2FQ3A

Structure and function of the swirm domain, a conserved protein module found in chromatin regulatory complexes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
SKWFNLEKIHSIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription regulatory protein SWI3
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fq3A00
2L01A 2VT2A 4CYDA 3VEPA 1FSHA 1OYYA 4S05A 5H6RA 3I58A 1G3WA 1KQ0A 2HYGD 4IXAA 2K4BA 4EGZA 4F7ZA 1KQ8A 3QPHA 2XGXA 1D5VA 4KIBA 2ZKZA 1USTA 2A61A 2K27A 1YLFA 2H94A 5CJ9A 4ENKA 1FT9A 4EJOA 3Q9SA 2XAFA 2L54A 1S8NA 3E5UA 3F8FA 2O0YA 3NRVA 1LEAA 1OMIA 3E5XA 5JI6A 1JGSA 1WRJA 1DDNA 3PQJA 4HW0A 2V1XA 2IT0A 4FX0A 1BC7C 3F3XA 1UCRA 4Y15A 3F6VA 1R5GA 2P5KA 3IWFA 3ZN1A 1T38A 3CUQC 1B4AA 3ERED 2UXXA 1BI2A 1R1UA 4N9HA 3QU3A 2ZMEB 3RPUA 3O6BB 4KFCA 5FD6A 1V4RA 2VBYA 1YS6A 4A2UA 2CYYA 1U2WA 2CG4A 3SZPA 1XCBA 4BYYA 1VTNC 4LLLA 3ZMUA 2EWNA 2EFPA 5ILVA 2B0LA 2DQRA 4NB5A 3IWZA 4OOIA 4KIFA 4ZZDA 4HQEA 4DQ2A 2GA2A 3L00A 3ZMSA 3FM5A 3KLNA 3OOPA 2GWRA 2KKOA 4FHTA 4KT5C 5D4SA 2VN2A 2STWA 3HRUA 4EMSA 5E1XA 3M7GA 5FLXZ 2XIGA 2KJCA 4M6YA 4KA4A 1Z7UA 2EFOA 1SD4A 4I2OA 4BHBA 5ICCA 3H3ZA 3D0SA 4M9SA 3HSRA 5E1ZB 3FMRA 1HW5A 2P7CB 2IA1A 2NNNA 2E7WA 5D4RA 2QQAA 3E6MA 4WXHA 4N0BA 2H27A 2X0LA 2CGPA 3L9FA 4HF1A 4OIQF 4YFXF 4GXOA 5DV5A 1HSTA 5CVVA 2PJPA 4KIGA 3I59B 3IRQA 1BBYA 5E8GA 1IRFA 1HKTA 4L9VA 5EEGA 4MQ9F 1ZN2A 3KEOA 1SFEA 3LA2A 4RS8A 2HQNA 4LLGF 1H0MA 1HSJA 4MTDA 2DTRA 3KZYA 3J81Z 5BMZA 2A6HF 4IVNA 3LA3A 3EYIA 1MJAA 5J8FA 2XKOA 4CGZA 1RI7A 3GEZA 5L3GA 3RTRA 3L09A 1JHHA 4O5VA 3BJ6A 3QRFF 1LNWA 4IF4A 3K1PA 3RI4A 3RKYA 3NEUA 2O61A 2OAZA 3M8EA 1DPUA 2WWYA 3TOAA 1FYLA 3ZP5A 5K5RA 4EM0B 2EV6A 1XGSA 1XCVA 1IAWA 4MGRA 4CO8A 1SAXA 2RC4A 3BROA 1IXCA 4K2EA 2ZXJA 4M71A 3QP5A 4S04A 3E5QA 1E2XA 5LRRA 2A07F 5E8IA 1F1ZA 3RKXA 4NHJA 2DBBA 2O6GE 4ETSA 3I4PA 1P4AA 4QLCU 3SHFA 4RB0A 2QBYB 2MA3A 3WTXC 1FLIA 2HKXA 