FZPB 4G9YA 3FXRA 3ZN1A 4KJZA 3FMRA 3KPHA 3VOEA 1I1GA 4E7HA 3BTJA 4F93B 1BIBA 1W7PD 2XSDC 1LVAA 2ZFWA 3S32A 3V7SA 3RKWA 1PVEA 4II2A 1XC5A 5JVTA 3MD2A 2H1LA 3D0SA 4CICA 4Y4RA 4A12A 1VFCA 3IC7A 5FKOA 4EGZA 2L7MP 3A2KA 2KIMA 3W2WA 2ZJPF 2J5PA 3N4MA 2A5YB 2X51A 2Y0SA 3F8MA 2VBYA 2KIUA 3DBHB 3RKYA 3ZR8X 2NNYA 3FXLA 2VN2A 3LSTA 3A0HC 2IS6A 4EM0B 2M5WA 4YG2F 3WTTC 4RB1A 3E97A 4JP0A 1SFUA 2COMA 3ASOH 4RM2A 2EQRA 1K4SA 1GXQA 2L9NA 3ECOA 4A93J 2EH3A 3DP7A 3F23A 4L0YB 5C44J 3FXMA 2HQNA 5LRRA 2KRCA 2EIKH 2JVGA 1W0TA 4GDFA 1Z21A 4XLNF 1H9TA 2VQHA 3ML6A 4EV0A 1RRJA 5D6FA 3DTIA 2DFHA 4AIJA 1MBJA 3KCCA 5JHUA 4RB3C 3EPZA 3GMEA 1QVUA 3NQOA 4C3IJ 3G6EI 2B9SA 5A2QZ 2A61A 4BE1A 1RETA 3CJQB 3ZQHA 4L5EA 3CDLA 5FLMJ 1BN5A 1FPQA 1JUPA 2ZO4A 1LNWA 3W2VA 2L7ZA 3SZGA 4DYRA 3GUDA 1IAWA 3GTPJ 5KK1A 2P6SA 4WX9A 5BPIA 3W3CA 4XN0A 2NOJB 4YIIA 5L3GA 2LDUA 2R3SA 3HYIA 1RESA 2PN6A 4I76A 3M8FA 3NWSA 1R1UA 1YS6A 2DXIA 1W0UA 3EUHA 1HOMA 5DS9A 3J7YJ 2RQQA 5D6EA 1ZRCA 3HOTA 3WHCA 2IPQX 2ZC2A 2CW8A 1S7AA 3WE2A 3KYDB 3ABLH 3A0BC 3GVAA 4HV6A 1LVKA 2CQ7A 4N9HA 4Y13A 5FLVA 3GTJJ 4JOMA 1S72I 1LFPA 1XCVA 1O4XA 2R7UA 3ZGKA 2QENA 2DDBA 3CJTB 4I09A 5AONA 2L4AA 2UUZA 1T39A 1VNDA 3BR2A 5IYDJ 4BBRJ 1FSEA 3CUQB 1REPC 3HOVJ 3W6JB 9ANTA 3GXOA 4XM3A 1ETKA 5M5YJ 1BR4A 5DCFA 1E3OC 2B7EA 2QBYA 2CQNA 1LDJA 1WGXA 1JGGA 2PEXA 4XKBA 2V9KA 3SFZA 3J7ZI 4J01A 4ZZLA 4D7MA 1WJAA 1MDMB 4HAMA 2OQRA 3I3LA 4D0PA 2JVHA 2MG4A 2DOFA 2RGVA 1WCMJ 3HRSA 1BI1A 1X4OA 3P7NA 1N77A 3H3ZA 5CYVA 3TDUC 2J5OA 4PSXA 2DA7A 3JRGA 1ZHFA 1ZARA 2A68F 3SZPA 4OIQF 2R7SA 2A5WA 1I3AA 4UHTA 2VONA 1W36D 2X6WA 4M74A 3F6OA 2DTRA 2H09A 3E6DA 3LAJA 4A2UA 2OTLI 2CYYA 2CH0A 2E7WA 2DMUA 5F64A 3JREA 2GA1A 2HTJA 2Q2EA 1TQPA 2F5VA 1YIOA 3LAPA 2FE3A 5ICFA 1B59A 1S6LA 4IEJA 5CVVA 1MBEA 3HBLA 1R9TJ 2Y9YA 3PJRA 2R93J 1ZR2A 2R4GA 2WB1A 2ZMEC 2A05A 3BR0A 1XSDA 3D5SC 5EEAA 4ZJZA 1IN7A 2MH9A 2OCCH 1YYVA 4UNOA 3I53A 4EJUA 3MEXA 5E3MA 2NVYJ 5K5RA 1R4NB 4P9UA 2LKXA 1C0WA 2HTSA 1YG2A 4ENJA 3KP5A 2AXLA 3R6SA 3AG4H 2LF8A 3BZ6A 1K83J 4NNJA 2WADA 3WTVC 4IL6C 1SD4A 3QPHA 3AKZA 2VI6A 2VE8A 2HDCA 5HS9A 3T5XA 4DYCA 1HKQA 4RB0A 4BHPA 3CMYA 1K79A 2EV5A 4PGGA 2F4IA 1T2KA 5FLXK 3D5LA 2KISA 3FWEA 4Y52J 1R5HA 5K1YA 2R5ZB 4A3JJ 1MDMA 1KU7A 3NRVA 4NBQA 1GUUA 1RUNA 1MJAA 2EZLA 4U7DA 1U0JA 4A0XA 5DUKA 1YLFA 3OL4A 1FYKA 5EDNA 1H9GA 1E3PA 3VEPA 4L18B 5C3EJ 3L2VA 2XRNA 1O3TA 5D8LB 5DCMA 1D5YA 4AM3A 2W7NA 1W4MA 1OLTA 2XGDA 2KDZA 2P0WA 2EFPA 2YU9J 3H5NA 2RAEA 4CCMA 4M71A 4WCGA 2NXNB 3L2QA 1U78A 3HTSB 1D0XA 3HM5A 1V55H 1AHDP 1MZBA 4L9TA 4P1WA 4Y17A 1O3QA 2HQAA 2R7DA 5HS8A 4IHTA 3U2RA 1DQUA 2K9MA 3JSOA 3LFKA 2P5LC 1PUFA 1IZ1A 2K40A 3QWLA 5L3DA 4AC0A 1FBUA 3K4LA 5D5WB 2OUMA 1ZGJA 2P8TA 2VQGA 1SFEA 2WAFA 2ZNZA 2V6EA 2MGQA 4JK1X 3ZN0A 1WH7A 2LD5A 3HG9A 3G1OA 2IJLA 3LNQA 2V9PA 1V4RA 4MIMA 1IRFA 2P5KA 1XGMA 2E5ZA 2XF6A 3SEZA 1W36C 4M6VA 5BMZA 2FF4A 1P4AA 2LYCA 2IRFG 1Y0NA 2VT2A 2AQEA 5IP9J 2HPMA 1R6RA 1IV8A 4G6QA 2FA5A 2NS7A 2W25A 3ELKA 3LSHA 2LREA 1T8IA 2V7FA 4RGSA 3BPVA 5J3LA 3BJ6A 2HDWA 1DGRM 1RPWA 2ZB9A 1SAXA 1QZZA 4HQMA 1XGNA 2BHYA 3FX3A 3HB9A 3GYHX 2WC2A 3SQNA 4IRIA 2FMLA 3KEQA 1UHSA 3OS1A 2H8RA 4I02A 1SVLA 4WXHA 2DPUA 4FHTA 2L9RA 4XSXF 1UG0A 4BBSJ 3MCZA 5LGUA 3HIFA 4E7KA 1YOVB 4L9VA 1B6AA 5J4VA 2D1HA 3DXJF 1LFBA 2ID6A 1ZG1A 5GAHJ 4PJ0C 4DJAA 3J7AO 3K2AA 4DGWB 3VYTB 5K5OA 1IN5A 5F04A 3IP4B 3WTZA 4EEFG 4RMNA 1OQYA 2EPFA 4BDYA 2CS3A 3LQRA 2K02A 5JLXA 2OQGA 2DT7B 2KJCA 4HX8A 1VQ9I 1IDZA 3A03A 4XRSG 4XN3A 4XK4A 2MSYA 2KLOA 1IN6A 3DLLF 2OU2A 4BQNA 1J9IA 4Z2YA 3S2DJ 5B66C 3WTSC 5E1WA 1FIAA 2XIGA 1O3SA 4BXXJ 1MBFA 1UHMA 2RN7A 3J80Z 1R36A 1QVTA 3D5RC 4UB8C 4ANJA 1ETVA 3E5QA 3ZCOA 3FZVA 4A69C 3CCQI 4PJLA 1T6SA 3H92A 2BXZA 4BAYA 1SD7A 1U5TB 2VC0A 4JX6A 5HOOA 3GZ6A 2NVTJ 3S3NA 4KN7X 1WVRA 3KP3A 1LJ9A 3FM3A 1DP7P 1GHCA 5IPAA 4OOIA 4E4HA 1XMXA 4XIDA 1CQTA 4JQFA 2BY0A 2VL8A 3IKTA 2A07F 3F0CA 1SAUA 5M3MJ 4WWCA 1G6NA 2DCEA 2QQ8A 2VC1A 1P7IA 1BOBA 5FRMA 4RGRA 3SHFA 1HW2A 1DGWY 2GA2A 1LE8A 3DPTA 2PBIA 5H20A 1FP2A 2UXNA 2F5CA 4B48A 2HYGD 3DPUA 3GEZA 1N75A 1NTCA 2LF7A 3C2BA 3CC2I 3JRAA 1LQ1A 1B72B 1AWCA 2E5NA 3BTIA 3I64A 2QM3A 1G3TA 5KNLA 2DODA 4IRHA 4M3GA 3OYKA 4CGZA 2W85A 1A6QA 1WJ5A 1JE8A 3C2GA 3DF8A 5J4YA 4XLHA 2CV1A 2BY3A 4FE4A 2RREA 1EV7A 4CXFA 1TP4A 5FD5A 5GADJ 1OISA 2DMNA 2DLLA 5DCMB 3J81Z 3B02A 2LRDA 2R7OA 2IS1A 1RNLA 2OAZA 2DJIA 4XNFA 4ESJA 1YJ9I 1R5GA 1OCCH 5FKMA 3S1NJ 1F43A 1QU3A 4P96A 2LC2A 5HLHA 1S5LC 2K27A 3CQZJ 2EIJH 2QKLB 3I5UA 1X2NA 2L2OA 4CYDA 2FEZA 3VSKA 5J1YA 3CO6C 3Q3SA 2C6YA 2OTJI 3DU6A 2DK8A 3JRBA 1YHQI 5EZGA 4H0EA 6PAXA 2X1DA 2GAUA 3G4SI 2WWYA 1YS7A 1QZEA 2WAQA 2KMUA 2WAEA 1R22A 3LA2A 1DPRA 4BKXA 5BNGA 3S1MJ 2MC4A 1X1BA 5D4RA 2EV0A 3HGGA 1WH5A 5LGNA 5FB2A 3TO9A 4U0YA 1QHHD 1W5SA 2WY7Q 1G3WA 2DI3A 4I0BA 3HOZJ 1QGPA 3GWZA 4A3KJ 3K2ZA 2GOXB 3HEFA 2RNJA 1I5ZA 3WU1B 4A3CJ 2ZKZA 3T0YA 3OYBA 4ZYEA 4LK1F 3ABTA 4CZCA 2JQ7A 2VQCA 2NNNA 4DBQA 5J47A 3BC8A 1NK3P 3IWZA 4Q4ZF 4XSZF 4JX4A 4OINF 2NOGA 2STWA 4EMSA 5ILVA 1YE9A 4W1UA 1A31A 3GO5A 5CVRA 4B43A 3QODA 3QPTA 4BXFA 2D2WA 2R7QA 2IGKA 2Z9OA 2MW8A 4XRFA 2EJRA 2K4BA 1D3YA 1J09A 1FOKA 1TLHB 5HNHA 3DV8A 2H6CA 2EZIA 4DOZA 1BL0A 1MBGA 4IOCF 5BS6A 3ZPLA 1OKRA 1U6GA 2QCOA 4BY1J 1E17A 2XAHA 4OIRF 3P9IA 1LEAA 5J8FA 3C2HA 3ULQB 5DM6F 3HHGA 5H6RA 5IT9K 4X0GA 2LKPA 4OIPF 2XGXA 2YX4A 2PFBA 2W48A 2JPBA 3F8CA 4FT8A 3RZOJ 3RDIA 4C2MJ 4YRVA 1LB2A 3Q9SA 4QSHA 3KYCB 4ZZDA 2F5EA 4XQFA 1YJNI 2VJ5A 2R7RA 4GYGA 2OJED 4ZYGA 2DA6A 3I54A 2M3AA 1TC3C 2CWEA 2BHZA 2A6HF 2EV6A 3L2UA 3KZYA 3J80K 4R8HA 4QPQA 2XSJC 2Q8KA 5E1ZB 2ELJA 3KP7A 5DTDA 2A69F 2YSRA 5E18F 2KRFA 3BCAA 2LMDA 1MMDA 1U5TA 1V5GA 2VBWA 3TOAA 4CCNA 1LEBA 4A3BJ 5D5VB 5CKTA 1S7OA 3TP0A 5KHDA 2E35A 1XCBA 4M6XA 3JRHA 4LLNA 2D5VA 2OF7A 4HLYA 3PUBA 2VASA 2BXYA 2E71A 4N0BA 2DU9A 2AO9A 1ERDA 3R61A 1JKQC 1JI8A 1K6OA 2X48A 4EM2A 2XAJA 2O03A 2V9VA 2ELKA 3ZXSA 3WTUC 1ZG5A 3AG2H 3F6VA 3CP2A 3V4GA 2ZCWA 4U88A 2L7KA 2O61A 2HOAA 2X9DA 1SMTA 1IN4A 1NG6A 2KDOA 4UUSB 4IHWA 1T0FC 3IKVA 3RPUA 4IOAF 2EFWA 3Q5FA 2ESHA 3WU2C 1XX5A 4RBOA 4HF1A 3L1PA 2STTA 3OYCA 5DEQA 3BG6A 4EM1A 3RYRA 1F9NA 2DMTA 2Y75A 3PIOF 1XGSA 4IHXA 4HRIA 4UV8A 1B8IB 1ODDA 3HPGA 1P4WA 1BI2A 5LHGA 1KGSA 2P7VB 3M9AA 4M9ZA 2COBA 5JHFA 3ISPA 2FSWA 4I0AA 4HDVA 1MMSA 1PUEE 2B63J 3DKYA 2G9WA 4ZC3A 1AKHB 2A3SA 3WU0A 3GFMA 1WJCA 4HQEA 1IDYA 4M3BA 1QPIA 2H1KA 4HZFA 1FEXA 1R1VA 4O5VA 2R5YA 1G8XA 1ETXA 3GFJA 4XOTA 2O7OA 3ERMA 5CVIA 5GTHC 3MQ0A 3S3MA 3K1NA 4LG3A 5LHHA 1SVMA 1STZA 3ZMTA 1HSTA 2HI3A 2UV1A 3VYUB 3K69A 4Y33A 1VQOI 1BI0A 4RGUA 3CDHA 4U7BA 4QIWN 3OY9A 4J19A 5FKLA 4A3DJ 2L02A 1MJBA 3CC7I 2P7CB 2IGMA 4M72A 2KP6A 4JBAA 1Z0XA 5LEJA 1KQ9A 3KLOA 3MZ8A 3PNVA 1MBHA 3AFHA 3U1DA 3V8JA 4D5FA 2MYSA 3BTCA 5HDNA 2HYJA 2WA0A 3K9TA 4E7IA 2L0KA 3TW7A 3G73A 2ELHA 2CUEA 2FOKA 2NVQJ 4C2TA 3MFKA 1G59A 3DEWA 1ZTRA 5CJ9A 5EGOB 3M1CA 4MQVA 3GTLJ 2EB7A 3PFIA 3I56I 5EF6A 2E1MB 3L7WA 3LMMA 1AOYA 3K1MA 4F92B 2Z3YA 4A3IJ 4HYEA 2ZBKA 1P92A 3MMYB 3W6VA 1NHAA 1P4XA 4A5NA 5IYCJ 1HLVA 3GW2A 3H35A 3HRTA 4XL9A 2X4HA 3ROUA 4CCJA 4G7ZF 2X6XA 4ABZA 1UZCA 1IV6A 4C3JJ 4KIFA 5L3BA 4DZPA 5IP6A 3M8EA 2HWVA 4CUGA 3ZQGA 4WXCA 2PJPA 2CJJA 4HX4A 4B44A 3DBLB 3MKZA 1MSFC 4BACA 3C7JA 3H3UA 2W00A 2QBYB 4DQ2A 2RVCA 3CF2A 3QYFA 3R0AA 5M3FJ 3UNGC 3GZ5A 3LSJA 1MJ9A 2XDVA 1KYZA 1ZKGA 3FISA 3F21A 4R1HA 3E6CC 1MKMA 2R7VA 2YUSA 2AHQA 4A3EJ 5JLWA 3VFZA 2TCTA 3OMYA 2HFHA 2O8XA 4FETA 3V7RA 3IRQA 2WBMA 4OAYA 4AUXA 2ETHA 5J8CA 5IT9Z 3QOPA 3IAM2 4O3MA 3S1RJ 3I71A 3FBIB 1FTTA 2Y69H 3F8NA 4A3GJ 5K7FA 5FD6A 2E2JJ 5CLSA 2D45A 3HKZN 5FJ8J 4E7ZA 3V8KA 3F3XA 1IC8A 2O9LA 2EBIA 1R7JA 4HOBA 1D0YA 3IAS2 1R5ID 1Y0UA 1J59A 2DN0A 2HYFA 4Q5SF 4RAZA 3F9KA 3PQJA 3KLNA 5DD8A 1F36A 3WODF 3EUAA 1T08B 4RS8A 5B5EC 3HOWJ 1JKOC 3CC4I 4N9IA 5BPDA 4BY7J 2BE5F 1Z6RA 3IH4A 4B4CA 2K86A 2MABA 4Z6YA 2DMQA 3JTGA 3HDDA 3A1YA 4LGWA 2QZ8A 1X1DA 4I98B 5IOYA 4F3QA 4YFNF 1H88C 4YELA 2KZGA 2X0LA 3LSPA 3QOEA 1LUJB 1USTA 1WJEA 4ON0A 3I4PA 4ZDOA 1SEUA 4O6JA 3VYRB 1ZYRF 2JTVA 3IUOA 2IA0A 2K3FA 2QQAA 3BZKA 3ZMDA 5BOXA 5LEKA 2MD5A 2OA4A 2QF7A 1USSA 3B73A 4C2UA 5DM7F 3WHBA 4BE0A 3FKIJ 1EKEA 1XTAA 1JTYA 3RSNA 1EJ9A 4KITB 3KP6A 1E2XA 4DW6A 1G3YA 2ZFUA 2RKHA 2RV8A 3VYSB 3ESWB 2OBPA 3RKXA 2L7FP 2LTPA 3JCUC 3RCOA 4U87A 2JJ7A 3KEYA 3QQAA 3CESA 4S04A 1MNDA 3CMAI 2IGNA 3S16J 2H6BA 2HVRA 1UB9A 5F6FA 1ETYA 5HLTA 2HVSA 1J2XA 4RM3A 5ERIA 1AA7A 3PM1A 3ZMUA 1VF9A 1ZELA 2VKDA 3E6MA 4GXOA 4HG2A 1BR2A 3OYJA 1B72A 3O3KA 4XLEA 2V1NA 1TWGJ 3FM5A 4Y3OA 1ZQ3P 1Z7LA 1YW8A 2EILH 1T56A 3ZQFA 2NVUB 3ZQCA 5J1RA 2DQLA 1ETQA 3CLOA 1TL8A 1XS9A 5AIQA 1QBJA 4Q47A 2M34A 1Y1WJ 2KIFA 4HF0A 4XKWA 4EJWA 1OR7A 3KZZA 3ECHA 4B09A 5DV5A 3GCMA 1HDDC 4D1QA 2JA2A 5J6XA 2L54A 1QRYA 2F5DA 2LLKA 1VQ5I 2ADUA 3SYTA 2ESNA 2CV0A 4PJNA 4M3EA 3SJMA 1OYYA 2P81A 1R4MB 2GXAA 1IJWC 5F0FA 2ZXIA 3ASNH 4UV9A 2V1DA 2W84A 1U2WA 2FOWA 1OJLA 1JKPC 1BW5A 1A35A 4BQAA 3M7GA 1IRZA 1DU6A 5M5XJ 4AYBA 1SFOJ 1UAAA 2CO5A 2WB1N 3L09A 4IHYA 4G94A 2NRAC 2IEKA 2BZTA 4RAYA 4E7JA 5TGTA 2V1XA 3K70C 1U8RA 2M30A 3MZHA 1GDTA 5J1UA 4HPQA 3DKXA 3V8LA 3BJOA 2OZ6A 2F6CA 2X6YA 3C3WA 3FMQA 4C9YA 4DIQA 4XLPF 3GFIA 1P2FA 1BC7C 4IKFA 5FKKA 4D7NA 2CUJA 3EDPA 5C4JJ 4OAZA 4L5JA 4N4OB 5FFZA 1OCZH 1UCRA 1H0MA 3BLYA 2LG4A 2JRMA 3OYFA 2AS5F 2PG4A 4AIKA 3QP6A 5H6QA 1DP3A 1WZ2A 2M9HA 1I27A 5HLIA 2VXDA 5B1BH 2Y0SN 3K10A 3LQQA 2GLOA 2ZSHB 2DA4A 4FE7A 5KCMA 1QA6A 3KP2A 3BOQA 4E6KG 1A04A 4ZTFA 1P7JA 1LDKB 3PSFA 3CCUI 2DFEA 2L3DA 1XG1A 1IXRC 3KYLA 3E5UA 2F5FA 3QPSA 1HW1A 4OWRB 1WFXA 1FNNA 1UFMA 3CCEI 1XDUA 3OYMA 2AQFA 5K7HA 1Z9CA 3MN2A 2ISZA 2D1VA 1D8JA 2KKOA 3N05A 4LG0B 3U9GA 4KT5C 1JXSA 3FXJA 1L0OC 2PJRA 3KFWX 4UUVA 4IHSA 1UELB 2E1MC 2VJIA 1R00A 2KRHA 4QPOA 2KFDA 3CCSI 3PO3J 3WTWC 4ESFA 2DK5A 3U21A 4BEHB 4MO7A 1PUFB 4ASNA 1XGOA 3M8JA 4XLCA 5LRSA 1ULYA 4HSTA 4YIFA 2LSOA 3OR1C 1ONVA 4C30A 5J40A 1RR7A 3T1BA 1JGSA 1VZ0A 2PLYA 2CFXA 2FQ4A 2A6EF 2WTEA 4XICA 3FF5A 3BR1A 1TWAJ 1FYMA 2HDDA 3LSGA 3P9KA 5IY5H 1R1TA 1O7FA 3K1PA 2Z2SB 2HNHA 2DPDA 3CO7C 1HCRA 2VB6A 3IV5A 4I7HA 5CPRB 2TRTA 4F52A 2YU3A 2QVOA 3CCMI 3IRRA 1HXDA 2ECCA 2JRTA 1I3QJ 3SFIA 4M9SA 1VQKI 3SDBA 2XAFA 1GLNA 2X1CA 4G12A 3OS2A 2H94A 4MTDA 3HTUA 3LSMA 2VPRA 1ACIA 5FLXZ 4NC7A 4RGXA 4WK8F 1O7LA 4LMYA 3OR2C 5LGTA 1OCRH 3FMSA 3OL3A 4MEXF 3JTHA 2GXBA 3GTOJ 2H8WA 1ZAOA 4Y7NJ 2UZKA 2PI0A 2K7LA 3CCYA 3HC7A 3W6KB 1ZLKA 3VDXA 1UMQA 4UUTA 2R7WA 1HBXG 4XLAA 1IUFA 2G0EA 1S8NA 1IRXA 3MZYA 3S3OA 2IS2A 1V5EA 1IO2A 2Y9ZA 1TNTA 1F4KA 4XBFA 3B6AA 1K7AA 2K3PA 4HDUA 1DU0A 1EA3A 1Q1HA 4KDPA 2HXIA 3BQYA 4GYIA 5AIPA 3DPLC 3O8GA
