2FQ3A

Structure and function of the swirm domain, a conserved protein module found in chromatin regulatory complexes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
SKWFNLEKIHSIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription regulatory protein SWI3
publication title Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fq3A00
3K0LA 5J8FA 3T0YA 1U6GA 1XD7A 3H3UA 3GLXA 4HZFA 5BMZA 3F8CA 1ZREA 3KLNA 4FT8A 3K9TA 1O7FA 5D5UB 1G4DA 3ZMUA 3LWFA 3SQNA 4Y17A 3WGIA 4M6YA 2VC1A 2XAGA 2F5CA 2HS5A 1YTYA 3ZPLA 2FA5A 2CFXA 1D8KA 1TW3A 3KP4A 1XDSA 2HOEA 3W6KB 4G7HF 2P6TA 1B59A 4EJTA 4LMYA 2KIMA 2HYFA 3JW4A 1WQ2A 3FM3A 5ERIA 4IRIA 2RGVA 4A12A 3WE3A 2G7UA 4WXCA 3G73A 2ESHA 1MZBA 2QBYB 4HLXA 3W6JB 5HOOA 3T8TA 5KVRA 3ABTA 2KIFA 2MLGA 2EA4A 1DUXC 4LLLA 5LBQA 4KICA 5BOXA 3ISPA 5L3GA 1FBQA 3MCZA 2LKPA 1HW2A 3WODF 1O3TA 1HSJA 2HQRA 1ZYRF 4AWXB 3GX4X 2VT3A 1T98A 2EA2A 4HAMA 2FF4A 5CVIA 3DQVC 4M71A 1XGSA 2FBKA 3I54A 4MHGA 4HOBA 2G7HA 4A2UA 2AXLA 2H09A 4G7ZF 5FD5A 1O3QA 4P9FA 2ISZA 2EV6A 2GQQA 2ZBKA 3F8FA 3FXUA 3IRRA 1F5TA 4QLCU 3S2WA 1HW1A 2JPBA 4EV0A 1BM9A 4ESBA 2ZNYA 2MH2A 1XN7A 4WF2A 4EJVA 1S3JA 4LLGF 4KT5C 2XUBA 1FSEA 2HTSA 2H94A 5AIQA 1ZG1A 5J8CA 4EJWA 2Q0OA 2VBWA 3ECOA 2VE9A 3F23A 1K79A 2ISYA 1G3TA 3PFIA 1LVAA 4CXFA 1IN8A 4HF0A 4YIIA 1W7PD 3P7NA 2IRFG 2COMA 3OOPA 5A2QZ 4XSXF 2RN7A 3R6SA 5HVQC 1YW9A 1W7PA 2FEZA 4IHTA 2R3SA 4EVIA 3SZPA 1IF1A 5LHIA 2QQBA 3SFZA 3KCCA 1KU7A 4R79A 5LRRA 3TDUC 1Y0UA 2DQLA 3L00A 4BHPA 1PP7U 4HLYA 2RV8A 2XKOA 1ZAOA 1J9IA 3HHGA 5FLXZ 3TO9A 4ON0A 2ADUA 4JBAA 4PGGA 4FX4A 3D5LA 4DQ2A 1OYIA 2NYXA 4UUVA 1P6RA 1ZRFA 5BPDA 2XAHA 5CVUA 2X4HA 2KIUA 1S8NA 2FBHA 3LAPA 3M7GA 2ZJ2A 1J75A 1HKTA 1H9GA 1MD0A 3ERED 2IA2A 5ILSA 4EGZA 2NS0A 4HW0A 2D1HA 3KE2A 2FMYA 2GA1A 3E5UA 1BI1A 1ZG5A 2CSOA 1P4WA 1DPUA 2OZ6A 2OAZA 3PQKA 1YW8A 3VOEA 3EYIA 1XSVA 4OIRF 2MA3A 4WXDA 3E6CC 3F21A 1O7LA 4EQQA 4EM2A 1H0MA 1SD5A 2DTRA 2ZCWA 5ICFA 1P4XA 2M1BA 4U0WA 2YR2A 4E70A 4ENMA 4CO8A 2DQRA 3EETA 1T2KA 1FLIA 2FNAA 1J0RA 5IT9Z 3JAMZ 2XAJA 2IW5A 2CQKA 1LQ1A 4KYWA 5BPIA 3BJOA 2WWYA 3R60A 3QU3A 1U8RA 3CO6C 2RKHA 3BROA 3QPTA 5FLXK 4UV9A 3GXOA 3JTGA 4ZH4F 4KN4X 4HX4A 1MDMB 2H27A 4BHBA 4EJOA 4FX0A 4RGUA 2EWNA 5HDKA 4I09A 3TOAA 1IRFA 1J7KA 2OQRA 4R1HA 1MGTA 4NHJA 3O2PE 4Q47A 1V4RA 5E1ZB 2PFBA 5K1YA 2P5KA 1O3RA 1S7OA 2ZNZA 3M9AA 3L9FA 4M74A 4WCGA 5L3BA 4B09A 2F5FA 3F3XA 3LA2A 3I64A 1Q1HA 4ZYDA 5E17F 2MC3A 3WTZA 1LEBA 4WX9A 1FYMA 1JXSA 4LB6B 3IWZA 2VBZA 3DFGA 4G94A 3CTAA 4ZYGA 1Z9CA 4HX8A 3LA7A 2KJCA 2DK5A 3QP5A 2MLKA 3PQJA 2VC0A 4OU0A 4KA4A 2F5EA 1KYZA 3DV8A 5JVTA 1KA8A 4GYIA 2H6CA 5LRSA 5HS9A 1FBSA 1EH8A 5DCFA 1HW5A 2QUFA 2VE8A 4IRHA 4EM0B 1IXSB 5BQTA 5IT9K 3VODA 4RGXA 3DPLC 4RGSA 5D6FA 4Q48A 3LA3A 3SHFA 4XRFA 4MQVA 4RS8A 2W25A 2ZFWA 3BPXA 3WTUC 4IHSA 1HKQA 1ULYA 1PP8F 3OV8A 1YYVA 4L0YB 1BI0A 4GCVA 1V3FA 3RYRA 4TV7A 3HRUA 4HDUA 5HLHA 4M9ZA 1TBXA 4I98B 5CVJA 1KQ0A 5L3FA 1G3WA 4P96A 4L9VA 4A5NA 5JI6A 4WWCA 3GF2A 3DF8A 1DPRA 4PDKA 3FMSA 1R36A 5E1XA 4BHCA 1E2XA 3ML6A 2CYYA 1DP7P 4GGGA 4KFCA 3COAC 1Z05A 2JRTA 3HHHA 4OINF 1H9TA 4K2EA 4MNUA 3T1BA 1FY7A 4IRGA 5LHGA 1OYYA 4RB1A 3IL2A 5D4RA 2JSCA 4N9IA 1B4AA 2P6SA 3QRFF 1EV7A 2D2WA 2FE3A 4NQWA 4JQFA 4ESFA 1YO5C 3K2ZA 3DPTA 1HXDA 2B0LA 3B02A 1T38A 5E18F 3LFKA 3MEXA 3RKXA 1WI9A 3I58A 4L9NA 3CUQA 3V7RA 1SAXA 4WXHA 2WTEA 3ZQ7A 2A6EF 1WKMA 5L3CA 1ZGAA 2RQPA 1ZH5A 1J2XA 1KYWA 1S6LA 2VOPA 4LG0A 2RVCA 5D4SA 4YFXF 3Q5FA 2L01A 3P9IA 1YW7A 1FSHA 3IHUA 3F22A 1RZ4A 3WTYC 3KP2A 1IN6A 5HS8A 2HWVA 1QQIA 3BWGA 3I59A 1R00A 2PLYA 1YG2A 3BOQA 2CO5A 5LEKA 1UHMA 5EEHA 4HDVA 2H6BA 4KIFA 5EEGA 5D8LB 3ELKA 6PAXA 3ZN0A 4I01A 1Z6RA 2FSWA 2QQ9A 3WTXC 2STWA 3REOA 1YFHA 4IF4A 4UHTA 3ULQB 3LAJA 2QVOA 2CGPA 1LDKB 1B1BA 2O61A 1GXQA 1BIAA 4KMUX 1ZHFA 3Q9VA 4MQ9F 4I0BA 2QZ8A 5DUKA 5TJJA 5K5OA 5F1RA 1LB2A 1FOKA 1IRGA 1JHFA 2LDUA 4I0AA 4YFNF 4U7DA 2XROA 4M9XA 3ECHA 1B9NA 3TO6A 1IUYA 3FZVA 1LNWA 5DCMA 4YFKF 3HRTA 4PZJA 2YU3A 3HIFA 2XKPA 3QU6A 4UNOA 2HKXA 2YSRA 4I7HA 3BP8A 2DK8A 2CWEA 3I53A 2F2EA 2IA1A 3JSOA 2K86A 3FHZA 3GUDA 2GAUA 2W57A 2HGCA 5ICEA 5DD8A 2V6CA 2ZMEA 2E1CA 2EV0A 2L4MA 4PCQA 3C1DA 3D0SA 4HQMA 3RDIA 1RUNA 1XGNA 2HDCA 3MQ0A 2XV4S 4G8XA 1WWXA 2DBBA 1R7JA 2LNBA 2P4WA 3V8LA 2GWRA 4NB5A 4D0PA 2W24A 3KP7A 2DI3A 3VFZA 1BOAA 3F8NA 3F8BA 4M6XA 2VODA 4RAYA 2HYGD 3U2RA 1IZ1A 2WC2A 1SFXA 1TQIA 3ZN1A 2EFPA 3MWMA 2Z33A 4G6QA 3CLOA 2HEOA 3EDPA 2XASA 3WU1B 3C3WA 4L18B 2Z99A 4ZZLA 2XAQA 2Y0MA 2PI0A 1FBUA 2E7WA 2LF8A 2PQ8A 1ZG3A 4L9JA 2YX7A 1GVJA 3I0TA 1R22A 2GZWA 5E8IA 1T6SA 2V1XA 1OR7A 3V8KA 1ZARA 2EFNA 3M8FA 3KP6A 1ON2A 2UXNA 5FFZA 3RIRA 2NNNA 2K27A 2XIGA 4N0BA 2Z5UA 1NHAA 5DEQA 1TTYA 2O8XA 2PJPA 1IXRC 2XVCA 5L3DA 3RI4A 1U2WA 2A68F 2HFHA 3DKWA 4KUMA 4MEXF 2KKOA 3IWFA 2RDPA 1UFMA 3DEUA 4OIPF 2QBYA 3E6DA 2Q8KA 1ZRDA 2EFQA 2IPQX 3HOSA 3M8EA 3KP5A 5D6EA 2G9WA 3HRSA 5FO5A 2BBYA 4OIQF 3E3VA 2M5WA 2W85A 1LDDA 5DD4A 1KQ9A 5A2QK 2PEXA 3SZTA 5DV5A 1KU2A 1CF7A 3BDDA 2DO7A 3FX3A 1F4KA 3GWZA 3WE2A 4B8XA 2JTVA 3ZMVA 4HQEA 2LF7A 2VXZA 5H6RA 2F5DA 1S7AA 1XDUA 2M45A 1W5SA 1Z91A 4A6EA 1BC7C 4G6DA 4GYGA 3WU0A 3J80Z 1CGPA 3WTTC 3K69A 1U78A 1RIOH 1MKMA 3P9KA 3KEQA 2HR3A 4UXNA 2R7FA 3CO7C 4LB5A 1FC3A 2XHKA 1XCVA 1I1GA 1O57A 1OKRA 1L3LA 4H0EA 3R4KA 5CJ9A 2NNYA 3LQQA 4HX7A 2LSOA 4CYDA 4P5OA 3CUQB 2IVMA 2A69F 4KDPA 2V9VA 1UB9A 2JZYA 1GHCA 2HKOA 3G3ZA 2IA0A 3E97A 1SD4A 3NRVA 4Y15A 3ABUA 4LFUA 4HA8A 2MBFA 3QAHA 4U0YA 4HF1A 3K1PA 3E6BA 3HTUA 4CICA 2BE5F 2J5PA 3SXYA 4GXOA 3J81Z 1F1ZA 1ON1A 3JAMK 1FX7A 4HV5A 4R8HA 2PMHA 4IJAA 2J5OA 4L5IA 2CW0F 3K1MA 3M1EA 2EK5A 1L0OC 3E5QA 4MTEA 1BI3A 3J80K 2E7XA 1LDJA 3HTSB 2A61A 3HYIA 1REPC 2VBXA 2Y48A 5F64A 1XGMA 1K7AA 4GO1A 1QNTA 3HSRA 1RUOA 2VOOA 3CUQC 1AOYA 2NAZA 1BC8C 2STTA 1XMKA 1YLFA 3GO5A 4PGHA 3MZYA 4JK1X 3EYYA 3V8JA 1TQMA 2E1NA 4CZZA 2DW4A 4BQAA 2WV0A 3KEOA 1MJAA 5CVRA 5LGUA 4G7OF 4Y13A 1FP2A 1QZZA 4YIFA 2TDXA 2DPDA 1TW2A 1LEAA 2A6HF 2M30A 1PDNC 5AONA 2A07F 4AIKA 2HTJA 3KFWX 4KN7X 1SFUA 2FQ3A 2ZO4A 1HQCA 1JHHA 2EFWA 2ZKZA 4XLNF 1PUEE 1FT9A 2DT5A 3CUOA 4KNYA 1EH6A 1SMTA 4G9YA 2ZMEB 4HBLA 5E8GA 3RTRA 3V7SA 2KRFA 2EFOA 1R1TA 3BZ6A 2UZKA 4OMZA 2V1UA 3J81K 3R61A 4A0YA 1SFEA 1OMIA 1D8JA 1FYKA 1USSA 3L09A 4ESJA 5JHUA 5CYVA 1UCRA 3JSPA 3EQLF 2Y75A 2FXAA 3ZMTA 3TDZC 1IN4A 4BH9A 3KZZA 2QYOA 2L02A 1RNLA 1W7PB 2DFIA 3TGNA 5HDNA 3JTHA 3ROUA 3WTSC 1DDNA 3MZHA 5ED4A 1U5TA 2ELHA 2XAFA 3LQRA 1R58A 2A3SA 3R0JA 2K02A 3E6MA 2CG4A 2GA2A 4S05A 5H6QA 1ZRCA 1KGSA 1I1SA 4AVPA 5DUIA 4IVNA 1XGOA 3IC7A 1GXPA 2YPRA 1YS7A 1USTA 3F6OA 3RPQA 1QBJA 3N4MA 1UHWA 1D5VA 1IXCA 3CDHA 3TQNA 1R23A 1XCBA 3QOPA 5L3EA 3VB2A 5DDGA 2D45A 1XB4A 2OU2A 2ACJA 1T0FA 2GIVA 4M9SA 1BI2A 1YIOA 2ZXJA 4L0ZB 1FZPB 4AD9A 5E20A 5IT3A 1FWZA 2HZTA 1SMYF 1BIBA 1P2FA 2P5VA 2FNPA 5CVVA 1AWCA 1I27A 3ZMSA 1HBXG 1BBYA 2VONA 2O3FA 3GZ5A 3DXJF 1KU9A 2A5YB 2YX4A 5ICGA 5D5WB 4O5VA 4LK0F 1MJ9A 3ZMDA 3GZ6A 3K1NA 2BGCA 4F7ZA 4HF2A 2M87A 1CF7B 4RGRA 2L3DA 5KK1A 3HOTA 1K78A 4O6JA 5LHHA 2O0YA 5J6XA 3F6VA 1TNSA 3GVAA 3GEZA 3R0AA 1LJ9A 1C0WA 3IRQA 3J7AO 1TLHB 5FD6A 3MAJA 3V7CA 1IAWA 1G3YA 2DPUA 1D3YA 4EM1A 3H92A 2IT0A 4ENJA 2MD5A 5DYMA 4UV8A 1IW7F 4MTDA 4RAZA 1ZLJA 4WK8F 2OBPA 2Z3YA 3KLOA 3GFMA 1FYLA 3CJNA 3RJPA 2FRHA 5TRDA 5D5VB 5LLQA 2K4JA 2PBIA 4M72A 4DNCA 4OIOF 3BJAA 3ZMZA 4CDGA 2O03A 2Z9OA 1EH7A 2C6YA 4BYYA 1YS6A 1R5HA 2P8TA 3WTWC 2IP2A 1I6XA 4AIHA 4QWQA 5ICCA 1R1VA 5HDGA 1ODDA 4HYEA 4ETSA 2QWWA 3H3ZA 4ASNA 2BYVE 2JT1A 4BNCA 1A04A 5FFXA 1HSTA 3NQOA 3EUHA 4UVCA 1F9NA 2DAOA 5JFRA 1VTNC 2RNJA 5FB2A 2FOKA 3FXQA 2IJLA 4A0XA 5ILVA 1W5TA 3BPVA 1XSXA 4LJZF 1SD6A 2UXXA 1S29A 3QP6A 2W84A 4ZYHA 3GFLA 1P4AA 3GW2A 3RPUA 5FGMA 1OPCA 1W4MA 3HUGA 3B73A 4U7BA 1QO0D 1I5ZA 3FXRA 1K6OA 3GFJA 5D5XB 3RKYA 5ILUA 2ETHA 2GXBA 5CLSA 3ZP5A 3MFKA 1XMAA 1P92A 1XSDA 2O6GE 1FP1D 3I4PA 3I71A 2OZUA 1STZA 2OQGA 2RC4A 4IXAA 2ESNA 3GFIA 5LGTA 4LLNA 3O6BB 1G3SA 1OYWA 3BJ6A 4RB2C 4KMFA 1J59A 4Q5SF 1YQAA 1Z7UA 4HV6A 5D8KB 2EV5A 1QGPA 2DLLA 4XBFA 2VT2A 4ZZDA 2BV6A 2KJBA 1Z1DA 4IPAA 3V4GA 3LSTA 4FHTA 5HLGA 3U1DA 4A6DA 4M73A 2L54A 2QLZA 3O3KA 3P9CA 1QPMA 4EMSA 1ONVA 3T5XA 4ENKA 5K5QA 1B6AA 1FPQA 4ENNA 4L5JA 3TKYA 2XRNA 1QZYA 5LEJA 3U9GA 4A0ZA 2OA4A 4I2OA 2R7DA 1JE8A 4U88A 3DP7A 4LK1F 1FNNA 2FBIA 2PG4A 1KU3A 2P5LC 4U0VA 4LG0B 5F6FA 1MJBA 2OD5A 4N9HA 1U5TB 1ZN2A 4BXUA 1JGSA 1B9MA 1ZLKA 3F72A 4UVAA 2K7LA 2DU9A 1O3SA 5LGNA 4Q4ZF 2L4AA 5K5RA 3HSFA 3TO7A 1Z6TA 3F8MA 3I59B 2UWMA 2BEOA 3FF5A 4Z2YA 3KP3A 2VBYA 4XLPF 2X0LA 4BAYA 4YG2F 3WG9A 4KIBA 3BY6A 3WGHA 1G6NA 2QM3A 3L2CA 3L7WA 1IN5A 3NEUA 2MH9A 4MEYF 4AIJA 3C18A 5BS6A 1ZGJA 3E5XA 3QPHA 3HRMA 3T8RA 1R1UA 1J5YA 3KZYA 4OOIA 2PMUA 1X3UA 4P55A 4ZYEA 1TNTA 3I5UA 2D1VA 3WTVC 1R5GA 1BN5A 2Q2EA 4LD5A 3FM5A 2HQNA 4LGWA 1E17A 3KETA 4CGZA 3AAFA 3N97A 2V1DA 1U5TC 4RB0A 1TQPA 5DCMB 4EGYA 1RI7A 3C7JA 4P9UA 4UVBA 4OMYA 2PN6A 1K78B 3WGGA 2NRAC 4RB3C 5HLIA 2XGXA 2FMLA 2V79A 1WSUA 1SD7A 2K4BA 3HSEA 2GXGA 3GYHX 3Q9SA 4CHUA 5AIPA 3RYPA 1T39A 4KIGA 1HKSA 5JR3A 3FMRA 1MDMA 2VN2A 2EJRA 3FMQA 4MGRA 5E1WA 2QENA 3IKVA 3TOBA 3FWEA 1BJAA 2M8EA 2P7CB 5HS7A 2AS5F 4XSZF 3IKTA 1KQ8A 1U3EM 4L9TA 2QQAA 5H20A 3VEPA 4O3MA 4EJUA 1IN7A 2P7VB 2FU4A 3RKWA 4I02A 4S04A 2EB7A 4A5MA 1WRJA 2JPCA
chains in the Genus database with same CATH superfamily
2YUSA 3K0LA 5J8FA 1QA6A 3T0YA 1VQ4I 5DM7F 1U6GA 3N05A 2CQXA 3ONQA 1XD7A 3H3UA 4JX4A 3GLXA 4HZFA 2IGKA 5BMZA 3F8CA 1ZREA 1DQUA 3KLNA 4FT8A 3JRGA 3K9TA 2HOAA 1XTAA 3HB9A 3BR1A 1O7FA 4KITB 5D5UB 3CJRB 1G4DA 2QQ8A 3ZMUA 2E36A 3LWFA 3OR2C 3SQNA 1S72I 2GM4A 4Y17A 1VZ0A 3WGIA 4M6YA 2VC1A 2M4GA 1Y1VJ 2XAGA 2F5CA 2HS5A 1YTYA 3IAM2 1Y39A 3ZPLA 2HDDA 4KJZA 3MKZA 2EIJH 2FA5A 2CFXA 2KQRA 1D8KA 1TW3A 1X19A 5IYDJ 3KP4A 1XDSA 5EJCA 2BY1A 2HOEA 2IGMA 3W6KB 1N77A 2VLAA 1K6YA 4G7HF 1ETKA 2P6TA 1B59A 1K83J 2IAIA 2VJ4A 4RA2A 3JRFA 4EJTA 4QPQA 2ELJA 1TWFJ 3W2VA 4DOZA 5HNHA 3I55I 2HVRA 4LMYA 1SANA 2PMZA 2HOSA 3BTCA 2KIMA 2LKSA 4F3QA 2HYFA 1H88C 3JW4A 4EATA 1WQ2A 3FM3A 5ERIA 4IRIA 4E7SA 4BJ6C 2DOFA 2RGVA 4A12A 2R7XA 2EZLA 1FMWA 3WE3A 1IO2A 2ELKA 2G7UA 4WXCA 4XLFA 3CDLA 3G73A 3AKZA 2ESHA 3LSPA 4NC8A 1MZBA 4RM2A 2QBYB 2CW7A 4HLXA 3W6JB 5HOOA 2DA7A 2VIXA 4XKWA 3T8TA 2B7EA 5KVRA 3OS0A 3ABTA 1MMGA 1ZQ3P 2H1LA 2KIFA 3CCUI 2MLGA 4X6AJ 2EA4A 2WAQA 3HUGB 3KZIC 1DUXC 4LLLA 5LBQA 5FLVA 3M3YJ 4KICA 1X4PA 5BOXA 3ISPA 1R71A 5B66C 5L3GA 1XPXA 1FBQA 1WH5A 2HDWA 3HXLA 2CUEA 3PO3J 3MCZA 3J7YJ 4DYCA 2LKPA 1HW2A 2XF7A 4MO7A 3WODF 1QRYA 2ID6A 1O3TA 1VQ5I 1HSJA 2HQRA 1ZYRF 2W1OA 4AWXB 3IAS2 1SAUA 1WPKA 5LD2C 3GX4X 2VT3A 4A3LJ 1OR7C 1T98A 2EA2A 4HAMA 2FF4A 5CVIA 2KDZA 1NK2P 3A2KA 3DQVC 4M71A 1XGSA 2FBKA 1AKHB 3O8HA 3I54A 4MHGA 3CCSI 4HOBA 1F36A 2G7HA 1MNEA 4A2UA 1PVEA 2AXLA 3TW6A 2H09A 2X1CA 4LIUA 4G7ZF 5FD5A 3VYSB 1O3QA 3EUHC 4P9FA 3BQYA 3CESA 2ISZA 2EV6A 2GQQA 2ZBKA 3F8FA 2AQFA 1DU6A 3FXUA 2WY8Q 3WHBA 3AL0B 4U87A 2IS2A 3IRRA 4A3KJ 3FXLA 5LFAA 1F5TA 2X51A 4BE2A 4QLCU 3S2WA 1HW1A 1A6QA 2JPBA 4PJMA 2ZC2A 4EV0A 2CUZA 1BM9A 1FMVA 1YI2I 4ESBA 2DYRH 2ZNYA 1D1AA 2MH2A 1XN7A 4WF2A 4EJVA 4ZTJA 1S3JA 4LLGF 4KT5C 4XM3A 2XUBA 3VYRB 1FSEA 3HL2A 2HTSA 1B72B 2H94A 5J40A 5AIQA 1RRJA 1ZG1A 3FXOA 3D5RC 5J8CA 4EJWA 2Q0OA 2VBWA 1X1CA 1W36D 1GDTA 4HPQA 2L9RA 3ECOA 3IH2A 4UUTA 3ZQIA 3F23A 2VE9A 1K79A 2WB1A 2DMNA 2ISYA 2TRTA 1G3TA 3PFIA 1LVAA 2M9HA 4CXFA 1IN8A 4HF0A 4YIIA 1W7PD 4BJ5C 3OIPA 1NK3P 1T56A 3P7NA 5IP6A 2M3AA 2COMA 3OOPA 5A2QZ 2IRFG 3QQAA 1ZGWA 4XSXF 5K7ZA 2RN7A 3R6SA 3AG3H 5HVQC 1YW9A 1W7PA 3PUBA 2FEZA 1JGGA 4IHTA 2MSYA 3J7AY 2R3SA 4EVIA 4HRIA 4RLFA 4YEJA 3SZPA 3HBLA 1IF1A 1X1DA 1TWHJ 5LHIA 2QQBA 