2MH2A 4P55A 5HLIA 1PP7U 4R8HA 4M9ZA 1BN5A 5J8CA 1L3LA 1U5TA 2YR2A 2UWMA 5D5WB 2EJRA 4HOBA 5CVIA 3SZTA 1YW8A 1REPC 3C7JA 4HZFA 2KRFA 2YU3A 3GFMA 1O7LA 3JTHA 5F6FA 3DFGA 1FBQA 1HKQA 2STTA 1P4XA 5ILSA 1HBXG 4FT8A 3F8BA 5FGMA 1W4MA 3I0TA 4LD5A 4B09A 3OV8A 1IN8A 3U1DA 2ZJ2A 2EA4A 1TNSA 1YG2A 3KP6A 3ECOA 3ZMVA 2ACJA 3ZQ7A 3S2WA 4QWQA 3WGHA 2ELHA 1TQIA 1H9TA 1YW9A 2W24A 4OIPF 2RKHA 1DP7P 2QZ8A 3R61A 1G4DA 4IJAA 3WE2A 1G3TA 4UV9A 4IHTA 3E6DA 4A12A 1TW3A 1MDMA 3IKTA 5DYMA 3DXJF 4LB5A 3FWEA 2BBYA 1Q1HA 3CDHA 1ZREA 1KU2A 4I7HA 5DCMB 2QUFA 1CGPA 1KU7A 3O3KA 1ODDA 2BV6A 2EB7A 2HTJA 4HV5A 4KMUX 2ZMEA 3ISPA 1USSA 1KA8A 2ETHA 4AIKA 4O3MA 2J5PA 3RYRA 4I09A 1BIBA 5DCFA 2QVOA 3RDIA 1Z05A 1GVJA 3HRSA 4WCGA 3H3UA 4A5NA 2XASA 3FXUA 4Y13A 2ZFWA 1W7PB 1UFMA 4HQMA 4U0YA 6PAXA 3TGNA 1QNTA 5HOOA 2V9VA 2ISZA 2FNAA 2O3FA 4GGGA 1KU3A 5HDGA 3E3VA 2GAUA 1R58A 1LB2A 3CUQA 1K78B 2ADUA 3M8FA 2V79A 1J9IA 1W7PD 1L0OC 3FMQA 1YW7A 3HYIA 4UXNA 4A0XA 3WU1B 3MAJA 2O03A 2V1UA 1QO0D 3EQLF 3ZMDA 3BPVA 2HYFA 3R0AA 3F8NA 1OR7A 4IRIA 2W57A 5DD8A 4EV0A 1MZBA 4BQAA 4XRFA 3QPTA 4YFKF 2PMHA 4EJWA 3TO9A 1B6AA 2QWWA 5FB2A 4BHCA 2JZYA 1P4WA 3W6JB 1ZHFA 2IRFG 1OYWA 1TQMA 3BPXA 1I1SA 2R7DA 2VC0A 2K86A 1HKSA 5JFRA 2LNBA 3GFLA 1SMYF 1ONVA 1HXDA 2JT1A 2VONA 4CZZA 4ZYHA 3KCCA 3GFIA 1IZ1A 5BPDA 5LHHA 3F6OA 3TOBA 3BDDA 5L3BA 5K5QA 5E18F 5F1RA 3VOEA 1HW1A 2J5OA 4RAZA 2FF4A 2F5EA 3FX3A 5LGNA 3C3WA 2OA4A 1FBSA 1U8RA 2FBKA 2TDXA 2FOKA 1ZAOA 3LFKA 1TNTA 4KN7X 3P9KA 1Z6TA 1ZYRF 2MLKA 1G6NA 2K02A 4L0ZB 1Z1DA 2RQPA 2JTVA 4DNCA 1ZG3A 1LDJA 3WTSC 2A5YB 4AVPA 3K0LA 3I54A 1BM9A 5DEQA 4MEXF 1ZLKA 3HTUA 5HLHA 5ED4A 4UNOA 3MZHA 4MHGA 1R7JA 2DU9A 1TLHB 2XUBA 1LVAA 2VBXA 1PP8F 4I01A 4HLXA 3RPQA 3ZN0A 5D6EA 2LKPA 4WXDA 3F8CA 4XSXF 3LQRA 3EUHA 4HDUA 2MBFA 1FP2A 5ICEA 4ZYEA 1AOYA 4UVCA 2Z99A 1YTYA 4I02A 4AIHA 1K79A 2DLLA 4L0YB 3RIRA 3REOA 3ABTA 5A2QK 1K78A 2A3SA 