chains in the Genus database with same CATH topology
2OD5A 1I1SA 1KU2A 2V79A 1PDNC 3GF2A 5FGMA 2RC4A 4GGGA 5DD4A 1IUYA 3QU6A 2FQ3A 3RJPA 1XDSA 4ENMA 2V6CA 4ZH4F 3CTAA 1TW3A 2XROA 1YW9A 4LLGF 2HEOA 4EJVA 5JR3A 1FBQA 3C18A 4R79A 1I6XA 4KYWA 1YTYA 4EQQA 2JT1A 1F1ZA 4UVCA 3DKWA 1XN7A 1TQMA 3S2WA 2EA4A 2BEOA 3HSEA 4KICA 2FBKA 4HF2A 3BWGA 5E8IA 4IRGA 3ZQ7A 4BNCA 1O57A 1XB4A 1BJAA 1J5YA 2HZTA 3HUGA 2L01A 1BBYA 2GIVA 2XV4S 3WGHA 2XUBA 4KFCA 4ZYDA 4HX7A 2GZWA 4KMUX 1Z1DA 3ZMZA 1KU9A 4HA8A 1FBSA 4YFXF 4AWXB 1YFHA 3EYIA 2HOEA 5A2QK 1YO5C 1RIOH 4L5IA 4MQ9F 2IVMA 1ZREA 2L4MA 2QQBA 3TQNA 4GO1A 2MH2A 2DAOA 1X3UA 3IHUA 3WGGA 4MTEA 1XMAA 4G7HF 4OU0A 4CDGA 3ZMVA 4E70A 4LLLA 1KU3A 4Q48A 1TTYA 3WG9A 3C1DA 5TRDA 3F72A 1SFXA 3JSPA 3ERED 4M9XA 1ZGAA 3HSFA 5F1RA 2XAQA 2IA1A 1CF7A 4BH9A 1J0RA 1RUOA 1PP7U 4GCVA 4LD5A 3KEOA 3QP5A 4U0WA 1W7PB 3DQVC 1BC8C 2R7FA 4G6DA 3I0TA 5LHIA 2G7UA 4L0ZB 2CSOA 1IN8A 4EJTA 4OMZA 2ZNYA 4M6YA 2W57A 2YPRA 4KA4A 2XASA 3LA3A 4ESBA 3GFLA 4K2EA 4MHGA 3SXYA 2K4JA 1B1BA 3CUQA 1P6RA 2G7HA 4CHUA 5HS7A 3TKYA 1CGPA 1F5TA 1QZYA 4I01A 4NQWA 3PQKA 2NAZA 1OYWA 3EETA 4UVBA 3R4KA 3L00A 1TQIA 3TO7A 1DDNA 4ENNA 3FXUA 1UHWA 1T38A 3HRMA 3MWMA 2O6GE 4B8XA 2FBHA 1GXPA 2YR2A 2M1BA 3E3VA 1B4AA 1HW5A 5EEHA 3DFGA 1XD7A 2BYVE 2FBIA 3OV8A 1KYWA 1KQ8A 4A5MA 2ZJ2A 5IT3A 3RYPA 3TO6A 1J75A 3K0LA 2XKPA 1Z91A 2H27A 1JHFA 2P4WA 2E1NA 4UVAA 4P9FA 1FC3A 4BHCA 1KQ0A 4S05A 2E1CA 1Z7UA 4IVNA 4L9NA 3QRFF 1T0FA 5JI6A 3COAC 1EH6A 3WE3A 2HR3A 4F7ZA 2QUFA 1ON1A 1B9NA 1RZ4A 4TV7A 3O2PE 3QAHA 2EFQA 4WF2A 1D5VA 1ZRDA 3RPQA 2CGPA 2HGCA 1HKTA 1K78B 1D8KA 3IWFA 4A0YA 3RIRA 3BPXA 3OOPA 4KIGA 1Z05A 1YQAA 4QWQA 1O3RA 1BM9A 4FX4A 1MGTA 1FLIA 3HHHA 5HVQC 2UWMA 3JAMZ 2F2EA 3CJNA 3R0JA 5HDGA 1WKMA 2VBZA 4MEYF 3RI4A 2GWRA 2P6TA 3L9FA 3WGIA 4A0ZA 2ZMEA 5CVJA 4A6DA 4LG0A 1DPUA 4M73A 3FXQA 2CG4A 4IF4A 2VOOA 2MLKA 3QU3A 1OYIA 4ZYHA 1T98A 5LBQA 2ZMEB 2DQRA 3L2CA 3CUQC 2TDXA 1U3EM 2NYXA 5BQTA 2BGCA 4IPAA 3EYYA 5KVRA 4ETSA 2EA2A 3LA7A 2FNAA 5E20A 3I59A 1TW2A 1QO0D 4AIHA 3V7CA 1VTNC 4LB5A 4MGRA 2XVCA 3R60A 5D5UB 1XSVA 3N97A 1QPMA 3E6BA 4HW0A 1SD6A 2P5VA 4P55A 2OZUA 1G3SA 1TNSA 2E7XA 4LK0F 4OIOF 5E17F 1QQIA 2LNBA 1FSHA 4P5OA 2EK5A 3ZMSA 3KE2A 1R23A 2XKOA 4QLCU 2JZYA 1S3JA 4DNCA 1WI9A 5E1XA 2IA2A 1S29A 4BXUA 5K5QA 3Q9VA 2W24A 1HQCA 3F8FA 2PMHA 1CF7B 1MD0A 5D8KB 2Z99A 3RTRA 2FU4A 2CW0F 4CO8A 1WRJA 4YFKF 5L3CA 2QQ9A 3JW4A 1FWZA 3CUOA 1OPCA 1R58A 3WTXC 5D4SA 3P9CA 5L3EA 2DO7A 2B0LA 4KUMA 5CVUA 4IXAA 1XMKA 2HQRA 2ISYA 3BY6A 4WXDA 2EFNA 3GLXA 5ICGA 2Z5UA 4PZJA 4LB6B 3GX4X 2V1UA 3HRUA 4HV5A 1PP8F 1JHHA 5L3FA 4Y15A 2UXXA 4BYYA 1K78A 2IT0A 3DEUA 1OMIA 4PCQA 1QNTA 5E8GA 1J7KA 2RQPA 3T8TA 1G4DA 4FX0A 2VBXA 3J81K 2BBYA 1LDDA 2DFIA 4EJOA 1SMYF 1WQ2A 1IRGA 2GXGA 4LFUA 2CQKA 4G8XA 4KIBA 3TDZC 2XHKA 4A6EA 1GVJA 1FYLA 1FP1D 3TOBA 2ACJA 5LLQA 2DW4A 1EH7A 5JFRA 2M45A 1B9MA 1BIAA 4HBLA 2QLZA 5TJJA 2HKXA 2MBFA 4EVIA 5ICEA 2FNPA 5ICCA 4UXNA 1U5TC 2FRHA 3I59B 3TGNA 3AAFA 1TBXA 2M8EA 4AD9A 1XSXA 5EEGA 3T8RA 1WWXA 2MA3A 2Y0MA 2GQQA 3BP8A 2Q0OA 4EGYA 1IXSB 4OMYA 2VE9A 4KN4X 5ILUA 1RI7A 3E5XA 1ZG3A 1L3LA 3O6BB 1ZLJA 5ED4A 3M1EA 2BV6A 2Z33A 2MC3A 2PMUA 1DUXC 2KJBA 1ZH5A 2O3FA 3F22A 5HDKA 5FFXA 3EQLF 1SD5A 1FX7A 3JAMK 2JSCA 3IL2A 4G7OF 2FXAA 1KA8A 2NS0A 3F8BA 1IW7F 3HOSA 4IJAA 4I2OA 2O0YA 1ZN2A 5FO5A 4PGHA 2HKOA 1BI3A 1ON2A 1YW7A 2DBBA 4MNUA 1FT9A 3VB2A 2MLGA 3BDDA 2PQ8A 4LJZF 2VOPA 2XAGA 1IF1A 5ILSA 3KETA 2IP2A 2EWNA 3MAJA 2ZXJA 5DUIA 4U0VA 2JPCA 3SZTA 5HLGA 1Z6TA 1W7PA 1V3FA 2QYOA 2VXZA 5DYMA 2M87A 3VODA 3KP4A 1FY7A 3HSRA 2EFOA 1EH8A 4CZZA 4RB2C 3G3ZA 3REOA 1IXCA 2DT5A 4HLXA 1BOAA 1WSUA 2WV0A 2RDPA 1W5TA 3I58A 3ABUA 3LWFA 1HSJA 4L9JA 2YX7A 3FHZA 3WTYC 4NHJA 4KMFA 5D5XB 1ZRFA 4ENKA 2FMYA 4PDKA 5DDGA 3NEUA 2IW5A 3BROA 2QWWA 4AVPA 1HKSA 2VT3A 3BJAA 4NB5A 2Y48A 4BHBA 4KNYA 2HS5A 3ZP5A 2VODA 1FZPB 4G9YA 3FXRA 3ZN1A 3FMRA 3VOEA 1I1GA 1BIBA 1W7PD 1LVAA 2ZFWA 3V7SA 3RKWA 5JVTA 3D0SA 4CICA 4A12A 3IC7A 4EGZA 2KIMA 2J5PA 3N4MA 2A5YB 3F8MA 2VBYA 2KIUA 3RKYA 2NNYA 2VN2A 3LSTA 4EM0B 2M5WA 4YG2F 3WTTC 4RB1A 3E97A 1SFUA 2COMA 1GXQA 3ECOA 3DP7A 3F23A 4L0YB 2HQNA 5LRRA 4XLNF 1H9TA 3ML6A 4EV0A 5D6FA 4AIJA 3KCCA 5JHUA 4RB3C 3NQOA 5A2QZ 2A61A 1BN5A 1FPQA 1LNWA 2ZO4A 3GUDA 1IAWA 5KK1A 2P6SA 4WX9A 5BPIA 4YIIA 5L3GA 2LDUA 2R3SA 3HYIA 2PN6A 3M8FA 1R1UA 1YS6A 3EUHA 5D6EA 1ZRCA 3HOTA 2IPQX 1S7AA 3WE2A 3GVAA 4HV6A 4N9HA 4Y13A 1XCVA 2QENA 4I09A 5AONA 2L4AA 1T39A 1FSEA 3CUQB 1REPC 3W6JB 3GXOA 5DCFA 2QBYA 1LDJA 2PEXA 3SFZA 4ZZLA 1MDMB 4HAMA 2OQRA 4D0PA 2RGVA 3HRSA 1BI1A 3P7NA 3H3ZA 5CYVA 3TDUC 2J5OA 1ZHFA 1ZARA 2A68F 3SZPA 4OIQF 4UHTA 2VONA 4M74A 3F6OA 2DTRA 2H09A 3E6DA 3LAJA 4A2UA 2CYYA 2E7WA 5F64A 2GA1A 2HTJA 2Q2EA 1TQPA 1YIOA 3LAPA 2FE3A 5ICFA 1B59A 1S6LA 5CVVA 1XSDA 1IN7A 2MH9A 1YYVA 4UNOA 3I53A 4EJUA 3MEXA 5K5RA 4P9UA 1C0WA 2HTSA 1YG2A 4ENJA 3KP5A 2AXLA 3R6SA 2LF8A 3BZ6A 3WTVC 1SD4A 3QPHA 2VE8A 2HDCA 5HS9A 3T5XA 1HKQA 4RB0A 4BHPA 1K79A 2EV5A 4PGGA 1T2KA 5FLXK 3D5LA 3FWEA 1R5HA 5K1YA 1MDMA 1KU7A 3NRVA 1RUNA 1MJAA 4U7DA 4A0XA 5DUKA 1YLFA 1FYKA 1H9GA 4L18B 3VEPA 2XRNA 1O3TA 5D8LB 5DCMA 1W4MA 2EFPA 1U78A 4M71A 4WCGA 3HTSB 1MZBA 4L9TA 4Y17A 1O3QA 2R7DA 5HS8A 4IHTA 3U2RA 3JSOA 3LFKA 2P5LC 1IZ1A 5L3DA 1FBUA 5D5WB 1ZGJA 2P8TA 1SFEA 2ZNZA 4JK1X 3ZN0A 2IJLA 1V4RA 1IRFA 2P5KA 1XGMA 5BMZA 2FF4A 1P4AA 2IRFG 2VT2A 4G6QA 2FA5A 2W25A 3ELKA 4RGSA 3BPVA 3BJ6A 1SAXA 1QZZA 4HQMA 1XGNA 3FX3A 3GYHX 2WC2A 3SQNA 4IRIA 2FMLA 3KEQA 4I02A 4WXHA 2DPUA 4FHTA 4XSXF 3MCZA 5LGUA 3HIFA 4L9VA 1B6AA 2D1HA 3DXJF 1ZG1A 3J7AO 5K5OA 1IN5A 3WTZA 3LQRA 2K02A 2OQGA 2KJCA 4HX8A 1IN6A 2OU2A 1J9IA 4Z2YA 3WTSC 5E1WA 2XIGA 1O3SA 1UHMA 2RN7A 3J80Z 1R36A 3E5QA 3FZVA 1T6SA 3H92A 4BAYA 1SD7A 1U5TB 2VC0A 5HOOA 3GZ6A 4KN7X 3KP3A 1LJ9A 3FM3A 1DP7P 1GHCA 4OOIA 4JQFA 3IKTA 2A07F 4WWCA 1G6NA 2VC1A 4RGRA 3SHFA 1HW2A 2GA2A 3DPTA 2PBIA 5H20A 1FP2A 2UXNA 2F5CA 2HYGD 3GEZA 2LF7A 1LQ1A 1AWCA 3I64A 2QM3A 1G3TA 4IRHA 4CGZA 2W85A 1JE8A 3DF8A 1EV7A 4CXFA 5FD5A 2DLLA 5DCMB 3J81Z 3B02A 1RNLA 2OAZA 4ESJA 1R5GA 4P96A 5HLHA 2K27A 3I5UA 3CO6C 4CYDA 2FEZA 2C6YA 2DK8A 4H0EA 6PAXA 2GAUA 2WWYA 1YS7A 1R22A 3LA2A 1DPRA 5D4RA 2EV0A 5LGNA 5FB2A 3TO9A 4U0YA 1W5SA 1G3WA 2DI3A 4I0BA 1QGPA 3GWZA 3K2ZA 2RNJA 1I5ZA 3WU1B 2ZKZA 3T0YA 4ZYEA 4LK1F 3ABTA 2NNNA 3IWZA 4Q4ZF 4XSZF 4OINF 2STWA 4EMSA 5ILVA 3GO5A 5CVRA 3QPTA 2D2WA 2Z9OA 4XRFA 2EJRA 2K4BA 1D3YA 1FOKA 1TLHB 3DV8A 2H6CA 5BS6A 3ZPLA 1OKRA 1U6GA 1E17A 2XAHA 4OIRF 3P9IA 1LEAA 5J8FA 3ULQB 3HHGA 5H6RA 5IT9K 2LKPA 4OIPF 2XGXA 2PFBA 2YX4A 3F8CA 2JPBA 4FT8A 3RDIA 1LB2A 3Q9SA 4ZZDA 2F5EA 4GYGA 4ZYGA 3I54A 2CWEA 2A6HF 2EV6A 3KZYA 3J80K 4R8HA 2Q8KA 5E1ZB 3KP7A 2A69F 2YSRA 5E18F 2KRFA 1U5TA 2VBWA 3TOAA 1LEBA 5D5VB 1S7OA 1XCBA 4M6XA 4LLNA 4HLYA 4N0BA 2DU9A 3R61A 1K6OA 4EM2A 2XAJA 2O03A 2V9VA 1ZG5A 3WTUC 3F6VA 3V4GA 2ZCWA 4U88A 2O61A 1SMTA 1IN4A 3IKVA 3RPUA 2EFWA 3Q5FA 2ESHA 4HF1A 2STTA 5DEQA 4EM1A 3RYRA 1F9NA 2Y75A 1XGSA 4UV8A 1ODDA 1P4WA 1BI2A 5LHGA 1KGSA 2P7VB 3M9AA 4M9ZA 3ISPA 2FSWA 4I0AA 4HDVA 1PUEE 2G9WA 2A3SA 3WU0A 3GFMA 4HQEA 4HZFA 1R1VA 4O5VA 3GFJA 5CVIA 3MQ0A 3K1NA 5LHHA 1STZA 3ZMTA 1HSTA 3K69A 1BI0A 4RGUA 3CDHA 4U7BA 2L02A 1MJBA 2P7CB 4M72A 4JBAA 5LEJA 1KQ9A 3KLOA 3U1DA 3V8JA 5HDNA 3K9TA 3G73A 2ELHA 2FOKA 3MFKA 5CJ9A 4MQVA 2EB7A 3PFIA 3L7WA 1AOYA 3K1MA 2Z3YA 4HYEA 2ZBKA 1P92A 1NHAA 1P4XA 4A5NA 3GW2A 3HRTA 2X4HA 3ROUA 4G7ZF 4KIFA 5L3BA 3M8EA 2HWVA 4WXCA 2PJPA 4HX4A 3C7JA 3H3UA 2QBYB 4DQ2A 2RVCA 3R0AA 3GZ5A 1MJ9A 1KYZA 3F21A 4R1HA 3E6CC 1MKMA 3VFZA 2HFHA 2O8XA 3V7RA 3IRQA 2ETHA 5J8CA 5IT9Z 3QOPA 4O3MA 3I71A 3F8NA 5FD6A 5CLSA 2D45A 3V8KA 3F3XA 1R7JA 4HOBA 1Y0UA 1J59A 2HYFA 4Q5SF 4RAZA 3PQJA 3KLNA 5DD8A 3WODF 4RS8A 4N9IA 5BPDA 2BE5F 1Z6RA 2K86A 3JTGA 4LGWA 2QZ8A 4I98B 4YFNF 2X0LA 4ON0A 1USTA 3I4PA 4O6JA 1ZYRF 2JTVA 2IA0A 2QQAA 3ZMDA 5BOXA 5LEKA 2MD5A 2OA4A 1USSA 3B73A 3KP6A 1E2XA 1G3YA 2RKHA 2RV8A 2OBPA 3RKXA 4S04A 2H6BA 1UB9A 5F6FA 1J2XA 5ERIA 3ZMUA 3E6MA 4GXOA 3O3KA 3FM5A 1YW8A 2DQLA 3CLOA 1QBJA 5AIQA 4Q47A 2KIFA 4HF0A 4EJWA 1OR7A 3KZZA 3ECHA 4B09A 5DV5A 5J6XA 2L54A 2F5DA 2ADUA 2ESNA 1OYYA 4UV9A 2V1DA 2W84A 1U2WA 4BQAA 3M7GA 