3SFZA 3KCCA 2VPRA 3LSJA 3JRCA 4R79A 1KU7A 1CQTA 5LRRA 3TDUC 4C3HJ 1K4SA 1RKTA 3OR1C 4B3AA 1Y0UA 2DQLA 3L00A 4BHPA 1AA7A 2FD5A 2EH3A 1PP7U 3I56I 3HDDA 4HLYA 2RV8A 3QYBA 2XKOA 1ZAOA 1BL0A 1J9IA 3JRBA 3HHGA 5FLXZ 3TO9A 4ON0A 3S1QJ 3AL0C 3RKQA 2E2IJ 2MGQA 4RMNA 1PYVA 2ADUA 4JBAA 2R7ZJ 2CQQA 4PGGA 4FX4A 3D5LA 4DQ2A 4BE0A 1OYIA 2NYXA 3SZGA 4UUVA 1P6RA 1ZRFA 1LE8B 5BPDA 2XAHA 1W0UA 5CVUA 1U8BA 1N75A 2X4HA 1W1WE 2KIUA 3DTEA 1S8NA 5C44J 3G6EI 3S3MA 2XPVA 3FDYA 2FBHA 3LAPA 2HU9A 3M7GA 4W97A 2ZJ2A 4XLEA 2QGUA 3BR0A 3ZR8X 1J75A 1HKTA 1H9GA 1MD0A 2KL4A 3LSRA 3ERED 1FTZA 2IA2A 3B6AA 1UJ8A 5ILSA 4XLHA 1VQMI 2JRMA 4XKCA 2QKMB 4BY7J 1IUFA 4EGZA 3GTMJ 2NVQJ 2BVLA 2NS0A 1X1BA 2CFOA 2LY9A 2D1HA 2E5ZA 4HW0A 3KE2A 4CA0A 5K7FA 3S1NJ 2HPMA 2FMYA 2GA1A 5TISC 3E5UA 1BI1A 4JP0A 5J1RA 1ZG5A 2CSOA 1P4WA 5GADJ 1DPUA 4BKXA 2OZ6A 2OAZA 5KHDA 3PQKA 1YW8A 3VOEA 3HOYJ 4A93J 2O7OA 1ETQA 3EYIA 2EBIA 3E7LA 3L2WA 2E1MB 2EPFA 4CCNA 1XSVA 2DMQA 4OIRF 5F0CA 2MA3A 4ITVA 4WXDA 1LFUP 3E6CC 2WAEA 3F21A 1O7LA 1R4NB 2HQAA 2Z16A 3CC4I 4BL0B 2D5VA 1Y8QB 4AYBA 4EQQA 4EM2A 1H0MA 1SD5A 2DTRA 2ZCWA 5ICFA 1ACIA 2JA6J 1I3AA 1P4XA 2M1BA 2DFFA 3ZCOA 4U0WA 2YR2A 4E70A 4ENMA 4A3MJ 1QU3A 4CO8A 2E34A 3K4JA 3HKZN 2DQRA 3EETA 4J00A 1T8IA 4ZDLA 1QVUA 1T2KA 2E1OA 3DCFA 2XF5A 2NS8A 3IH4A 3K10A 1FLIA 2FNAA 2HVQA 1J0RA 4YRVA 2XAJA 3JAMZ 2IW5A 5IT9Z 2HI3A 2V4JC 2CQKA 1LQ1A 4KYWA 3CJTB 2AXTC 5BPIA 3BJOA 2QCOA 3K4LA 2WWYA 4J19A 1T95A 3R60A 1E17A 3QU3A 1IDZA 1U8RA 3CO6C 1O4XA 1FOYA 3PSFA 4IQJA 2NS7A 3BROA 2X6OA 2K40A 2RKHA 3FBIB 3QPTA 5FLXK 4UV9A 3GXOA 3JTGA 4ZH4F 1VQOI 1Z7LA 2E5NA 4KN4X 4HX4A 3TMOA 1MDMB 4AVZA 1IRZA 2ZSIB 3OYKA 2H27A 5J3LA 3MVPA 4MIMA 4BHBA 3HG9A 4EJOA 4IO9F 2YS9A 4FX0A 4RGUA 2EWNA 5HDKA 4I09A 3TOAA 4XNFA 1IRFA 2B63J 1VQNI 1J7KA 2OQRA 4R1HA 4HSRA 3HM5A 2OCEA 3BG7A 1MGTA 4NHJA 3O2PE 3BQZA 4GRIA 4Q47A 1V4RA 5E1ZB 2PFBA 5K1YA 2P5KA 3H0DA 1O3RA 1S7OA 2ZNZA 1LUJB 3M9AA 2DA1A 2Y9YA 3L9FA 4M74A 4D5CA 2L7MP 1YRNA 4WCGA 5L3BA 2FOWA 4B09A 2M7BA 2X9DA 4I6ZA 2F5FA 3F3XA 1BR4A 2F5VA 3LA2A 3HOXJ 3I64A 3OYIA 3S14J 3KYDB 3CCLI 2OUMA 1MBKA 1Q1HA 4ZYDA 5E17F 5GTHC 4C2MJ 2FJ1A 1VQLI 1U0JA 2PJRA 2MC3A 3G4SI 3WTZA 1MSFC 3MKYB 1LEBA 4WX9A 3V42A 1FYMA 1JXSA 3A4CA 1HDPA 4LB6B 2VL8A 3IWZA 2VBZA 2BW3A 3AFHA 3DFGA 4G94A 3CTAA 4KISA 4XOPA 4ZYGA 1Z9CA 1I3QJ 4C2TA 3K4KA 4HX8A 4FTHA 3LA7A 2KJCA 4CCJA 4BQOA 2M34A 3BC8A 2DK5A 2HQ5A 3QP5A 2W82A 5JVGF 2MLKA 2VQHA 1BJZA 2K9SA 2KDOA 1H89C 1V5FA 2KRCA 1XC5A 3PQJA 1OCTC 3NARA 2VC0A 5J4VA 5FKNA 4OU0A 2HNHA 4KA4A 5TGTA 3CQZJ 4BXFA 1U9OA 2F5EA 1KYZA 1X1AA 3DV8A 1R49A 4LOCA 3BG6A 5JVTA 1KA8A 1FOWA 3DEEA 4GYIA 2H6CA 5LRSA 5HS9A 1FBSA 1EH8A 5DCFA 1HW5A 2QUFA 2VE8A 1ITYA 4IRHA 4EM0B 1IXSB 5BQTA 3VSKA 2F4OB 5IT9K 3VODA 4RGXA 2PMZN 4XL9A 3DPLC 3I3LA 4RGSA 5D6FA 4A3BJ 4Q48A 1JKOC 3LA3A 3SHFA 4XRFA 2CV2A 4MQVA 1A6IA 2X6WA 4GDFA 4XR6A 2OTJI 1Y56A 3B6CA 1F43A 3OS2A 4RS8A 1BR2A 4DYQA 3LSGA 4N4NB 4PSXA 4V2FA 2W25A 1MNDA 3HC7A 2ZFWA 1H8AC 3BPXA 1TP4A 1WJEA 3FXJA 3WTUC 4IHSA 1FIAA 2CU7A 2DOEA 1LPQA 1HKQA 1ULYA 2R5YA 1PP8F 3OV8A 2WAQN 2VUMJ 1YYVA 4XLCA 4L0YB 1BI0A 4GCVA 1V3FA 3RYRA 2BVMA 2HXIA 3HRUA 3K4MA 4TV7A 4ABZA 5HLHA 4M9ZA 4JOMA 4HDUA 1TBXA 2HOTA 3GTGJ 4I98B 2L9SA 5CVJA 3K4NA 1KQ0A 3JRDA 5L3FA 5GPCA 1G3WA 4P96A 4L9VA 4A5NA 2VQLA 3GTOJ 2ME6A 1OQYA 5JI6A 2LBFB 3DTIA 4WWCA 4QSHA 3LOCA 3FIWA 2O5RA 3GF2A 3DF8A 1DPRA 4PDKA 3FMSA 4ZC3A 1R36A 3GBGA 5E1XA 4BHCA 1E2XA 4QTRA 1TWGJ 3ML6A 2CYYA 4E6KG 1DP7P 4HSTA 2Y31A 4GGGA 4KFCA 1OCZH 3COAC 2NVXJ 4OAZA 1VFCA 1Z05A 2XGDA 1T0FC 2JRTA 2M8GX 3HHHA 5FKLA 4E4HA 4OINF 1H9TA 3E0JB 1RR7A 4K2EA 4MNUA 3T1BA 3CP2A 2XB5A 1YE9A 5IY5H 3G1LA 3X2QH 1PUFB 1FY7A 2K85A 3DKYA 2X48A 4IRGA 5LHGA 3HGGA 2ZJRF 3IUOA 1OYYA 4RB1A 5KCMA 3IL2A 1WFXA 3JRHA 1S5LC 5D4RA 2JSCA 4Y3OA 4N9IA 1B4AA 4CYCA 2P6SA 3QRFF 2M4KA 1EV7A 3QYEA 1YJWI 1QPIA 4D7MA 2D2WA 1A35A 1WZ2A 2W48A 1A36A 3S2DJ 4JX6A 2JN6A 4ZYAA 1R5ID 2FE3A 4NQWA 3BR2A 4JQFA 4ESFA 3O8GA 1YO5C 1P7JA 1MNMC 3K2ZA 3DPTA 1HXDA 3HGYA 2R92J 2B0LA 2Z1DA 3B02A 3EUAA 1T38A 5E18F 3LFKA 2WADA 1EKEA 5E3OA 3LSMA 3MEXA 2WB1N 3KX2A 5E3NA 3RKXA 3RZOJ 2E71A 1WI9A 3FKIJ 3I58A 4L9NA 5B1AH 3CUQA 3V7RA 2R7RA 4WXHA 1P9QC 1SAXA 2WTEA 3TBIA 3ZQ7A 2A6EF 3JRAA 1WKMA 1Z3YA 4DBRA 5L3CA 5M5WJ 1ZGAA 3GTQJ 2RQPA 2LMDA 1ZH5A 1UMQA 1J2XA 1KYWA 4A3JJ 1BW5A 2VQCA 1S6LA 2VOPA 2A5WA 3S1MJ 4LG0A 2RVCA 5F1JA 5D4SA 1D1CA 2VKEA 4YFXF 3MD2A 1E0EA 2H8RA 1Z67A 3Q5FA 2LTPA 2L01A 2KPMA 3CJQB 1B8IA 1RKWA 3GMEA 3P9IA 1YW7A 3HOZJ 5M5YJ 1FSHA 2L0KA 3IHUA 3OIQA 4B47A 3SDGA 3OYBA 3F22A 1RZ4A 3WTYC 3RSNA 4RLQA 3A0HC 1UZCA 4M3BA 3KP2A 1IN6A 5HS8A 2HWVA 1QQIA 2VKDA 3BWGA 3A02A 3I59A 3DEWA 4CCMA 1R00A 2LG4A 2PLYA 1YG2A 3BOQA 2CO5A 5LEKA 1HOMA 1UHMA 3H9GA 5EEHA 4HDVA 2H6BA 4KIFA 1YHQI 2CH0A 5EEGA 3CC2I 1JTXA 5D8LB 3ELKA 6PAXA 3ZN0A 4I01A 3AG4H 4A3DJ 1Z6RA 2FSWA 2QQ9A 3WTXC 5DS9A 2STWA 1X58A 3REOA 3OYHA 1YFHA 2DN0A 1ZK8A 2Y2ZA 4IF4A 2KFDA 4UHTA 4C30A 1YIJI 3ULQB 2DA6A 3LAJA 3DKXA 2QVOA 2CGPA 1LFBA 2JA8J 3VSLA 1LDKB 3TP0A 1B1BA 2XF6A 2O61A 1GXQA 5E3MA 1BIAA 4KMUX 4HNTA 2QKLB 1ZHFA 3Q9VA 5CKTA 2ICWG 1WVRA 4DZPA 5H2FC 4XRMA 4MQ9F 4AUXA 2F4IA 4I0BA 3GTJJ 2QZ8A 5DUKA 5TJJA 5K5OA 5F1RA 1LB2A 3HZJA 1HF0A 3NWTA 1FOKA 3RCOA 3L2VA 1IRGA 3JCUC 2DDAA 1YX5A 4IHYA 2IS1A 1VQ6I 3BZCA 1JHFA 1R9TJ 2LDUA 4I0AA 4YFNF 2L7ZA 4U7DA 3OSGA 2XROA 4UUSB 4M9XA 3ECHA 1JKPC 1B9NA 2M0CA 3TO6A 3CMAI 1IUYA 4L5EA 3LMMA 3FZVA 1LNWA 5DCMA 3OS1A 4AYBN 4YFKF 1RR8C 3FK6A 4B44A 2HPIA 1UG2A 3HRTA 2ZSHB 4PZJA 5E79C 2YU3A 2VKHA 2ZB9A 2ZXWH 3HIFA 2XKPA 3QU6A 1N25A 4UNOA 2HKXA 2YSRA 4I7HA 3BP8A 3BG3A 2DK8A 1FJLA 2CWEA 3I53A 2F2EA 2IA1A 3H5AA 2K86A 3JSOA 3ZQCA 3FHZA 3GUDA 2GAUA 1EA3A 2W57A 1MMDA 2DA3A 5FJ8J 2HGCA 5ICEA 5DD8A 2V6CA 2ZMEA 1VQ7I 5FKKA 2E1CA 2EV0A 2LP0A 2DDBA 2L4MA 4PCQA 1ETYA 2DA4A 5JLXA 3C1DA 3D0SA 2VXDA 2LY2A 2MYSA 4FCYA 4HQMA 3RDIA 3U21A 1RUNA 3DBHB 3TEDA 1XGNA 2BZTA 1MH4A 2ZJQF 2HDCA 3MQ0A 2XV4S 4QIWN 2WV1A 4G8XA 2EILH 3S32A 4E7KA 4ZJZA 1WWXA 2DBBA 4IEJA 1R7JA 3FXKA 2LNBA 2P4WA 2JUGA 3V8LA 1RESA 2GWRA 1DGRM 2GXAA 4NB5A 4D0PA 2W24A 1A31A 1KZHA 1YJ9I 3OYLA 2GLOA 5CQGA 3KP7A 4N4OB 4BJTA 3BR6A 2DI3A 3VDXA 2V26A 3VFZA 1IG7A 1BOAA 2ME0A 3F8NA 3F8BA 4M6XA 2VODA 4RAYA 2HYGD 3U2RA 1IZ1A 3OOUA 3BG9A 2WC2A 4RDUA 1SFXA 1VQ9I 4BY1J 1TQIA 3ZN1A 2EFPA 4PJJA 3MWMA 1V55H 2DODA 2DMTA 4M6VA 2Z33A 4G6QA 4BBRJ 1IV6A 3CLOA 2HEOA 3EDPA 2XASA 2XRLA 3WU1B 2CW8A 3HEFA 4XKVA 4C3IJ 3ASOH 3C3WA 4OAYA 3SDBA 3ASNH 3ZOBA 4B43A 5GAEJ 5KAIC 4L18B 1X1PA 1T33A 2Z99A 1ETVA 1VF9A 2XAQA 2Y0MA 4ZZLA 2PI0A 1Z0XA 5EG0A 4JX5A 2AQEA 1FBUA 3VYTB 3ABMH 1KONA 2E7WA 2LF8A 1X3WB 1MW7A 2I8DA 3SYTA 2PQ8A 5E3LA 2BW3B 1ZG3A 4L9JA 2YX7A 5FKMA 1GVJA 3I0TA 1R22A 1SEUA 4C9YA 2R7WA 1I50J 2BY2A 2GZWA 3H5NA 5E8IA 1T6SA 2V1XA 1OR7A 5IOZA 1JKQC 3V8KA 3ZRGA 2JA5J 2MW8A 3BTLA 4BXXJ 1ZARA 2EFNA 3M8FA 3KP6A 1LKXA 1ON2A 2UXNA 5FFZA 3RIRA 2NNNA 4E7JA 2X6XA 1MMNA 4FE4A 2K27A 2XIGA 4N0BA 4PJ0C 2Z5UA 2DJNA 2LY1A 5GAHJ 1WJDA 1NHAA 4HG2A 5DEQA 1TTYA 2O8XA 2PJPA 5F27A 1IXRC 1TWAJ 1WJFA 4Z6YA 2XVCA 5HLTA 1MIJA 5L3DA 3RI4A 1SVOA 1U2WA 2A68F 3ZXSA 2HFHA 3DKWA 3BTJA 2HVSA 3QWLA 3PNYA 4KUMA 4DYRA 4MEXF 1S7EA 2KKOA 3G1MA 3IWFA 2RDPA 1UFMA 1ZTRA 3DEUA 4OIPF 1BA5A 2QBYA 3FHNA 4IHXA 3E6DA 2Q8KA 1ZRDA 2EFQA 2IPQX 3HOSA 3M8EA 3DU5A 3KP5A 5D6EA 3I4NJ 3W2WA 5F04A 4C2UA 2F48A 1S9HA 2W7NA 2LH9A 2LFBA 3GCMA 3OSFA 4CZCA 2OF7A 2G9WA 4DIQA 3HRSA 4G12A 5FO5A 2AHQA 2BBYA 4OIQF 3E3VA 5DTDA 2E35A 4YELA 2DFHA 2R5YB 2JJ7A 2M5WA 2DYSH 1OCRH 2W85A 1NG7A 2Q2EB 1LDDA 1OCOH 5DD4A 3CCRI 1KQ9A 2EIMH 2EINH 2PEXA 3SZTA 5A2QK 4BEHB 5DV5A 1KU2A 1CF7A 3BDDA 2DO7A 5BNGA 3FX3A 3OMYA 1F4KA 3CZ6A 2VI6A 3OYMA 3OYDA 2B9SA 3GWZA 3WE2A 4B8XA 3CCVI 2P0WA 1XS9A 2JTVA 2MABA 5EGOB 3ZMVA 3Q0UA 4HQEA 2K3FA 2K9QA 2CUFA 3TL4X 2EZHA 2LF7A 2VXZA 1AKHA 5H6RA 2F5DA 1S7AA 2ID3A 2MFZA 1XDUA 2M45A 1W5SA 1Z3XA 1Z91A 3H36A 4V19K 4A6EA 2KMUA 3BCAA 3BCBA 1BC7C 4G6DA 1BOBA 4GYGA 1T08B 4PUSA 3WU0A 4XICA 4A3IJ 1HA8A 3J80Z 3PSIA 1ENHA 3H9QA 4V2GA 1CGPA 1HLVA 1MBJA 3PL8A 3K69A 3WTTC 3A01A 1U78A 1RIOH 1MKMA 1GT0C 3P9KA 2RQQA 5M3MJ 1BW6A 3FISA 3UR3C 3KEQA 3K70C 2HR3A 5J47A 4UXNA 1QHHD 2R7FA 2V9KA 3AG2H 3CO7C 2E2JJ 4LB5A 3A03A 4F93B 1FC3A 1B72A 2XHKA 2E1MC 1JJ8C 1XCVA 3GTKJ 2UV1A 3S3OA 1I1GA 1O57A 1OKRA 1IC8A 4XRSA 1IDYA 1L3LA 4CCOA 4H0EA 4HNUA 3OL3A 3R4KA 4LIVA 5CJ9A 2NNYA 1DP3A 3LQQA 4NUBA 3M1CA 4HX7A 3BZKA 4E7IA 2LSOA 2XPWA 2GOXB 4CYDA 4P5OA 2R7VA 3CUQB 3C2HA 2EZKA 2A69F 2IVMA 4KDPA 1JUSA 2RNGA 2V9VA 1UB9A 2JZYA 1GHCA 2HKOA 3G3ZA 2FQ4A 4BBSJ 2IA0A 2LLKA 3E97A 1SD4A 5B5EC 3NRVA 3CCQI 1IJWC 4Y15A 3ABUA 4LFUA 3PO2J 4HA8A 2MBFA 3QAHA 2R0QC 2CUJA 4U0YA 4PK4A 3FXMA 4HF1A 2LYCA 4MFDA 3DPUA 3MZ8A 3CCJI 5HNFA 1ETOA 3K1PA 4XKBA 3ESWB 4IHVA 3E6BA 3HTUA 4CICA 2ZJPF 2EZIA 2JSPA 2BE5F 4II2A 2TCTA 2J5PA 3SXYA 4YIRX 1ETXA 3Q0WA 3J7ZI 4GXOA 3J81Z 2VJ5A 1F1ZA 3L2RA 1ON1A 5JHFA 1XX5A 1LVKA 3JAMK 1FX7A 3D1NI 3F9KA 4HV5A 3DBLB 5FROA 4R8HA 1D0YA 2PMHA 1OCCH 4IJAA 2XPUA 4CCKA 2JA7J 2J5OA 4FQGA 1ORKA 2CW0F 2BXZA 3Q0VA 3K1MA 4L5IA 3DU6A 5F0HA 3M1EA 1GUUA 2EK5A 1L0OC 3E5QA 4MTEA 1BI3A 3CDIA 3DBRB 2R7QA 2F6CA 3J80K 2E7XA 1LDJA 3OYGA 3HTSB 2M2EA 2A61A 3HYIA 2R7UA 2JK3A 2BOLA 1REPC 5EF6A 2VBXA 2Y48A 5F64A 1WI3A 1XGMA 1K7AA 5J1UA 4GO1A 1QNTA 3HSRA 4A3FJ 1RUOA 4DJAA 1ZR4A 2VOOA 2GBYA 3CUQC 3ABLH 1AOYA 2NAZA 1BC8C 3W2AA 2JMWA 2STTA 1XMKA 1YLFA 3GO5A 3MKWB 3CCYA 3S8PA 3S17J 5IYBJ 4B48A 4PGHA 2OJED 3MZYA 4JK1X 4M3GA 5IPAA 1R4MB 3ERMA 2JUCA 4XQFA 2XSJC 3EYYA 3V8JA 1E3OC 1TQMA 2E1NA 2QEXI 2QF7A 4CCLA 3SEZA 3LNQA 4CZZA 3M07A 2DW4A 2JVHA 4BQAA 2WV0A 3KEOA 1MJAA 5CVRA 5LGUA 1FEXA 4G7OF 4Y13A 1FP2A 3LL7A 4E7LA 3SFIA 3OWTA 3S3NA 5GP9A 1QZZA 3U1KA 4YIFA 3CF5F 2DT6A 2TDXA 4UB6C 2DPDA 1TW2A 1LEAA 2A6HF 2M30A 3OYJA 1PDNC 5AONA 1WJCA 2A07F 3LFUA 2KRHA 4AIKA 2HTJA 3KFWX 4KN7X 1SFUA 2FQ3A 2ZO4A 4XN0A 2HYJA 4BQQA 1HQCA 2WAFA 1JHHA 3TW7A 2EFWA 1Y8RB 5CQEA 3EUKL 1SC7A 2DMPA 2ZKZA 4XLNF 4RBOA 5C3EJ 1PUEE 1WJAA 4X0GA 3A0BC 1FT9A 2R5ZA 2DT5A 3CUOA 3IV5A 4KNYA 4II3A 1HC8A 1EH6A 1SMTA 4G9YA 3WHCA 1TZLA 5IYCJ 3L1PA 2ZMEB 4HBLA 2COBA 3H35A 5E8GA 3RTRA 3V7SA 3OYNA 1X4OA 2KRFA 1SFOJ 2EFOA 1Z77A 1R1TA 2L5QA 3BZ6A 2UZKA 4OMZA 2V1UA 2YU9J 1M1EB 3J81K 1JTYA 1WGXA 2IGOA 3R61A 4A0YA 1SFEA 2RAEA 1OMIA 1K4TA 5EZHA 1D8JA 1FYKA 2WY7Q 2FX0A 1USSA 3L09A 4LITA 4ESJA 3I9V2 5CPRB 5JHUA 5CYVA 3L2QA 1UCRA 3H5RA 3JSPA 3S16J 3EQLF 3G2BA 2Y75A 3HOVJ 2H8WA 1GVDA 2FXAA 3WG7H 1GLNA 2KHMA 4NC7A 3ZMTA 3TDZC 2KP6A 1IN4A 1IGNA 1I39A 4BUPA 4BH9A 1W5CC 5J1YA 2Y30A 2NVTJ 4I76A 3KZZA 2QYOA 2L2OA 3TP3A 2L02A 2BXYA 4AU7A 4D9JA 1RNLA 1MMAA 2G0EA 1W7PB 2DFIA 2IBDA 3TGNA 1FTTA 1YJNI 5M3FJ 2L9NA 5J4YA 5HODA 2V1NA 5HDNA 3JTHA 1VI0A 1Y6IA 4D5FA 4QPOA 3ROUA 3CC7I 3WTSC 1DDNA 2JQ7A 3ZQGA 3MZHA 2KIQA 4A69C 5ED4A 1U5TA 1XMXA 2ELHA 2XAFA 3LQRA 2IS4A 1OCPA 4Y52J 1R58A 1JJ6C 2A3SA 3R0JA 2K02A 3E6MA 2CG4A 2GA2A 4S05A 5EG0B 5H6QA 1ZRCA 3BR5A 1KGSA 1E3PA 1I1SA 4AVPA 5DUIA 4IVNA 2Y9ZA 1XGOA 2ZMEC 3IC7A 3BG5A 1GXPA 2CRGA 1ZR2A 2R7SA 1RC9A 4BS9A 2YPRA 1YS7A 3CLQA 1USTA 3F6OA 4BE1A 3RPQA 1QBJA 3N4MA 1UHWA 1D5VA 1IXCA 3CDHA 3TQNA 3GTLJ 1R23A 1XCBA 3GZNB 3QOPA 5L3EA 3VB2A 3JREA 5DDGA 2D45A 2DMUA 1SVLA 1XB4A 2OU2A 2W4SA 3VPRA 2ACJA 4BU2A 1T0FA 1X2NA 2GIVA 4M9SA 1BI2A 1YIOA 4ZDOA 2ZXJA 4L0ZB 1MBGA 2LKXA 2F4MB 1P7IA 1FZPB 5EZGA 4AD9A 3FBNB 2XDVA 2E60A 5E20A 4HNVA 5IT3A 2VPLA 4A3EJ 4Y33A 1W36C 1FWZA 2HZTA 2WBMA 1SMYF 1OFCX 1G59A 1BIBA 5EDNA 1RPWA 1DGWY 3HOUJ 1P2FA 2P5VA 4F91B 1WHUA 2FNPA 5CVVA 4IOAF 1AWCA 3JR9A 1I27A 4B1RA 2MC4A 1MBEA 1UG0A 1VQKI 3ZMSA 2NVUB 1MMSA 1HBXG 2XB0X 1HCRA 1BBYA 4MFEA 