1QPMA 3T5XA 1XGMA 1HQCA 3ELKA 1XSDA 5JR3A 1IXSB 5BQTA 4PGGA 3TQNA 1EH7A 3ML6A 1U3EM 2NAZA 3LSTA 5LGUA 4G94A 1V3FA 3MWMA 5CVUA 2VXZA 3SFZA 2PBIA 3I5UA 4P96A 2OQRA 1R5HA 4CICA 2NYXA 1YS7A 4M6XA 2RDPA 4EVIA 2F5FA 2G9WA 2R3SA 5ICFA 3FM3A 2DT5A 1S7OA 5LHIA 1B59A 3K2ZA 5L3FA 4WWCA 2YX7A 1MGTA 1S3JA 2COMA 4AWXB 1QGPA 2ISYA 3EDPA 4Q48A 4JBAA 1WQ2A 2HQRA 1LEBA 1S6LA 2BE5F 4G7HF 1MKMA 5HLGA 2VE9A 1H9GA 2ESNA 3K69A 2FU4A 3LAPA 4CHUA 4HX4A 2JPCA 5L3DA 3HTSB 5DCMA 3WTTC 4P9UA 5L3CA 1EV7A 2D2WA 5E1WA 2P7VB 1G3YA 5HDKA 3T8TA 3EETA 3T8RA 2H6BA 1I6XA 3GZ6A 4Q47A 3JW4A 1BC8C 1FZPB 3ZMZA 2FEZA 1J75A 1PUEE 3C1DA 4ENMA 3FHZA 1B9MA 5IT3A 1R23A 2Z9OA 4RGSA 3WGGA 4R1HA 3MFKA 2P5LC 4HDVA 4A6DA 3V8LA 2QBYA 2F2EA 3MEXA 3V8KA 2JSCA 5AONA 2GXGA 1GXPA 1U78A 5D6FA 3U2RA 4OIRF 1Z91A 1O3QA 1B9NA 3KZZA 4XBFA 3MQ0A 1E17A 4Q5SF 3E6BA 1A04A 3KE2A 1JHFA 4U0VA 2VBWA 5E20A 1O3SA 5AIPA 4EJTA 2DAOA 1BOAA 4IPAA 1PDNC 1R36A 2ESHA 1FP1D 2MC3A 2D1VA 1FC3A 3GWZA 5D8LB 2VODA 4HX8A 1D8KA 4UUVA 4EM2A 1KYZA 1XMKA 2ZNYA 4HYEA 1OKRA 1T6SA 2EFWA 3I59A 1TBXA 3V7SA 1B1BA 2W84A 4WK8F 4PGHA 3RKWA 5KVRA 3J80Z 1LDKB 2PFBA 4RGXA 2EFQA 1STZA 3GW2A 2L4AA 3LA7A 1RZ4A 3QOPA 2XV4S 4OIOF 2CWEA 4CDGA 4P9FA 1Y0UA 2NRAC 2EA2A 2QYOA 3DF8A 3IKVA 3BP8A 1K7AA 4ESJA 5TJJA 4G9YA 3DQVC 4A5MA 1ZGJA 3H92A 4MQVA 3VFZA 1ZRFA 2V1DA 3HIFA 3HRTA 1J59A 3EYYA 3VODA 4JK1X 1XSVA 1YO5C 5FLXK 4A0YA 1YFHA 4HF0A 4EGYA 2D45A 1F5TA 2CSOA 2O8XA 1ULYA 2EV0A 2HOEA 2FMYA 3WG9A 4ZYGA 5ERIA 1JE8A 2OZ6A 2IVMA 4LK0F 2D1HA 4IHSA 4PCQA 1XB4A 4GYIA 5DDGA 2M30A 1S7AA 1IN7A 1HW2A 4LLNA 5E17F 4FX4A 1ZH5A 4LG0B 3T0YA 4ESFA 3LWFA 2Y0MA 1ZG1A 2IA0A 1T0FA 2MLGA 4RAYA 3KP7A 4A0ZA 4G8XA 2K4JA 3RJPA 2W25A 4O6JA 4CXFA 2F5DA 3HSFA 3VB2A 3IHUA 2YX4A 5L3EA 2H09A 4LJZF 4RB2C 3M1EA 4KUMA 4HX7A 1JXSA 3O2PE 5JHUA 2OBPA 2Q0OA 2M8EA 3G3ZA 2FA5A 2IP2A 3K1NA 4Y17A 2HGCA 4U88A 3DEUA 5K5OA 2F5CA 4L9JA 1SFXA 2FMLA 