2CO5A 3L09A 4G94A 2NRAC 4RAYA 2V1XA 1U8RA 2M30A 3MZHA 3V8LA 3BJOA 2OZ6A 3C3WA 3FMQA 4XLPF 3GFIA 1P2FA 1BC7C 3EDPA 4L5JA 5FFZA 1UCRA 1H0MA 2AS5F 2PG4A 4AIKA 3QP6A 5H6QA 1I27A 5HLIA 3LQQA 3KP2A 3BOQA 1A04A 1LDKB 2L3DA 1IXRC 3E5UA 2F5FA 1HW1A 1FNNA 1UFMA 1XDUA 1Z9CA 2ISZA 1D8JA 2D1VA 2KKOA 4LG0B 3U9GA 4KT5C 1JXSA 1L0OC 3KFWX 4UUVA 4IHSA 1R00A 3WTWC 4ESFA 2DK5A 4ASNA 1XGOA 5LRSA 1ULYA 4YIFA 2LSOA 1ONVA 3T1BA 1JGSA 2PLYA 2CFXA 2WTEA 2A6EF 3FF5A 1FYMA 3P9KA 1R1TA 1O7FA 3K1PA 2DPDA 3CO7C 4I7HA 2YU3A 2QVOA 3IRRA 1HXDA 2JRTA 4M9SA 2XAFA 2H94A 4MTDA 3HTUA 5FLXZ 4RGXA 4WK8F 1O7LA 4LMYA 5LGTA 3FMSA 4MEXF 3JTHA 2GXBA 1ZAOA 2UZKA 2PI0A 2K7LA 3W6KB 1ZLKA 1HBXG 1S8NA 3MZYA 1TNTA 1F4KA 4XBFA 1K7AA 4HDUA 1Q1HA 4KDPA 4GYIA 5AIPA 3DPLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OD5 A;  1I1S A;  1KU2 A;  2V79 A;  1PDN C;  3GF2 A;  5FGM A;  2RC4 A;  4GGG A;  5DD4 A;  1IUY A;  3QU6 A;  2FQ3 A;  3RJP A;  1XDS A;  4ENM A;  2V6C A;  4ZH4 F;  3CTA A;  1TW3 A;  2XRO A;  1YW9 A;  4LLG F;  2HEO A;  4EJV A;  5JR3 A;  1FBQ A;  3C18 A;  4R79 A;  1I6X A;  4KYW A;  1YTY A;  4EQQ A;  2JT1 A;  1F1Z A;  4UVC A;  3DKW A;  1XN7 A;  1TQM A;  3S2W A;  2EA4 A;  2BEO A;  3HSE A;  4KIC A;  2FBK A;  4HF2 A;  3BWG A;  5E8I A;  4IRG A;  3ZQ7 A;  4BNC A;  1O57 A;  1XB4 A;  1BJA A;  1J5Y A;  2HZT A;  3HUG A;  2L01 A;  1BBY A;  2GIV A;  2XV4 S;  3WGH A;  2XUB A;  4KFC A;  4ZYD A;  4HX7 A;  2GZW A;  4KMU X;  1Z1D A;  3ZMZ A;  1KU9 A;  4HA8 A;  1FBS A;  4YFX F;  4AWX B;  1YFH A;  3EYI A;  2HOE A;  5A2Q K;  1YO5 C;  1RIO H;  4L5I A;  4MQ9 F;  2IVM A;  1ZRE A;  2L4M A;  2QQB A;  3TQN A;  4GO1 A;  2MH2 A;  2DAO A;  1X3U A;  3IHU A;  3WGG A;  4MTE A;  1XMA A;  4G7H F;  4OU0 A;  4CDG A;  3ZMV A;  4E70 A;  4LLL A;  1KU3 A;  4Q48 A;  1TTY A;  3WG9 A;  3C1D A;  5TRD A;  3F72 A;  1SFX A;  3JSP A;  3ERE D;  4M9X A;  1ZGA A;  3HSF A;  5F1R A;  2XAQ A;  2IA1 A;  1CF7 A;  4BH9 A;  1J0R A;  1RUO A;  1PP7 U;  4GCV A;  4LD5 A;  3KEO A;  3QP5 A;  4U0W A;  1W7P B;  3DQV C;  1BC8 C;  2R7F A;  4G6D A;  3I0T A;  5LHI A;  2G7U A;  4L0Z B;  2CSO A;  1IN8 A;  4EJT A;  4OMZ A;  2ZNY A;  4M6Y A;  2W57 A;  2YPR A;  4KA4 A;  2XAS A;  3LA3 A;  4ESB A;  3GFL A;  4K2E A;  4MHG A;  3SXY A;  2K4J A;  1B1B A;  3CUQ A;  1P6R A;  2G7H A;  4CHU A;  5HS7 A;  3TKY A;  1CGP A;  1F5T A;  1QZY A;  4I01 A;  4NQW A;  3PQK A;  2NAZ A;  1OYW A;  3EET A;  4UVB A;  3R4K A;  3L00 A;  1TQI A;  3TO7 A;  1DDN A;  4ENN A;  3FXU A;  1UHW A;  1T38 A;  3HRM A;  3MWM A;  2O6G E;  4B8X A;  2FBH A;  1GXP A;  2YR2 A;  2M1B A;  3E3V A;  1B4A A;  1HW5 A;  5EEH A;  3DFG A;  1XD7 A;  2BYV E;  2FBI A;  3OV8 A;  1KYW A;  1KQ8 A;  4A5M A;  2ZJ2 A;  5IT3 A;  3RYP A;  3TO6 A;  1J75 A;  3K0L A;  2XKP A;  1Z91 A;  2H27 A;  1JHF A;  2P4W A;  2E1N A;  4UVA A;  4P9F A;  1FC3 A;  4BHC A;  1KQ0 A;  4S05 A;  2E1C A;  1Z7U A;  4IVN A;  4L9N A;  3QRF F;  1T0F A;  5JI6 A;  3COA C;  1EH6 A;  3WE3 A;  2HR3 A;  4F7Z A;  2QUF A;  1ON1 A;  1B9N A;  1RZ4 A;  4TV7 A;  3O2P E;  3QAH A;  2EFQ A;  4WF2 A;  1D5V A;  1ZRD A;  3RPQ A;  2CGP A;  2HGC A;  1HKT A;  1K78 B;  1D8K A;  3IWF A;  4A0Y A;  3RIR A;  3BPX A;  3OOP A;  4KIG A;  1Z05 A;  1YQA A;  4QWQ A;  1O3R A;  1BM9 A;  4FX4 A;  1MGT A;  1FLI A;  3HHH A;  5HVQ C;  2UWM A;  3JAM Z;  2F2E A;  3CJN A;  3R0J A;  5HDG A;  1WKM A;  2VBZ A;  4MEY F;  3RI4 A;  2GWR A;  2P6T A;  3L9F A;  3WGI A;  4A0Z A;  2ZME A;  5CVJ A;  4A6D A;  4LG0 A;  1DPU A;  4M73 A;  3FXQ A;  2CG4 A;  4IF4 A;  2VOO A;  2MLK A;  3QU3 A;  1OYI A;  4ZYH A;  1T98 A;  5LBQ A;  2ZME B;  2DQR A;  3L2C A;  3CUQ C;  2TDX A;  1U3E M;  2NYX A;  5BQT A;  2BGC A;  4IPA A;  3EYY A;  5KVR A;  4ETS A;  2EA2 A;  3LA7 A;  2FNA A;  5E20 A;  3I59 A;  1TW2 A;  1QO0 D;  4AIH A;  3V7C A;  1VTN C;  4LB5 A;  4MGR A;  2XVC A;  3R60 A;  5D5U B;  1XSV A;  3N97 A;  1QPM A;  3E6B A;  4HW0 A;  1SD6 A;  2P5V A;  4P55 A;  2OZU A;  1G3S A;  1TNS A;  2E7X A;  4LK0 F;  4OIO F;  5E17 F;  1QQI A;  2LNB A;  1FSH A;  4P5O A;  2EK5 A;  3ZMS A;  3KE2 A;  1R23 A;  2XKO A;  4QLC U;  2JZY A;  1S3J A;  4DNC A;  1WI9 A;  5E1X A;  2IA2 A;  1S29 A;  4BXU A;  5K5Q A;  3Q9V A;  2W24 A;  1HQC A;  3F8F A;  2PMH A;  1CF7 B;  1MD0 A;  5D8K B;  2Z99 A;  3RTR A;  2FU4 A;  2CW0 F;  4CO8 A;  1WRJ A;  4YFK F;  5L3C A;  2QQ9 A;  3JW4 A;  1FWZ A;  3CUO A;  1OPC A;  1R58 A;  3WTX C;  5D4S A;  3P9C A;  5L3E A;  2DO7 A;  2B0L A;  4KUM A;  5CVU A;  4IXA A;  1XMK A;  2HQR A;  2ISY A;  3BY6 A;  4WXD A;  2EFN A;  3GLX A;  5ICG A;  2Z5U A;  4PZJ A;  4LB6 B;  3GX4 X;  2V1U A;  3HRU A;  4HV5 A;  1PP8 F;  1JHH A;  5L3F A;  4Y15 A;  2UXX A;  4BYY A;  1K78 A;  2IT0 A;  3DEU A;  1OMI A;  4PCQ A;  1QNT A;  5E8G A;  1J7K A;  2RQP A;  3T8T A;  1G4D A;  4FX0 A;  2VBX A;  3J81 K;  2BBY A;  1LDD A;  2DFI A;  4EJO A;  1SMY F;  1WQ2 A;  1IRG A;  2GXG A;  4LFU A;  2CQK A;  4G8X A;  4KIB A;  3TDZ C;  2XHK A;  4A6E A;  1GVJ A;  1FYL A;  1FP1 D;  3TOB A;  2ACJ A;  5LLQ A;  2DW4 A;  1EH7 A;  5JFR A;  2M45 A;  1B9M A;  1BIA A;  4HBL A;  2QLZ A;  5TJJ A;  2HKX A;  2MBF A;  4EVI A;  5ICE A;  2FNP A;  5ICC A;  4UXN A;  1U5T C;  2FRH A;  3I59 B;  3TGN A;  3AAF A;  1TBX A;  2M8E A;  4AD9 A;  1XSX A;  5EEG A;  3T8R A;  1WWX A;  2MA3 A;  2Y0M A;  2GQQ A;  3BP8 A;  2Q0O A;  4EGY A;  1IXS B;  4OMY A;  2VE9 A;  4KN4 X;  5ILU A;  1RI7 A;  3E5X A;  1ZG3 A;  1L3L A;  3O6B B;  1ZLJ A;  5ED4 A;  3M1E A;  2BV6 A;  2Z33 A;  2MC3 A;  2PMU A;  1DUX C;  2KJB A;  1ZH5 A;  2O3F A;  3F22 A;  5HDK A;  5FFX A;  3EQL F;  1SD5 A;  1FX7 A;  3JAM K;  2JSC A;  3IL2 A;  4G7O F;  2FXA A;  1KA8 A;  2NS0 A;  3F8B A;  1IW7 F;  3HOS A;  4IJA A;  4I2O A;  2O0Y A;  1ZN2 A;  5FO5 A;  4PGH A;  2HKO A;  1BI3 A;  1ON2 A;  1YW7 A;  2DBB A;  4MNU A;  1FT9 A;  3VB2 A;  2MLG A;  3BDD A;  2PQ8 A;  4LJZ F;  2VOP A;  2XAG A;  1IF1 A;  5ILS A;  3KET A;  2IP2 A;  2EWN A;  3MAJ A;  2ZXJ A;  5DUI A;  4U0V A;  2JPC A;  3SZT A;  5HLG A;  1Z6T A;  1W7P A;  1V3F A;  2QYO A;  2VXZ A;  5DYM A;  2M87 A;  3VOD A;  3KP4 A;  1FY7 A;  3HSR A;  2EFO A;  1EH8 A;  4CZZ A;  4RB2 C;  3G3Z A;  3REO A;  1IXC A;  2DT5 A;  4HLX A;  1BOA A;  1WSU A;  2WV0 A;  2RDP A;  1W5T A;  3I58 A;  3ABU A;  3LWF A;  1HSJ A;  4L9J A;  2YX7 A;  3FHZ A;  3WTY C;  4NHJ A;  4KMF A;  5D5X B;  1ZRF A;  4ENK A;  2FMY A;  4PDK A;  5DDG A;  3NEU A;  2IW5 A;  3BRO A;  2QWW A;  4AVP A;  1HKS A;  2VT3 A;  3BJA A;  4NB5 A;  2Y48 A;  4BHB A;  4KNY A;  2HS5 A;  3ZP5 A;  2VOD A;  1FZP B;  4G9Y A;  3FXR A;  3ZN1 A;  3FMR A;  3VOE A;  1I1G A;  1BIB A;  1W7P D;  1LVA A;  2ZFW A;  3V7S A;  3RKW A;  5JVT A;  3D0S A;  4CIC A;  4A12 A;  3IC7 A;  4EGZ A;  2KIM A;  2J5P A;  3N4M A;  2A5Y B;  3F8M A;  2VBY A;  2KIU A;  3RKY A;  2NNY A;  2VN2 A;  3LST A;  4EM0 B;  2M5W A;  4YG2 F;  3WTT C;  4RB1 A;  3E97 A;  1SFU A;  2COM A;  1GXQ A;  3ECO A;  3DP7 A;  3F23 A;  4L0Y B;  2HQN A;  5LRR A;  4XLN F;  1H9T A;  3ML6 A;  4EV0 A;  5D6F A;  4AIJ A;  3KCC A;  5JHU A;  4RB3 C;  3NQO A;  5A2Q Z;  2A61 A;  1BN5 A;  1FPQ A;  1LNW A;  2ZO4 A;  3GUD A;  1IAW A;  5KK1 A;  2P6S A;  4WX9 A;  5BPI A;  4YII A;  5L3G A;  2LDU A;  2R3S A;  3HYI A;  2PN6 A;  3M8F A;  1R1U A;  1YS6 A;  3EUH A;  5D6E A;  1ZRC A;  3HOT A;  2IPQ X;  1S7A A;  3WE2 A;  3GVA A;  4HV6 A;  4N9H A;  4Y13 A;  1XCV A;  2QEN A;  4I09 A;  5AON A;  2L4A A;  1T39 A;  1FSE A;  3CUQ B;  1REP C;  3W6J B;  3GXO A;  5DCF A;  2QBY A;  1LDJ A;  2PEX A;  3SFZ A;  4ZZL A;  1MDM B;  4HAM A;  2OQR A;  4D0P A;  2RGV A;  3HRS A;  1BI1 A;  3P7N A;  3H3Z A;  5CYV A;  3TDU C;  2J5O A;  1ZHF A;  1ZAR A;  2A68 F;  3SZP A;  4OIQ F;  4UHT A;  2VON A;  4M74 A;  3F6O A;  2DTR A;  2H09 A;  3E6D A;  3LAJ A;  4A2U A;  2CYY A;  2E7W A;  5F64 A;  2GA1 A;  2HTJ A;  2Q2E A;  1TQP A;  1YIO A;  3LAP A;  2FE3 A;  5ICF A;  1B59 A;  1S6L A;  5CVV A;  1XSD A;  1IN7 A;  2MH9 A;  1YYV A;  4UNO A;  3I53 A;  4EJU A;  3MEX A;  5K5R A;  4P9U A;  1C0W A;  2HTS A;  1YG2 A;  4ENJ A;  3KP5 A;  2AXL A;  3R6S A;  2LF8 A;  3BZ6 A;  3WTV C;  1SD4 A;  3QPH A;  2VE8 A;  2HDC A;  5HS9 A;  3T5X A;  1HKQ A;  4RB0 A;  4BHP A;  1K79 A;  2EV5 A;  4PGG A;  1T2K A;  5FLX K;  3D5L A;  3FWE A;  1R5H A;  5K1Y A;  1MDM A;  1KU7 A;  3NRV A;  1RUN A;  1MJA A;  4U7D A;  4A0X A;  5DUK A;  1YLF A;  1FYK A;  1H9G A;  4L18 B;  3VEP A;  2XRN A;  1O3T A;  5D8L B;  5DCM A;  1W4M A;  2EFP A;  1U78 A;  4M71 A;  4WCG A;  3HTS B;  1MZB A;  4L9T A;  4Y17 A;  1O3Q A;  2R7D A;  5HS8 A;  4IHT A;  3U2R A;  3JSO A;  3LFK A;  2P5L C;  1IZ1 A;  5L3D A;  1FBU A;  5D5W B;  1ZGJ A;  2P8T A;  1SFE A;  2ZNZ A;  4JK1 X;  3ZN0 A;  2IJL A;  1V4R A;  1IRF A;  2P5K A;  1XGM A;  5BMZ A;  2FF4 A;  1P4A A;  2IRF G;  2VT2 A;  4G6Q A;  2FA5 A;  2W25 A;  3ELK A;  4RGS A;  3BPV A;  3BJ6 A;  1SAX A;  1QZZ A;  4HQM A;  1XGN A;  3FX3 A;  3GYH X;  2WC2 A;  3SQN A;  4IRI A;  2FML A;  3KEQ A;  4I02 A;  4WXH A;  2DPU A;  4FHT A;  4XSX F;  3MCZ A;  5LGU A;  3HIF A;  4L9V A;  1B6A A;  2D1H A;  3DXJ F;  1ZG1 A;  3J7A O;  5K5O A;  1IN5 A;  3WTZ A;  3LQR A;  2K02 A;  2OQG A;  2KJC A;  4HX8 A;  1IN6 A;  2OU2 A;  1J9I A;  4Z2Y A;  3WTS C;  5E1W A;  2XIG A;  1O3S A;  1UHM A;  2RN7 A;  3J80 Z;  1R36 A;  3E5Q A;  3FZV A;  1T6S A;  3H92 A;  4BAY A;  1SD7 A;  1U5T B;  2VC0 A;  5HOO A;  