2VONA 4CSWA 4BQNA 2O3FA 2A05A 2BY0A 3GZ5A 3DXJF 1QHGA 3LSIA 1YX3A 3KYCB 4B3XA 2OTLI 1KU9A 2A5YB 2YX4A 4B4CA 1HDDC 5ICGA 1LFPA 4XORA 5D5WB 4O5VA 2M0MA 4LK0F 1MJ9A 3ZMDA 3GZ6A 1Q1VA 3K1NA 1YITI 2LBFA 1MBHA 2BGCA 2VASA 5GTIC 4F7ZA 1MH3A 4HF2A 2M87A 1CF7B 3S1RJ 4RGRA 4XLAA 2L3DA 1UAAA 3BLYA 5F08A 5KK1A 3HOTA 1K78A 4H4KC 2Y0SA 2NVYJ 2WA0A 3CD6I 4O6JA 3VYUB 4MLOA 5LHHA 1TC3C 1IRXA 1N78A 2O0YA 5J6XA 3F6VA 1TNSA 3GVAA 3CF2A 2DA5A 3GEZA 4KT6A 4RAGA 1JUPA 3R0AA 2O8KA 1LJ9A 3UKGA 1C0WA 3IRQA 5FLMJ 2EQRA 3J7AO 1PJRA 1TLHB 5FD6A 1PUFA 3AG1H 3MAJA 3V7CA 1IAWA 2KISA 1G3YA 1VQPI 2DPUA 4PFOA 1D3YA 3ZQLA 3HPGA 3H92A 4EM1A 3OY9A 2IT0A 4ENJA 2LK2A 5GPAA 2MD5A 5DYMA 3A01B 2K9NA 4UV8A 5B1BH 2CMPA 1IW7F 4MTDA 3CP8A 4RAZA 1OJLA 1ZLJA 3DLAA 3QOEA 4WK8F 2ZXIA 2KZVA 4ZTFA 2OBPA 2Z3YA 3KLOA 3RZDJ 2QSFX 3GFMA 4D7NA 3FKJA 1FYLA 3CJNA 3RJPA 2FRHA 3RQIA 5TRDA 3LSKA 2EIKH 5D5VB 5K7HA 4IX7A 3OIOA 3QODA 1UELB 2CS3A 5LLQA 2KZGA 1YRNB 2V7FA 1A5JA 2K4JA 2PBIA 4M72A 4DNCA 4OIOF 3BJAA 3ZMZA 4CDGA 4BDYA 2O03A 3CMEI 2P81A 2PJRB 1EH7A 2Z9OA 2C6YA 4PJNA 3PUFA 4BYYA 2BHYA 1TT0A 1YS6A 3HPHA 3G71I 1R5HA 2P8TA 3WTWC 3PIPF 2DOAA 4AC0A 2IP2A 3OYCA 1I6XA 2E19A 4XRSG 1UHSA 1Y1WJ 4XIDA 1WJ5A 1G2HA 4AIHA 4QWQA 1V5GA 4RM3A 1WCMJ 4DBQA 1D1BA 5ICCA 4XMYA 1R1VA 2XAUA 5HDGA 3MMYB 2LREA 1ODDA 4HYEA 4ETSA 2VKVA 2QWWA 3H3ZA 2W00A 4FETA 4ASNA 4BACA 1X3ZB 2BYVE 2JT1A 3BT9A 4DW6A 2IS6A 4BNCA 1A04A 5FFXA 1HSTA 3EPZA 3NQOA 2HXOA 2VJIA 1I6HJ 1Z21A 3EUHA 4UVCA 1F9NA 2DAOA 2K9LA 4CUGA 4F52A 2JWTA 2KT0A 4IZZA 1WJBA 3SEQA 5JFRA 4IL6C 1VTNC 2RNJA 3CCEI 3K4CA 3JRIA 5FB2A 2FOKA 3FXQA 3OYAA 2IJLA 3QPSA 4A0XA 5ILVA 3PIOF 1W5TA 3BPVA 1XSXA 2IEKA 3CCMI 4M3DA 2MG4A 3ZGKA 4LJZF 1SD6A 3RPUD 2GOMA 2UXXA 1S29A 4E7ZA 1MSEC 3QP6A 2W84A 4J01A 4HEA2 4ZYHA 2CV1A 3GFLA 2JA2A 1P4AA 1JKRC 3GW2A 3RPUA 5FGMA 3QYFA 1OPCA 3I4MJ 1W4MA 3HUGA 3B73A 3S93A 1OLTA 4PJLA 1QO0D 4U7BA 1I5ZA 3FXRA 3K2AA 1K6OA 4AM3A 3GFJA 5D5XB 3M4OJ 2LOOA 3RKYA 1AHDP 2IXSA 4NBQA 5ILUA 2OCCH 3K6GA 2ETHA 2GXBA 5CLSA 3ZP5A 3MFKA 1XMAA 2VB6A 3D5SC 2CQ7A 1P92A 3PNVA 1K61A 4ANJA 2R93J 1XSDA 2O6GE 1FP1D 4IOCF 3I4PA 3I71A 4UUSA 2OZUA 1STZA 3C2GA 2OQGA 1YOVB 2RC4A 3OYEA 1U9NA 3PM1A 3NWSA 4IXAA 2LD5A 1OISA 2ESNA 3GFIA 5IP9J 5LGTA 4LLNA 3Q3SA 4C3JJ 3O6BB 4S0HB 1G3SA 1OYWA 2ZFUA 2MD0A 2OC6A 3BJ6A 3CMYA 3H9JA 4RB2C 4KMFA 3ABKH 1J59A 4Q5SF 1G8XA 1YQAA 1Z7UA 2O9LA 4HV6A 4I99C 5D8KB 2EV5A 2DFEA 1QGPA 2K5CA 2DLLA 4XBFA 2VT2A 1TWCJ 4ZZDA 2BV6A 1J09A 2ECCA 2KJBA 1Z1DA 4IPAA 3V4GA 3LSTA 2VQGA 2R5ZB 4FHTA 5HLGA 3U1DA 3KEYA 4A6DA 4A3CJ 3DWLE 4JYKA 4OWRB 5JLWA 4M73A 2L54A 4A3GJ 3FK7A 2QLZA 3O3KA 2RREA 4CYCB 2L9VA 2NXNB 4FE7A 2XGEA 3P9CA 1QPMA 1TL8A 2V6EA 4EMSA 1ONVA 4UB8C 4GFBA 1EF4A 3GLLA 5FRMA 4NQWB 3T5XA 4BDZA 1RETA 4ENKA 2DTZA 1D0XA 5K5QA 4M3FA 1B6AA 1FPQA 4ENNA 4L5JA 1VQ8I 4PFPA 3MN2A 1ZKGA 2ECBA 2R7OA 1IV8A 4NNJA 1E3HA 1GV2A 3TKYA 2XRNA 3DLLF 1QZYA 1VNDA 5LEJA 3U9GA 4PSWA 4XK4A 2OA4A 4A0ZA 2FUG2 3KYLA 4I2OA 2R7DA 5FKOA 1JUMA 3HJEA 1WH7A 1JE8A 4U88A 3KPHA 2CQNA 2CJJA 2DCEA 5EYRA 3DP7A 3BR3A 2DJIA 4LK1F 1FNNA 2FBIA 2PG4A 1JT0A 1NTCA 1KU3A 1MBFA 2P5LC 3H3VK 4LG3A 4AIDA 4U0VA 4LG0B 2QSGX 3A1YA 3L2UA 2I10A 1POGA 5F6FA 2R4GA 4M3EA 4X1EA 1MJBA 2OD5A 3ZQFA 4N9HA 1U5TB 1ZN2A 4BXUA 1B8IB 1JGSA 4EEFG 3VWBA 1B9MA 1ZLKA 3F72A 4Y7NJ 3ZQQA 4UVAA 2LRDA 3P5JA 2K7LA 1QVTA 2DU9A 2L7FP 2M7AA 1O3SA 2DT7B 3NAUA 5LGNA 1APLC 4Q4ZF 2L4AA 5K5RA 5FRNA 3H1CA 3PFYA 1LE8A 3HSFA 4G6TB 3TO7A 1Z6TA 5DM6F 1SFKA 2LVSA 3F8MA 3I59B 1JT6A 2QSHX 2OV7A 2UWMA 2BEOA 1D5YA 3FF5A 4Z2YA 3KP3A 2X85A 5IOYA 3OYFA 2VBYA 4IKFA 4ZDPA 4XLPF 2X0LA 5M5XJ 4BAYA 4YG2F 3WG9A 4KIBA 3BY6A 4CH7A 3WGHA 1V5EA 2JVGA 3E1SA 1G6NA 3QPLA 3WU2C 4D1QA 3K70D 2E2HJ 4DZJA 2QM3A 4DGWB 3L2CA 3L7WA 4FISA 1IN5A 2NOJB 2R7TA 3NEUA 4Y4RA 4XOTA 2MH9A 2BY3A 1ZELA 4MEYF 3S2HJ 3F0CA 4AIJA 2LR8A 3C18A 5BS6A 2DXIA 4P1WA 4UY8I 1ZGJA 3E5XA 3QPHA 4NC6A 3HRMA 2HZDA 5C4XJ 3T8RA 4NDLA 1R1UA 1J5YA 1GV5A 2VJJA 3KZYA 2Y69H 4OOIA 2PMUA 1X3UA 1V54H 2N8GA 3H0GJ 4P55A 4ZYEA 1R6RA 1TNTA 1X2MA 3I5UA 1QZEA 3KIOA 3SJMA 2D1VA 3WTVC 2X1DA 3UNGC 1R5GA 2OPTA 1BN5A 2Q2EA 4LD5A 3FM5A 2HQNA 4LGWA 2IGNA 2LC2A 5C4JJ 3KETA 2XC7A 3AAFA 3N97A 4CGZA 4BEHA 2V1DA 1U5TC 4RB0A 2H1KA 1TQPA 4IQ4A 5DCMB 4EGYA 1XG1A 4W1UA 2ZXHA 4BGDA 1RI7A 3MKLA 3PJRA 2A6TA 3C7JA 2PX9A 3K7AJ 3HKZA 2XSDC 1W0TA 4P9UA 3IP4B 5EEAA 5KAFC 4UVBA 3ZQHA 5IP7J 5EGOA 4OMYA 2Y0SN 3CMMA 5F0FA 3M8JA 3K4BA 2PN6A 2QA4I 1K78B 1ETWA 3WGGA 5GAGJ 2NRAC 2BHZA 2V9PA 4RB3C 2UUZA 5HLIA 4XN3A 2XGXA 2FMLA 2V79A 4XONA 1WSUA 2K3PA 1SD7A 3HOWJ 1ERDA 2K4BA 3HSEA 2GXGA 3OL4A 1AU7A 3GTPJ 3GYHX 3W6VA 3Q9SA 3S15J 4CHUA 5AIPA 3RYPA 2L7KA 1T39A 4KIGA 2X1EA 3BTIA 1NH3A 2DA2A 1HKSA 5JR3A 3FMRA 3C2BA 1MDMA 4RAFA 1NG6A 2Q1ZB 2AO9A 2X6YA 2XGCA 2CV0A 3DTKA 1FOXA 4E7HA 2VN2A 3IH3A 2EJRA 3FMQA 4MGRA 5E1WA 2QENA 3IKVA 1SVMA 3TOBA 1TT5B 3FWEA 1BJAA 2M8EA 2I5UA 5B3SH 2P7CB 5HS7A 5KNLA 4XSZF 3IKTA 2AS5F 2KLOA 3G1OA 3RQ4A 9ANTA 2Z2SB 1KQ8A 1U3EM 4IHWA 4L9TA 1JI8A 3W3CA 2QQAA 5H20A 1FIPA 3VEPA 4O3MA 4EJUA 1IN7A 2P7VB 4F55A 2FU4A 3RKWA 4I02A 4FASD 1BR1A 4S04A 2NOGA 2EB7A 1EJ9A 3LSHA 3PNTA 4A5MA 1DU0A 2GIZA 1Y0NA 2K9MA 1D0ZA 1WRJA 2JPCA 4F92B
chains in the Genus database with same CATH topology
3K0LA 5J8FA 3T0YA 1U6GA 1XD7A 3H3UA 3GLXA 4HZFA 5BMZA 3F8CA 1ZREA 3KLNA 4FT8A 3K9TA 1O7FA 5D5UB 1G4DA 3ZMUA 3LWFA 3SQNA 4Y17A 3WGIA 4M6YA 2VC1A 2XAGA 2F5CA 2HS5A 1YTYA 3ZPLA 2FA5A 2CFXA 1D8KA 1TW3A 3KP4A 1XDSA 2HOEA 3W6KB 4G7HF 2P6TA 1B59A 4EJTA 4LMYA 2KIMA 2HYFA 3JW4A 1WQ2A 3FM3A 5ERIA 4IRIA 2RGVA 4A12A 3WE3A 2G7UA 4WXCA 3G73A 2ESHA 1MZBA 2QBYB 4HLXA 3W6JB 5HOOA 3T8TA 5KVRA 3ABTA 2KIFA 2MLGA 2EA4A 1DUXC 4LLLA 5LBQA 4KICA 5BOXA 3ISPA 5L3GA 1FBQA 3MCZA 2LKPA 1HW2A 3WODF 1O3TA 1HSJA 2HQRA 1ZYRF 4AWXB 3GX4X 2VT3A 1T98A 2EA2A 4HAMA 2FF4A 5CVIA 3DQVC 4M71A 1XGSA 2FBKA 3I54A 4MHGA 4HOBA 2G7HA 4A2UA 2AXLA 2H09A 4G7ZF 5FD5A 1O3QA 4P9FA 2ISZA 2EV6A 2GQQA 2ZBKA 3F8FA 3FXUA 3IRRA 1F5TA 4QLCU 3S2WA 1HW1A 2JPBA 4EV0A 1BM9A 4ESBA 2ZNYA 2MH2A 1XN7A 4WF2A 4EJVA 1S3JA 4LLGF 4KT5C 2XUBA 1FSEA 2HTSA 2H94A 5AIQA 1ZG1A 5J8CA 4EJWA 2Q0OA 2VBWA 3ECOA 2VE9A 3F23A 1K79A 2ISYA 1G3TA 3PFIA 1LVAA 4CXFA 1IN8A 4HF0A 4YIIA 1W7PD 3P7NA 2IRFG 2COMA 3OOPA 5A2QZ 4XSXF 2RN7A 3R6SA 5HVQC 1YW9A 1W7PA 2FEZA 4IHTA 2R3SA 4EVIA 3SZPA 1IF1A 5LHIA 2QQBA 3SFZA 3KCCA 1KU7A 4R79A 5LRRA 3TDUC 1Y0UA 2DQLA 3L00A 4BHPA 1PP7U 4HLYA 2RV8A 2XKOA 1ZAOA 1J9IA 3HHGA 5FLXZ 3TO9A 4ON0A 2ADUA 4JBAA 4PGGA 4FX4A 3D5LA 4DQ2A 1OYIA 2NYXA 4UUVA 1P6RA 1ZRFA 5BPDA 2XAHA 5CVUA 2X4HA 2KIUA 1S8NA 2FBHA 3LAPA 3M7GA 2ZJ2A 1J75A 1HKTA 1H9GA 1MD0A 3ERED 2IA2A 5ILSA 4EGZA 2NS0A 4HW0A 2D1HA 3KE2A 2FMYA 2GA1A 3E5UA 1BI1A 1ZG5A 2CSOA 1P4WA 1DPUA 2OZ6A 2OAZA 3PQKA 1YW8A 3VOEA 3EYIA 1XSVA 4OIRF 2MA3A 4WXDA 3E6CC 3F21A 1O7LA 4EQQA 4EM2A 1H0MA 1SD5A 2DTRA 2ZCWA 5ICFA 1P4XA 2M1BA 4U0WA 2YR2A 4E70A 4ENMA 4CO8A 2DQRA 3EETA 1T2KA 1FLIA 2FNAA 1J0RA 5IT9Z 3JAMZ 2XAJA 2IW5A 2CQKA 1LQ1A 4KYWA 5BPIA 3BJOA 2WWYA 3R60A 3QU3A 1U8RA 3CO6C 2RKHA 3BROA 3QPTA 5FLXK 4UV9A 3GXOA 3JTGA 4ZH4F 4KN4X 4HX4A 1MDMB 2H27A 4BHBA 4EJOA 4FX0A 4RGUA 2EWNA 5HDKA 4I09A 3TOAA 1IRFA 1J7KA 2OQRA 4R1HA 1MGTA 4NHJA 3O2PE 4Q47A 1V4RA 5E1ZB 2PFBA 5K1YA 2P5KA 1O3RA 1S7OA 2ZNZA 3M9AA 3L9FA 4M74A 4WCGA 5L3BA 4B09A 2F5FA 3F3XA 3LA2A 3I64A 1Q1HA 4ZYDA 5E17F 2MC3A 3WTZA 1LEBA 4WX9A 1FYMA 1JXSA 4LB6B 3IWZA 2VBZA 3DFGA 4G94A 3CTAA 4ZYGA 1Z9CA 4HX8A 3LA7A 2KJCA 2DK5A 3QP5A 2MLKA 3PQJA 2VC0A 4OU0A 4KA4A 2F5EA 1KYZA 3DV8A 5JVTA 1KA8A 4GYIA 2H6CA 5LRSA 5HS9A 1FBSA 1EH8A 5DCFA 1HW5A 2QUFA 2VE8A 4IRHA 4EM0B 1IXSB 5BQTA 5IT9K 3VODA 4RGXA 3DPLC 4RGSA 5D6FA 4Q48A 3LA3A 3SHFA 4XRFA 4MQVA 4RS8A 2W25A 2ZFWA 3BPXA 3WTUC 4IHSA 1HKQA 1ULYA 1PP8F 3OV8A 1YYVA 4L0YB 1BI0A 4GCVA 1V3FA 3RYRA 4TV7A 3HRUA 4HDUA 5HLHA 4M9ZA 1TBXA 4I98B 5CVJA 1KQ0A 5L3FA 1G3WA 4P96A 4L9VA 4A5NA 5JI6A 4WWCA 3GF2A 3DF8A 1DPRA 4PDKA 3FMSA 1R36A 5E1XA 4BHCA 1E2XA 3ML6A 2CYYA 1DP7P 4GGGA 4KFCA 3COAC 1Z05A 2JRTA 3HHHA 4OINF 1H9TA 4K2EA 4MNUA 3T1BA 1FY7A 4IRGA 5LHGA 1OYYA 4RB1A 3IL2A 5D4RA 2JSCA 4N9IA 1B4AA 2P6SA 3QRFF 1EV7A 2D2WA 2FE3A 4NQWA 4JQFA 4ESFA 1YO5C 3K2ZA 3DPTA 1HXDA 2B0LA 3B02A 1T38A 5E18F 3LFKA 3MEXA 3RKXA 1WI9A 3I58A 4L9NA 3CUQA 3V7RA 1SAXA 4WXHA 2WTEA 3ZQ7A 2A6EF 1WKMA 5L3CA 1ZGAA 2RQPA 1ZH5A 1J2XA 1KYWA 1S6LA 2VOPA 4LG0A 2RVCA 5D4SA 4YFXF 3Q5FA 2L01A 3P9IA 1YW7A 1FSHA 3IHUA 3F22A 1RZ4A 3WTYC 3KP2A 1IN6A 5HS8A 2HWVA 1QQIA 3BWGA 3I59A 1R00A 2PLYA 1YG2A 3BOQA 2CO5A 5LEKA 1UHMA 5EEHA 4HDVA 2H6BA 4KIFA 5EEGA 5D8LB 3ELKA 6PAXA 3ZN0A 4I01A 1Z6RA 2FSWA 2QQ9A 3WTXC 2STWA 3REOA 1YFHA 4IF4A 4UHTA 3ULQB 3LAJA 2QVOA 2CGPA 1LDKB 1B1BA 2O61A 1GXQA 1BIAA 4KMUX 1ZHFA 3Q9VA 4MQ9F 4I0BA 2QZ8A 5DUKA 5TJJA 5K5OA 5F1RA 1LB2A 1FOKA 1IRGA 1JHFA 2LDUA 4I0AA 4YFNF 4U7DA 2XROA 4M9XA 3ECHA 1B9NA 3TO6A 1IUYA 3FZVA 1LNWA 5DCMA 4YFKF 3HRTA 4PZJA 2YU3A 3HIFA 2XKPA 3QU6A 4UNOA 2HKXA 2YSRA 4I7HA 3BP8A 2DK8A 2CWEA 3I53A 2F2EA 2IA1A 3JSOA 2K86A 3FHZA 3GUDA 2GAUA 2W57A 2HGCA 5ICEA 5DD8A 2V6CA 2ZMEA 2E1CA 2EV0A 2L4MA 4PCQA 3C1DA 3D0SA 4HQMA 3RDIA 1RUNA 1XGNA 2HDCA 3MQ0A 2XV4S 4G8XA 1WWXA 2DBBA 1R7JA 2LNBA 2P4WA 3V8LA 2GWRA 4NB5A 4D0PA 2W24A 3KP7A 2DI3A 3VFZA 1BOAA 3F8NA 3F8BA 4M6XA 2VODA 4RAYA 2HYGD 3U2RA 1IZ1A 2WC2A 1SFXA 1TQIA 3ZN1A 2EFPA 3MWMA 2Z33A 4G6QA 3CLOA 2HEOA 3EDPA 2XASA 3WU1B 3C3WA 4L18B 2Z99A 4ZZLA 2XAQA 2Y0MA 2PI0A 1FBUA 2E7WA 2LF8A 2PQ8A 1ZG3A 4L9JA 2YX7A 1GVJA 3I0TA 1R22A 2GZWA 5E8IA 1T6SA 2V1XA 1OR7A 3V8KA 1ZARA 2EFNA 3M8FA 3KP6A 1ON2A 2UXNA 5FFZA 3RIRA 2NNNA 2K27A 2XIGA 4N0BA 2Z5UA 1NHAA 5DEQA 1TTYA 2O8XA 2PJPA 1IXRC 2XVCA 5L3DA 3RI4A 1U2WA 2A68F 2HFHA 3DKWA 4KUMA 4MEXF 2KKOA 3IWFA 2RDPA 1UFMA 3DEUA 4OIPF 2QBYA 3E6DA 2Q8KA 1ZRDA 2EFQA 2IPQX 3HOSA 3M8EA 3KP5A 5D6EA 2G9WA 3HRSA 5FO5A 2BBYA 4OIQF 3E3VA 2M5WA 2W85A 1LDDA 5DD4A 1KQ9A 5A2QK 2PEXA 3SZTA 5DV5A 1KU2A 1CF7A 3BDDA 2DO7A 3FX3A 1F4KA 3GWZA 3WE2A 4B8XA 2JTVA 3ZMVA 4HQEA 2LF7A 2VXZA 5H6RA 2F5DA 1S7AA 1XDUA 2M45A 1W5SA 1Z91A 4A6EA 1BC7C 4G6DA 4GYGA 3WU0A 3J80Z 1CGPA 3WTTC 3K69A 1U78A 1RIOH 1MKMA 3P9KA 3KEQA 2HR3A 4UXNA 2R7FA 3CO7C 4LB5A 1FC3A 2XHKA 1XCVA 1I1GA 1O57A 1OKRA 1L3LA 4H0EA 3R4KA 5CJ9A 2NNYA 3LQQA 4HX7A 2LSOA 4CYDA 4P5OA 3CUQB 2IVMA 2A69F 4KDPA 2V9VA 1UB9A 2JZYA 1GHCA 2HKOA 3G3ZA 2IA0A 3E97A 1SD4A 3NRVA 4Y15A 3ABUA 4LFUA 4HA8A 2MBFA 3QAHA 4U0YA 4HF1A 3K1PA 3E6BA 3HTUA 4CICA 2BE5F 2J5PA 3SXYA 4GXOA 3J81Z 1F1ZA 1ON1A 3JAMK 1FX7A 4HV5A 4R8HA 2PMHA 4IJAA 2J5OA 4L5IA 2CW0F 3K1MA 3M1EA 2EK5A 1L0OC 3E5QA 4MTEA 1BI3A 3J80K 2E7XA 1LDJA 3HTSB 2A61A 3HYIA 1REPC 2VBXA 2Y48A 5F64A 1XGMA 1K7AA 4GO1A 1QNTA 3HSRA 1RUOA 2VOOA 3CUQC 1AOYA 2NAZA 1BC8C 2STTA 1XMKA 1YLFA 3GO5A 4PGHA 3MZYA 4JK1X 3EYYA 3V8JA 1TQMA 2E1NA 4CZZA 2DW4A 4BQAA 2WV0A 3KEOA 1MJAA 5CVRA 5LGUA 4G7OF 4Y13A 1FP2A 1QZZA 4YIFA 2TDXA 2DPDA 1TW2A 1LEAA 2A6HF 2M30A 1PDNC 5AONA 2A07F 4AIKA 2HTJA 3KFWX 4KN7X 1SFUA 2FQ3A 2ZO4A 1HQCA 1JHHA 2EFWA 2ZKZA 4XLNF 1PUEE 1FT9A 2DT5A 3CUOA 4KNYA 1EH6A 1SMTA 4G9YA 2ZMEB 4HBLA 5E8GA 3RTRA 3V7SA 2KRFA 2EFOA 1R1TA 3BZ6A 2UZKA 4OMZA 2V1UA 3J81K 3R61A 4A0YA 1SFEA 1OMIA 1D8JA 1FYKA 1USSA 3L09A 4ESJA 5JHUA 5CYVA 1UCRA 3JSPA 3EQLF 2Y75A 2FXAA 3ZMTA 3TDZC 1IN4A 4BH9A 3KZZA 2QYOA 2L02A 1RNLA 1W7PB 2DFIA 3TGNA 5HDNA 3JTHA 3ROUA 3WTSC 1DDNA 3MZHA 5ED4A 1U5TA 2ELHA 2XAFA 3LQRA 1R58A 2A3SA 3R0JA 2K02A 3E6MA 2CG4A 2GA2A 4S05A 5H6QA 1ZRCA 1KGSA 1I1SA 4AVPA 5DUIA 4IVNA 1XGOA 3IC7A 1GXPA 2YPRA 1YS7A 1USTA 3F6OA 3RPQA 1QBJA 3N4MA 1UHWA 1D5VA 1IXCA 3CDHA 3TQNA 1R23A 1XCBA 3QOPA 5L3EA 3VB2A 5DDGA 2D45A 1XB4A 2OU2A 2ACJA 1T0FA 2GIVA 4M9SA 1BI2A 1YIOA 2ZXJA 