5K1YA 2EK5A 2UXNA 1XGOA 1XDSA 3E97A 2HS5A 4BNCA 2ZCWA 2V6CA 4HLYA 4ZH4F 4MNUA 3TDUC 4RB3C 5DUIA 1J7KA 2Q2EA 2A68F 2RN7A 1FPQA 1OPCA 2XAJA 1GHCA 3B73A 2X4HA 3MZYA 1F4KA 3HOSA 3F22A 4HAMA 1J0RA 1LJ9A 1UHWA 3V8JA 4N9IA 2HTSA 4M74A 3TO7A 1Z9CA 1S29A 3HHGA 3WTUC 4XLPF 1U6GA 2DPDA 2HDCA 2M87A 1P92A 1QBJA 2BYVE 1KU9A 5CVJA 5LEJA 2DPUA 3GLXA 4IRHA 4ENJA 2XROA 1MDMB 3TO6A 5IT9K 2ZBKA 5D5XB 3F21A 5LHGA 3KP4A 4I0BA 2E1CA 1ZGAA 2BEOA 5ICGA 2DI3A 5DUKA 1RUOA 2NNYA 2HZTA 3GUDA 4WXCA 4BAYA 4YIIA 2XAQA 1I5ZA 2A69F 2VOPA 1K6OA 4A6EA 2M5WA 5CYVA 4KYWA 4M9XA 2FE3A 3JSOA 3WE3A 3ULQB 1FYKA 4G7ZF 1P2FA 3AAFA 2FBIA 5LBQA 1FBUA 2WV0A 2PQ8A 2G7UA 4BXUA 1T98A 5BOXA 4OINF 3DKWA 1T39A 2DFIA 3F8MA 2Q8KA 1G3SA 3QP6A 4TV7A 1ON2A 1KYWA 2ZO4A 1IUYA 1BJAA 2CFXA 3CJNA 1KGSA 3FF5A 4UV8A 2GZWA 5FFXA 2RNJA 3CO6C 2P6SA 2CQKA 3QAHA 2WC2A 2R7FA 1UHMA 3B02A 5AIQA 4IRGA 3HSEA 2DK8A 1IN5A 2L4MA 2RVCA 4PDKA 3GVAA 3KP3A 4ZZLA 2HR3A 3TKYA 1SD6A 1SD7A 3J7AO 1SD5A 5J6XA 1TQPA 2CO5A 4XLNF 1XDUA 4L5IA 3L7WA 2OQGA 1C0WA 2G7HA 1BI3A 3JAMZ 4LFUA 4KN4X 2GXBA 3GXOA 4PZJA 3I71A 2QENA 2EV5A 2JRTA 3FZVA 4M72A 1IW7F 2GA1A 2XAHA 2Z5UA 4GYGA 4I98B 2LF7A 2OZUA 3R60A 5DD4A 4LGWA 2HFHA 4BH9A 2DW4A 1LDDA 4NQWA 2OD5A 1O7FA 1YQAA 2PG4A 3ECHA 5HS8A 4OMYA 2L02A 3HRMA 3Q5FA 5HS7A 3N97A 5H20A 2MD5A 2YSRA 5TRDA 4HBLA 2DK5A 4ON0A 1AWCA 4EM1A 2EFNA 5BS6A 3NQOA 1J2XA 2VOOA 3WTZA 1FX7A 3DPTA 2E7XA 3KEQA 2XRNA 2MH9A 4OU0A 2P8TA 4G6QA 4LG0A 4L5JA 3KETA 1RIOH 1TW2A 3JAMK 1W5TA 1IF1A 4RGRA 1R1TA 4G7OF 2FSWA 1W7PA 4JQFA 1IXRC 3KFWX 5CVRA 2C6YA 3V7RA 1RNLA 3COAC 4U0WA 3V7CA 5FD5A 4WF2A 3WTYC 3KP5A 3U9GA 2M1BA 1BIAA 3HOTA 4KNYA 4D0PA 3DP7A 3E6CC 3W6KB 3PFIA 2QLZA 1TTYA 3SXYA 4AIJA 3GO5A 5JVTA 4P5OA 3T1BA 5LLQA 4Q4ZF 2YPRA 3M9AA 5HS9A 4Z2YA 4UHTA 2FBHA 3F72A 3I53A 2DO7A 3ROUA 3BOQA 2Y48A 1O3RA 2GIVA 3BY6A 5HVQC 4LK1F 2XVCA 4U7BA 1Z6RA 4B8XA 2FQ3A 3Q9VA 5EEHA 3ZMTA 