3GZ6 A;  4KN7 X;  3KP3 A;  1LJ9 A;  3FM3 A;  1DP7 P;  1GHC A;  4OOI A;  4JQF A;  3IKT A;  2A07 F;  4WWC A;  1G6N A;  2VC1 A;  4RGR A;  3SHF A;  1HW2 A;  2GA2 A;  3DPT A;  2PBI A;  5H20 A;  1FP2 A;  2UXN A;  2F5C A;  2HYG D;  3GEZ A;  2LF7 A;  1LQ1 A;  1AWC A;  3I64 A;  2QM3 A;  1G3T A;  4IRH A;  4CGZ A;  2W85 A;  1JE8 A;  3DF8 A;  1EV7 A;  4CXF A;  5FD5 A;  2DLL A;  5DCM B;  3J81 Z;  3B02 A;  1RNL A;  2OAZ A;  4ESJ A;  1R5G A;  4P96 A;  5HLH A;  2K27 A;  3I5U A;  3CO6 C;  4CYD A;  2FEZ A;  2C6Y A;  2DK8 A;  4H0E A;  6PAX A;  2GAU A;  2WWY A;  1YS7 A;  1R22 A;  3LA2 A;  1DPR A;  5D4R A;  2EV0 A;  5LGN A;  5FB2 A;  3TO9 A;  4U0Y A;  1W5S A;  1G3W A;  2DI3 A;  4I0B A;  1QGP A;  3GWZ A;  3K2Z A;  2RNJ A;  1I5Z A;  3WU1 B;  2ZKZ A;  3T0Y A;  4ZYE A;  4LK1 F;  3ABT A;  2NNN A;  3IWZ A;  4Q4Z F;  4XSZ F;  4OIN F;  2STW A;  4EMS A;  5ILV A;  3GO5 A;  5CVR A;  3QPT A;  2D2W A;  2Z9O A;  4XRF A;  2EJR A;  2K4B A;  1D3Y A;  1FOK A;  1TLH B;  3DV8 A;  2H6C A;  5BS6 A;  3ZPL A;  1OKR A;  1U6G A;  1E17 A;  2XAH A;  4OIR F;  3P9I A;  1LEA A;  5J8F A;  3ULQ B;  3HHG A;  5H6R A;  5IT9 K;  2LKP A;  4OIP F;  2XGX A;  2PFB A;  2YX4 A;  3F8C A;  2JPB A;  4FT8 A;  3RDI A;  1LB2 A;  3Q9S A;  4ZZD A;  2F5E A;  4GYG A;  4ZYG A;  3I54 A;  2CWE A;  2A6H F;  2EV6 A;  3KZY A;  3J80 K;  4R8H A;  2Q8K A;  5E1Z B;  3KP7 A;  2A69 F;  2YSR A;  5E18 F;  2KRF A;  1U5T A;  2VBW A;  3TOA A;  1LEB A;  5D5V B;  1S7O A;  1XCB A;  4M6X A;  4LLN A;  4HLY A;  4N0B A;  2DU9 A;  3R61 A;  1K6O A;  4EM2 A;  2XAJ A;  2O03 A;  2V9V A;  1ZG5 A;  3WTU C;  3F6V A;  3V4G A;  2ZCW A;  4U88 A;  2O61 A;  1SMT A;  1IN4 A;  3IKV A;  3RPU A;  2EFW A;  3Q5F A;  2ESH A;  4HF1 A;  2STT A;  5DEQ A;  4EM1 A;  3RYR A;  1F9N A;  2Y75 A;  1XGS A;  4UV8 A;  1ODD A;  1P4W A;  1BI2 A;  5LHG A;  1KGS A;  2P7V B;  3M9A A;  4M9Z A;  3ISP A;  2FSW A;  4I0A A;  4HDV A;  1PUE E;  2G9W A;  2A3S A;  3WU0 A;  3GFM A;  4HQE A;  4HZF A;  1R1V A;  4O5V A;  3GFJ A;  5CVI A;  3MQ0 A;  3K1N A;  5LHH A;  1STZ A;  3ZMT A;  1HST A;  3K69 A;  1BI0 A;  4RGU A;  3CDH A;  4U7B A;  2L02 A;  1MJB A;  2P7C B;  4M72 A;  4JBA A;  5LEJ A;  1KQ9 A;  3KLO A;  3U1D A;  3V8J A;  5HDN A;  3K9T A;  3G73 A;  2ELH A;  2FOK A;  3MFK A;  5CJ9 A;  4MQV A;  2EB7 A;  3PFI A;  3L7W A;  1AOY A;  3K1M A;  2Z3Y A;  4HYE A;  2ZBK A;  1P92 A;  1NHA A;  1P4X A;  4A5N A;  3GW2 A;  3HRT A;  2X4H A;  3ROU A;  4G7Z F;  4KIF A;  5L3B A;  3M8E A;  2HWV A;  4WXC A;  2PJP A;  4HX4 A;  3C7J A;  3H3U A;  2QBY B;  4DQ2 A;  2RVC A;  3R0A A;  3GZ5 A;  1MJ9 A;  1KYZ A;  3F21 A;  4R1H A;  3E6C C;  1MKM A;  3VFZ A;  2HFH A;  2O8X A;  3V7R A;  3IRQ A;  2ETH A;  5J8C A;  5IT9 Z;  3QOP A;  4O3M A;  3I71 A;  3F8N A;  5FD6 A;  5CLS A;  2D45 A;  3V8K A;  3F3X A;  1R7J A;  4HOB A;  1Y0U A;  1J59 A;  2HYF A;  4Q5S F;  4RAZ A;  3PQJ A;  3KLN A;  5DD8 A;  3WOD F;  4RS8 A;  4N9I A;  5BPD A;  2BE5 F;  1Z6R A;  2K86 A;  3JTG A;  4LGW A;  2QZ8 A;  4I98 B;  4YFN F;  2X0L A;  4ON0 A;  1UST A;  3I4P A;  4O6J A;  1ZYR F;  2JTV A;  2IA0 A;  2QQA A;  3ZMD A;  5BOX A;  5LEK A;  2MD5 A;  2OA4 A;  1USS A;  3B73 A;  3KP6 A;  1E2X A;  1G3Y A;  2RKH A;  2RV8 A;  2OBP A;  3RKX A;  4S04 A;  2H6B A;  1UB9 A;  5F6F A;  1J2X A;  5ERI A;  3ZMU A;  3E6M A;  4GXO A;  3O3K A;  3FM5 A;  1YW8 A;  2DQL A;  3CLO A;  1QBJ A;  5AIQ A;  4Q47 A;  2KIF A;  4HF0 A;  4EJW A;  1OR7 A;  3KZZ A;  3ECH A;  4B09 A;  5DV5 A;  5J6X A;  2L54 A;  2F5D A;  2ADU A;  2ESN A;  1OYY A;  4UV9 A;  2V1D A;  2W84 A;  1U2W A;  4BQA A;  3M7G A;  2CO5 A;  3L09 A;  4G94 A;  2NRA C;  4RAY A;  2V1X A;  1U8R A;  2M30 A;  3MZH A;  3V8L A;  3BJO A;  2OZ6 A;  3C3W A;  3FMQ A;  4XLP F;  3GFI A;  1P2F A;  1BC7 C;  3EDP A;  4L5J A;  5FFZ A;  1UCR A;  1H0M A;  2AS5 F;  2PG4 A;  4AIK A;  3QP6 A;  5H6Q A;  1I27 A;  5HLI A;  3LQQ A;  3KP2 A;  3BOQ A;  1A04 A;  1LDK B;  2L3D A;  1IXR C;  3E5U A;  2F5F A;  1HW1 A;  1FNN A;  1UFM A;  1XDU A;  1Z9C A;  2ISZ A;  1D8J A;  2D1V A;  2KKO A;  4LG0 B;  3U9G A;  4KT5 C;  1JXS A;  1L0O C;  3KFW X;  4UUV A;  4IHS A;  1R00 A;  3WTW C;  4ESF A;  2DK5 A;  4ASN A;  1XGO A;  5LRS A;  1ULY A;  4YIF A;  2LSO A;  1ONV A;  3T1B A;  1JGS A;  2PLY A;  2CFX A;  2WTE A;  2A6E F;  3FF5 A;  1FYM A;  3P9K A;  1R1T A;  1O7F A;  3K1P A;  2DPD A;  3CO7 C;  4I7H A;  2YU3 A;  2QVO A;  3IRR A;  1HXD A;  2JRT A;  4M9S A;  2XAF A;  2H94 A;  4MTD A;  3HTU A;  5FLX Z;  4RGX A;  4WK8 F;  1O7L A;  4LMY A;  5LGT A;  3FMS A;  4MEX F;  3JTH A;  2GXB A;  1ZAO A;  2UZK A;  2PI0 A;  2K7L A;  3W6K B;  1ZLK A;  1HBX G;  1S8N A;  3MZY A;  1TNT A;  1F4K A;  4XBF A;  1K7A A;  4HDU A;  1Q1H A;  4KDP A;  4GYI A;  5AIP A;  3DPL C; 
#chains in the Genus database with same CATH topology
 2OD5 A;  1MNM C;  1I1S A;  3DLA A;  1KU2 A;  2V79 A;  4V2G A;  1PDN C;  3GF2 A;  1JKR C;  2XF5 A;  5FGM A;  2L9S A;  2Q1Z B;  3CZ6 A;  2VUM J;  2RC4 A;  3CMM A;  4GGG A;  2HQ5 A;  5DD4 A;  1WHU A;  2HOS A;  1IUY A;  3QU6 A;  2FQ3 A;  4IX7 A;  4PFP A;  1E3H A;  1Y8Q B;  5F1J A;  3GTQ J;  1ENH A;  5EG0 A;  3RJP A;  1XDS A;  2X6O A;  3MKW B;  4ENM A;  2JA6 J;  1TWC J;  2V6C A;  4ZH4 F;  3CTA A;  1TW3 A;  2XRO A;  1YW9 A;  3TED A;  2NS8 A;  4LLG F;  3CCR I;  3OS0 A;  4PUS A;  2HEO A;  4EJV A;  5JR3 A;  4AVZ A;  4BGD A;  5EG0 B;  1FBQ A;  1Q1V A;  3C18 A;  1FTZ A;  2LP0 A;  5LFA A;  1RKW A;  4R79 A;  1I6X A;  4KYW A;  1YTY A;  1UJ8 A;  5EZH A;  4EQQ A;  2JT1 A;  1F1Z A;  4CA0 A;  4UVC A;  3DKW A;  4X1E A;  3K4B A;  1POG A;  1XN7 A;  1TQM A;  3S2W A;  1OFC X;  1LKX A;  5GAG J;  4V19 K;  2EA4 A;  4QTR A;  1K4T A;  2BEO A;  1BJZ A;  3HSE A;  2W82 A;  4KIC A;  2FBK A;  4HF2 A;  1I50 J;  2XB5 A;  3BWG A;  5E8I A;  2LR8 A;  4IRG A;  1YRN A;  3ZQ7 A;  4BNC A;  5FKN A;  3NAR A;  1O57 A;  2ECB A;  4F55 A;  1XB4 A;  4I6Z A;  1BJA A;  1SAN A;  3UKG A;  1IGN A;  1J5Y A;  2HZT A;  2VJ4 A;  3HUG A;  2DFF A;  2KPM A;  2M2E A;  4PK4 A;  2L01 A;  1JT6 A;  1ORK A;  1OCO H;  1BBY A;  3H9J A;  2GIV A;  2XV4 S;  3HKZ A;  3WGH A;  2DOE A;  2XUB A;  4IQJ A;  4KFC A;  4ZYD A;  1OR7 C;  2K9Q A;  1E0E A;  2ZSI B;  4HX7 A;  5IP7 J;  2GZW A;  4KMU X;  5F08 A;  3Q0U A;  1Z1D A;  2ICW G;  1Z67 A;  3ZMZ A;  1KU9 A;  2XB0 X;  3PIP F;  4IO9 F;  3LOC A;  3G71 I;  1VQL I;  4IZZ A;  4HA8 A;  2KQR A;  1FBS A;  4YFX F;  2XAU A;  2LBF A;  1SVO A;  1VQ7 I;  3EUK L;  1VI0 A;  3H0G J;  4PSW A;  4AWX B;  4A3F J;  4CCO A;  1YFH A;  2BOL A;  3EYI A;  1KZH A;  2HOE A;  5KAF C;  3BG7 A;  3H5R A;  5A2Q K;  1YO5 C;  4L5I A;  1RIO H;  4MQ9 F;  2IVM A;  1ZRE A;  2L4M A;  2EZK A;  2QQB A;  2W4S A;  3TQN A;  3L2W A;  3S14 J;  4GO1 A;  5FRN A;  2MH2 A;  3GTG J;  2DAO A;  4LIV A;  1X3U A;  3IHU A;  3WGG A;  1X1P A;  3TBI A;  1MMA A;  4MTE A;  2V4J C;  1XMA A;  2KL4 A;  4G7H F;  4UY8 I;  4OU0 A;  2HXO A;  4CDG A;  4RDU A;  3ZQQ A;  3ZMV A;  3CCJ I;  5CQE A;  4E70 A;  3A01 B;  4LLL A;  3HZJ A;  4E7L A;  1KU3 A;  2E2H J;  4Q48 A;  1TTY A;  3WG9 A;  3C1D A;  5TRD A;  3F72 A;  1SFX A;  2F48 A;  3GLL A;  2GOM A;  3JSP A;  3H1C A;  3ZOB A;  3ERE D;  4M9X A;  1ZGA A;  2Q2E B;  3HSF A;  5F1R A;  2OCE A;  3BZC A;  2XAQ A;  2IA1 A;  1CF7 A;  4BH9 A;  1J0R A;  1RUO A;  1PP7 U;  4GCV A;  1A6I A;  4LD5 A;  3FDY A;  1W5C C;  3KEO A;  3ONQ A;  3BQZ A;  2GIZ A;  3QP5 A;  4U0W A;  1W7P B;  2A6T A;  3DQV C;  1BC8 C;  1JJ6 C;  3RZD J;  2R7F A;  2ME6 A;  4G6D A;  3I0T A;  2HVQ A;  1HDP A;  5LHI A;  2V26 A;  2G7U A;  2I5U A;  4RAF A;  2CSO A;  4L0Z B;  1IN8 A;  2DA5 A;  4EJT A;  4OMZ A;  2ZNY A;  3PO2 J;  4GRI A;  4M6Y A;  1D0Z A;  2W57 A;  1AKH A;  2XGE A;  4XLF A;  3RPU D;  2YPR A;  4KA4 A;  2XAS A;  3LA3 A;  3IH3 A;  5F0C A;  4ESB A;  3GFL A;  4K2E A;  4MHG A;  3SXY A;  1YJW I;  2VLA A;  2K4J A;  1APL C;  1B1B A;  3CUQ A;  1P6R A;  2G7H A;  4CCK A;  4CHU A;  4G6T B;  5HS7 A;  3TKY A;  3HOY J;  2BW3 B;  1CGP A;  2O5R A;  1F5T A;  1QZY A;  4I01 A;  4NQW A;  5GTI C;  3PQK A;  3ABM H;  2NAZ A;  3EET A;  1OYW A;  1S7E A;  2DTZ A;  4UVB A;  3R4K A;  3AL0 C;  1MMN A;  3K7A J;  3L00 A;  2JA5 J;  1TQI A;  2N8G A;  3TO7 A;  3WG7 H;  1DDN A;  4ENN A;  4B47 A;  1XPX A;  3FXU A;  1U9O A;  1ZK8 A;  1UHW A;  2VJJ A;  3DU5 A;  2M4K A;  2BVL A;  4PJJ A;  4XOR A;  1T38 A;  3CJR B;  3K4K A;  1WJD A;  3AG1 H;  1PYV A;  1V54 H;  2IBD A;  3HRM A;  3MWM A;  2O6G E;  3HL2 A;  1TWH J;  2DYS H;  4B8X A;  2FBH A;  2ZJQ F;  2QSG X;  5HNF A;  3E3V A;  2M1B A;  2YR2 A;  4ZYA A;  1GXP A;  1B4A A;  1WJF A;  1HW5 A;  4BUP A;  1QHG A;  1Y39 A;  2VQL A;  2I10 A;  1YRN B;  5EEH A;  2DYR H;  3DFG A;  1JT0 A;  1MW7 A;  3BR5 A;  1XD7 A;  2VKH A;  2BYV E;  2QSH X;  3BTL A;  1ZGW A;  4MFD A;  2QSF X;  3FIW A;  2OC6 A;  2M0M A;  2K85 A;  2FBI A;  2PMZ N;  3OV8 A;  1KYW A;  3MKY B;  1KQ8 A;  1HF0 A;  3BR6 A;  1MH3 A;  4A5M A;  1RC9 A;  2R7T A;  2FD5 A;  2ZJ2 A;  5IT3 A;  2PX9 A;  2XPW A;  3RYP A;  2RNG A;  3TO6 A;  2KIQ A;  3ZRG A;  3MKL A;  3KIO A;  1J75 A;  5K7Z A;  3K0L A;  1MH4 A;  2DA3 A;  1I39 A;  2XKP A;  2VPL A;  1U9N A;  1Z91 A;  2H27 A;  4ZDL A;  1JHF A;  2HZD A;  2P4W A;  3OYL A;  2E1N A;  2E36 A;  2VIX A;  3FBN B;  4UVA A;  4P9F A;  1FC3 A;  4BHC A;  1KQ0 A;  4S05 A;  3AG3 H;  1X2M A;  2E1C A;  1Z7U A;  2IXS A;  4IVN A;  3V42 A;  1VQN I;  