4L0ZB 1FZPB 4AD9A 5E20A 5IT3A 1FWZA 2HZTA 1SMYF 1BIBA 1P2FA 2P5VA 2FNPA 5CVVA 1AWCA 1I27A 3ZMSA 1HBXG 1BBYA 2VONA 2O3FA 3GZ5A 3DXJF 1KU9A 2A5YB 2YX4A 5ICGA 5D5WB 4O5VA 4LK0F 1MJ9A 3ZMDA 3GZ6A 3K1NA 2BGCA 4F7ZA 4HF2A 2M87A 1CF7B 4RGRA 2L3DA 5KK1A 3HOTA 1K78A 4O6JA 5LHHA 2O0YA 5J6XA 3F6VA 1TNSA 3GVAA 3GEZA 3R0AA 1LJ9A 1C0WA 3IRQA 3J7AO 1TLHB 5FD6A 3MAJA 3V7CA 1IAWA 1G3YA 2DPUA 1D3YA 4EM1A 3H92A 2IT0A 4ENJA 2MD5A 5DYMA 4UV8A 1IW7F 4MTDA 4RAZA 1ZLJA 4WK8F 2OBPA 2Z3YA 3KLOA 3GFMA 1FYLA 3CJNA 3RJPA 2FRHA 5TRDA 5D5VB 5LLQA 2K4JA 2PBIA 4M72A 4DNCA 4OIOF 3BJAA 3ZMZA 4CDGA 2O03A 2Z9OA 1EH7A 2C6YA 4BYYA 1YS6A 1R5HA 2P8TA 3WTWC 2IP2A 1I6XA 4AIHA 4QWQA 5ICCA 1R1VA 5HDGA 1ODDA 4HYEA 4ETSA 2QWWA 3H3ZA 4ASNA 2BYVE 2JT1A 4BNCA 1A04A 5FFXA 1HSTA 3NQOA 3EUHA 4UVCA 1F9NA 2DAOA 5JFRA 1VTNC 2RNJA 5FB2A 2FOKA 3FXQA 2IJLA 4A0XA 5ILVA 1W5TA 3BPVA 1XSXA 4LJZF 1SD6A 2UXXA 1S29A 3QP6A 2W84A 4ZYHA 3GFLA 1P4AA 3GW2A 3RPUA 5FGMA 1OPCA 1W4MA 3HUGA 3B73A 4U7BA 1QO0D 1I5ZA 3FXRA 1K6OA 3GFJA 5D5XB 3RKYA 5ILUA 2ETHA 2GXBA 5CLSA 3ZP5A 3MFKA 1XMAA 1P92A 1XSDA 2O6GE 1FP1D 3I4PA 3I71A 2OZUA 1STZA 2OQGA 2RC4A 4IXAA 2ESNA 3GFIA 5LGTA 4LLNA 3O6BB 1G3SA 1OYWA 3BJ6A 4RB2C 4KMFA 1J59A 4Q5SF 1YQAA 1Z7UA 4HV6A 5D8KB 2EV5A 1QGPA 2DLLA 4XBFA 2VT2A 4ZZDA 2BV6A 2KJBA 1Z1DA 4IPAA 3V4GA 3LSTA 4FHTA 5HLGA 3U1DA 4A6DA 4M73A 2L54A 2QLZA 3O3KA 3P9CA 1QPMA 4EMSA 1ONVA 3T5XA 4ENKA 5K5QA 1B6AA 1FPQA 4ENNA 4L5JA 3TKYA 2XRNA 1QZYA 5LEJA 3U9GA 4A0ZA 2OA4A 4I2OA 2R7DA 1JE8A 4U88A 3DP7A 4LK1F 1FNNA 2FBIA 2PG4A 1KU3A 2P5LC 4U0VA 4LG0B 5F6FA 1MJBA 2OD5A 4N9HA 1U5TB 1ZN2A 4BXUA 1JGSA 1B9MA 1ZLKA 3F72A 4UVAA 2K7LA 2DU9A 1O3SA 5LGNA 4Q4ZF 2L4AA 5K5RA 3HSFA 3TO7A 1Z6TA 3F8MA 3I59B 2UWMA 2BEOA 3FF5A 4Z2YA 3KP3A 2VBYA 4XLPF 2X0LA 4BAYA 4YG2F 3WG9A 4KIBA 3BY6A 3WGHA 1G6NA 2QM3A 3L2CA 3L7WA 1IN5A 3NEUA 2MH9A 4MEYF 4AIJA 3C18A 5BS6A 1ZGJA 3E5XA 3QPHA 3HRMA 3T8RA 1R1UA 1J5YA 3KZYA 4OOIA 2PMUA 1X3UA 4P55A 4ZYEA 1TNTA 3I5UA 2D1VA 3WTVC 1R5GA 1BN5A 2Q2EA 4LD5A 3FM5A 2HQNA 4LGWA 1E17A 3KETA 4CGZA 3AAFA 3N97A 2V1DA 1U5TC 4RB0A 1TQPA 5DCMB 4EGYA 1RI7A 3C7JA 4P9UA 4UVBA 4OMYA 2PN6A 1K78B 3WGGA 2NRAC 4RB3C 5HLIA 2XGXA 2FMLA 2V79A 1WSUA 1SD7A 2K4BA 3HSEA 2GXGA 3GYHX 3Q9SA 4CHUA 5AIPA 3RYPA 1T39A 4KIGA 1HKSA 5JR3A 3FMRA 1MDMA 2VN2A 2EJRA 3FMQA 4MGRA 5E1WA 2QENA 3IKVA 3TOBA 3FWEA 1BJAA 2M8EA 2P7CB 5HS7A 2AS5F 4XSZF 3IKTA 1KQ8A 1U3EM 4L9TA 2QQAA 5H20A 3VEPA 4O3MA 4EJUA 1IN7A 2P7VB 2FU4A 3RKWA 4I02A 4S04A 2EB7A 4A5MA 1WRJA 2JPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0L A;  5J8F A;  3T0Y A;  1U6G A;  1XD7 A;  3H3U A;  3GLX A;  4HZF A;  5BMZ A;  3F8C A;  1ZRE A;  3KLN A;  4FT8 A;  3K9T A;  1O7F A;  5D5U B;  1G4D A;  3ZMU A;  3LWF A;  3SQN A;  4Y17 A;  3WGI A;  4M6Y A;  2VC1 A;  2XAG A;  2F5C A;  2HS5 A;  1YTY A;  3ZPL A;  2FA5 A;  2CFX A;  1D8K A;  1TW3 A;  3KP4 A;  1XDS A;  2HOE A;  3W6K B;  4G7H F;  2P6T A;  1B59 A;  4EJT A;  4LMY A;  2KIM A;  2HYF A;  3JW4 A;  1WQ2 A;  3FM3 A;  5ERI A;  4IRI A;  2RGV A;  4A12 A;  3WE3 A;  2G7U A;  4WXC A;  3G73 A;  2ESH A;  1MZB A;  2QBY B;  4HLX A;  3W6J B;  5HOO A;  3T8T A;  5KVR A;  3ABT A;  2KIF A;  2MLG A;  2EA4 A;  1DUX C;  4LLL A;  5LBQ A;  4KIC A;  5BOX A;  3ISP A;  5L3G A;  1FBQ A;  3MCZ A;  2LKP A;  1HW2 A;  3WOD F;  1O3T A;  1HSJ A;  2HQR A;  1ZYR F;  4AWX B;  3GX4 X;  2VT3 A;  1T98 A;  2EA2 A;  4HAM A;  2FF4 A;  5CVI A;  3DQV C;  4M71 A;  1XGS A;  2FBK A;  3I54 A;  4MHG A;  4HOB A;  2G7H A;  4A2U A;  2AXL A;  2H09 A;  4G7Z F;  5FD5 A;  1O3Q A;  4P9F A;  2ISZ A;  2EV6 A;  2GQQ A;  2ZBK A;  3F8F A;  3FXU A;  3IRR A;  1F5T A;  4QLC U;  3S2W A;  1HW1 A;  2JPB A;  4EV0 A;  1BM9 A;  4ESB A;  2ZNY A;  2MH2 A;  1XN7 A;  4WF2 A;  4EJV A;  1S3J A;  4LLG F;  4KT5 C;  2XUB A;  1FSE A;  2HTS A;  2H94 A;  5AIQ A;  1ZG1 A;  5J8C A;  4EJW A;  2Q0O A;  2VBW A;  3ECO A;  2VE9 A;  3F23 A;  1K79 A;  2ISY A;  1G3T A;  3PFI A;  1LVA A;  4CXF A;  1IN8 A;  4HF0 A;  4YII A;  1W7P D;  3P7N A;  2IRF G;  2COM A;  3OOP A;  5A2Q Z;  4XSX F;  2RN7 A;  3R6S A;  5HVQ C;  1YW9 A;  1W7P A;  2FEZ A;  4IHT A;  2R3S A;  4EVI A;  3SZP A;  1IF1 A;  5LHI A;  2QQB A;  3SFZ A;  3KCC A;  1KU7 A;  4R79 A;  5LRR A;  3TDU C;  1Y0U A;  2DQL A;  3L00 A;  4BHP A;  1PP7 U;  4HLY A;  2RV8 A;  2XKO A;  1ZAO A;  1J9I A;  3HHG A;  5FLX Z;  3TO9 A;  4ON0 A;  2ADU A;  4JBA A;  4PGG A;  4FX4 A;  3D5L A;  4DQ2 A;  1OYI A;  2NYX A;  4UUV A;  1P6R A;  1ZRF A;  5BPD A;  2XAH A;  5CVU A;  2X4H A;  2KIU A;  1S8N A;  2FBH A;  3LAP A;  3M7G A;  2ZJ2 A;  1J75 A;  1HKT A;  1H9G A;  1MD0 A;  3ERE D;  2IA2 A;  5ILS A;  4EGZ A;  2NS0 A;  4HW0 A;  2D1H A;  3KE2 A;  2FMY A;  2GA1 A;  3E5U A;  1BI1 A;  1ZG5 A;  2CSO A;  1P4W A;  1DPU A;  2OZ6 A;  2OAZ A;  3PQK A;  1YW8 A;  3VOE A;  3EYI A;  1XSV A;  4OIR F;  2MA3 A;  4WXD A;  3E6C C;  3F21 A;  1O7L A;  4EQQ A;  4EM2 A;  1H0M A;  1SD5 A;  2DTR A;  2ZCW A;  5ICF A;  1P4X A;  2M1B A;  4U0W A;  2YR2 A;  4E70 A;  4ENM A;  4CO8 A;  2DQR A;  3EET A;  1T2K A;  1FLI A;  2FNA A;  1J0R A;  5IT9 Z;  3JAM Z;  2XAJ A;  2IW5 A;  2CQK A;  1LQ1 A;  4KYW A;  5BPI A;  3BJO A;  2WWY A;  3R60 A;  3QU3 A;  1U8R A;  3CO6 C;  2RKH A;  3BRO A;  3QPT A;  5FLX K;  4UV9 A;  3GXO A;  3JTG A;  4ZH4 F;  4KN4 X;  4HX4 A;  1MDM B;  2H27 A;  4BHB A;  4EJO A;  4FX0 A;  4RGU A;  2EWN A;  5HDK A;  4I09 A;  3TOA A;  1IRF A;  1J7K A;  2OQR A;  4R1H A;  1MGT A;  4NHJ A;  3O2P E;  4Q47 A;  1V4R A;  5E1Z B;  2PFB A;  5K1Y A;  2P5K A;  1O3R A;  1S7O A;  2ZNZ A;  3M9A A;  3L9F A;  4M74 A;  4WCG A;  5L3B A;  4B09 A;  2F5F A;  3F3X A;  3LA2 A;  3I64 A;  1Q1H A;  4ZYD A;  5E17 F;  2MC3 A;  3WTZ A;  1LEB A;  4WX9 A;  1FYM A;  1JXS A;  4LB6 B;  3IWZ A;  2VBZ A;  3DFG A;  4G94 A;  3CTA A;  4ZYG A;  1Z9C A;  4HX8 A;  3LA7 A;  2KJC A;  2DK5 A;  3QP5 A;  2MLK A;  3PQJ A;  2VC0 A;  4OU0 A;  4KA4 A;  2F5E A;  1KYZ A;  3DV8 A;  5JVT A;  1KA8 A;  4GYI A;  2H6C A;  5LRS A;  5HS9 A;  1FBS A;  1EH8 A;  5DCF A;  1HW5 A;  2QUF A;  2VE8 A;  4IRH A;  4EM0 B;  1IXS B;  5BQT A;  5IT9 K;  3VOD A;  4RGX A;  3DPL C;  4RGS A;  5D6F A;  4Q48 A;  3LA3 A;  3SHF A;  4XRF A;  4MQV A;  4RS8 A;  2W25 A;  2ZFW A;  3BPX A;  3WTU C;  4IHS A;  1HKQ A;  1ULY A;  1PP8 F;  3OV8 A;  1YYV A;  4L0Y B;  1BI0 A;  4GCV A;  1V3F A;  3RYR A;  4TV7 A;  3HRU A;  4HDU A;  5HLH A;  4M9Z A;  1TBX A;  4I98 B;  5CVJ A;  1KQ0 A;  5L3F A;  1G3W A;  4P96 A;  4L9V A;  4A5N A;  5JI6 A;  4WWC A;  3GF2 A;  3DF8 A;  1DPR A;  4PDK A;  3FMS A;  1R36 A;  5E1X A;  4BHC A;  1E2X A;  3ML6 A;  2CYY A;  1DP7 P;  4GGG A;  4KFC A;  3COA C;  1Z05 A;  2JRT A;  3HHH A;  4OIN F;  1H9T A;  4K2E A;  4MNU A;  3T1B A;  1FY7 A;  4IRG A;  5LHG A;  1OYY A;  4RB1 A;  3IL2 A;  5D4R A;  2JSC A;  4N9I A;  1B4A A;  2P6S A;  3QRF F;  1EV7 A;  2D2W A;  2FE3 A;  4NQW A;  4JQF A;  4ESF A;  1YO5 C;  3K2Z A;  3DPT A;  1HXD A;  2B0L A;  3B02 A;  1T38 A;  5E18 F;  3LFK A;  3MEX A;  3RKX A;  1WI9 A;  3I58 A;  4L9N A;  3CUQ A;  3V7R A;  1SAX A;  4WXH A;  2WTE A;  3ZQ7 A;  2A6E F;  1WKM A;  5L3C A;  1ZGA A;  2RQP A;  1ZH5 A;  1J2X A;  1KYW A;  1S6L A;  2VOP A;  4LG0 A;  2RVC A;  5D4S A;  4YFX F;  3Q5F A;  2L01 A;  3P9I A;  1YW7 A;  1FSH A;  3IHU A;  3F22 A;  1RZ4 A;  3WTY C;  3KP2 A;  1IN6 A;  5HS8 A;  2HWV A;  1QQI A;  3BWG A;  3I59 A;  1R00 A;  2PLY A;  1YG2 A;  3BOQ A;  2CO5 A;  5LEK A;  1UHM A;  5EEH A;  4HDV A;  2H6B A;  4KIF A;  5EEG A;  5D8L B;  3ELK A;  6PAX A;  3ZN0 A;  4I01 A;  1Z6R A;  2FSW A;  2QQ9 A;  3WTX C;  2STW A;  3REO A;  1YFH A;  4IF4 A;  4UHT A;  3ULQ B;  3LAJ A;  2QVO A;  2CGP A;  1LDK B;  1B1B A;  2O61 A;  1GXQ A;  1BIA A;  4KMU X;  1ZHF A;  3Q9V A;  4MQ9 F;  4I0B A;  2QZ8 A;  5DUK A;  5TJJ A;  5K5O A;  5F1R A;  1LB2 A;  1FOK A;  1IRG A;  1JHF A;  2LDU A;  4I0A A;  4YFN F;  4U7D A;  2XRO A;  4M9X A;  3ECH A;  1B9N A;  3TO6 A;  1IUY A;  3FZV A;  1LNW A;  5DCM A;  4YFK F;  3HRT A;  4PZJ A;  2YU3 A;  3HIF A;  2XKP A;  3QU6 A;  4UNO A;  2HKX A;  2YSR A;  4I7H A;  3BP8 A;  2DK8 A;  2CWE A;  3I53 A;  2F2E A;  2IA1 A;  3JSO A;  2K86 A;  3FHZ A;  3GUD A;  2GAU A;  2W57 A;  2HGC A;  5ICE A;  5DD8 A;  2V6C A;  2ZME A;  2E1C A;  2EV0 A;  2L4M A;  4PCQ A;  3C1D A;  3D0S A;  4HQM A;  3RDI A;  1RUN A;  1XGN A;  2HDC A;  3MQ0 A;  2XV4 S;  4G8X A;  1WWX A;  2DBB A;  1R7J A;  2LNB A;  2P4W A;  3V8L A;  2GWR A;  4NB5 A;  4D0P A;  2W24 A;  3KP7 A;  2DI3 A;  3VFZ A;  1BOA A;  3F8N A;  3F8B A;  4M6X A;  2VOD A;  4RAY A;  2HYG D;  3U2R A;  1IZ1 A;  2WC2 A;  1SFX A;  1TQI A;  3ZN1 A;  2EFP A;  3MWM A;  2Z33 A;  4G6Q A;  3CLO A;  2HEO A;  3EDP A;  2XAS A;  3WU1 B;  3C3W A;  4L18 B;  2Z99 A;  4ZZL A;  2XAQ A;  2Y0M A;  2PI0 A;  1FBU A;  2E7W A;  2LF8 A;  2PQ8 A;  1ZG3 A;  4L9J A;  2YX7 A;  1GVJ A;  3I0T A;  1R22 A;  2GZW A;  5E8I A;  1T6S A;  2V1X A;  1OR7 A;  3V8K A;  1ZAR A;  2EFN A;  3M8F A;  3KP6 A;  1ON2 A;  2UXN A;  5FFZ A;  3RIR A;  2NNN A;  2K27 A;  2XIG A;  4N0B A;  2Z5U A;  1NHA A;  5DEQ A;  1TTY A;  2O8X A;  2PJP A;  1IXR C;  2XVC A;  5L3D A;  3RI4 A;  1U2W A;  2A68 F;  2HFH A;  3DKW A;  4KUM A;  4MEX F;  2KKO A;  3IWF A;  2RDP A;  1UFM A;  3DEU A;  4OIP F;  2QBY A;  3E6D A;  2Q8K A;  1ZRD A;  2EFQ A;  2IPQ X;  3HOS A;  3M8E A;  3KP5 A;  5D6E A;  2G9W A;  3HRS A;  5FO5 A;  2BBY A;  4OIQ F;  3E3V A;  2M5W A;  2W85 A;  1LDD A;  5DD4 A;  1KQ9 A;  5A2Q K;  2PEX A;  3SZT A;  5DV5 A;  1KU2 A;  1CF7 A;  3BDD A;  2DO7 A;  3FX3 A;  1F4K A;  3GWZ A;  3WE2 A;  4B8X A;  2JTV A;  3ZMV A;  4HQE A;  2LF7 A;  2VXZ A;  5H6R A;  2F5D A;  1S7A A;  1XDU A;  2M45 A;  1W5S A;  1Z91 A;  4A6E A;  1BC7 C;  4G6D A;  4GYG A;  3WU0 A;  3J80 Z;  1CGP A;  3WTT C;  3K69 A;  1U78 A;  1RIO H;  1MKM A;  3P9K A;  3KEQ A;  2HR3 A;  4UXN A;  2R7F A;  3CO7 C;  4LB5 A;  1FC3 A;  2XHK A;  1XCV A;  1I1G A;  1O57 A;  1OKR A;  1L3L A;  4H0E A;  3R4K A;  5CJ9 A;  2NNY A;  3LQQ A;  4HX7 A;  2LSO A;  4CYD A;  4P5O A;  3CUQ B;  2IVM A;  2A69 F;  4KDP A;  2V9V A;  1UB9 A;  2JZY A;  1GHC A;  2HKO A;  3G3Z A;  2IA0 A;  3E97 A;  1SD4 A;  3NRV A;  4Y15 A;  3ABU A;  4LFU A;  4HA8 A;  2MBF A;  3QAH A;  4U0Y A;  4HF1 A;  3K1P A;  3E6B A;  3HTU A;  4CIC A;  2BE5 F;  2J5P A;  3SXY A;  4GXO A;  3J81 Z;  1F1Z A;  1ON1 A;  3JAM K;  1FX7 A;  4HV5 A;  4R8H A;  2PMH A;  4IJA A;  2J5O A;  4L5I A;  2CW0 F;  3K1M A;  3M1E A;  2EK5 A;  1L0O C;  3E5Q A;  4MTE A;  1BI3 A;  3J80 K;  2E7X A;  1LDJ A;  3HTS B;  2A61 A;  3HYI A;  1REP C;  2VBX A;  2Y48 A;  5F64 A;  1XGM A;  1K7A A;  4GO1 A;  1QNT A;  3HSR A;  1RUO A;  2VOO A;  3CUQ C;  1AOY A;  2NAZ A;  1BC8 C;  2STT A;  1XMK A;  1YLF A;  3GO5 A;  4PGH A;  3MZY A;  4JK1 X;  3EYY A;  3V8J A;  1TQM A;  2E1N A;  4CZZ A;  2DW4 A;  4BQA A;  2WV0 A;  3KEO A;  1MJA A;  5CVR A;  5LGU A;  4G7O F;  4Y13 A;  1FP2 A;  1QZZ A;  4YIF A;  2TDX A;  2DPD A;  1TW2 A;  1LEA A;  2A6H F;  2M30 A;  1PDN C;  5AON A;  2A07 F;  4AIK A;  2HTJ A;  3KFW X;  4KN7 X;  1SFU A;  2FQ3 A;  2ZO4 A;  1HQC A;  1JHH A;  2EFW A;  2ZKZ A;  4XLN F;  1PUE E;  1FT9 A;  2DT5 A;  3CUO A;  4KNY A;  1EH6 A;  1SMT A;  4G9Y A;  2ZME B;  4HBL A;  5E8G A;  3RTR A;  3V7S A;  2KRF A;  2EFO A;  1R1T A;  3BZ6 A;  2UZK A;  4OMZ A;  2V1U A;  3J81 K;  3R61 A;  4A0Y A;  1SFE A;  1OMI A;  1D8J A;  1FYK A;  1USS A;  3L09 A;  4ESJ A;  5JHU A;  5CYV A;  1UCR A;  3JSP A;  3EQL F;  2Y75 A;  2FXA A;  3ZMT A;  3TDZ C;  1IN4 A;  4BH9 A;  3KZZ A;  2QYO A;  2L02 A;  1RNL A;  1W7P B;  2DFI A;  3TGN A;  5HDN A;  3JTH A;  3ROU A;  3WTS C;  1DDN A;  3MZH A;  5ED4 A;  1U5T A;  2ELH A;  2XAF A;  3LQR A;  1R58 A;  2A3S A;  3R0J A;  2K02 A;  3E6M A;  2CG4 A;  2GA2 A;  4S05 A;  5H6Q A;  1ZRC A;  1KGS A;  1I1S A;  4AVP A;  5DUI A;  4IVN A;  1XGO A;  3IC7 A;  1GXP A;  2YPR A;  1YS7 A;  1UST A;  3F6O A;  3RPQ A;  1QBJ A;  3N4M A;  1UHW A;  1D5V A;  1IXC A;  3CDH A;  3TQN A;  1R23 A;  1XCB A;  3QOP A;  5L3E A;  3VB2 A;  5DDG A;  2D45 A;  1XB4 A;  2OU2 A;  2ACJ A;  1T0F A;  2GIV A;  4M9S A;  1BI2 A;  1YIO A;  2ZXJ A;  4L0Z B;  1FZP B;  4AD9 A;  5E20 A;  5IT3 A;  1FWZ A;  2HZT A;  1SMY F;  1BIB A;  1P2F A;  2P5V A;  2FNP A;  5CVV A;  1AWC A;  1I27 A;  3ZMS A;  1HBX G;  1BBY A;  2VON A;  2O3F A;  3GZ5 A;  3DXJ F;  1KU9 A;  2A5Y B;  2YX4 A;  5ICG A;  5D5W B;  4O5V A;  4LK0 F;  1MJ9 A;  3ZMD A;  3GZ6 A;  3K1N A;  2BGC A;  4F7Z A;  4HF2 A;  2M87 A;  1CF7 B;  4RGR A;  2L3D A;  5KK1 A;  3HOT A;  1K78 A;  4O6J A;  5LHH A;  2O0Y A;  5J6X A;  3F6V A;  1TNS A;  3GVA A;  3GEZ A;  3R0A A;  1LJ9 A;  1C0W A;  3IRQ A;  3J7A O;  1TLH B;  5FD6 A;  3MAJ A;  3V7C A;  1IAW A;  1G3Y A;  2DPU A;  1D3Y A;  4EM1 A;  3H92 A;  2IT0 A;  4ENJ A;  2MD5 A;  5DYM A;  4UV8 A;  1IW7 F;  4MTD A;  4RAZ A;  1ZLJ A;  4WK8 F;  2OBP A;  2Z3Y A;  3KLO A;  3GFM A;  1FYL A;  3CJN A;  3RJP A;  2FRH A;  5TRD A;  5D5V B;  5LLQ A;  2K4J A;  2PBI A;  4M72 A;  4DNC A;  4OIO F;  3BJA A;  3ZMZ A;  4CDG A;  2O03 A;  2Z9O A;  1EH7 A;  2C6Y A;  4BYY A;  1YS6 A;  1R5H A;  2P8T A;  3WTW C;  2IP2 A;  1I6X A;  4AIH A;  4QWQ A;  5ICC A;  1R1V A;  5HDG A;  1ODD A;  4HYE A;  4ETS A;  2QWW A;  3H3Z A;  4ASN A;  2BYV E;  2JT1 A;  4BNC A;  1A04 A;  5FFX A;  1HST A;  3NQO A;  3EUH A;  4UVC A;  1F9N A;  2DAO A;  5JFR A;  1VTN C;  2RNJ A;  5FB2 A;  2FOK A;  3FXQ A;  2IJL A;  4A0X A;  5ILV A;  1W5T A;  3BPV A;  1XSX A;  4LJZ F;  1SD6 A;  2UXX A;  1S29 A;  3QP6 A;  2W84 A;  4ZYH A;  3GFL A;  1P4A A;  3GW2 A;  3RPU A;  5FGM A;  1OPC A;  1W4M A;  3HUG A;  3B73 A;  4U7B A;  1QO0 D;  1I5Z A;  3FXR A;  1K6O A;  3GFJ A;  5D5X B;  3RKY A;  5ILU A;  2ETH A;  2GXB A;  5CLS A;  3ZP5 A;  3MFK A;  1XMA A;  1P92 A;  1XSD A;  2O6G E;  1FP1 D;  3I4P A;  3I71 A;  2OZU A;  1STZ A;  2OQG A;  2RC4 A;  4IXA A;  2ESN A;  3GFI A;  5LGT A;  4LLN A;  3O6B B;  1G3S A;  1OYW A;  3BJ6 A;  4RB2 C;  4KMF A;  1J59 A;  4Q5S F;  1YQA A;  1Z7U A;  4HV6 A;  5D8K B;  2EV5 A;  1QGP A;  2DLL A;  4XBF A;  2VT2 A;  4ZZD A;  2BV6 A;  2KJB A;  1Z1D A;  4IPA A;  3V4G A;  3LST A;  4FHT A;  5HLG A;  3U1D A;  4A6D A;  4M73 A;  2L54 A;  2QLZ A;  3O3K A;  3P9C A;  1QPM A;  4EMS A;  1ONV A;  3T5X A;  4ENK A;  5K5Q A;  1B6A A;  1FPQ A;  4ENN A;  4L5J A;  3TKY A;  2XRN A;  1QZY A;  5LEJ A;  3U9G A;  4A0Z A;  2OA4 A;  4I2O A;  2R7D A;  1JE8 A;  4U88 A;  3DP7 A;  4LK1 F;  1FNN A;  2FBI A;  2PG4 A;  1KU3 A;  2P5L C;  4U0V A;  4LG0 B;  5F6F A;  1MJB A;  2OD5 A;  4N9H A;  1U5T B;  1ZN2 A;  4BXU A;  1JGS A;  1B9M A;  1ZLK A;  3F72 A;  4UVA A;  2K7L A;  2DU9 A;  1O3S A;  5LGN A;  4Q4Z F;  2L4A A;  5K5R A;  3HSF A;  3TO7 A;  1Z6T A;  3F8M A;  3I59 B;  2UWM A;  2BEO A;  3FF5 A;  4Z2Y A;  3KP3 A;  2VBY A;  4XLP F;  2X0L A;  4BAY A;  4YG2 F;  3WG9 A;  4KIB A;  3BY6 A;  3WGH A;  1G6N A;  2QM3 A;  3L2C A;  3L7W A;  1IN5 A;  3NEU A;  2MH9 A;  4MEY F;  4AIJ A;  3C18 A;  5BS6 A;  1ZGJ A;  3E5X A;  3QPH A;  3HRM A;  3T8R A;  1R1U A;  1J5Y A;  3KZY A;  4OOI A;  2PMU A;  1X3U A;  4P55 A;  4ZYE A;  1TNT A;  3I5U A;  2D1V A;  3WTV C;  1R5G A;  1BN5 A;  2Q2E A;  4LD5 A;  3FM5 A;  2HQN A;  4LGW A;  1E17 A;  3KET A;  4CGZ A;  3AAF A;  3N97 A;  2V1D A;  1U5T C;  4RB0 A;  1TQP A;  5DCM B;  4EGY A;  1RI7 A;  3C7J A;  4P9U A;  4UVB A;  4OMY A;  2PN6 A;  1K78 B;  3WGG A;  2NRA C;  4RB3 C;  5HLI A;  2XGX A;  2FML A;  2V79 A;  1WSU A;  1SD7 A;  2K4B A;  3HSE A;  2GXG A;  3GYH X;  3Q9S A;  4CHU A;  5AIP A;  3RYP A;  1T39 A;  4KIG A;  1HKS A;  5JR3 A;  3FMR A;  1MDM A;  2VN2 A;  2EJR A;  3FMQ A;  4MGR A;  5E1W A;  2QEN A;  3IKV A;  3TOB A;  3FWE A;  1BJA A;  2M8E A;  2P7C B;  5HS7 A;  2AS5 F;  4XSZ F;  3IKT A;  1KQ8 A;  1U3E M;  4L9T A;  2QQA A;  5H20 A;  3VEP A;  4O3M A;  4EJU A;  1IN7 A;  2P7V B;  2FU4 A;  3RKW A;  4I02 A;  4S04 A;  2EB7 A;  4A5M A;  1WRJ A;  2JPC A; 
#chains in the Genus database with same CATH topology
 2YUS A;  3K0L A;  5J8F A;  1QA6 A;  3T0Y A;  1VQ4 I;  5DM7 F;  1U6G A;  3N05 A;  2CQX A;  3ONQ A;  1XD7 A;  3H3U A;  4JX4 A;  3GLX A;  4HZF A;  2IGK A;  5BMZ A;  3F8C A;  1ZRE A;  1DQU A;  3KLN A;  4FT8 A;  3JRG A;  3K9T A;  2HOA A;  1XTA A;  3HB9 A;  3BR1 A;  1O7F A;  4KIT B;  5D5U B;  3CJR B;  1G4D A;  2QQ8 A;  3ZMU A;  2E36 A;  3LWF A;  3OR2 C;  3SQN A;  1S72 I;  2GM4 A;  4Y17 A;  1VZ0 A;  3WGI A;  4M6Y A;  2VC1 A;  2M4G A;  1Y1V J;  2XAG A;  2F5C A;  2HS5 A;  1YTY A;  3IAM 2;  1Y39 A;  3ZPL A;  2HDD A;  4KJZ A;  3MKZ A;  2EIJ H;  2FA5 A;  2CFX A;  2KQR A;  1D8K A;  1TW3 A;  1X19 A;  5IYD J;  3KP4 A;  1XDS A;  5EJC A;  2BY1 A;  2HOE A;  2IGM A;  3W6K B;  1N77 A;  2VLA A;  1K6Y A;  4G7H F;  1ETK A;  2P6T A;  1B59 A;  1K83 J;  2IAI A;  2VJ4 A;  4RA2 A;  3JRF A;  4EJT A;  4QPQ A;  2ELJ A;  1TWF J;  3W2V A;  4DOZ A;  5HNH A;  3I55 I;  2HVR A;  4LMY A;  1SAN A;  2PMZ A;  2HOS A;  3BTC A;  2KIM A;  2LKS A;  4F3Q A;  2HYF A;  1H88 C;  3JW4 A;  4EAT A;  1WQ2 A;  3FM3 A;  5ERI A;  4IRI A;  4E7S A;  4BJ6 C;  2DOF A;  2RGV A;  4A12 A;  2R7X A;  2EZL A;  1FMW A;  3WE3 A;  1IO2 A;  2ELK A;  2G7U A;  4WXC A;  4XLF A;  3CDL A;  3G73 A;  3AKZ A;  2ESH A;  3LSP A;  4NC8 A;  1MZB A;  4RM2 A;  2QBY B;  2CW7 A;  4HLX A;  3W6J B;  5HOO A;  2DA7 A;  2VIX A;  4XKW A;  3T8T A;  2B7E A;  5KVR A;  3OS0 A;  3ABT A;  1MMG A;  1ZQ3 P;  2H1L A;  2KIF A;  3CCU I;  2MLG A;  4X6A J;  2EA4 A;  2WAQ A;  3HUG B;  3KZI C;  1DUX C;  4LLL A;  5LBQ A;  5FLV A;  3M3Y J;  4KIC A;  1X4P A;  5BOX A;  3ISP A;  1R71 A;  5B66 C;  5L3G A;  1XPX A;  1FBQ A;  1WH5 A;  2HDW A;  3HXL A;  2CUE A;  3PO3 J;  3MCZ A;  3J7Y J;  4DYC A;  2LKP A;  1HW2 A;  2XF7 A;  4MO7 A;  3WOD F;  1QRY A;  2ID6 A;  1O3T A;  1VQ5 I;  1HSJ A;  2HQR A;  1ZYR F;  2W1O A;  4AWX B;  3IAS 2;  1SAU A;  1WPK A;  5LD2 C;  3GX4 X;  2VT3 A;  4A3L J;  1OR7 C;  1T98 A;  2EA2 A;  4HAM A;  2FF4 A;  5CVI A;  2KDZ A;  1NK2 P;  3A2K A;  3DQV C;  4M71 A;  1XGS A;  2FBK A;  1AKH B;  3O8H A;  3I54 A;  4MHG A;  3CCS I;  4HOB A;  1F36 A;  2G7H A;  1MNE A;  4A2U A;  1PVE A;  2AXL A;  3TW6 A;  2H09 A;  2X1C A;  4LIU A;  4G7Z F;  5FD5 A;  3VYS B;  1O3Q A;  3EUH C;  4P9F A;  3BQY A;  3CES A;  2ISZ A;  2EV6 A;  2GQQ A;  2ZBK A;  3F8F A;  2AQF A;  1DU6 A;  3FXU A;  2WY8 Q;  3WHB A;  3AL0 B;  4U87 A;  2IS2 A;  3IRR A;  4A3K J;  3FXL A;  5LFA A;  1F5T A;  2X51 A;  4BE2 A;  4QLC U;  3S2W A;  1HW1 A;  1A6Q A;  2JPB A;  4PJM A;  2ZC2 A;  4EV0 A;  2CUZ A;  1BM9 A;  1FMV A;  1YI2 I;  4ESB A;  2DYR H;  2ZNY A;  1D1A A;  2MH2 A;  1XN7 A;  4WF2 A;  4EJV A;  4ZTJ A;  1S3J A;  4LLG F;  4KT5 C;  4XM3 A;  2XUB A;  3VYR B;  1FSE A;  3HL2 A;  2HTS A;  1B72 B;  2H94 A;  5J40 A;  5AIQ A;  1RRJ A;  1ZG1 A;  3FXO A;  3D5R C;  5J8C A;  4EJW A;  2Q0O A;  2VBW A;  1X1C A;  1W36 D;  1GDT A;  4HPQ A;  2L9R A;  3ECO A;  3IH2 A;  4UUT A;  3ZQI A;  3F23 A;  2VE9 A;  1K79 A;  2WB1 A;  2DMN A;  2ISY A;  2TRT A;  1G3T A;  3PFI A;  1LVA A;  2M9H A;  4CXF A;  1IN8 A;  4HF0 A;  4YII A;  1W7P D;  4BJ5 C;  3OIP A;  1NK3 P;  1T56 A;  3P7N A;  5IP6 A;  2M3A A;  2COM A;  3OOP A;  5A2Q Z;  2IRF G;  3QQA A;  1ZGW A;  4XSX F;  5K7Z A;  2RN7 A;  3R6S A;  3AG3 H;  5HVQ C;  1YW9 A;  1W7P A;  3PUB A;  2FEZ A;  1JGG A;  4IHT A;  2MSY A;  3J7A Y;  2R3S A;  4EVI A;  4HRI A;  4RLF A;  4YEJ A;  3SZP A;  3HBL A;  1IF1 A;  1X1D A;  1TWH J;  5LHI A;  2QQB A;  3SFZ A;  3KCC A;  2VPR A;  3LSJ A;  3JRC A;  4R79 A;  1KU7 A;  1CQT A;  5LRR A;  3TDU C;  4C3H J;  1K4S A;  1RKT A;  3OR1 C;  4B3A A;  1Y0U A;  2DQL A;  3L00 A;  4BHP A;  1AA7 A;  2FD5 A;  2EH3 A;  1PP7 U;  3I56 I;  3HDD A;  4HLY A;  2RV8 A;  3QYB A;  2XKO A;  1ZAO A;  1BL0 A;  1J9I A;  3JRB A;  3HHG A;  5FLX Z;  3TO9 A;  4ON0 A;  3S1Q J;  3AL0 C;  3RKQ A;  2E2I J;  2MGQ A;  4RMN A;  1PYV A;  2ADU A;  4JBA A;  2R7Z J;  2CQQ A;  4PGG A;  4FX4 A;  3D5L A;  4DQ2 A;  4BE0 A;  1OYI A;  2NYX A;  3SZG A;  4UUV A;  1P6R A;  1ZRF A;  1LE8 B;  5BPD A;  2XAH A;  1W0U A;  5CVU A;  1U8B A;  1N75 A;  2X4H A;  1W1W E;  2KIU A;  3DTE A;  1S8N A;  5C44 J;  3G6E I;  3S3M A;  2XPV A;  3FDY A;  2FBH A;  3LAP A;  2HU9 A;  3M7G A;  4W97 A;  2ZJ2 A;  4XLE A;  2QGU A;  3BR0 A;  3ZR8 X;  1J75 A;  1HKT A;  1H9G A;  1MD0 A;  2KL4 A;  3LSR A;  3ERE D;  1FTZ A;  2IA2 A;  3B6A A;  1UJ8 A;  5ILS A;  4XLH A;  1VQM I;  2JRM A;  4XKC A;  2QKM B;  4BY7 J;  1IUF A;  4EGZ A;  3GTM J;  2NVQ J;  2BVL A;  2NS0 A;  1X1B A;  2CFO A;  2LY9 A;  2D1H A;  2E5Z A;  4HW0 A;  3KE2 A;  4CA0 A;  5K7F A;  3S1N J;  2HPM A;  2FMY A;  2GA1 A;  5TIS C;  3E5U A;  1BI1 A;  4JP0 A;  5J1R A;  1ZG5 A;  2CSO A;  1P4W A;  5GAD J;  1DPU A;  4BKX A;  2OZ6 A;  2OAZ A;  5KHD A;  3PQK A;  1YW8 A;  3VOE A;  3HOY J;  4A93 J;  2O7O A;  1ETQ A;  3EYI A;  2EBI A;  3E7L A;  3L2W A;  2E1M B;  2EPF A;  4CCN A;  1XSV A;  2DMQ A;  4OIR F;  5F0C A;  2MA3 A;  4ITV A;  4WXD A;  1LFU P;  3E6C C;  2WAE A;  3F21 A;  1O7L A;  1R4N B;  2HQA A;  2Z16 A;  3CC4 I;  4BL0 B;  2D5V A;  1Y8Q B;  4AYB A;  4EQQ A;  4EM2 A;  1H0M A;  1SD5 A;  2DTR A;  2ZCW A;  5ICF A;  1ACI A;  2JA6 J;  1I3A A;  1P4X A;  2M1B A;  2DFF A;  3ZCO A;  4U0W A;  2YR2 A;  4E70 A;  4ENM A;  4A3M J;  1QU3 A;  4CO8 A;  2E34 A;  3K4J A;  3HKZ N;  2DQR A;  3EET A;  4J00 A;  1T8I A;  4ZDL A;  1QVU A;  1T2K A;  2E1O A;  3DCF A;  2XF5 A;  2NS8 A;  3IH4 A;  3K10 A;  1FLI A;  2FNA A;  2HVQ A;  1J0R A;  4YRV A;  2XAJ A;  3JAM Z;  2IW5 A;  5IT9 Z;  2HI3 A;  2V4J C;  2CQK A;  1LQ1 A;  4KYW A;  3CJT B;  2AXT C;  5BPI A;  3BJO A;  2QCO A;  3K4L A;  2WWY A;  4J19 A;  1T95 A;  3R60 A;  1E17 A;  3QU3 A;  1IDZ A;  1U8R A;  3CO6 C;  1O4X A;  1FOY A;  3PSF A;  4IQJ A;  2NS7 A;  3BRO A;  2X6O A;  2K40 A;  2RKH A;  3FBI B;  3QPT A;  5FLX K;  4UV9 A;  3GXO A;  3JTG A;  4ZH4 F;  1VQO I;  1Z7L A;  2E5N A;  4KN4 X;  4HX4 A;  3TMO A;  1MDM B;  4AVZ A;  1IRZ A;  2ZSI B;  3OYK A;  2H27 A;  5J3L A;  3MVP A;  4MIM A;  4BHB A;  3HG9 A;  4EJO A;  4IO9 F;  2YS9 A;  4FX0 A;  4RGU A;  2EWN A;  5HDK A;  4I09 A;  3TOA A;  4XNF A;  1IRF A;  2B63 J;  1VQN I;  1J7K A;  2OQR A;  4R1H A;  4HSR A;  3HM5 A;  2OCE A;  3BG7 A;  1MGT A;  4NHJ A;  3O2P E;  3BQZ A;  4GRI A;  4Q47 A;  1V4R A;  5E1Z B;  2PFB A;  5K1Y A;  2P5K A;  3H0D A;  1O3R A;  1S7O A;  2ZNZ A;  1LUJ B;  3M9A A;  2DA1 A;  2Y9Y A;  3L9F A;  4M74 A;  4D5C A;  2L7M P;  1YRN A;  4WCG A;  5L3B A;  2FOW A;  4B09 A;  2M7B A;  2X9D A;  4I6Z A;  2F5F A;  3F3X A;  1BR4 A;  2F5V A;  3LA2 A;  3HOX J;  3I64 A;  3OYI A;  3S14 J;  3KYD B;  3CCL I;  2OUM A;  1MBK A;  1Q1H A;  4ZYD A;  5E17 F;  5GTH C;  4C2M J;  2FJ1 A;  1VQL I;  1U0J A;  2PJR A;  2MC3 A;  3G4S I;  3WTZ A;  1MSF C;  3MKY B;  1LEB A;  4WX9 A;  3V42 A;  1FYM A;  1JXS A;  3A4C A;  1HDP A;  4LB6 B;  2VL8 A;  3IWZ A;  2VBZ A;  2BW3 A;  3AFH A;  3DFG A;  4G94 A;  3CTA A;  4KIS A;  4XOP A;  4ZYG A;  1Z9C A;  1I3Q J;  4C2T A;  3K4K A;  4HX8 A;  4FTH A;  3LA7 A;  2KJC A;  4CCJ A;  4BQO A;  2M34 A;  3BC8 A;  2DK5 A;  2HQ5 A;  3QP5 A;  2W82 A;  5JVG F;  2MLK A;  2VQH A;  1BJZ A;  2K9S A;  2KDO A;  1H89 C;  1V5F A;  2KRC A;  1XC5 A;  3PQJ A;  1OCT C;  3NAR A;  2VC0 A;  5J4V A;  5FKN A;  4OU0 