4L9N A;  3QRF F;  3NWT A;  1T0F A;  4J00 A;  4BE2 A;  5JI6 A;  4MFE A;  3COA C;  1EH6 A;  3WE3 A;  2HR3 A;  5JVG F;  5GAE J;  4F7Z A;  2QUF A;  1ON1 A;  1B9N A;  1FOW A;  1RZ4 A;  3JRC A;  3DTK A;  3CDI A;  3S93 A;  2LY2 A;  3HOU J;  4TV7 A;  3O2P E;  1TZL A;  3QAH A;  2EFQ A;  4WF2 A;  1X3W B;  2WY8 Q;  1D5V A;  3OIO A;  4FTH A;  4CYC B;  1YIJ I;  1ZRD A;  4HSR A;  3RPQ A;  2CGP A;  2HGC A;  3H3V K;  1Z3Y A;  4HNU A;  2CRG A;  1HKT A;  1K78 B;  1D8K A;  1X58 A;  2LFB A;  3IWF A;  4A0Y A;  3RIR A;  3BPX A;  3OOP A;  3UR3 C;  1IG7 A;  3M4O J;  1T95 A;  1A36 A;  4KIG A;  3FXK A;  2QGU A;  2K9L A;  3GZN B;  2BY2 A;  4AU7 A;  1Z05 A;  1D1C A;  1YQA A;  4MLO A;  4QWQ A;  1WPK A;  4BJT A;  4HNT A;  1O3R A;  1BM9 A;  3M07 A;  4FX4 A;  3CD6 I;  1MGT A;  1FLI A;  3HHH A;  5HVQ C;  2UWM A;  1S9H A;  3JAM Z;  1JUS A;  2F2E A;  4A3L J;  5E3L A;  3CJN A;  3K4N A;  3CLQ A;  3R0J A;  5HDG A;  1WKM A;  2VBZ A;  3G2B A;  5KAI C;  2CU7 A;  3S17 J;  4MEY F;  4LIT A;  4BS9 A;  3OYG A;  3RI4 A;  1BW6 A;  3X2Q H;  3HPH A;  2YS9 A;  2GWR A;  2CUF A;  5IOZ A;  2P6T A;  3FHN A;  1TT0 A;  2DJN A;  3L9F A;  4EAT A;  2GM4 A;  3WGI A;  1OCT C;  3QYE A;  3IH2 A;  2DT6 A;  2LK2 A;  4A0Z A;  2ZME A;  5CVJ A;  4A6D A;  4LG0 A;  2FJ1 A;  3O8H A;  3RKQ A;  1WJB A;  2XPV A;  4M73 A;  1DPU A;  3FXQ A;  2NVX J;  2CG4 A;  4W97 A;  1P9Q C;  4V2F A;  3VSL A;  4IF4 A;  2VOO A;  2DMP A;  2MLK A;  1KON A;  1OYI A;  2OV7 A;  3H5A A;  3OIQ A;  1T98 A;  3QU3 A;  4ZYH A;  5LBQ A;  4PFO A;  1VQM I;  2DOA A;  2Z16 A;  2ZME B;  4NC8 A;  2DQR A;  3L2C A;  3K70 D;  3CUQ C;  3MVP A;  1FMW A;  2F4O B;  4UUS A;  2TDX A;  2XF7 A;  4BL0 B;  1SFK A;  1U3E M;  1VQP I;  2NYX A;  5M5W J;  2IGO A;  4UB6 C;  1RKT A;  5BQT A;  2JN6 A;  2BGC A;  4IPA A;  3EYY A;  1ETW A;  1FMV A;  5KVR A;  4ETS A;  2EA2 A;  2JSP A;  3LA7 A;  2FNA A;  5E20 A;  3I59 A;  3E1S A;  1JTX A;  3CCL I;  1H89 C;  1FOY A;  1TW2 A;  2M0C A;  1QO0 D;  1N78 A;  4AIH A;  3V7C A;  1VTN C;  4LB5 A;  4A3M J;  3JRD A;  1K61 A;  4MGR A;  4CSW A;  3OSF A;  1FJL A;  3KX2 A;  2XVC A;  3R60 A;  5D5U B;  1XSV A;  1SC7 A;  3N97 A;  2KT0 A;  1QPM A;  4FQG A;  3E6B A;  4X6A J;  4HW0 A;  4FCY A;  1Z3X A;  1SD6 A;  2P5V A;  4P55 A;  3QPL A;  2OZU A;  1G3S A;  1TNS A;  2LOO A;  2E7X A;  3Q0V A;  4LK0 F;  4CYC A;  2PMZ A;  3LFU A;  2E34 A;  4OIO F;  3K4M A;  1GV2 A;  3SDG A;  1Y1V J;  4B3A A;  5E17 F;  1QQI A;  3DCF A;  2LNB A;  3ZQL A;  1YX3 A;  2DA2 A;  4AYB N;  1VQ6 I;  2LY9 A;  2MD0 A;  1FSH A;  3CF5 F;  4P5O A;  3PL8 A;  2EK5 A;  2K5C A;  3ZMS A;  3DWL E;  2ID3 A;  3KE2 A;  1R23 A;  2XKO A;  4B3X A;  3TL4 X;  4QLC U;  3I4N J;  2JZY A;  4YIR X;  1S3J A;  4C3H J;  4DNC A;  1WI9 A;  2E60 A;  5E1X A;  1UG2 A;  2IA2 A;  1S29 A;  4BXU A;  1HA8 A;  5K5Q A;  3Q9V A;  1D1A A;  1PJR A;  2W24 A;  1HQC A;  2W1O A;  3F8F A;  2L5Q A;  5EJC A;  3OOU A;  2PMH A;  5B1A H;  1CF7 B;  1MD0 A;  2LVS A;  5D8K B;  3BG3 A;  4XKV A;  2F4M B;  1N25 A;  1YIT I;  2Z99 A;  3FXO A;  3RTR A;  3A02 A;  3HGY A;  2FU4 A;  1V5F A;  2M4G A;  2CW0 F;  3FKJ A;  4H4K C;  4CO8 A;  2R5Y B;  1R49 A;  1WRJ A;  4YFK F;  2GBY A;  5L3C A;  3OIP A;  1BA5 A;  3E7L A;  2QQ9 A;  3JW4 A;  3A01 A;  1FWZ A;  4S0H B;  2HU9 A;  3CUO A;  1OPC A;  3Q0W A;  3I9V 2;  1R58 A;  3WTX C;  1GVD A;  3K6G A;  5D4S A;  3LL7 A;  2QKM B;  3P9C A;  5L3E A;  2DO7 A;  2OPT A;  2B0L A;  5LD2 C;  4KUM A;  1LFU P;  1NG7 A;  5CVU A;  1R71 A;  4IXA A;  1X4P A;  1XMK A;  2HQR A;  2AXT C;  2ISY A;  4GFB A;  3BY6 A;  4WXD A;  3TW6 A;  3PNT A;  4BQO A;  2XRL A;  3BG9 A;  2EFN A;  5GPC A;  3GLX A;  5E79 C;  5ICG A;  2FX0 A;  2Z5U A;  2HOT A;  4PZJ A;  4LB6 B;  3GX4 X;  3H9Q A;  1YI2 I;  2V1U A;  4XON A;  4F91 B;  3PSI A;  5FRO A;  3HRU A;  2X1E A;  3U1K A;  4HV5 A;  1PP8 F;  1JHH A;  5L3F A;  4NDL A;  2LY1 A;  3BG5 A;  4XKC A;  3NAU A;  4Y15 A;  2UXX A;  2E2I J;  4BYY A;  1K78 A;  2IT0 A;  1X3Z B;  2E1O A;  4ITV A;  3OYE A;  3W2A A;  1M1E B;  4XOP A;  3DEU A;  3JRI A;  1OMI A;  4N4N B;  4CCL A;  4PCQ A;  1QNT A;  5E8G A;  1J7K A;  1GT0 C;  4D5C A;  2EIN H;  2RQP A;  3JR9 A;  2R7X A;  3H9G A;  2R5Z A;  3T8T A;  1G4D A;  4FX0 A;  1K6Y A;  2BVM A;  2VBX A;  2XGC A;  3J81 K;  2BBY A;  4LOC A;  1NH3 A;  1LDD A;  2DFI A;  4FAS D;  4EJO A;  2K9N A;  5CQG A;  1SMY F;  2R0Q C;  4HEA 2;  3G1L A;  1WQ2 A;  4BJ5 C;  1IRG A;  2GXG A;  2XC7 A;  2CV2 A;  3TMO A;  4LFU A;  2PJR B;  2CQK A;  2WAQ N;  3S15 J;  4G8X A;  4KIB A;  1RR8 C;  1I6H J;  3TDZ C;  2LBF B;  4RLQ A;  2XHK A;  5HOD A;  4IQ4 A;  3HJE A;  3OYA A;  4XR6 A;  4A6E A;  1GVJ A;  1GV5 A;  2R7Z J;  1A5J A;  1FYL A;  4JYK A;  4RAG A;  1FP1 D;  3TOB A;  2ACJ A;  4NC6 A;  5LLQ A;  2DW4 A;  3H36 A;  1YX5 A;  2KHM A;  3RQI A;  1EH7 A;  3LSK A;  1JJ8 C;  5JFR A;  2M45 A;  1B9M A;  3DBR B;  2Y31 A;  5GP9 A;  3SEQ A;  2CQX A;  3I4M J;  1BIA A;  4HBL A;  2Y30 A;  2QLZ A;  4D9J A;  3GBG A;  3GTM J;  5TJJ A;  3E0J B;  2HKX A;  2MBF A;  4EVI A;  5ICE A;  2EIM H;  2FNP A;  2CUZ A;  5ICC A;  4KIS A;  2CW7 A;  4UXN A;  1U5T C;  2FRH A;  3PUF A;  3I59 B;  3TGN A;  1W1W E;  4BDZ A;  3AAF A;  2QEX I;  1TBX A;  2M8E A;  4AD9 A;  3L2R A;  3S8P A;  2IAI A;  5EYR A;  3M3Y J;  1XSX A;  5EEG A;  5GPA A;  3T8R A;  4IHV A;  1WWX A;  3BCB A;  3CP8 A;  2MA3 A;  5H2F C;  1D1B A;  2Y0M A;  2I8D A;  4JX5 A;  2GQQ A;  3BP8 A;  2Q0O A;  4EGY A;  2CMP A;  1IXS B;  2Z1D A;  2JMW A;  4OMY A;  2VE9 A;  4KN4 X;  2VKE A;  4BU2 A;  5ILU A;  1ETO A;  1RI7 A;  1MSE C;  1MMG A;  3E5X A;  1ZG3 A;  4BJ6 C;  2JA8 J;  1LPQ A;  1G2H A;  3HOX J;  1L3L A;  1B8I A;  3S2H J;  3O6B B;  2BY1 A;  1ZLJ A;  3I55 I;  4HNV A;  5ED4 A;  4B1R A;  3M1E A;  2M8G X;  3S1Q J;  3BT9 A;  3VPR A;  1AU7 A;  2BV6 A;  2LKS A;  3K4C A;  3VWB A;  2Z33 A;  2MC3 A;  2IS4 A;  2PMU A;  2ZXW H;  4LIU A;  5IYB J;  1DUX C;  1MBK A;  2KJB A;  1ZH5 A;  5E3O A;  2O3F A;  3D1N I;  3F22 A;  5HDK A;  3ZQI A;  5FFX A;  1X1C A;  3EQL F;  1SD5 A;  1FX7 A;  5B3S H;  3JAM K;  2JSC A;  3HUG B;  2QA4 I;  4BEH A;  3IL2 A;  4G7O F;  1Y8R B;  2XPU A;  1KA8 A;  2FXA A;  2NS0 A;  4E7S A;  3F8B A;  5E3N A;  1VQ4 I;  3TP3 A;  3OYN A;  4KT6 A;  1IW7 F;  3A4C A;  1WI3 A;  3K4J A;  3HOS A;  4IJA A;  5TIS C;  4I2O A;  2O0Y A;  1ZN2 A;  2K9S A;  3B6C A;  4M3F A;  4ZTJ A;  5FO5 A;  4PGH A;  2HKO A;  2O8K A;  2ME0 A;  1BI3 A;  4II3 A;  3AL0 B;  2KZV A;  1ON2 A;  1Z77 A;  1VQ8 I;  2DA1 A;  1YW7 A;  4RLF A;  3DEE A;  2DBB A;  2R92 J;  4MNU A;  2HPI A;  1Y6I A;  3P5J A;  1FT9 A;  3VB2 A;  3OYD A;  3LSR A;  2MLG A;  3BDD A;  2PQ8 A;  2ZJR F;  4LJZ F;  2L9V A;  2VOP A;  2XAG A;  2Y2Z A;  1IF1 A;  3FK6 A;  5ILS A;  3KET A;  2IP2 A;  2EWN A;  3MAJ A;  3EUH C;  2MFZ A;  2VKV A;  3OWT A;  2ZXJ A;  5DUI A;  4U0V A;  3GTK J;  4FIS A;  2JPC A;  4DBR A;  3SZT A;  5HLG A;  1Z6T A;  3PNY A;  4PJM A;  2DDA A;  1W7P A;  2WV1 A;  1V3F A;  2QYO A;  4NUB A;  2VXZ A;  3H0D A;  2JA7 J;  3J7A Y;  5DYM A;  4XMY A;  2M87 A;  4ZDP A;  4XRM A;  3VOD A;  4XRS A;  2JWT A;  4YEJ A;  3KP4 A;  1FY7 A;  3QYB A;  3HSR A;  1MIJ A;  2EFO A;  2E19 A;  1OCP A;  2ZXH A;  1EH8 A;  3OYH A;  1U8B A;  3PFY A;  1HC8 A;  1NK2 P;  4CZZ A;  1MNE A;  4RB2 C;  1TT5 B;  3JRF A;  1H8A C;  3G3Z A;  5F27 A;  1ZR4 A;  3REO A;  1FIP A;  2CFO A;  2JUC A;  3HXL A;  1IXC A;  2BW3 A;  2FUG 2;  2DT5 A;  4HLX A;  1ITY A;  5EGO A;  1BOA A;  3OSG A;  3CCV I;  1WSU A;  3KZI C;  3LSI A;  1JUM A;  3FK7 A;  5F0H A;  3DTE A;  2WV0 A;  2RDP A;  1W5T A;  2M7B A;  3I58 A;  3ABU A;  4I99 C;  4M3D A;  2M7A A;  3LWF A;  1HSJ A;  4L9J A;  3BR3 A;  4DYQ A;  1T33 A;  1EF4 A;  1Y56 A;  2YX7 A;  1X19 A;  3CME I;  3FHZ A;  3WTY C;  4DZJ A;  4NHJ A;  4KMF A;  4CH7 A;  5D5X B;  5C4X J;  1ZRF A;  3OYI A;  2X85 A;  1LE8 B;  4BQQ A;  1BR1 A;  4ENK A;  2FMY A;  1FOX A;  4PDK A;  2LH9 A;  3RQ4 A;  5DDG A;  3NEU A;  2IW5 A;  3BRO A;  2QWW A;  2JK3 A;  2EZH A;  4AID A;  1TWF J;  4NQW B;  4AVP A;  1HKS A;  2VT3 A;  3BJA A;  3ABK H;  4NB5 A;  2Y48 A;  4BHB A;  2JUG A;  4RA2 A;  4KNY A;  2HS5 A;  2CQQ A;  3G1M A;  1X1A A;  3ZP5 A;  2VOD A;  1FZP B;  4G9Y A;  3FXR A;  3ZN1 A;  4KJZ A;  3FMR A;  3KPH A;  3VOE A;  1I1G A;  4E7H A;  3BTJ A;  4F93 B;  1BIB A;  1W7P D;  2XSD C;  1LVA A;  2ZFW A;  3S32 A;  3V7S A;  3RKW A;  1PVE A;  4II2 A;  1XC5 A;  5JVT A;  3MD2 A;  2H1L A;  3D0S A;  4CIC A;  4Y4R A;  4A12 A;  1VFC A;  3IC7 A;  5FKO A;  4EGZ A;  2L7M P;  3A2K A;  2KIM A;  3W2W A;  2ZJP F;  2J5P A;  3N4M A;  2A5Y B;  2X51 A;  2Y0S A;  3F8M A;  2VBY A;  2KIU A;  3DBH B;  3RKY A;  3ZR8 X;  2NNY A;  3FXL A;  2VN2 A;  3LST A;  3A0H C;  2IS6 A;  4EM0 B;  2M5W A;  4YG2 F;  3WTT C;  4RB1 A;  3E97 A;  4JP0 A;  1SFU A;  2COM A;  3ASO H;  4RM2 A;  2EQR A;  1K4S A;  1GXQ A;  2L9N A;  3ECO A;  4A93 J;  2EH3 A;  3DP7 A;  3F23 A;  4L0Y B;  5C44 J;  3FXM A;  2HQN A;  5LRR A;  2KRC A;  2EIK H;  2JVG A;  1W0T A;  4GDF A;  1Z21 A;  4XLN F;  1H9T A;  2VQH A;  3ML6 A;  4EV0 A;  1RRJ A;  5D6F A;  3DTI A;  2DFH A;  4AIJ A;  1MBJ A;  3KCC A;  5JHU A;  4RB3 C;  3EPZ A;  3GME A;  1QVU A;  3NQO A;  4C3I J;  3G6E I;  2B9S A;  5A2Q Z;  2A61 A;  4BE1 A;  1RET A;  3CJQ B;  3ZQH A;  4L5E A;  3CDL A;  5FLM J;  1BN5 A;  1FPQ A;  1JUP A;  2ZO4 A;  1LNW A;  3W2V A;  2L7Z A;  