A;  2HNH A;  4KA4 A;  5TGT A;  3CQZ J;  4BXF A;  1U9O A;  2F5E A;  1KYZ A;  1X1A A;  3DV8 A;  1R49 A;  4LOC A;  3BG6 A;  5JVT A;  1KA8 A;  1FOW A;  3DEE A;  4GYI A;  2H6C A;  5LRS A;  5HS9 A;  1FBS A;  1EH8 A;  5DCF A;  1HW5 A;  2QUF A;  2VE8 A;  1ITY A;  4IRH A;  4EM0 B;  1IXS B;  5BQT A;  3VSK A;  2F4O B;  5IT9 K;  3VOD A;  4RGX A;  2PMZ N;  4XL9 A;  3DPL C;  3I3L A;  4RGS A;  5D6F A;  4A3B J;  4Q48 A;  1JKO C;  3LA3 A;  3SHF A;  4XRF A;  2CV2 A;  4MQV A;  1A6I A;  2X6W A;  4GDF A;  4XR6 A;  2OTJ I;  1Y56 A;  3B6C A;  1F43 A;  3OS2 A;  4RS8 A;  1BR2 A;  4DYQ A;  3LSG A;  4N4N B;  4PSX A;  4V2F A;  2W25 A;  1MND A;  3HC7 A;  2ZFW A;  1H8A C;  3BPX A;  1TP4 A;  1WJE A;  3FXJ A;  3WTU C;  4IHS A;  1FIA A;  2CU7 A;  2DOE A;  1LPQ A;  1HKQ A;  1ULY A;  2R5Y A;  1PP8 F;  3OV8 A;  2WAQ N;  2VUM J;  1YYV A;  4XLC A;  4L0Y B;  1BI0 A;  4GCV A;  1V3F A;  3RYR A;  2BVM A;  2HXI A;  3HRU A;  3K4M A;  4TV7 A;  4ABZ A;  5HLH A;  4M9Z A;  4JOM A;  4HDU A;  1TBX A;  2HOT A;  3GTG J;  4I98 B;  2L9S A;  5CVJ A;  3K4N A;  1KQ0 A;  3JRD A;  5L3F A;  5GPC A;  1G3W A;  4P96 A;  4L9V A;  4A5N A;  2VQL A;  3GTO J;  2ME6 A;  1OQY A;  5JI6 A;  2LBF B;  3DTI A;  4WWC A;  4QSH A;  3LOC A;  3FIW A;  2O5R A;  3GF2 A;  3DF8 A;  1DPR A;  4PDK A;  3FMS A;  4ZC3 A;  1R36 A;  3GBG A;  5E1X A;  4BHC A;  1E2X A;  4QTR A;  1TWG J;  3ML6 A;  2CYY A;  4E6K G;  1DP7 P;  4HST A;  2Y31 A;  4GGG A;  4KFC A;  1OCZ H;  3COA C;  2NVX J;  4OAZ A;  1VFC A;  1Z05 A;  2XGD A;  1T0F C;  2JRT A;  2M8G X;  3HHH A;  5FKL A;  4E4H A;  4OIN F;  1H9T A;  3E0J B;  1RR7 A;  4K2E A;  4MNU A;  3T1B A;  3CP2 A;  2XB5 A;  1YE9 A;  5IY5 H;  3G1L A;  3X2Q H;  1PUF B;  1FY7 A;  2K85 A;  3DKY A;  2X48 A;  4IRG A;  5LHG A;  3HGG A;  2ZJR F;  3IUO A;  1OYY A;  4RB1 A;  5KCM A;  3IL2 A;  1WFX A;  3JRH A;  1S5L C;  5D4R A;  2JSC A;  4Y3O A;  4N9I A;  1B4A A;  4CYC A;  2P6S A;  3QRF F;  2M4K A;  1EV7 A;  3QYE A;  1YJW I;  1QPI A;  4D7M A;  2D2W A;  1A35 A;  1WZ2 A;  2W48 A;  1A36 A;  3S2D J;  4JX6 A;  2JN6 A;  4ZYA A;  1R5I D;  2FE3 A;  4NQW A;  3BR2 A;  4JQF A;  4ESF A;  3O8G A;  1YO5 C;  1P7J A;  1MNM C;  3K2Z A;  3DPT A;  1HXD A;  3HGY A;  2R92 J;  2B0L A;  2Z1D A;  3B02 A;  3EUA A;  1T38 A;  5E18 F;  3LFK A;  2WAD A;  1EKE A;  5E3O A;  3LSM A;  3MEX A;  2WB1 N;  3KX2 A;  5E3N A;  3RKX A;  3RZO J;  2E71 A;  1WI9 A;  3FKI J;  3I58 A;  4L9N A;  5B1A H;  3CUQ A;  3V7R A;  2R7R A;  4WXH A;  1P9Q C;  1SAX A;  2WTE A;  3TBI A;  3ZQ7 A;  2A6E F;  3JRA A;  1WKM A;  1Z3Y A;  4DBR A;  5L3C A;  5M5W J;  1ZGA A;  3GTQ J;  2RQP A;  2LMD A;  1ZH5 A;  1UMQ A;  1J2X A;  1KYW A;  4A3J J;  1BW5 A;  2VQC A;  1S6L A;  2VOP A;  2A5W A;  3S1M J;  4LG0 A;  2RVC A;  5F1J A;  5D4S A;  1D1C A;  2VKE A;  4YFX F;  3MD2 A;  1E0E A;  2H8R A;  1Z67 A;  3Q5F A;  2LTP A;  2L01 A;  2KPM A;  3CJQ B;  1B8I A;  1RKW A;  3GME A;  3P9I A;  1YW7 A;  3HOZ J;  5M5Y J;  1FSH A;  2L0K A;  3IHU A;  3OIQ A;  4B47 A;  3SDG A;  3OYB A;  3F22 A;  1RZ4 A;  3WTY C;  3RSN A;  4RLQ A;  3A0H C;  1UZC A;  4M3B A;  3KP2 A;  1IN6 A;  5HS8 A;  2HWV A;  1QQI A;  2VKD A;  3BWG A;  3A02 A;  3I59 A;  3DEW A;  4CCM A;  1R00 A;  2LG4 A;  2PLY A;  1YG2 A;  3BOQ A;  2CO5 A;  5LEK A;  1HOM A;  1UHM A;  3H9G A;  5EEH A;  4HDV A;  2H6B A;  4KIF A;  1YHQ I;  2CH0 A;  5EEG A;  3CC2 I;  1JTX A;  5D8L B;  3ELK A;  6PAX A;  3ZN0 A;  4I01 A;  3AG4 H;  4A3D J;  1Z6R A;  2FSW A;  2QQ9 A;  3WTX C;  5DS9 A;  2STW A;  1X58 A;  3REO A;  3OYH A;  1YFH A;  2DN0 A;  1ZK8 A;  2Y2Z A;  4IF4 A;  2KFD A;  4UHT A;  4C30 A;  1YIJ I;  3ULQ B;  2DA6 A;  3LAJ A;  3DKX A;  2QVO A;  2CGP A;  1LFB A;  2JA8 J;  3VSL A;  1LDK B;  3TP0 A;  1B1B A;  2XF6 A;  2O61 A;  1GXQ A;  5E3M A;  1BIA A;  4KMU X;  4HNT A;  2QKL B;  1ZHF A;  3Q9V A;  5CKT A;  2ICW G;  1WVR A;  4DZP A;  5H2F C;  4XRM A;  4MQ9 F;  4AUX A;  2F4I A;  4I0B A;  3GTJ J;  2QZ8 A;  5DUK A;  5TJJ A;  5K5O A;  5F1R A;  1LB2 A;  3HZJ A;  1HF0 A;  3NWT A;  1FOK A;  3RCO A;  3L2V A;  1IRG A;  3JCU C;  2DDA A;  1YX5 A;  4IHY A;  2IS1 A;  1VQ6 I;  3BZC A;  1JHF A;  1R9T J;  2LDU A;  4I0A A;  4YFN F;  2L7Z A;  4U7D A;  3OSG A;  2XRO A;  4UUS B;  4M9X A;  3ECH A;  1JKP C;  1B9N A;  2M0C A;  3TO6 A;  3CMA I;  1IUY A;  4L5E A;  3LMM A;  3FZV A;  1LNW A;  5DCM A;  3OS1 A;  4AYB N;  4YFK F;  1RR8 C;  3FK6 A;  4B44 A;  2HPI A;  1UG2 A;  3HRT A;  2ZSH B;  4PZJ A;  5E79 C;  2YU3 A;  2VKH A;  2ZB9 A;  2ZXW H;  3HIF A;  2XKP A;  3QU6 A;  1N25 A;  4UNO A;  2HKX A;  2YSR A;  4I7H A;  3BP8 A;  3BG3 A;  2DK8 A;  1FJL A;  2CWE A;  3I53 A;  2F2E A;  2IA1 A;  3H5A A;  2K86 A;  3JSO A;  3ZQC A;  3FHZ A;  3GUD A;  2GAU A;  1EA3 A;  2W57 A;  1MMD A;  2DA3 A;  5FJ8 J;  2HGC A;  5ICE A;  5DD8 A;  2V6C A;  2ZME A;  1VQ7 I;  5FKK A;  2E1C A;  2EV0 A;  2LP0 A;  2DDB A;  2L4M A;  4PCQ A;  1ETY A;  2DA4 A;  5JLX A;  3C1D A;  3D0S A;  2VXD A;  2LY2 A;  2MYS A;  4FCY A;  4HQM A;  3RDI A;  3U21 A;  1RUN A;  3DBH B;  3TED A;  1XGN A;  2BZT A;  1MH4 A;  2ZJQ F;  2HDC A;  3MQ0 A;  2XV4 S;  4QIW N;  2WV1 A;  4G8X A;  2EIL H;  3S32 A;  4E7K A;  4ZJZ A;  1WWX A;  2DBB A;  4IEJ A;  1R7J A;  3FXK A;  2LNB A;  2P4W A;  2JUG A;  3V8L A;  1RES A;  2GWR A;  1DGR M;  2GXA A;  4NB5 A;  4D0P A;  2W24 A;  1A31 A;  1KZH A;  1YJ9 I;  3OYL A;  2GLO A;  5CQG A;  3KP7 A;  4N4O B;  4BJT A;  3BR6 A;  2DI3 A;  3VDX A;  2V26 A;  3VFZ A;  1IG7 A;  1BOA A;  2ME0 A;  3F8N A;  3F8B A;  4M6X A;  2VOD A;  4RAY A;  2HYG D;  3U2R A;  1IZ1 A;  3OOU A;  3BG9 A;  2WC2 A;  4RDU A;  1SFX A;  1VQ9 I;  4BY1 J;  1TQI A;  3ZN1 A;  2EFP A;  4PJJ A;  3MWM A;  1V55 H;  2DOD A;  2DMT A;  4M6V A;  2Z33 A;  4G6Q A;  4BBR J;  1IV6 A;  3CLO A;  2HEO A;  3EDP A;  2XAS A;  2XRL A;  3WU1 B;  2CW8 A;  3HEF A;  4XKV A;  4C3I J;  3ASO H;  3C3W A;  4OAY A;  3SDB A;  3ASN H;  3ZOB A;  4B43 A;  5GAE J;  5KAI C;  4L18 B;  1X1P A;  1T33 A;  2Z99 A;  1ETV A;  1VF9 A;  2XAQ A;  2Y0M A;  4ZZL A;  2PI0 A;  1Z0X A;  5EG0 A;  4JX5 A;  2AQE A;  1FBU A;  3VYT B;  3ABM H;  1KON A;  2E7W A;  2LF8 A;  1X3W B;  1MW7 A;  2I8D A;  3SYT A;  2PQ8 A;  5E3L A;  2BW3 B;  1ZG3 A;  4L9J A;  2YX7 A;  5FKM A;  1GVJ A;  3I0T A;  1R22 A;  1SEU A;  4C9Y A;  2R7W A;  1I50 J;  2BY2 A;  2GZW A;  3H5N A;  5E8I A;  1T6S A;  2V1X A;  1OR7 A;  5IOZ A;  1JKQ C;  3V8K A;  3ZRG A;  2JA5 J;  2MW8 A;  3BTL A;  4BXX J;  1ZAR A;  2EFN A;  3M8F A;  3KP6 A;  1LKX A;  1ON2 A;  2UXN A;  5FFZ A;  3RIR A;  2NNN A;  4E7J A;  2X6X A;  1MMN A;  4FE4 A;  2K27 A;  2XIG A;  4N0B A;  4PJ0 C;  2Z5U A;  2DJN A;  2LY1 A;  5GAH J;  1WJD A;  1NHA A;  4HG2 A;  5DEQ A;  1TTY A;  2O8X A;  2PJP A;  5F27 A;  1IXR C;  1TWA J;  1WJF A;  4Z6Y A;  2XVC A;  5HLT A;  1MIJ A;  5L3D A;  3RI4 A;  1SVO A;  1U2W A;  2A68 F;  3ZXS A;  2HFH A;  3DKW A;  3BTJ A;  2HVS A;  3QWL A;  3PNY A;  4KUM A;  4DYR A;  4MEX F;  1S7E A;  2KKO A;  3G1M A;  3IWF A;  2RDP A;  1UFM A;  1ZTR A;  3DEU A;  4OIP F;  1BA5 A;  2QBY A;  3FHN A;  4IHX A;  3E6D A;  2Q8K A;  1ZRD A;  2EFQ A;  2IPQ X;  3HOS A;  3M8E A;  3DU5 A;  3KP5 A;  5D6E A;  3I4N J;  3W2W A;  5F04 A;  4C2U A;  2F48 A;  1S9H A;  2W7N A;  2LH9 A;  2LFB A;  3GCM A;  3OSF A;  4CZC A;  2OF7 A;  2G9W A;  4DIQ A;  3HRS A;  4G12 A;  5FO5 A;  2AHQ A;  2BBY A;  4OIQ F;  3E3V A;  5DTD A;  2E35 A;  4YEL A;  2DFH A;  2R5Y B;  2JJ7 A;  2M5W A;  2DYS H;  1OCR H;  2W85 A;  1NG7 A;  2Q2E B;  1LDD A;  1OCO H;  5DD4 A;  3CCR I;  1KQ9 A;  2EIM H;  2EIN H;  2PEX A;  3SZT A;  5A2Q K;  4BEH B;  5DV5 A;  1KU2 A;  1CF7 A;  3BDD A;  2DO7 A;  5BNG A;  3FX3 A;  3OMY A;  1F4K A;  3CZ6 A;  2VI6 A;  3OYM A;  3OYD A;  2B9S A;  3GWZ A;  3WE2 A;  4B8X A;  3CCV I;  2P0W A;  1XS9 A;  2JTV A;  2MAB A;  5EGO B;  3ZMV A;  3Q0U A;  4HQE A;  2K3F A;  2K9Q A;  2CUF A;  3TL4 X;  2EZH A;  2LF7 A;  2VXZ A;  1AKH A;  5H6R A;  2F5D A;  1S7A A;  2ID3 A;  2MFZ A;  1XDU A;  2M45 A;  1W5S A;  1Z3X A;  1Z91 A;  3H36 A;  4V19 K;  4A6E A;  2KMU A;  3BCA A;  3BCB A;  1BC7 C;  4G6D A;  1BOB A;  4GYG A;  1T08 B;  4PUS A;  3WU0 A;  4XIC A;  4A3I J;  1HA8 A;  3J80 Z;  3PSI A;  1ENH A;  3H9Q A;  4V2G A;  1CGP A;  1HLV A;  1MBJ A;  3PL8 A;  3K69 A;  3WTT C;  3A01 A;  1U78 A;  1RIO H;  1MKM A;  1GT0 C;  3P9K A;  2RQQ A;  5M3M J;  1BW6 A;  3FIS A;  3UR3 C;  3KEQ A;  3K70 C;  2HR3 A;  5J47 A;  4UXN A;  1QHH D;  2R7F A;  2V9K A;  3AG2 H;  3CO7 C;  2E2J J;  4LB5 A;  3A03 A;  4F93 B;  1FC3 A;  1B72 A;  2XHK A;  2E1M C;  1JJ8 C;  1XCV A;  3GTK J;  2UV1 A;  3S3O A;  1I1G A;  1O57 A;  1OKR A;  1IC8 A;  4XRS A;  1IDY A;  1L3L A;  4CCO A;  4H0E A;  4HNU A;  3OL3 A;  3R4K A;  4LIV A;  5CJ9 A;  2NNY A;  1DP3 A;  3LQQ A;  4NUB A;  3M1C A;  4HX7 A;  3BZK A;  4E7I A;  2LSO A;  2XPW A;  2GOX B;  4CYD A;  4P5O A;  2R7V A;  3CUQ B;  3C2H A;  2EZK A;  2A69 F;  2IVM A;  4KDP A;  1JUS A;  2RNG A;  2V9V A;  1UB9 A;  2JZY A;  1GHC A;  2HKO A;  3G3Z A;  2FQ4 A;  4BBS J;  2IA0 A;  2LLK A;  3E97 A;  1SD4 A;  5B5E C;  3NRV A;  3CCQ I;  1IJW C;  4Y15 A;  3ABU A;  4LFU A;  3PO2 J;  4HA8 A;  2MBF A;  3QAH A;  2R0Q C;  2CUJ A;  4U0Y A;  4PK4 A;  3FXM A;  4HF1 A;  2LYC A;  4MFD A;  3DPU A;  3MZ8 A;  3CCJ I;  5HNF A;  1ETO A;  3K1P A;  4XKB A;  3ESW B;  4IHV A;  3E6B A;  3HTU A;  4CIC A;  2ZJP F;  2EZI A;  2JSP A;  2BE5 F;  4II2 A;  2TCT A;  2J5P A;  3SXY A;  4YIR X;  1ETX A;  3Q0W A;  3J7Z I;  4GXO A;  3J81 Z;  2VJ5 A;  1F1Z A;  3L2R A;  1ON1 A;  5JHF A;  1XX5 A;  1LVK A;  3JAM K;  1FX7 A;  3D1N I;  3F9K A;  4HV5 A;  3DBL B;  5FRO A;  4R8H A;  1D0Y A;  2PMH A;  1OCC H;  4IJA A;  2XPU A;  4CCK A;  2JA7 J;  2J5O A;  4FQG A;  1ORK A;  2CW0 F;  2BXZ A;  3Q0V A;  3K1M A;  4L5I A;  3DU6 A;  5F0H A;  3M1E A;  1GUU A;  2EK5 A;  1L0O C;  3E5Q A;  4MTE A;  1BI3 A;  3CDI A;  3DBR B;  2R7Q A;  2F6C A;  3J80 K;  2E7X A;  1LDJ A;  3OYG A;  3HTS B;  2M2E A;  2A61 A;  3HYI A;  2R7U A;  2JK3 A;  2BOL A;  1REP C;  5EF6 A;  2VBX A;  2Y48 A;  5F64 A;  1WI3 A;  1XGM A;  1K7A A;  5J1U A;  4GO1 A;  1QNT A;  3HSR A;  4A3F J;  1RUO A;  4DJA A;  1ZR4 A;  2VOO A;  2GBY A;  3CUQ C;  3ABL H;  1AOY A;  2NAZ A;  1BC8 C;  3W2A A;  2JMW A;  2STT A;  1XMK A;  1YLF A;  3GO5 A;  3MKW B;  3CCY A;  3S8P A;  3S17 J;  5IYB J;  4B48 A;  4PGH A;  2OJE D;  3MZY A;  4JK1 X;  4M3G A;  5IPA A;  1R4M B;  3ERM A;  2JUC A;  4XQF A;  2XSJ C;  3EYY A;  3V8J A;  1E3O C;  1TQM A;  2E1N A;  2QEX I;  2QF7 A;  4CCL A;  3SEZ A;  3LNQ A;  4CZZ A;  3M07 A;  2DW4 A;  2JVH A;  4BQA A;  2WV0 A;  3KEO A;  1MJA A;  5CVR A;  5LGU A;  1FEX A;  4G7O F;  4Y13 A;  1FP2 A;  3LL7 A;  4E7L A;  3SFI A;  3OWT A;  3S3N A;  5GP9 A;  1QZZ A;  3U1K A;  4YIF A;  3CF5 F;  2DT6 A;  2TDX A;  4UB6 C;  2DPD A;  1TW2 A;  1LEA A;  2A6H F;  2M30 A;  3OYJ A;  1PDN C;  5AON A;  1WJC A;  2A07 F;  3LFU A;  2KRH A;  4AIK A;  2HTJ A;  3KFW X;  4KN7 X;  1SFU A;  2FQ3 A;  2ZO4 A;  4XN0 A;  2HYJ A;  4BQQ A;  1HQC A;  2WAF A;  1JHH A;  3TW7 A;  2EFW A;  1Y8R B;  5CQE A;  3EUK L;  1SC7 A;  2DMP A;  2ZKZ A;  4XLN F;  4RBO A;  5C3E J;  1PUE E;  1WJA A;  4X0G A;  3A0B C;  1FT9 A;  2R5Z A;  2DT5 A;  3CUO A;  3IV5 A;  4KNY A;  4II3 A;  1HC8 A;  1EH6 A;  1SMT A;  4G9Y A;  3WHC A;  1TZL A;  5IYC J;  3L1P A;  2ZME B;  4HBL A;  2COB A;  3H35 A;  5E8G A;  3RTR A;  3V7S A;  3OYN A;  1X4O A;  2KRF A;  1SFO J;  2EFO A;  1Z77 A;  1R1T A;  2L5Q A;  3BZ6 A;  2UZK A;  4OMZ A;  2V1U A;  2YU9 J;  1M1E B;  3J81 K;  1JTY A;  1WGX A;  2IGO A;  3R61 A;  4A0Y A;  1SFE A;  2RAE A;  1OMI A;  1K4T A;  5EZH A;  1D8J A;  1FYK A;  2WY7 Q;  2FX0 A;  1USS A;  3L09 A;  4LIT A;  4ESJ A;  3I9V 2;  5CPR B;  5JHU A;  5CYV A;  3L2Q A;  1UCR A;  3H5R A;  3JSP A;  3S16 J;  3EQL F;  3G2B A;  2Y75 A;  3HOV J;  2H8W A;  1GVD A;  2FXA A;  3WG7 H;  1GLN A;  2KHM A;  4NC7 A;  3ZMT A;  3TDZ C;  2KP6 A;  1IN4 A;  1IGN A;  1I39 A;  4BUP A;  4BH9 A;  1W5C C;  5J1Y A;  2Y30 A;  2NVT J;  4I76 A;  3KZZ A;  2QYO A;  2L2O A;  3TP3 A;  2L02 A;  2BXY A;  4AU7 A;  4D9J A;  1RNL A;  1MMA A;  2G0E A;  1W7P B;  2DFI A;  2IBD A;  3TGN A;  1FTT A;  1YJN I;  5M3F J;  2L9N A;  5J4Y A;  5HOD A;  2V1N A;  5HDN A;  3JTH A;  1VI0 A;  1Y6I A;  4D5F A;  4QPO A;  3ROU A;  3CC7 I;  3WTS C;  1DDN A;  2JQ7 A;  3ZQG A;  3MZH A;  2KIQ A;  4A69 C;  5ED4 A;  1U5T A;  1XMX A;  2ELH A;  2XAF A;  3LQR A;  2IS4 A;  1OCP A;  4Y52 J;  1R58 A;  1JJ6 C;  2A3S A;  3R0J A;  2K02 A;  3E6M A;  2CG4 A;  2GA2 A;  4S05 A;  5EG0 B;  5H6Q A;  1ZRC A;  3BR5 A;  1KGS A;  1E3P A;  1I1S A;  4AVP A;  5DUI A;  4IVN A;  2Y9Z A;  1XGO A;  2ZME C;  3IC7 A;  3BG5 A;  1GXP A;  2CRG A;  1ZR2 A;  2R7S A;  1RC9 A;  4BS9 A;  2YPR A;  1YS7 A;  3CLQ A;  1UST A;  3F6O A;  4BE1 A;  3RPQ A;  1QBJ A;  3N4M A;  1UHW A;  1D5V A;  1IXC A;  3CDH A;  3TQN A;  3GTL J;  1R23 A;  1XCB A;  3GZN B;  3QOP A;  5L3E A;  3VB2 A;  3JRE A;  5DDG A;  2D45 A;  2DMU A;  1SVL A;  1XB4 A;  2OU2 A;  2W4S A;  3VPR A;  2ACJ A;  4BU2 A;  1T0F A;  1X2N A;  2GIV A;  4M9S A;  1BI2 A;  1YIO A;  4ZDO A;  2ZXJ A;  4L0Z B;  1MBG A;  2LKX A;  2F4M B;  1P7I A;  1FZP B;  5EZG A;  4AD9 A;  3FBN B;  2XDV A;  2E60 A;  5E20 A;  4HNV A;  5IT3 A;  2VPL A;  4A3E J;  4Y33 A;  1W36 C;  1FWZ A;  2HZT A;  2WBM A;  1SMY F;  1OFC X;  1G59 A;  1BIB A;  5EDN A;  1RPW A;  1DGW Y;  3HOU J;  1P2F A;  2P5V A;  4F91 B;  1WHU A;  2FNP A;  5CVV A;  4IOA F;  1AWC A;  3JR9 A;  1I27 A;  4B1R A;  2MC4 A;  1MBE A;  1UG0 A;  1VQK I;  3ZMS A;  2NVU B;  1MMS A;  1HBX G;  2XB0 X;  1HCR A;  1BBY A;  4MFE A;  2VON A;  4CSW A;  4BQN A;  2O3F A;  2A05 A;  2BY0 A;  3GZ5 A;  3DXJ F;  1QHG A;  3LSI A;  1YX3 A;  3KYC B;  4B3X A;  2OTL I;  1KU9 A;  2A5Y B;  2YX4 A;  4B4C A;  1HDD C;  5ICG A;  1LFP A;  4XOR A;  5D5W B;  4O5V A;  2M0M A;  4LK0 F;  1MJ9 A;  3ZMD A;  3GZ6 A;  1Q1V A;  3K1N A;  1YIT I;  2LBF A;  1MBH A;  2BGC A;  2VAS A;  5GTI C;  4F7Z A;  1MH3 A;  4HF2 A;  2M87 A;  1CF7 B;  3S1R J;  4RGR A;  4XLA A;  2L3D A;  1UAA A;  3BLY A;  5F08 A;  5KK1 A;  3HOT A;  1K78 A;  4H4K C;  2Y0S A;  2NVY J;  2WA0 A;  3CD6 I;  4O6J A;  3VYU B;  4MLO A;  5LHH A;  1TC3 C;  1IRX A;  1N78 A;  2O0Y A;  5J6X A;  3F6V A;  1TNS A;  3GVA A;  3CF2 A;  2DA5 A;  3GEZ A;  4KT6 A;  4RAG A;  1JUP A;  3R0A A;  2O8K A;  1LJ9 A;  3UKG A;  1C0W A;  3IRQ A;  5FLM J;  2EQR A;  3J7A O;  1PJR A;  1TLH B;  5FD6 A;  1PUF A;  3AG1 H;  3MAJ A;  3V7C A;  1IAW A;  2KIS A;  1G3Y A;  1VQP I;  2DPU A;  4PFO A;  1D3Y A;  3ZQL A;  3HPG A;  3H92 A;  4EM1 A;  3OY9 A;  2IT0 A;  4ENJ A;  2LK2 A;  5GPA A;  2MD5 A;  5DYM A;  3A01 B;  2K9N A;  4UV8 A;  5B1B H;  2CMP A;  1IW7 F;  4MTD A;  3CP8 A;  4RAZ A;  1OJL A;  1ZLJ A;  3DLA A;  3QOE A;  4WK8 F;  2ZXI A;  2KZV A;  4ZTF A;  2OBP A;  2Z3Y A;  3KLO A;  3RZD J;  2QSF X;  3GFM A;  4D7N A;  3FKJ A;  1FYL A;  3CJN A;  3RJP A;  2FRH A;  3RQI A;  5TRD A;  3LSK A;  2EIK H;  5D5V B;  5K7H A;  4IX7 A;  3OIO A;  3QOD A;  1UEL B;  2CS3 A;  5LLQ A;  2KZG A;  1YRN B;  2V7F A;  1A5J A;  2K4J A;  2PBI A;  4M72 A;  4DNC A;  4OIO F;  3BJA A;  3ZMZ A;  4CDG A;  4BDY A;  2O03 A;  3CME I;  2P81 A;  2PJR B;  1EH7 A;  2Z9O A;  2C6Y A;  4PJN A;  3PUF A;  4BYY A;  2BHY A;  1TT0 A;  1YS6 A;  3HPH A;  3G71 I;  1R5H A;  2P8T A;  3WTW C;  3PIP F;  2DOA A;  4AC0 A;  2IP2 A;  3OYC A;  1I6X A;  2E19 A;  4XRS G;  1UHS A;  1Y1W J;  4XID A;  1WJ5 A;  1G2H A;  4AIH A;  4QWQ A;  1V5G A;  4RM3 A;  1WCM J;  4DBQ A;  1D1B A;  5ICC A;  4XMY A;  1R1V A;  2XAU A;  5HDG A;  3MMY B;  2LRE A;  1ODD A;  4HYE A;  4ETS A;  2VKV A;  2QWW A;  3H3Z A;  2W00 A;  4FET A;  4ASN A;  4BAC A;  1X3Z B;  2BYV E;  2JT1 A;  3BT9 A;  4DW6 A;  2IS6 A;  4BNC A;  1A04 A;  5FFX A;  1HST A;  3EPZ A;  3NQO A;  2HXO A;  2VJI A;  1I6H J;  1Z21 A;  3EUH A;  4UVC A;  1F9N A;  2DAO A;  2K9L A;  4CUG A;  4F52 A;  2JWT A;  2KT0 A;  4IZZ A;  1WJB A;  3SEQ A;  5JFR A;  4IL6 C;  1VTN C;  2RNJ A;  3CCE I;  3K4C A;  3JRI A;  5FB2 A;  2FOK A;  3FXQ A;  3OYA A;  2IJL A;  3QPS A;  4A0X A;  5ILV A;  3PIO F;  1W5T A;  3BPV A;  1XSX A;  2IEK A;  3CCM I;  4M3D A;  2MG4 A;  3ZGK A;  4LJZ F;  1SD6 A;  3RPU D;  2GOM A;  2UXX A;  1S29 A;  4E7Z A;  1MSE C;  3QP6 A;  2W84 A;  4J01 A;  4HEA 2;  4ZYH A;  2CV1 A;  3GFL A;  2JA2 A;  1P4A A;  1JKR C;  3GW2 A;  3RPU A;  5FGM A;  3QYF A;  1OPC A;  3I4M J;  1W4M A;  3HUG A;  3B73 A;  3S93 A;  1OLT A;  4PJL A;  1QO0 D;  4U7B A;  1I5Z A;  3FXR A;  3K2A A;  1K6O A;  4AM3 A;  3GFJ A;  5D5X B;  3M4O J;  2LOO A;  3RKY A;  1AHD P;  2IXS A;  4NBQ A;  5ILU A;  2OCC H;  3K6G A;  2ETH A;  2GXB A;  5CLS A;  3ZP5 A;  3MFK A;  1XMA A;  2VB6 A;  3D5S C;  2CQ7 A;  1P92 A;  3PNV A;  1K61 A;  4ANJ A;  2R93 J;  1XSD A;  2O6G E;  1FP1 D;  4IOC F;  3I4P A;  3I71 A;  4UUS A;  2OZU A;  1STZ A;  3C2G A;  2OQG A;  1YOV B;  2RC4 A;  3OYE A;  1U9N A;  3PM1 A;  3NWS A;  4IXA A;  2LD5 A;  1OIS A;  2ESN A;  3GFI A;  5IP9 J;  5LGT A;  4LLN A;  3Q3S A;  4C3J J;  3O6B B;  4S0H B;  1G3S A;  1OYW A;  2ZFU A;  2MD0 A;  2OC6 A;  3BJ6 A;  3CMY A;  3H9J A;  4RB2 C;  4KMF A;  3ABK H;  1J59 A;  4Q5S F;  1G8X A;  1YQA A;  1Z7U A;  2O9L A;  4HV6 A;  4I99 C;  5D8K B;  2EV5 A;  2DFE A;  1QGP A;  2K5C A;  2DLL A;  4XBF A;  2VT2 A;  1TWC J;  4ZZD A;  2BV6 A;  1J09 A;  2ECC A;  2KJB A;  1Z1D A;  4IPA A;  3V4G A;  3LST A;  2VQG A;  2R5Z B;  4FHT A;  5HLG A;  3U1D A;  3KEY A;  4A6D A;  4A3C J;  3DWL E;  4JYK A;  4OWR B;  5JLW A;  4M73 A;  2L54 A;  4A3G J;  3FK7 A;  2QLZ A;  3O3K A;  2RRE A;  4CYC B;  2L9V A;  2NXN B;  4FE7 A;  2XGE A;  3P9C A;  1QPM A;  1TL8 A;  2V6E A;  4EMS A;  1ONV A;  4UB8 C;  4GFB A;  1EF4 A;  3GLL A;  5FRM A;  4NQW B;  3T5X A;  4BDZ A;  1RET A;  4ENK A;  2DTZ A;  1D0X A;  5K5Q A;  4M3F A;  1B6A A;  1FPQ A;  4ENN A;  4L5J A;  1VQ8 I;  4PFP A;  3MN2 A;  1ZKG A;  2ECB A;  2R7O A;  1IV8 A;  4NNJ A;  1E3H A;  1GV2 A;  3TKY A;  2XRN A;  3DLL F;  1QZY A;  1VND A;  5LEJ A;  3U9G A;  4PSW A;  4XK4 A;  2OA4 A;  4A0Z A;  2FUG 2;  3KYL A;  4I2O A;  2R7D A;  5FKO A;  1JUM A;  3HJE A;  1WH7 A;  1JE8 A;  4U88 A;  3KPH A;  2CQN A;  2CJJ A;  2DCE A;  5EYR A;  3DP7 A;  3BR3 A;  2DJI A;  4LK1 F;  1FNN A;  2FBI A;  2PG4 A;  1JT0 A;  1NTC A;  1KU3 A;  1MBF A;  2P5L C;  3H3V K;  4LG3 A;  4AID A;  4U0V A;  4LG0 B;  2QSG X;  3A1Y A;  3L2U A;  2I10 A;  1POG A;  5F6F A;  2R4G A;  4M3E A;  4X1E A;  1MJB A;  2OD5 A;  3ZQF A;  4N9H A;  1U5T B;  1ZN2 A;  4BXU A;  1B8I B;  1JGS A;  4EEF G;  3VWB A;  1B9M A;  1ZLK A;  3F72 A;  4Y7N J;  3ZQQ A;  4UVA A;  2LRD A;  3P5J A;  2K7L A;  1QVT A;  2DU9 A;  2L7F P;  2M7A A;  1O3S A;  2DT7 B;  3NAU A;  5LGN A;  1APL C;  4Q4Z F;  2L4A A;  5K5R A;  5FRN A;  3H1C A;  3PFY A;  1LE8 A;  3HSF A;  4G6T B;  3TO7 A;  1Z6T A;  5DM6 F;  1SFK A;  2LVS A;  3F8M A;  3I59 B;  1JT6 A;  2QSH X;  2OV7 A;  2UWM A;  2BEO A;  1D5Y A;  3FF5 A;  4Z2Y A;  3KP3 A;  2X85 A;  5IOY A;  3OYF A;  2VBY A;  4IKF A;  4ZDP A;  4XLP F;  2X0L A;  5M5X J;  4BAY A;  4YG2 F;  3WG9 A;  4KIB A;  3BY6 A;  4CH7 A;  3WGH A;  1V5E A;  2JVG A;  3E1S A;  1G6N A;  3QPL A;  3WU2 C;  4D1Q A;  3K70 D;  2E2H J;  4DZJ A;  2QM3 A;  4DGW B;  3L2C A;  3L7W A;  4FIS A;  1IN5 A;  2NOJ B;  2R7T A;  3NEU A;  4Y4R A;  4XOT A;  2MH9 A;  2BY3 A;  1ZEL A;  4MEY F;  3S2H J;  3F0C A;  4AIJ A;  2LR8 A;  3C18 A;  5BS6 A;  2DXI A;  4P1W A;  4UY8 I;  1ZGJ A;  3E5X A;  3QPH A;  4NC6 A;  3HRM A;  2HZD A;  5C4X J;  3T8R A;  4NDL A;  1R1U A;  1J5Y A;  1GV5 A;  2VJJ A;  3KZY A;  2Y69 H;  4OOI A;  2PMU A;  1X3U A;  1V54 H;  2N8G A;  3H0G J;  4P55 A;  4ZYE A;  1R6R A;  1TNT A;  1X2M A;  3I5U A;  1QZE A;  3KIO A;  3SJM A;  2D1V A;  3WTV C;  2X1D A;  3UNG C;  1R5G A;  2OPT A;  1BN5 A;  2Q2E A;  4LD5 A;  3FM5 A;  2HQN A;  4LGW A;  2IGN A;  2LC2 A;  5C4J J;  3KET A;  2XC7 A;  3AAF A;  3N97 A;  4CGZ A;  4BEH A;  2V1D A;  1U5T C;  4RB0 A;  2H1K A;  1TQP A;  4IQ4 A;  5DCM B;  4EGY A;  1XG1 A;  4W1U A;  2ZXH A;  4BGD A;  1RI7 A;  3MKL A;  3PJR A;  2A6T A;  3C7J A;  2PX9 A;  3K7A J;  3HKZ A;  2XSD C;  1W0T A;  4P9U A;  3IP4 B;  5EEA A;  5KAF C;  4UVB A;  3ZQH A;  5IP7 J;  5EGO A;  4OMY A;  2Y0S N;  3CMM A;  5F0F A;  3M8J A;  3K4B A;  2PN6 A;  2QA4 I;  1K78 B;  1ETW A;  3WGG A;  5GAG J;  2NRA C;  2BHZ A;  2V9P A;  4RB3 C;  2UUZ A;  5HLI A;  4XN3 A;  2XGX A;  2FML A;  2V79 A;  4XON A;  1WSU A;  2K3P A;  1SD7 A;  3HOW J;  1ERD A;  2K4B A;  3HSE A;  2GXG A;  3OL4 A;  1AU7 A;  3GTP J;  3GYH X;  3W6V A;  3Q9S A;  3S15 J;  4CHU A;  5AIP A;  3RYP A;  2L7K A;  1T39 A;  4KIG A;  2X1E A;  3BTI A;  1NH3 A;  2DA2 A;  1HKS A;  5JR3 A;  3FMR A;  3C2B A;  1MDM A;  4RAF A;  1NG6 A;  2Q1Z B;  2AO9 A;  2X6Y A;  2XGC A;  2CV0 A;  3DTK A;  1FOX A;  4E7H A;  2VN2 A;  3IH3 A;  2EJR A;  3FMQ A;  4MGR A;  5E1W A;  2QEN A;  3IKV A;  1SVM A;  3TOB A;  1TT5 B;  3FWE A;  1BJA A;  2M8E A;  2I5U A;  5B3S H;  2P7C B;  5HS7 A;  5KNL A;  4XSZ F;  3IKT A;  2AS5 F;  2KLO A;  3G1O A;  3RQ4 A;  9ANT A;  2Z2S B;  1KQ8 A;  1U3E M;  4IHW A;  4L9T A;  1JI8 A;  3W3C A;  2QQA A;  5H20 A;  1FIP A;  3VEP A;  4O3M A;  4EJU A;  1IN7 A;  2P7V B;  4F55 A;  2FU4 A;  3RKW A;  4I02 A;  4FAS D;  1BR1 A;  4S04 A;  2NOG A;  2EB7 A;  1EJ9 A;  3LSH A;  3PNT A;  4A5M A;  1DU0 A;  2GIZ A;  1Y0N A;  2K9M A;  1D0Z A;  1WRJ A;  2JPC A;  4F92 B; 
#chains in the Genus database with same CATH homology
 3K0L A;  5J8F A;  3T0Y A;  1U6G A;  1XD7 A;  3H3U A;  3GLX A;  4HZF A;  5BMZ A;  3F8C A;  1ZRE A;  3KLN A;  4FT8 A;  3K9T A;  1O7F A;  5D5U B;  1G4D A;  3ZMU A;  3LWF A;  3SQN A;  4Y17 A;  3WGI A;  4M6Y A;  2VC1 A;  2XAG A;  2F5C A;  2HS5 A;  1YTY A;  3ZPL A;  2FA5 A;  2CFX A;  1D8K A;  1TW3 A;  3KP4 A;  1XDS A;  2HOE A;  3W6K B;  4G7H F;  2P6T A;  1B59 A;  4EJT A;  4LMY A;  2KIM A;  2HYF A;  3JW4 A;  1WQ2 A;  3FM3 A;  5ERI A;  4IRI A;  2RGV A;  4A12 A;  3WE3 A;  2G7U A;  4WXC A;  3G73 A;  2ESH A;  1MZB A;  2QBY B;  4HLX A;  3W6J B;  5HOO A;  3T8T A;  5KVR A;  3ABT A;  2KIF A;  2MLG A;  2EA4 A;  1DUX C;  4LLL A;  5LBQ A;  4KIC A;  5BOX A;  3ISP A;  5L3G A;  1FBQ A;  3MCZ A;  2LKP A;  1HW2 A;  3WOD F;  1O3T A;  1HSJ A;  2HQR A;  1ZYR F;  4AWX B;  3GX4 X;  2VT3 A;  1T98 A;  2EA2 A;  4HAM A;  2FF4 A;  5CVI A;  3DQV C;  4M71 A;  1XGS A;  2FBK A;  3I54 A;  4MHG A;  4HOB A;  2G7H A;  4A2U A;  2AXL A;  2H09 A;  4G7Z F;  5FD5 A;  1O3Q A;  4P9F A;  2ISZ A;  2EV6 A;  2GQQ A;  2ZBK A;  3F8F A;  3FXU A;  3IRR A;  1F5T A;  4QLC U;  3S2W A;  1HW1 A;  2JPB A;  4EV0 A;  1BM9 A;  4ESB A;  2ZNY A;  2MH2 A;  1XN7 A;  4WF2 A;  4EJV A;  1S3J A;  4LLG F;  4KT5 C;  2XUB A;  1FSE A;  2HTS A;  2H94 A;  5AIQ A;  1ZG1 A;  5J8C A;  4EJW A;  2Q0O A;  2VBW A;  3ECO A;  2VE9 A;  3F23 A;  1K79 A;  2ISY A;  1G3T A;  3PFI A;  1LVA A;  4CXF A;  1IN8 A;  4HF0 A;  4YII A;  1W7P D;  3P7N A;  2IRF G;  2COM A;  3OOP A;  5A2Q Z;  4XSX F;  2RN7 A;  3R6S A;  5HVQ C;  1YW9 A;  1W7P A;  2FEZ A;  4IHT A;  2R3S A;  4EVI A;  3SZP A;  1IF1 A;  5LHI A;  2QQB A;  3SFZ A;  3KCC A;  1KU7 A;  4R79 A;  5LRR A;  3TDU C;  1Y0U A;  2DQL A;  3L00 A;  4BHP A;  1PP7 U;  4HLY A;  2RV8 A;  2XKO A;  1ZAO