3SZG A;  4DYR A;  3GUD A;  1IAW A;  3GTP J;  5KK1 A;  2P6S A;  4WX9 A;  5BPI A;  3W3C A;  4XN0 A;  2NOJ B;  4YII A;  5L3G A;  2LDU A;  2R3S A;  3HYI A;  1RES A;  2PN6 A;  4I76 A;  3M8F A;  3NWS A;  1R1U A;  1YS6 A;  2DXI A;  1W0U A;  3EUH A;  1HOM A;  5DS9 A;  3J7Y J;  2RQQ A;  5D6E A;  1ZRC A;  3HOT A;  3WHC A;  2IPQ X;  2ZC2 A;  2CW8 A;  1S7A A;  3WE2 A;  3KYD B;  3ABL H;  3A0B C;  3GVA A;  4HV6 A;  1LVK A;  2CQ7 A;  4N9H A;  4Y13 A;  5FLV A;  3GTJ J;  4JOM A;  1S72 I;  1LFP A;  1XCV A;  1O4X A;  2R7U A;  3ZGK A;  2QEN A;  2DDB A;  3CJT B;  4I09 A;  5AON A;  2L4A A;  2UUZ A;  1T39 A;  1VND A;  3BR2 A;  5IYD J;  4BBR J;  1FSE A;  3CUQ B;  1REP C;  3HOV J;  3W6J B;  9ANT A;  3GXO A;  4XM3 A;  1ETK A;  5M5Y J;  1BR4 A;  5DCF A;  1E3O C;  2B7E A;  2QBY A;  2CQN A;  1LDJ A;  1WGX A;  1JGG A;  2PEX A;  4XKB A;  2V9K A;  3SFZ A;  3J7Z I;  4J01 A;  4ZZL A;  4D7M A;  1WJA A;  1MDM B;  4HAM A;  2OQR A;  3I3L A;  4D0P A;  2JVH A;  2MG4 A;  2DOF A;  2RGV A;  1WCM J;  3HRS A;  1BI1 A;  1X4O A;  3P7N A;  1N77 A;  3H3Z A;  5CYV A;  3TDU C;  2J5O A;  4PSX A;  2DA7 A;  3JRG A;  1ZHF A;  1ZAR A;  2A68 F;  3SZP A;  4OIQ F;  2R7S A;  2A5W A;  1I3A A;  4UHT A;  2VON A;  1W36 D;  2X6W A;  4M74 A;  3F6O A;  2DTR A;  2H09 A;  3E6D A;  3LAJ A;  4A2U A;  2OTL I;  2CYY A;  2CH0 A;  2E7W A;  2DMU A;  5F64 A;  3JRE A;  2GA1 A;  2HTJ A;  2Q2E A;  1TQP A;  2F5V A;  1YIO A;  3LAP A;  2FE3 A;  5ICF A;  1B59 A;  1S6L A;  4IEJ A;  5CVV A;  1MBE A;  3HBL A;  1R9T J;  2Y9Y A;  3PJR A;  2R93 J;  1ZR2 A;  2R4G A;  2WB1 A;  2ZME C;  2A05 A;  3BR0 A;  1XSD A;  3D5S C;  5EEA A;  4ZJZ A;  1IN7 A;  2MH9 A;  2OCC H;  1YYV A;  4UNO A;  3I53 A;  4EJU A;  3MEX A;  5E3M A;  2NVY J;  5K5R A;  1R4N B;  4P9U A;  2LKX A;  1C0W A;  2HTS A;  1YG2 A;  4ENJ A;  3KP5 A;  2AXL A;  3R6S A;  3AG4 H;  2LF8 A;  3BZ6 A;  1K83 J;  4NNJ A;  2WAD A;  3WTV C;  4IL6 C;  1SD4 A;  3QPH A;  3AKZ A;  2VI6 A;  2VE8 A;  2HDC A;  5HS9 A;  3T5X A;  4DYC A;  1HKQ A;  4RB0 A;  4BHP A;  3CMY A;  1K79 A;  2EV5 A;  4PGG A;  2F4I A;  1T2K A;  5FLX K;  3D5L A;  2KIS A;  3FWE A;  4Y52 J;  1R5H A;  5K1Y A;  2R5Z B;  4A3J J;  1MDM A;  1KU7 A;  3NRV A;  4NBQ A;  1GUU A;  1RUN A;  1MJA A;  2EZL A;  4U7D A;  1U0J A;  4A0X A;  5DUK A;  1YLF A;  3OL4 A;  1FYK A;  5EDN A;  1H9G A;  1E3P A;  3VEP A;  4L18 B;  5C3E J;  3L2V A;  2XRN A;  1O3T A;  5D8L B;  5DCM A;  1D5Y A;  4AM3 A;  2W7N A;  1W4M A;  1OLT A;  2XGD A;  2KDZ A;  2P0W A;  2EFP A;  2YU9 J;  3H5N A;  2RAE A;  4CCM A;  4M71 A;  4WCG A;  2NXN B;  3L2Q A;  1U78 A;  3HTS B;  1D0X A;  3HM5 A;  1V55 H;  1AHD P;  1MZB A;  4L9T A;  4P1W A;  4Y17 A;  1O3Q A;  2HQA A;  2R7D A;  5HS8 A;  4IHT A;  3U2R A;  1DQU A;  2K9M A;  3JSO A;  3LFK A;  2P5L C;  1PUF A;  1IZ1 A;  2K40 A;  3QWL A;  5L3D A;  4AC0 A;  1FBU A;  3K4L A;  5D5W B;  2OUM A;  1ZGJ A;  2P8T A;  2VQG A;  1SFE A;  2WAF A;  2ZNZ A;  2V6E A;  2MGQ A;  4JK1 X;  3ZN0 A;  1WH7 A;  2LD5 A;  3HG9 A;  3G1O A;  2IJL A;  3LNQ A;  2V9P A;  1V4R A;  4MIM A;  1IRF A;  2P5K A;  1XGM A;  2E5Z A;  2XF6 A;  3SEZ A;  1W36 C;  4M6V A;  5BMZ A;  2FF4 A;  1P4A A;  2LYC A;  2IRF G;  1Y0N A;  2VT2 A;  2AQE A;  5IP9 J;  2HPM A;  1R6R A;  1IV8 A;  4G6Q A;  2FA5 A;  2NS7 A;  2W25 A;  3ELK A;  3LSH A;  2LRE A;  1T8I A;  2V7F A;  4RGS A;  3BPV A;  5J3L A;  3BJ6 A;  2HDW A;  1DGR M;  1RPW A;  2ZB9 A;  1SAX A;  1QZZ A;  4HQM A;  1XGN A;  2BHY A;  3FX3 A;  3HB9 A;  3GYH X;  2WC2 A;  3SQN A;  4IRI A;  2FML A;  3KEQ A;  1UHS A;  3OS1 A;  2H8R A;  4I02 A;  1SVL A;  4WXH A;  2DPU A;  4FHT A;  2L9R A;  4XSX F;  1UG0 A;  4BBS J;  3MCZ A;  5LGU A;  3HIF A;  4E7K A;  1YOV B;  4L9V A;  1B6A A;  5J4V A;  2D1H A;  3DXJ F;  1LFB A;  2ID6 A;  1ZG1 A;  5GAH J;  4PJ0 C;  4DJA A;  3J7A O;  3K2A A;  4DGW B;  3VYT B;  5K5O A;  1IN5 A;  5F04 A;  3IP4 B;  3WTZ A;  4EEF G;  4RMN A;  1OQY A;  2EPF A;  4BDY A;  2CS3 A;  3LQR A;  2K02 A;  5JLX A;  2OQG A;  2DT7 B;  2KJC A;  4HX8 A;  1VQ9 I;  1IDZ A;  3A03 A;  4XRS G;  4XN3 A;  4XK4 A;  2MSY A;  2KLO A;  1IN6 A;  3DLL F;  2OU2 A;  4BQN A;  1J9I A;  4Z2Y A;  3S2D J;  5B66 C;  3WTS C;  5E1W A;  1FIA A;  2XIG A;  1O3S A;  4BXX J;  1MBF A;  1UHM A;  2RN7 A;  3J80 Z;  1R36 A;  1QVT A;  3D5R C;  4UB8 C;  4ANJ A;  1ETV A;  3E5Q A;  3ZCO A;  3FZV A;  4A69 C;  3CCQ I;  4PJL A;  1T6S A;  3H92 A;  2BXZ A;  4BAY A;  1SD7 A;  1U5T B;  2VC0 A;  4JX6 A;  5HOO A;  3GZ6 A;  2NVT J;  3S3N A;  4KN7 X;  1WVR A;  3KP3 A;  1LJ9 A;  3FM3 A;  1DP7 P;  1GHC A;  5IPA A;  4OOI A;  4E4H A;  1XMX A;  4XID A;  1CQT A;  4JQF A;  2BY0 A;  2VL8 A;  3IKT A;  2A07 F;  3F0C A;  1SAU A;  5M3M J;  4WWC A;  1G6N A;  2DCE A;  2QQ8 A;  2VC1 A;  1P7I A;  1BOB A;  5FRM A;  4RGR A;  3SHF A;  1HW2 A;  1DGW Y;  2GA2 A;  1LE8 A;  3DPT A;  2PBI A;  5H20 A;  1FP2 A;  2UXN A;  2F5C A;  4B48 A;  2HYG D;  3DPU A;  3GEZ A;  1N75 A;  1NTC A;  2LF7 A;  3C2B A;  3CC2 I;  3JRA A;  1LQ1 A;  1B72 B;  1AWC A;  2E5N A;  3BTI A;  3I64 A;  2QM3 A;  1G3T A;  5KNL A;  2DOD A;  4IRH A;  4M3G A;  3OYK A;  4CGZ A;  2W85 A;  1A6Q A;  1WJ5 A;  1JE8 A;  3C2G A;  3DF8 A;  5J4Y A;  4XLH A;  2CV1 A;  2BY3 A;  4FE4 A;  2RRE A;  1EV7 A;  4CXF A;  1TP4 A;  5FD5 A;  5GAD J;  1OIS A;  2DMN A;  2DLL A;  5DCM B;  3J81 Z;  3B02 A;  2LRD A;  2R7O A;  2IS1 A;  1RNL A;  2OAZ A;  2DJI A;  4XNF A;  4ESJ A;  1YJ9 I;  1R5G A;  1OCC H;  5FKM A;  3S1N J;  1F43 A;  1QU3 A;  4P96 A;  2LC2 A;  5HLH A;  1S5L C;  2K27 A;  3CQZ J;  2EIJ H;  2QKL B;  3I5U A;  1X2N A;  2L2O A;  4CYD A;  2FEZ A;  3VSK A;  5J1Y A;  3CO6 C;  3Q3S A;  2C6Y A;  2OTJ I;  3DU6 A;  2DK8 A;  3JRB A;  1YHQ I;  5EZG A;  4H0E A;  6PAX A;  2X1D A;  2GAU A;  3G4S I;  2WWY A;  1YS7 A;  1QZE A;  2WAQ A;  2KMU A;  2WAE A;  1R22 A;  3LA2 A;  1DPR A;  4BKX A;  5BNG A;  3S1M J;  2MC4 A;  1X1B A;  5D4R A;  2EV0 A;  3HGG A;  1WH5 A;  5LGN A;  5FB2 A;  3TO9 A;  4U0Y A;  1QHH D;  1W5S A;  2WY7 Q;  1G3W A;  2DI3 A;  4I0B A;  3HOZ J;  1QGP A;  3GWZ A;  4A3K J;  3K2Z A;  2GOX B;  3HEF A;  2RNJ A;  1I5Z A;  3WU1 B;  4A3C J;  2ZKZ A;  3T0Y A;  3OYB A;  4ZYE A;  4LK1 F;  3ABT A;  4CZC A;  2JQ7 A;  2VQC A;  2NNN A;  4DBQ A;  5J47 A;  3BC8 A;  1NK3 P;  3IWZ A;  4Q4Z F;  4XSZ F;  4JX4 A;  4OIN F;  2NOG A;  2STW A;  4EMS A;  5ILV A;  1YE9 A;  4W1U A;  1A31 A;  3GO5 A;  5CVR A;  4B43 A;  3QOD A;  3QPT A;  4BXF A;  2D2W A;  2R7Q A;  2IGK A;  2Z9O A;  2MW8 A;  4XRF A;  2EJR A;  2K4B A;  1D3Y A;  1J09 A;  1FOK A;  1TLH B;  5HNH A;  3DV8 A;  2H6C A;  2EZI A;  4DOZ A;  1BL0 A;  1MBG A;  4IOC F;  5BS6 A;  3ZPL A;  1OKR A;  1U6G A;  2QCO A;  4BY1 J;  1E17 A;  2XAH A;  4OIR F;  3P9I A;  1LEA A;  5J8F A;  3C2H A;  3ULQ B;  5DM6 F;  3HHG A;  5H6R A;  5IT9 K;  4X0G A;  2LKP A;  4OIP F;  2XGX A;  2YX4 A;  2PFB A;  2W48 A;  2JPB A;  3F8C A;  4FT8 A;  3RZO J;  3RDI A;  4C2M J;  4YRV A;  1LB2 A;  3Q9S A;  4QSH A;  3KYC B;  4ZZD A;  2F5E A;  4XQF A;  1YJN I;  2VJ5 A;  2R7R A;  4GYG A;  2OJE D;  4ZYG A;  2DA6 A;  3I54 A;  2M3A A;  1TC3 C;  2CWE A;  2BHZ A;  2A6H F;  2EV6 A;  3L2U A;  3KZY A;  3J80 K;  4R8H A;  4QPQ A;  2XSJ C;  2Q8K A;  5E1Z B;  2ELJ A;  3KP7 A;  5DTD A;  2A69 F;  2YSR A;  5E18 F;  2KRF A;  3BCA A;  2LMD A;  1MMD A;  1U5T A;  1V5G A;  2VBW A;  3TOA A;  4CCN A;  1LEB A;  4A3B J;  5D5V B;  5CKT A;  1S7O A;  3TP0 A;  5KHD A;  2E35 A;  1XCB A;  4M6X A;  3JRH A;  4LLN A;  2D5V A;  2OF7 A;  4HLY A;  3PUB A;  2VAS A;  2BXY A;  2E71 A;  4N0B A;  2DU9 A;  2AO9 A;  1ERD A;  3R61 A;  1JKQ C;  1JI8 A;  1K6O A;  2X48 A;  4EM2 A;  2XAJ A;  2O03 A;  2V9V A;  2ELK A;  3ZXS A;  3WTU C;  1ZG5 A;  3AG2 H;  3F6V A;  3CP2 A;  3V4G A;  2ZCW A;  4U88 A;  2L7K A;  2O61 A;  2HOA A;  2X9D A;  1SMT A;  1IN4 A;  1NG6 A;  2KDO A;  4UUS B;  4IHW A;  1T0F C;  3IKV A;  3RPU A;  4IOA F;  2EFW A;  3Q5F A;  2ESH A;  3WU2 C;  1XX5 A;  4RBO A;  4HF1 A;  3L1P A;  2STT A;  3OYC A;  5DEQ A;  3BG6 A;  4EM1 A;  3RYR A;  1F9N A;  2DMT A;  2Y75 A;  3PIO F;  1XGS A;  4IHX A;  4HRI A;  4UV8 A;  1B8I B;  1ODD A;  3HPG A;  1P4W A;  1BI2 A;  5LHG A;  1KGS A;  2P7V B;  3M9A A;  4M9Z A;  2COB A;  5JHF A;  3ISP A;  2FSW A;  4I0A A;  4HDV A;  1MMS A;  1PUE E;  2B63 J;  3DKY A;  2G9W A;  4ZC3 A;  1AKH B;  2A3S A;  3WU0 A;  3GFM A;  1WJC A;  4HQE A;  1IDY A;  4M3B A;  1QPI A;  2H1K A;  4HZF A;  1FEX A;  1R1V A;  4O5V A;  2R5Y A;  1G8X A;  1ETX A;  3GFJ A;  4XOT A;  2O7O A;  3ERM A;  5CVI A;  5GTH C;  3MQ0 A;  3S3M A;  3K1N A;  4LG3 A;  5LHH A;  1SVM A;  1STZ A;  3ZMT A;  1HST A;  2HI3 A;  2UV1 A;  3VYU B;  3K69 A;  4Y33 A;  1VQO I;  1BI0 A;  4RGU A;  3CDH A;  4U7B A;  4QIW N;  3OY9 A;  4J19 A;  5FKL A;  4A3D J;  2L02 A;  1MJB A;  3CC7 I;  2P7C B;  2IGM A;  4M72 A;  2KP6 A;  4JBA A;  1Z0X A;  5LEJ A;  1KQ9 A;  3KLO A;  3MZ8 A;  3PNV A;  1MBH A;  3AFH A;  3U1D A;  3V8J A;  4D5F A;  2MYS A;  3BTC A;  5HDN A;  2HYJ A;  2WA0 A;  3K9T A;  4E7I A;  2L0K A;  3TW7 A;  3G73 A;  2ELH A;  2CUE A;  2FOK A;  2NVQ J;  4C2T A;  3MFK A;  1G59 A;  3DEW A;  1ZTR A;  5CJ9 A;  5EGO B;  3M1C A;  4MQV A;  3GTL J;  2EB7 A;  3PFI A;  3I56 I;  5EF6 A;  2E1M B;  3L7W A;  3LMM A;  1AOY A;  3K1M A;  4F92 B;  2Z3Y A;  4A3I J;  4HYE A;  2ZBK A;  1P92 A;  3MMY B;  3W6V A;  1NHA A;  1P4X A;  4A5N A;  5IYC J;  1HLV A;  3GW2 