A;  1J9I A;  3HHG A;  5FLX Z;  3TO9 A;  4ON0 A;  2ADU A;  4JBA A;  4PGG A;  4FX4 A;  3D5L A;  4DQ2 A;  1OYI A;  2NYX A;  4UUV A;  1P6R A;  1ZRF A;  5BPD A;  2XAH A;  5CVU A;  2X4H A;  2KIU A;  1S8N A;  2FBH A;  3LAP A;  3M7G A;  2ZJ2 A;  1J75 A;  1HKT A;  1H9G A;  1MD0 A;  3ERE D;  2IA2 A;  5ILS A;  4EGZ A;  2NS0 A;  4HW0 A;  2D1H A;  3KE2 A;  2FMY A;  2GA1 A;  3E5U A;  1BI1 A;  1ZG5 A;  2CSO A;  1P4W A;  1DPU A;  2OZ6 A;  2OAZ A;  3PQK A;  1YW8 A;  3VOE A;  3EYI A;  1XSV A;  4OIR F;  2MA3 A;  4WXD A;  3E6C C;  3F21 A;  1O7L A;  4EQQ A;  4EM2 A;  1H0M A;  1SD5 A;  2DTR A;  2ZCW A;  5ICF A;  1P4X A;  2M1B A;  4U0W A;  2YR2 A;  4E70 A;  4ENM A;  4CO8 A;  2DQR A;  3EET A;  1T2K A;  1FLI A;  2FNA A;  1J0R A;  5IT9 Z;  3JAM Z;  2XAJ A;  2IW5 A;  2CQK A;  1LQ1 A;  4KYW A;  5BPI A;  3BJO A;  2WWY A;  3R60 A;  3QU3 A;  1U8R A;  3CO6 C;  2RKH A;  3BRO A;  3QPT A;  5FLX K;  4UV9 A;  3GXO A;  3JTG A;  4ZH4 F;  4KN4 X;  4HX4 A;  1MDM B;  2H27 A;  4BHB A;  4EJO A;  4FX0 A;  4RGU A;  2EWN A;  5HDK A;  4I09 A;  3TOA A;  1IRF A;  1J7K A;  2OQR A;  4R1H A;  1MGT A;  4NHJ A;  3O2P E;  4Q47 A;  1V4R A;  5E1Z B;  2PFB A;  5K1Y A;  2P5K A;  1O3R A;  1S7O A;  2ZNZ A;  3M9A A;  3L9F A;  4M74 A;  4WCG A;  5L3B A;  4B09 A;  2F5F A;  3F3X A;  3LA2 A;  3I64 A;  1Q1H A;  4ZYD A;  5E17 F;  2MC3 A;  3WTZ A;  1LEB A;  4WX9 A;  1FYM A;  1JXS A;  4LB6 B;  3IWZ A;  2VBZ A;  3DFG A;  4G94 A;  3CTA A;  4ZYG A;  1Z9C A;  4HX8 A;  3LA7 A;  2KJC A;  2DK5 A;  3QP5 A;  2MLK A;  3PQJ A;  2VC0 A;  4OU0 A;  4KA4 A;  2F5E A;  1KYZ A;  3DV8 A;  5JVT A;  1KA8 A;  4GYI A;  2H6C A;  5LRS A;  5HS9 A;  1FBS A;  1EH8 A;  5DCF A;  1HW5 A;  2QUF A;  2VE8 A;  4IRH A;  4EM0 B;  1IXS B;  5BQT A;  5IT9 K;  3VOD A;  4RGX A;  3DPL C;  4RGS A;  5D6F A;  4Q48 A;  3LA3 A;  3SHF A;  4XRF A;  4MQV A;  4RS8 A;  2W25 A;  2ZFW A;  3BPX A;  3WTU C;  4IHS A;  1HKQ A;  1ULY A;  1PP8 F;  3OV8 A;  1YYV A;  4L0Y B;  1BI0 A;  4GCV A;  1V3F A;  3RYR A;  4TV7 A;  3HRU A;  4HDU A;  5HLH A;  4M9Z A;  1TBX A;  4I98 B;  5CVJ A;  1KQ0 A;  5L3F A;  1G3W A;  4P96 A;  4L9V A;  4A5N A;  5JI6 A;  4WWC A;  3GF2 A;  3DF8 A;  1DPR A;  4PDK A;  3FMS A;  1R36 A;  5E1X A;  4BHC A;  1E2X A;  3ML6 A;  2CYY A;  1DP7 P;  4GGG A;  4KFC A;  3COA C;  1Z05 A;  2JRT A;  3HHH A;  4OIN F;  1H9T A;  4K2E A;  4MNU A;  3T1B A;  1FY7 A;  4IRG A;  5LHG A;  1OYY A;  4RB1 A;  3IL2 A;  5D4R A;  2JSC A;  4N9I A;  1B4A A;  2P6S A;  3QRF F;  1EV7 A;  2D2W A;  2FE3 A;  4NQW A;  4JQF A;  4ESF A;  1YO5 C;  3K2Z A;  3DPT A;  1HXD A;  2B0L A;  3B02 A;  1T38 A;  5E18 F;  3LFK A;  3MEX A;  3RKX A;  1WI9 A;  3I58 A;  4L9N A;  3CUQ A;  3V7R A;  1SAX A;  4WXH A;  2WTE A;  3ZQ7 A;  2A6E F;  1WKM A;  5L3C A;  1ZGA A;  2RQP A;  1ZH5 A;  1J2X A;  1KYW A;  1S6L A;  2VOP A;  4LG0 A;  2RVC A;  5D4S A;  4YFX F;  3Q5F A;  2L01 A;  3P9I A;  1YW7 A;  1FSH A;  3IHU A;  3F22 A;  1RZ4 A;  3WTY C;  3KP2 A;  1IN6 A;  5HS8 A;  2HWV A;  1QQI A;  3BWG A;  3I59 A;  1R00 A;  2PLY A;  1YG2 A;  3BOQ A;  2CO5 A;  5LEK A;  1UHM A;  5EEH A;  4HDV A;  2H6B A;  4KIF A;  5EEG A;  5D8L B;  3ELK A;  6PAX A;  3ZN0 A;  4I01 A;  1Z6R A;  2FSW A;  2QQ9 A;  3WTX C;  2STW A;  3REO A;  1YFH A;  4IF4 A;  4UHT A;  3ULQ B;  3LAJ A;  2QVO A;  2CGP A;  1LDK B;  1B1B A;  2O61 A;  1GXQ A;  1BIA A;  4KMU X;  1ZHF A;  3Q9V A;  4MQ9 F;  4I0B A;  2QZ8 A;  5DUK A;  5TJJ A;  5K5O A;  5F1R A;  1LB2 A;  1FOK A;  1IRG A;  1JHF A;  2LDU A;  4I0A A;  4YFN F;  4U7D A;  2XRO A;  4M9X A;  3ECH A;  1B9N A;  3TO6 A;  1IUY A;  3FZV A;  1LNW A;  5DCM A;  4YFK F;  3HRT A;  4PZJ A;  2YU3 A;  3HIF A;  2XKP A;  3QU6 A;  4UNO A;  2HKX A;  2YSR A;  4I7H A;  3BP8 A;  2DK8 A;  2CWE A;  3I53 A;  2F2E A;  2IA1 A;  3JSO A;  2K86 A;  3FHZ A;  3GUD A;  2GAU A;  2W57 A;  2HGC A;  5ICE A;  5DD8 A;  2V6C A;  2ZME A;  2E1C A;  2EV0 A;  2L4M A;  4PCQ A;  3C1D A;  3D0S A;  4HQM A;  3RDI A;  1RUN A;  1XGN A;  2HDC A;  3MQ0 A;  2XV4 S;  4G8X A;  1WWX A;  2DBB A;  1R7J A;  2LNB A;  2P4W A;  3V8L A;  2GWR A;  4NB5 A;  4D0P A;  2W24 A;  3KP7 A;  2DI3 A;  3VFZ A;  1BOA A;  3F8N A;  3F8B A;  4M6X A;  2VOD A;  4RAY A;  2HYG D;  3U2R A;  1IZ1 A;  2WC2 A;  1SFX A;  1TQI A;  3ZN1 A;  2EFP A;  3MWM A;  2Z33 A;  4G6Q A;  3CLO A;  2HEO A;  3EDP A;  2XAS A;  3WU1 B;  3C3W A;  4L18 B;  2Z99 A;  4ZZL A;  2XAQ A;  2Y0M A;  2PI0 A;  1FBU A;  2E7W A;  2LF8 A;  2PQ8 A;  1ZG3 A;  4L9J A;  2YX7 A;  1GVJ A;  3I0T A;  1R22 A;  2GZW A;  5E8I A;  1T6S A;  2V1X A;  1OR7 A;  3V8K A;  1ZAR A;  2EFN A;  3M8F A;  3KP6 A;  1ON2 A;  2UXN A;  5FFZ A;  3RIR A;  2NNN A;  2K27 A;  2XIG A;  4N0B A;  2Z5U A;  1NHA A;  5DEQ A;  1TTY A;  2O8X A;  2PJP A;  1IXR C;  2XVC A;  5L3D A;  3RI4 A;  1U2W A;  2A68 F;  2HFH A;  3DKW A;  4KUM A;  4MEX F;  2KKO A;  3IWF A;  2RDP A;  1UFM A;  3DEU A;  4OIP F;  2QBY A;  3E6D A;  2Q8K A;  1ZRD A;  2EFQ A;  2IPQ X;  3HOS A;  3M8E A;  3KP5 A;  5D6E A;  2G9W A;  3HRS A;  5FO5 A;  2BBY A;  4OIQ F;  3E3V A;  2M5W A;  2W85 A;  1LDD A;  5DD4 A;  1KQ9 A;  5A2Q K;  2PEX A;  3SZT A;  5DV5 A;  1KU2 A;  1CF7 A;  3BDD A;  2DO7 A;  3FX3 A;  1F4K A;  3GWZ A;  3WE2 A;  4B8X A;  2JTV A;  3ZMV A;  4HQE A;  2LF7 A;  2VXZ A;  5H6R A;  2F5D A;  1S7A A;  1XDU A;  2M45 A;  1W5S A;  1Z91 A;  4A6E A;  1BC7 C;  4G6D A;  4GYG A;  3WU0 A;  3J80 Z;  1CGP A;  3WTT C;  3K69 A;  1U78 A;  1RIO H;  1MKM A;  3P9K A;  3KEQ A;  2HR3 A;  4UXN A;  2R7F A;  3CO7 C;  4LB5 A;  1FC3 A;  2XHK A;  1XCV A;  1I1G A;  1O57 A;  1OKR A;  1L3L A;  4H0E A;  3R4K A;  5CJ9 A;  2NNY A;  3LQQ A;  4HX7 A;  2LSO A;  4CYD A;  4P5O A;  3CUQ B;  2IVM A;  2A69 F;  4KDP A;  2V9V A;  1UB9 A;  2JZY A;  1GHC A;  2HKO A;  3G3Z A;  2IA0 A;  3E97 A;  1SD4 A;  3NRV A;  4Y15 A;  3ABU A;  4LFU A;  4HA8 A;  2MBF A;  3QAH A;  4U0Y A;  4HF1 A;  3K1P A;  3E6B A;  3HTU A;  4CIC A;  2BE5 F;  2J5P A;  3SXY A;  4GXO A;  3J81 Z;  1F1Z A;  1ON1 A;  3JAM K;  1FX7 A;  4HV5 A;  4R8H A;  2PMH A;  4IJA A;  2J5O A;  4L5I A;  2CW0 F;  3K1M A;  3M1E A;  2EK5 A;  1L0O C;  3E5Q A;  4MTE A;  1BI3 A;  3J80 K;  2E7X A;  1LDJ A;  3HTS B;  2A61 A;  3HYI A;  1REP C;  2VBX A;  2Y48 A;  5F64 A;  1XGM A;  1K7A A;  4GO1 A;  1QNT A;  3HSR A;  1RUO A;  2VOO A;  3CUQ C;  1AOY A;  2NAZ A;  1BC8 C;  2STT A;  1XMK A;  1YLF A;  3GO5 A;  4PGH A;  3MZY A;  4JK1 X;  3EYY A;  3V8J A;  1TQM A;  2E1N A;  4CZZ A;  2DW4 A;  4BQA A;  2WV0 A;  3KEO A;  1MJA A;  5CVR A;  5LGU A;  4G7O F;  4Y13 A;  1FP2 A;  1QZZ A;  4YIF A;  2TDX A;  2DPD A;  1TW2 A;  1LEA A;  2A6H F;  2M30 A;  1PDN C;  5AON A;  2A07 F;  4AIK A;  2HTJ A;  3KFW X;  4KN7 X;  1SFU A;  2FQ3 A;  2ZO4 A;  1HQC A;  1JHH A;  2EFW A;  2ZKZ A;  4XLN F;  1PUE E;  1FT9 A;  2DT5 A;  3CUO A;  4KNY A;  1EH6 A;  1SMT A;  4G9Y A;  2ZME B;  4HBL A;  5E8G A;  3RTR A;  3V7S A;  2KRF A;  2EFO A;  1R1T A;  3BZ6 A;  2UZK A;  4OMZ A;  2V1U A;  3J81 K;  3R61 A;  4A0Y A;  1SFE A;  1OMI A;  1D8J A;  1FYK A;  1USS A;  3L09 A;  4ESJ A;  5JHU A;  5CYV A;  1UCR A;  3JSP A;  3EQL F;  2Y75 A;  2FXA A;  3ZMT A;  3TDZ C;  1IN4 A;  4BH9 A;  3KZZ A;  2QYO A;  2L02 A;  1RNL A;  1W7P B;  2DFI A;  3TGN A;  5HDN A;  3JTH A;  3ROU A;  3WTS C;  1DDN A;  3MZH A;  5ED4 A;  1U5T A;  2ELH A;  2XAF A;  3LQR A;  1R58 A;  2A3S A;  3R0J A;  2K02 A;  3E6M A;  2CG4 A;  2GA2 A;  4S05 A;  5H6Q A;  1ZRC A;  1KGS A;  1I1S A;  4AVP A;  5DUI A;  4IVN A;  1XGO A;  3IC7 A;  1GXP A;  2YPR A;  1YS7 A;  1UST A;  3F6O A;  3RPQ A;  1QBJ A;  3N4M A;  1UHW A;  1D5V A;  1IXC A;  3CDH A;  3TQN A;  1R23 A;  1XCB A;  3QOP A;  5L3E A;  3VB2 A;  5DDG A;  2D45 A;  1XB4 A;  2OU2 A;  2ACJ A;  1T0F A;  2GIV A;  4M9S A;  1BI2 A;  1YIO A;  2ZXJ A;  4L0Z B;  1FZP B;  4AD9 A;  5E20 A;  5IT3 A;  1FWZ A;  2HZT A;  1SMY F;  1BIB A;  1P2F A;  2P5V A;  2FNP A;  5CVV A;  1AWC A;  1I27 A;  3ZMS A;  1HBX G;  1BBY A;  2VON A;  2O3F A;  3GZ5 A;  3DXJ F;  1KU9 A;  2A5Y B;  2YX4 A;  5ICG A;  5D5W B;  4O5V A;  4LK0 F;  1MJ9 A;  3ZMD A;  3GZ6 A;  3K1N A;  2BGC A;  4F7Z A;  4HF2 A;  2M87 A;  1CF7 B;  4RGR A;  2L3D A;  5KK1 A;  3HOT A;  1K78 A;  4O6J A;  5LHH A;  2O0Y A;  5J6X A;  3F6V A;  1TNS A;  3GVA A;  3GEZ A;  3R0A A;  1LJ9 A;  1C0W A;  3IRQ A;  3J7A O;  1TLH B;  5FD6 A;  3MAJ A;  3V7C A;  1IAW A;  1G3Y A;  2DPU A;  1D3Y A;  4EM1 A;  3H92 A;  2IT0 A;  4ENJ A;  2MD5 A;  5DYM A;  4UV8 A;  1IW7 F;  4MTD A;  4RAZ A;  1ZLJ A;  4WK8 F;  2OBP A;  2Z3Y A;  3KLO A;  3GFM A;  1FYL A;  3CJN A;  3RJP A;  2FRH A;  5TRD A;  5D5V B;  5LLQ A;  2K4J A;  2PBI A;  4M72 A;  4DNC A;  4OIO F;  3BJA A;  3ZMZ A;  4CDG A;  2O03 A;  2Z9O A;  1EH7 A;  2C6Y A;  4BYY A;  1YS6 A;  1R5H A;  2P8T A;  3WTW C;  2IP2 A;  1I6X A;  4AIH A;  4QWQ A;  5ICC A;  1R1V A;  5HDG A;  1ODD A;  4HYE A;  4ETS A;  2QWW A;  3H3Z A;  4ASN A;  2BYV E;  2JT1 A;  4BNC A;  1A04 A;  5FFX A;  1HST A;  3NQO A;  3EUH A;  4UVC A;  1F9N A;  2DAO A;  5JFR A;  1VTN C;  2RNJ A;  5FB2 A;  2FOK A;  3FXQ A;  2IJL A;  4A0X A;  5ILV A;  1W5T A;  3BPV A;  1XSX A;  4LJZ F;  1SD6 A;  2UXX A;  1S29 A;  3QP6 A;  2W84 A;  4ZYH A;  3GFL A;  1P4A A;  3GW2 A;  3RPU A;  5FGM A;  1OPC A;  1W4M A;  3HUG A;  3B73 A;  4U7B A;  1QO0 D;  1I5Z A;  3FXR A;  1K6O A;  3GFJ A;  5D5X B;  3RKY A;  5ILU A;  2ETH A;  2GXB A;  5CLS A;  3ZP5 A;  3MFK A;  1XMA A;  1P92 A;  1XSD A;  2O6G E;  1FP1 D;  3I4P A;  3I71 A;  2OZU A;  1STZ A;  2OQG A;  2RC4 A;  4IXA A;  2ESN A;  3GFI A;  5LGT A;  4LLN A;  3O6B B;  1G3S A;  1OYW A;  3BJ6 A;  4RB2 C;  4KMF A;  1J59 A;  4Q5S F;  1YQA A;  1Z7U A;  4HV6 A;  5D8K B;  2EV5 A;  1QGP A;  2DLL A;  4XBF A;  2VT2 A;  4ZZD A;  2BV6 A;  2KJB A;  1Z1D A;  4IPA A;  3V4G A;  3LST A;  4FHT A;  5HLG A;  3U1D A;  4A6D A;  4M73 A;  2L54 A;  2QLZ A;  3O3K A;  3P9C A;  1QPM A;  4EMS A;  1ONV A;  3T5X A;  4ENK A;  5K5Q A;  1B6A A;  1FPQ A;  4ENN A;  4L5J A;  3TKY A;  2XRN A;  1QZY A;  5LEJ A;  3U9G A;  4A0Z A;  2OA4 A;  4I2O A;  2R7D A;  1JE8 A;  4U88 A;  3DP7 A;  4LK1 F;  1FNN A;  2FBI A;  2PG4 A;  1KU3 A;  2P5L C;  4U0V A;  4LG0 B;  5F6F A;  1MJB A;  2OD5 A;  4N9H A;  1U5T B;  1ZN2 A;  4BXU A;  1JGS A;  1B9M A;  1ZLK A;  3F72 A;  4UVA A;  2K7L A;  2DU9 A;  1O3S A;  5LGN A;  4Q4Z F;  2L4A A;  5K5R A;  3HSF A;  3TO7 A;  1Z6T A;  3F8M A;  3I59 B;  2UWM A;  2BEO A;  3FF5 A;  4Z2Y A;  3KP3 A;  2VBY A;  4XLP F;  2X0L A;  4BAY A;  4YG2 F;  3WG9 A;  4KIB A;  3BY6 A;  3WGH A;  1G6N A;  2QM3 A;  3L2C A;  3L7W A;  1IN5 A;  3NEU A;  2MH9 A;  4MEY F;  4AIJ A;  3C18 A;  5BS6 A;  1ZGJ A;  3E5X A;  3QPH A;  3HRM A;  3T8R A;  1R1U A;  1J5Y A;  3KZY A;  4OOI A;  2PMU A;  1X3U A;  4P55 A;  4ZYE A;  1TNT A;  3I5U A;  2D1V A;  3WTV C;  1R5G A;  1BN5 A;  2Q2E A;  4LD5 A;  3FM5 A;  2HQN A;  4LGW A;  1E17 A;  3KET A;  4CGZ A;  3AAF A;  3N97 A;  2V1D A;  1U5T C;  4RB0 A;  1TQP A;  5DCM B;  4EGY A;  1RI7 A;  3C7J A;  4P9U A;  4UVB A;  4OMY A;  2PN6 A;  1K78 B;  3WGG A;  2NRA C;  4RB3 C;  5HLI A;  2XGX A;  2FML A;  2V79 A;  1WSU A;  1SD7 A;  2K4B A;  3HSE A;  2GXG A;  3GYH X;  3Q9S A;  4CHU A;  5AIP A;  3RYP A;  1T39 A;  4KIG A;  1HKS A;  5JR3 A;  3FMR A;  1MDM A;  2VN2 A;  2EJR A;  3FMQ A;  4MGR A;  5E1W A;  2QEN A;  3IKV A;  3TOB A;  3FWE A;  1BJA A;  2M8E A;  2P7C B;  5HS7 A;  2AS5 F;  4XSZ F;  3IKT A;  1KQ8 A;  1U3E M;  4L9T A;  2QQA A;  5H20 A;  3VEP A;  4O3M A;  4EJU A;  1IN7 A;  2P7V B;  2FU4 A;  3RKW A;  4I02 A;  4S04 A;  2EB7 A;  4A5M A;  1WRJ A;  2JPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...