A;  3H35 A;  3HRT A;  4XL9 A;  2X4H A;  3ROU A;  4CCJ A;  4G7Z F;  2X6X A;  4ABZ A;  1UZC A;  1IV6 A;  4C3J J;  4KIF A;  5L3B A;  4DZP A;  5IP6 A;  3M8E A;  2HWV A;  4CUG A;  3ZQG A;  4WXC A;  2PJP A;  2CJJ A;  4HX4 A;  4B44 A;  3DBL B;  3MKZ A;  1MSF C;  4BAC A;  3C7J A;  3H3U A;  2W00 A;  2QBY B;  4DQ2 A;  2RVC A;  3CF2 A;  3QYF A;  3R0A A;  5M3F J;  3UNG C;  3GZ5 A;  3LSJ A;  1MJ9 A;  2XDV A;  1KYZ A;  1ZKG A;  3FIS A;  3F21 A;  4R1H A;  3E6C C;  1MKM A;  2R7V A;  2YUS A;  2AHQ A;  4A3E J;  5JLW A;  3VFZ A;  2TCT A;  3OMY A;  2HFH A;  2O8X A;  4FET A;  3V7R A;  3IRQ A;  2WBM A;  4OAY A;  4AUX A;  2ETH A;  5J8C A;  5IT9 Z;  3QOP A;  3IAM 2;  4O3M A;  3S1R J;  3I71 A;  3FBI B;  1FTT A;  2Y69 H;  3F8N A;  4A3G J;  5K7F A;  5FD6 A;  2E2J J;  5CLS A;  2D45 A;  3HKZ N;  5FJ8 J;  4E7Z A;  3V8K A;  3F3X A;  1IC8 A;  2O9L A;  2EBI A;  1R7J A;  4HOB A;  1D0Y A;  3IAS 2;  1R5I D;  1Y0U A;  1J59 A;  2DN0 A;  2HYF A;  4Q5S F;  4RAZ A;  3F9K A;  3PQJ A;  3KLN A;  5DD8 A;  1F36 A;  3WOD F;  3EUA A;  1T08 B;  4RS8 A;  5B5E C;  3HOW J;  1JKO C;  3CC4 I;  4N9I A;  5BPD A;  4BY7 J;  2BE5 F;  1Z6R A;  3IH4 A;  4B4C A;  2K86 A;  2MAB A;  4Z6Y A;  2DMQ A;  3JTG A;  3HDD A;  3A1Y A;  4LGW A;  2QZ8 A;  1X1D A;  4I98 B;  5IOY A;  4F3Q A;  4YFN F;  1H88 C;  4YEL A;  2KZG A;  2X0L A;  3LSP A;  3QOE A;  1LUJ B;  1UST A;  1WJE A;  4ON0 A;  3I4P A;  4ZDO A;  1SEU A;  4O6J A;  3VYR B;  1ZYR F;  2JTV A;  3IUO A;  2IA0 A;  2K3F A;  2QQA A;  3BZK A;  3ZMD A;  5BOX A;  5LEK A;  2MD5 A;  2OA4 A;  2QF7 A;  1USS A;  3B73 A;  4C2U A;  5DM7 F;  3WHB A;  4BE0 A;  3FKI J;  1EKE A;  1XTA A;  1JTY A;  3RSN A;  1EJ9 A;  4KIT B;  3KP6 A;  1E2X A;  4DW6 A;  1G3Y A;  2ZFU A;  2RKH A;  2RV8 A;  3VYS B;  3ESW B;  2OBP A;  3RKX A;  2L7F P;  2LTP A;  3JCU C;  3RCO A;  4U87 A;  2JJ7 A;  3KEY A;  3QQA A;  3CES A;  4S04 A;  1MND A;  3CMA I;  2IGN A;  3S16 J;  2H6B A;  2HVR A;  1UB9 A;  5F6F A;  1ETY A;  5HLT A;  2HVS A;  1J2X A;  4RM3 A;  5ERI A;  1AA7 A;  3PM1 A;  3ZMU A;  1VF9 A;  1ZEL A;  2VKD A;  3E6M A;  4GXO A;  4HG2 A;  1BR2 A;  3OYJ A;  1B72 A;  3O3K A;  4XLE A;  2V1N A;  1TWG J;  3FM5 A;  4Y3O A;  1ZQ3 P;  1Z7L A;  1YW8 A;  2EIL H;  1T56 A;  3ZQF A;  2NVU B;  3ZQC A;  5J1R A;  2DQL A;  1ETQ A;  3CLO A;  1TL8 A;  1XS9 A;  5AIQ A;  1QBJ A;  4Q47 A;  2M34 A;  1Y1W J;  2KIF A;  4HF0 A;  4XKW A;  4EJW A;  1OR7 A;  3KZZ A;  3ECH A;  4B09 A;  5DV5 A;  3GCM A;  1HDD C;  4D1Q A;  2JA2 A;  5J6X A;  2L54 A;  1QRY A;  2F5D A;  2LLK A;  1VQ5 I;  2ADU A;  3SYT A;  2ESN A;  2CV0 A;  4PJN A;  4M3E A;  3SJM A;  1OYY A;  2P81 A;  1R4M B;  2GXA A;  1IJW C;  5F0F A;  2ZXI A;  3ASN H;  4UV9 A;  2V1D A;  2W84 A;  1U2W A;  2FOW A;  1OJL A;  1JKP C;  1BW5 A;  1A35 A;  4BQA A;  3M7G A;  1IRZ A;  1DU6 A;  5M5X J;  4AYB A;  1SFO J;  1UAA A;  2CO5 A;  2WB1 N;  3L09 A;  4IHY A;  4G94 A;  2NRA C;  2IEK A;  2BZT A;  4RAY A;  4E7J A;  5TGT A;  2V1X A;  3K70 C;  1U8R A;  2M30 A;  3MZH A;  1GDT A;  5J1U A;  4HPQ A;  3DKX A;  3V8L A;  3BJO A;  2OZ6 A;  2F6C A;  2X6Y A;  3C3W A;  3FMQ A;  4C9Y A;  4DIQ A;  4XLP F;  3GFI A;  1P2F A;  1BC7 C;  4IKF A;  5FKK A;  4D7N A;  2CUJ A;  3EDP A;  5C4J J;  4OAZ A;  4L5J A;  4N4O B;  5FFZ A;  1OCZ H;  1UCR A;  1H0M A;  3BLY A;  2LG4 A;  2JRM A;  3OYF A;  2AS5 F;  2PG4 A;  4AIK A;  3QP6 A;  5H6Q A;  1DP3 A;  1WZ2 A;  2M9H A;  1I27 A;  5HLI A;  2VXD A;  5B1B H;  2Y0S N;  3K10 A;  3LQQ A;  2GLO A;  2ZSH B;  2DA4 A;  4FE7 A;  5KCM A;  1QA6 A;  3KP2 A;  3BOQ A;  4E6K G;  1A04 A;  4ZTF A;  1P7J A;  1LDK B;  3PSF A;  3CCU I;  2DFE A;  2L3D A;  1XG1 A;  1IXR C;  3KYL A;  3E5U A;  2F5F A;  3QPS A;  1HW1 A;  4OWR B;  1WFX A;  1FNN A;  1UFM A;  3CCE I;  1XDU A;  3OYM A;  2AQF A;  5K7H A;  1Z9C A;  3MN2 A;  2ISZ A;  2D1V A;  1D8J A;  2KKO A;  3N05 A;  4LG0 B;  3U9G A;  4KT5 C;  1JXS A;  3FXJ A;  1L0O C;  2PJR A;  3KFW X;  4UUV A;  4IHS A;  1UEL B;  2E1M C;  2VJI A;  1R00 A;  2KRH A;  4QPO A;  2KFD A;  3CCS I;  3PO3 J;  3WTW C;  4ESF A;  2DK5 A;  3U21 A;  4BEH B;  4MO7 A;  1PUF B;  4ASN A;  1XGO A;  3M8J A;  4XLC A;  5LRS A;  1ULY A;  4HST A;  4YIF A;  2LSO A;  3OR1 C;  1ONV A;  4C30 A;  5J40 A;  1RR7 A;  3T1B A;  1JGS A;  1VZ0 A;  2PLY A;  2CFX A;  2FQ4 A;  2A6E F;  2WTE A;  4XIC A;  3FF5 A;  3BR1 A;  1TWA J;  1FYM A;  2HDD A;  3LSG A;  3P9K A;  5IY5 H;  1R1T A;  1O7F A;  3K1P A;  2Z2S B;  2HNH A;  2DPD A;  3CO7 C;  1HCR A;  2VB6 A;  3IV5 A;  4I7H A;  5CPR B;  2TRT A;  4F52 A;  2YU3 A;  2QVO A;  3CCM I;  3IRR A;  1HXD A;  2ECC A;  2JRT A;  1I3Q J;  3SFI A;  4M9S A;  1VQK I;  3SDB A;  2XAF A;  1GLN A;  2X1C A;  4G12 A;  3OS2 A;  2H94 A;  4MTD A;  3HTU A;  3LSM A;  2VPR A;  1ACI A;  5FLX Z;  4NC7 A;  4RGX A;  4WK8 F;  1O7L A;  4LMY A;  3OR2 C;  5LGT A;  1OCR H;  3FMS A;  3OL3 A;  4MEX F;  3JTH A;  2GXB A;  3GTO J;  2H8W A;  1ZAO A;  4Y7N J;  2UZK A;  2PI0 A;  2K7L A;  3CCY A;  3HC7 A;  3W6K B;  1ZLK A;  3VDX A;  1UMQ A;  4UUT A;  2R7W A;  1HBX G;  4XLA A;  1IUF A;  2G0E A;  1S8N A;  1IRX A;  3MZY A;  3S3O A;  2IS2 A;  1V5E A;  1IO2 A;  2Y9Z A;  1TNT A;  1F4K A;  4XBF A;  3B6A A;  1K7A A;  2K3P A;  4HDU A;  1DU0 A;  1EA3 A;  1Q1H A;  4KDP A;  2HXI A;  3BQY A;  4GYI A;  5AIP A;  3DPL C;  3O8G A; 
#chains in the Genus database with same CATH homology
 2OD5 A;  1I1S A;  1KU2 A;  2V79 A;  1PDN C;  3GF2 A;  5FGM A;  2RC4 A;  4GGG A;  5DD4 A;  1IUY A;  3QU6 A;  2FQ3 A;  3RJP A;  1XDS A;  4ENM A;  2V6C A;  4ZH4 F;  3CTA A;  1TW3 A;  2XRO A;  1YW9 A;  4LLG F;  2HEO A;  4EJV A;  5JR3 A;  1FBQ A;  3C18 A;  4R79 A;  1I6X A;  4KYW A;  1YTY A;  4EQQ A;  2JT1 A;  1F1Z A;  4UVC A;  3DKW A;  1XN7 A;  1TQM A;  3S2W A;  2EA4 A;  2BEO A;  3HSE A;  4KIC A;  2FBK A;  4HF2 A;  3BWG A;  5E8I A;  4IRG A;  3ZQ7 A;  4BNC A;  1O57 A;  1XB4 A;  1BJA A;  1J5Y A;  2HZT A;  3HUG A;  2L01 A;  1BBY A;  2GIV A;  2XV4 S;  3WGH A;  2XUB A;  4KFC A;  4ZYD A;  4HX7 A;  2GZW A;  4KMU X;  1Z1D A;  3ZMZ A;  1KU9 A;  4HA8 A;  1FBS A;  4YFX F;  4AWX B;  1YFH A;  3EYI A;  2HOE A;  5A2Q K;  1YO5 C;  1RIO H;  4L5I A;  4MQ9 F;  2IVM A;  1ZRE A;  2L4M A;  2QQB A;  3TQN A;  4GO1 A;  2MH2 A;  2DAO A;  1X3U A;  3IHU A;  3WGG A;  4MTE A;  1XMA A;  4G7H F;  4OU0 A;  4CDG A;  3ZMV A;  4E70 A;  4LLL A;  1KU3 A;  4Q48 A;  1TTY A;  3WG9 A;  3C1D A;  5TRD A;  3F72 A;  1SFX A;  3JSP A;  3ERE D;  4M9X A;  1ZGA A;  3HSF A;  5F1R A;  2XAQ A;  2IA1 A;  1CF7 A;  4BH9 A;  1J0R A;  1RUO A;  1PP7 U;  4GCV A;  4LD5 A;  3KEO A;  3QP5 A;  4U0W A;  1W7P B;  3DQV C;  1BC8 C;  2R7F A;  4G6D A;  3I0T A;  5LHI A;  2G7U A;  4L0Z B;  2CSO A;  1IN8 A;  4EJT A;  4OMZ A;  2ZNY A;  4M6Y A;  2W57 A;  2YPR A;  4KA4 A;  2XAS A;  3LA3 A;  4ESB A;  3GFL A;  4K2E A;  4MHG A;  3SXY A;  2K4J A;  1B1B A;  3CUQ A;  1P6R A;  2G7H A;  4CHU A;  5HS7 A;  3TKY A;  1CGP A;  1F5T A;  1QZY A;  4I01 A;  4NQW A;  3PQK A;  2NAZ A;  1OYW A;  3EET A;  4UVB A;  3R4K A;  3L00 A;  1TQI A;  3TO7 A;  1DDN A;  4ENN A;  3FXU A;  1UHW A;  1T38 A;  3HRM A;  3MWM A;  2O6G E;  4B8X A;  2FBH A;  1GXP A;  2YR2 A;  2M1B A;  3E3V A;  1B4A A;  1HW5 A;  5EEH A;  3DFG A;  1XD7 A;  2BYV E;  2FBI A;  3OV8 A;  1KYW A;  1KQ8 A;  4A5M A;  2ZJ2 A;  5IT3 A;  3RYP A;  3TO6 A;  1J75 A;  3K0L A;  2XKP A;  1Z91 A;  2H27 A;  1JHF A;  2P4W A;  2E1N A;  4UVA A;  4P9F A;  1FC3 A;  4BHC A;  1KQ0 A;  4S05 A;  2E1C A;  1Z7U A;  4IVN A;  4L9N A;  3QRF F;  1T0F A;  5JI6 A;  3COA C;  1EH6 A;  3WE3 A;  2HR3 A;  4F7Z A;  2QUF A;  1ON1 A;  1B9N A;  1RZ4 A;  4TV7 A;  3O2P E;  3QAH A;  2EFQ A;  4WF2 A;  1D5V A;  1ZRD A;  3RPQ A;  2CGP A;  2HGC A;  1HKT A;  1K78 B;  1D8K A;  3IWF A;  4A0Y A;  3RIR A;  3BPX A;  3OOP A;  4KIG A;  1Z05 A;  1YQA A;  4QWQ A;  1O3R A;  1BM9 A;  4FX4 A;  1MGT A;  1FLI A;  3HHH A;  5HVQ C;  2UWM A;  3JAM Z;  2F2E A;  3CJN A;  3R0J A;  5HDG A;  1WKM A;  2VBZ A;  4MEY F;  3RI4 A;  2GWR A;  2P6T A;  3L9F A;  3WGI A;  4A0Z A;  2ZME A;  5CVJ A;  4A6D A;  4LG0 A;  1DPU A;  4M73 A;  3FXQ A;  2CG4 A;  4IF4 A;  2VOO A;  2MLK A;  3QU3 A;  1OYI A;  4ZYH A;  1T98 A;  5LBQ A;  2ZME B;  2DQR A;  3L2C A;  3CUQ C;  2TDX A;  1U3E M;  2NYX A;  5BQT A;  2BGC A;  4IPA A;  3EYY A;  5KVR A;  4ETS A;  2EA2 A;  3LA7 A;  2FNA A;  5E20 A;  3I59 A;  1TW2 A;  1QO0 D;  4AIH A;  3V7C A;  1VTN C;  4LB5 A;  4MGR A;  2XVC A;  3R60 A;  5D5U B;  1XSV A;  3N97 A;  1QPM A;  3E6B A;  4HW0 A;  1SD6 A;  2P5V A;  4P55 A;  2OZU A;  1G3S A;  1TNS A;  2E7X A;  4LK0 F;  4OIO F;  5E17 F;  1QQI A;  2LNB A;  1FSH A;  4P5O A;  2EK5 A;  3ZMS A;  3KE2 A;  1R23 A;  2XKO A;  4QLC U;  2JZY A;  1S3J A;  4DNC A;  1WI9 A;  5E1X A;  2IA2 A;  1S29 A;  4BXU A;  5K5Q A;  3Q9V A;  2W24 A;  1HQC A;  3F8F A;  2PMH A;  1CF7 B;  1MD0 A;  5D8K B;  2Z99 A;  3RTR A;  2FU4 A;  2CW0 F;  4CO8 A;  1WRJ A;  4YFK F;  5L3C A;  2QQ9 A;  3JW4 A;  1FWZ A;  3CUO A;  1OPC A;  1R58 A;  3WTX C;  5D4S A;  3P9C A;  5L3E A;  2DO7 A;  2B0L A;  4KUM A;  5CVU A;  4IXA A;  1XMK A;  2HQR A;  2ISY A;  3BY6 A;  4WXD A;  2EFN A;  3GLX A;  5ICG A;  2Z5U A;  4PZJ A;  4LB6 B;  3GX4 X;  2V1U A;  3HRU A;  4HV5 A;  1PP8 F;  1JHH A;  5L3F A;  4Y15 A;  2UXX A;  4BYY A;  1K78 A;  2IT0 A;  3DEU A;  1OMI A;  4PCQ A;  1QNT A;  5E8G A;  1J7K A;  2RQP A;  3T8T A;  1G4D A;  4FX0 A;  2VBX A;  3J81 K;  2BBY A;  1LDD A;  2DFI A;  4EJO A;  1SMY F;  1WQ2 A;  1IRG A;  2GXG A;  4LFU A;  2CQK A;  4G8X A;  4KIB A;  3TDZ C;  2XHK A;  4A6E A;  1GVJ A;  1FYL A;  1FP1 D;  3TOB A;  2ACJ A;  5LLQ A;  2DW4 A;  1EH7 A;  5JFR A;  2M45 A;  1B9M A;  1BIA A;  4HBL A;  2QLZ A;  5TJJ A;  2HKX A;  2MBF A;  4EVI A;  5ICE A;  2FNP A;  5ICC A;  4UXN A;  1U5T C;  2FRH A;  3I59 B;  3TGN A;  3AAF A;  1TBX A;  2M8E A;  4AD9 A;  1XSX A;  5EEG A;  3T8R A;  1WWX A;  2MA3 A;  2Y0M A;  2GQQ A;  3BP8 A;  2Q0O A;  4EGY A;  1IXS B;  4OMY A;  2VE9 A;  4KN4 X;  5ILU A;  1RI7 A;  3E5X A;  1ZG3 A;  1L3L A;  3O6B B;  1ZLJ A;  5ED4 A;  3M1E A;  2BV6 A;  2Z33 A;  2MC3 A;  2PMU A;  1DUX C;  2KJB A;  1ZH5 A;  2O3F A;  3F22 A;  5HDK A;  5FFX A;  3EQL F;  1SD5 A;  1FX7 A;  3JAM K;  2JSC A;  3IL2 A;  4G7O F;  2FXA A;  1KA8 A;  2NS0 A;  3F8B A;  1IW7 F;  3HOS A;  4IJA A;  4I2O A;  2O0Y A;  1ZN2 A;  5FO5 A;  4PGH A;  2HKO A;  1BI3 A;  1ON2 A;  1YW7 A;  2DBB A;  4MNU A;  1FT9 A;  3VB2 A;  2MLG A;  3BDD A;  2PQ8 A;  4LJZ F;  2VOP A;  2XAG A;  1IF1 A;  5ILS A;  3KET A;  2IP2 A;  2EWN A;  3MAJ A;  2ZXJ A;  5DUI A;  4U0V A;  2JPC A;  3SZT A;  5HLG A;  1Z6T A;  1W7P A;  1V3F A;  2QYO A;  2VXZ A;  5DYM A;  2M87 A;  3VOD A;  3KP4 A;  1FY7 A;  3HSR A;  2EFO A;  1EH8 A;  4CZZ A;  4RB2 C;  3G3Z A;  3REO A;  1IXC A;  2DT5 A;  4HLX A;  1BOA A;  1WSU A;  2WV0 A;  2RDP A;  1W5T A;  3I58 A;  3ABU A;  3LWF A;  1HSJ A;  4L9J A;  2YX7 A;  3FHZ A;  3WTY C;  4NHJ A;  4KMF A;  5D5X B;  1ZRF A;  4ENK A;  2FMY A;  4PDK A;  5DDG A;  3NEU A;  2IW5 A;  3BRO A;  2QWW A;  4AVP A;  1HKS A;  2VT3 A;  3BJA A;  4NB5 A;  2Y48 A;  4BHB A;  4KNY A;  2HS5 A;  3ZP5 A;  2VOD A;  1FZP B;  4G9Y A;  3FXR A;  3ZN1 A;  3FMR A;  3VOE A;  1I1G A;  1BIB A;  1W7P D;  1LVA A;  2ZFW A;  3V7S A;  3RKW A;  5JVT A;  3D0S A;  4CIC A;  4A12 A;  3IC7 A;  4EGZ A;  2KIM A;  2J5P A;  3N4M A;  2A5Y B;  3F8M A;  2VBY A;  2KIU A;  3RKY A;  2NNY A;  2VN2 A;  3LST A;  4EM0 B;  2M5W A;  4YG2 F;  3WTT C;  4RB1 A;  3E97 A;  1SFU A;  2COM A;  1GXQ A;  3ECO A;  3DP7 A;  3F23 A;  4L0Y B;  2HQN A;  5LRR A;  4XLN F;  1H9T A;  3ML6 A;  4EV0 A;  5D6F A;  4AIJ A;  3KCC A;  5JHU A;  4RB3 C;  3NQO A;  5A2Q Z;  2A61 A;  1BN5 A;  1FPQ A;  1LNW A;  2ZO4 A;  3GUD A;  1IAW A;  5KK1 A;  2P6S A;  4WX9 A;  5BPI A;  4YII A;  5L3G A;  2LDU A;  2R3S A;  3HYI A;  2PN6 A;  3M8F A;  1R1U A;  1YS6 A;  3EUH A;  5D6E A;  1ZRC A;  3HOT A;  2IPQ X;  1S7A A;  3WE2 A;  3GVA A;  4HV6 A;  4N9H A;  4Y13 A;  1XCV A;  2QEN A;  4I09 A;  5AON A;  2L4A A;  1T39 A;  1FSE A;  3CUQ B;  1REP C;  3W6J B;  3GXO A;  5DCF A;  2QBY A;  1LDJ A;  2PEX A;  3SFZ A;  4ZZL A;  1MDM B;  4HAM A;  2OQR A;  4D0P A;  2RGV A;  3HRS A;  1BI1 A;  3P7N A;  3H3Z A;  5CYV A;  3TDU C;  2J5O A;  1ZHF A;  1ZAR A;  2A68 F;  3SZP A;  4OIQ F;  4UHT A;  2VON A;  4M74 A;  3F6O A;  2DTR A;  2H09 A;  3E6D A;  3LAJ A;  4A2U A;  2CYY A;  2E7W A;  5F64 A;  2GA1 A;  2HTJ A;  2Q2E A;  1TQP A;  1YIO A;  3LAP A;  2FE3 A;  5ICF A;  1B59 A;  1S6L A;  5CVV A;  1XSD A;  1IN7 A;  2MH9 A;  1YYV A;  4UNO A;  3I53 A;  4EJU A;  3MEX A;  5K5R A;  4P9U A;  1C0W A;  2HTS A;  1YG2 A;  4ENJ A;  3KP5 A;  2AXL A;  3R6S A;  2LF8 A;  3BZ6 A;  3WTV C;  1SD4 A;  3QPH A;  2VE8 A;  2HDC A;  5HS9 A;  3T5X A;  1HKQ A;  4RB0 A;  4BHP A;  1K79 A;  2EV5 A;  4PGG A;  1T2K A;  5FLX K;  3D5L A;  3FWE A;  1R5H A;  5K1Y A;  1MDM A;  1KU7 A;  3NRV A;  1RUN A;  1MJA A;  4U7D A;  4A0X A;  5DUK A;  1YLF A;  1FYK A;  1H9G A;  4L18 B;  3VEP A;  2XRN A;  1O3T A;  5D8L B;  5DCM A;  1W4M A;  2EFP A;  1U78 A;  4M71 A;  4WCG A;  3HTS B;  1MZB A;  4L9T A;  4Y17 A;  1O3Q A;  2R7D A;  5HS8 A;  4IHT A;  3U2R A;  3JSO A;  3LFK A;  2P5L C;  1IZ1 A;  5L3D A;  1FBU A;  5D5W B;  1ZGJ A;  2P8T A;  1SFE A;  2ZNZ A;  4JK1 X;  3ZN0 A;  2IJL A;  1V4R A;  1IRF A;  2P5K A;  1XGM A;  5BMZ A;  2FF4 A;  1P4A A;  2IRF G;  2VT2 A;  4G6Q A;  2FA5 A;  2W25 A;  3ELK A;  4RGS A;  3BPV A;  3BJ6 A;  1SAX A;  1QZZ A;  4HQM A;  1XGN A;  3FX3 A;  3GYH X;  2WC2 A;  3SQN A;  4IRI A;  2FML A;  3KEQ A;  4I02 A;  4WXH A;  2DPU A;  4FHT A;  4XSX F;  3MCZ A;  5LGU A;  3HIF A;  4L9V A;  1B6A A;  2D1H A;  3DXJ F;  1ZG1 A;  3J7A O;  5K5O A;  1IN5 A;  3WTZ A;  3LQR A;  2K02 A;  2OQG A;  2KJC A;  4HX8 A;  1IN6 A;  2OU2 A;  1J9I A;  4Z2Y A;  3WTS C;  5E1W A;  2XIG A;  1O3S A;  1UHM A;  2RN7 A;  3J80 Z;  1R36 A;  3E5Q A;  3FZV A;  1T6S A;  3H92 A;  4BAY A;  1SD7 A;  1U5T B;  2VC0 A;  5HOO A;  3GZ6 A;  4KN7 X;  3KP3 A;  1LJ9 A;  3FM3 A;  1DP7 P;  1GHC A;  4OOI A;  4JQF A;  3IKT A;  2A07 F;  4WWC A;  1G6N A;  2VC1 A;  4RGR A;  3SHF A;  1HW2 A;  2GA2 A;  3DPT A;  2PBI A;  5H20 A;  1FP2 A;  2UXN A;  2F5C A;  2HYG D;  3GEZ A;  2LF7 A;  1LQ1 A;  1AWC A;  3I64 A;  2QM3 A;  1G3T A;  4IRH A;  4CGZ A;  2W85 A;  1JE8 A;  3DF8 A;  1EV7 A;  4CXF A;  5FD5 A;  2DLL A;  5DCM B;  3J81 Z;  3B02 A;  1RNL A;  2OAZ A;  4ESJ A;  1R5G A;  4P96 A;  5HLH A;  2K27 A;  3I5U A;  3CO6 C;  4CYD A;  2FEZ A;  2C6Y A;  2DK8 A;  4H0E A;  6PAX A;  2GAU A;  2WWY A;  1YS7 A;  1R22 A;  3LA2 A;  1DPR A;  5D4R A;  2EV0 A;  5LGN A;  5FB2 A;  3TO9 A;  4U0Y A;  1W5S A;  1G3W A;  2DI3 A;  4I0B A;  1QGP A;  3GWZ A;  3K2Z A;  2RNJ A;  1I5Z A;  3WU1 B;  2ZKZ A;  3T0Y A;  4ZYE A;  4LK1 F;  3ABT A;  2NNN A;  3IWZ A;  4Q4Z F;  4XSZ F;  4OIN F;  2STW A;  4EMS A;  5ILV A;  3GO5 A;  5CVR A;  3QPT A;  2D2W A;  2Z9O A;  4XRF A;  2EJR A;  2K4B A;  1D3Y A;  1FOK A;  1TLH B;  3DV8 A;  2H6C A;  5BS6 A;  3ZPL A;  1OKR A;  1U6G A;  1E17 A;  2XAH A;  4OIR F;  3P9I A;  1LEA A;  5J8F A;  3ULQ B;  3HHG A;  5H6R A;  5IT9 K;  2LKP A;  4OIP F;  2XGX A;  2PFB A;  2YX4 A;  3F8C A;  2JPB A;  4FT8 A;  3RDI A;  1LB2 A;  3Q9S A;  4ZZD A;  2F5E A;  4GYG A;  4ZYG A;  3I54 A;  2CWE A;  2A6H F;  2EV6 A;  3KZY A;  3J80 K;  4R8H A;  2Q8K A;  5E1Z B;  3KP7 A;  2A69 F;  2YSR A;  5E18 F;  2KRF A;  1U5T A;  2VBW A;  3TOA A;  1LEB A;  5D5V B;  1S7O A;  1XCB A;  4M6X A;  4LLN A;  4HLY A;  4N0B A;  2DU9 A;  3R61 A;  1K6O A;  4EM2 A;  2XAJ A;  2O03 A;  2V9V A;  1ZG5 A;  3WTU C;  3F6V A;  3V4G A;  2ZCW A;  4U88 A;  2O61 A;  1SMT A;  1IN4 A;  3IKV A;  3RPU A;  2EFW A;  3Q5F A;  2ESH A;  4HF1 A;  2STT A;  5DEQ A;  4EM1 A;  3RYR A;  1F9N A;  2Y75 A;  1XGS A;  4UV8 A;  1ODD A;  1P4W A;  1BI2 A;  5LHG A;  1KGS A;  2P7V B;  3M9A A;  4M9Z A;  3ISP A;  2FSW A;  4I0A A;  4HDV A;  1PUE E;  2G9W A;  2A3S A;  3WU0 A;  3GFM A;  4HQE A;  4HZF A;  1R1V A;  4O5V A;  3GFJ A;  5CVI A;  3MQ0 A;  3K1N A;  5LHH A;  1STZ A;  3ZMT A;  1HST A;  3K69 A;  1BI0 A;  4RGU A;  3CDH A;  4U7B A;  2L02 A;  1MJB A;  2P7C B;  4M72 A;  4JBA A;  5LEJ A;  1KQ9 A;  3KLO A;  3U1D A;  3V8J A;  5HDN A;  3K9T A;  3G73 A;  2ELH A;  2FOK A;  3MFK A;  5CJ9 A;  4MQV A;  2EB7 A;  3PFI A;  3L7W A;  1AOY A;  3K1M A;  2Z3Y A;  4HYE A;  2ZBK A;  1P92 A;  1NHA A;  1P4X A;  4A5N A;  3GW2 A;  3HRT A;  2X4H A;  3ROU A;  4G7Z F;  4KIF A;  5L3B A;  3M8E A;  2HWV A;  4WXC A;  2PJP A;  4HX4 A;  3C7J A;  3H3U A;  2QBY B;  4DQ2 A;  2RVC A;  3R0A A;  3GZ5 A;  1MJ9 A;  1KYZ A;  3F21 A;  4R1H A;  3E6C C;  1MKM A;  3VFZ A;  2HFH A;  2O8X A;  3V7R A;  3IRQ A;  2ETH A;  5J8C A;  5IT9 Z;  3QOP A;  4O3M A;  3I71 A;  3F8N A;  5FD6 A;  5CLS A;  2D45 A;  3V8K A;  3F3X A;  1R7J A;  4HOB A;  1Y0U A;  1J59 A;  2HYF A;  4Q5S F;  4RAZ A;  3PQJ A;  3KLN A;  5DD8 A;  3WOD F;  4RS8 A;  4N9I A;  5BPD A;  2BE5 F;  1Z6R A;  2K86 A;  3JTG A;  4LGW A;  2QZ8 A;  4I98 B;  4YFN F;  2X0L A;  4ON0 A;  1UST A;  3I4P A;  4O6J A;  1ZYR F;  2JTV A;  2IA0 A;  2QQA A;  3ZMD A;  5BOX A;  5LEK A;  2MD5 A;  2OA4 A;  1USS A;  3B73 A;  3KP6 A;  1E2X A;  1G3Y A;  2RKH A;  2RV8 A;  2OBP A;  3RKX A;  4S04 A;  2H6B A;  1UB9 A;  5F6F A;  1J2X A;  5ERI A;  3ZMU A;  3E6M A;  4GXO A;  3O3K A;  3FM5 A;  1YW8 A;  2DQL A;  3CLO A;  1QBJ A;  5AIQ A;  4Q47 A;  2KIF A;  4HF0 A;  4EJW A;  1OR7 A;  3KZZ A;  3ECH A;  4B09 A;  5DV5 A;  5J6X A;  2L54 A;  2F5D A;  2ADU A;  2ESN A;  1OYY A;  4UV9 A;  2V1D A;  2W84 A;  1U2W A;  4BQA A;  3M7G A;  2CO5 A;  3L09 A;  4G94 A;  2NRA C;  4RAY A;  2V1X A;  1U8R A;  2M30 A;  3MZH A;  3V8L A;  3BJO A;  2OZ6 A;  3C3W A;  3FMQ A;  4XLP F;  3GFI A;  1P2F A;  1BC7 C;  3EDP A;  4L5J A;  5FFZ A;  1UCR A;  1H0M A;  2AS5 F;  2PG4 A;  4AIK A;  3QP6 A;  5H6Q A;  1I27 A;  5HLI A;  3LQQ A;  3KP2 A;  3BOQ A;  1A04 A;  1LDK B;  2L3D A;  1IXR C;  3E5U A;  2F5F A;  1HW1 A;  1FNN A;  1UFM A;  1XDU A;  1Z9C A;  2ISZ A;  1D8J A;  2D1V A;  2KKO A;  4LG0 B;  3U9G A;  4KT5 C;  1JXS A;  1L0O C;  3KFW X;  4UUV A;  4IHS A;  1R00 A;  3WTW C;  4ESF A;  2DK5 A;  4ASN A;  1XGO A;  5LRS A;  1ULY A;  4YIF A;  2LSO A;  1ONV A;  3T1B A;  1JGS A;  2PLY A;  2CFX A;  2WTE A;  2A6E F;  3FF5 A;  1FYM A;  3P9K A;  1R1T A;  1O7F A;  3K1P A;  2DPD A;  3CO7 C;  4I7H A;  2YU3 A;  2QVO A;  3IRR A;  1HXD A;  2JRT A;  4M9S A;  2XAF A;  2H94 A;  4MTD A;  3HTU A;  5FLX Z;  4RGX A;  4WK8 F;  1O7L A;  4LMY A;  5LGT A;  3FMS A;  4MEX F;  3JTH A;  2GXB A;  1ZAO A;  2UZK A;  2PI0 A;  2K7L A;  3W6K B;  1ZLK A;  1HBX G;  1S8N A;  3MZY A;  1TNT A;  1F4K A;  4XBF A;  1K7A A;  4HDU A;  1Q1H A;  4KDP A;  4GYI A;  5AIP A;  3DPL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...