3WTWC 3KP2A 2LDUA 5LRSA 4E70A 4U7DA 5D5VB 4M73A 3IL2A 2K7LA 1RUNA 1FY7A 2IA2A 1KQ9A 5FFZA 2UZKA 1R22A 2QQBA 1UB9A 1I1GA 1QQIA 2IJLA 1IRGA 1FWZA 3K1MA 1CF7B 3DPLC 2HWVA 2P6TA 4WX9A 1FNNA 4XSZF 2KIFA 4ZYDA 2PI0A 3WTVC 4KICA 2LF8A 3J80K 1FSEA 2PLYA 2IW5A 2PMUA 2L3DA 3CTAA 1XSXA 1O57A 1ZG5A 2QQ9A 2AS5F 4ESBA 1MJBA 3ABUA 2BGCA 2HKOA 1ZARA 2Y75A 1R00A 1CF7A 4GCVA 2IPQX 1BI1A 4HA8A 3LQQA 4L18B 2OU2A 3V4GA 4UVAA 4YG2F 4L9NA 3R6SA 4UVBA 5HDNA 3BJAA 4L9TA 1ZRDA 1XD7A 5IT9Z 1EH8A 2VT3A 3KLOA 2PEXA 2FRHA 2KJBA 1U5TB 2VBZA 3WODF 4MEYF 3L2CA 2VC1A 3CUQB 3F23A 2AXLA 4AD9A 2JPBA 2VE8A 3J81K 5LEKA 3GYHX 1D3YA 3WGIA 4R79A 3PQKA 3GX4X 4ENNA 5FO5A 1NHAA 3C18A 2P5VA 1DUXC 3K9TA 4I0AA 2P4WA 4LMYA 4YIFA 3N4MA 1YYVA 1ZLJA 1MJ9A 2HEOA 2RGVA 5H6QA 3GFJA 1WKMA 3BZ6A 4EJVA 1FYMA 1P6RA 4HV6A 2M45A 3I64A 5KK1A 1OYIA 1ON1A 4GO1A 5LGTA 4RGUA 5ILUA 1WI9A 2W85A 1J5YA 4EQQA 3HUGA 1FOKA 1MD0A 1WSUA 5CLSA 3WU0A 3IRRA 1LQ1A 1IN6A 2FXAA 3RYPA 1QZZA 3R4KA 4LB6B 1T2KA 3DV8A 3ZPLA 2RV8A 2LSOA 1IN4A 1I27A 1GXQA 3JSPA 3TDZC 1DPRA 2GQQA 5A2QZ 5D5UB 1EH6A 4YFNF 3GZ5A 2DQLA 1QZYA 3BWGA 3HHHA 3CLOA 1YIOA 5D8KB 2WTEA 2FNPA 4KDPA 2A6EF 3P9CA 3FMSA 3CO7C 1D8JA 1WWXA 4EJUA 3SQNA 2XKPA 2XAGA 3QU6A 3FXRA 4HF2A 2QM3A 1W5SA 3CUOA 1U5TC 3G73A 1R1VA 2NS0A 4BHPA 1XN7A 2ZNZA 3MCZA 2KIUA 3JTGA 2E1NA 4OMZA 4ASNA 2H6CA 2CW0F 2KIMA 3GF2A 3P9IA 1SFUA 3BJOA 4MTEA 2Z3YA 2PN6A 2XHKA 1X3UA 3P7NA 1SMTA 3D5LA 4RB1A 1XMAA 1O3TA 1ZRCA 3IC7A 3LAJA 1XGNA 4G6DA 5F64A 2Z33A 4H0EA 1BI0A 4KMFA 1F9NA 3R0JA 5BPIA 3FXQA
chains in the Genus database with same CATH superfamily
2L01A 2VT2A 4PJMA 3HM5A 4CYDA 4XLAA 2IGKA 3VEPA 1ETXA 1FSHA 4E7LA 1OYYA 4S05A 5H6RA 3JRGA 2I10A 2WAQA 3I58A 1HA8A 1G3WA 1KQ0A 1T95A 2HXOA 2HYGD 2M9HA 2DA7A 4M6VA 3I4NJ 3OYMA 4IXAA 2CMPA 2K4BA 2NVYJ 3E1SA 4EGZA 1Y39A 1D0ZA 4F7ZA 1KQ8A 1ZR4A 1MBKA 5FJ8J 4J19A 2W82A 1B8IB 2M2EA 2XGXA 3QPHA 1YE9A 4PSWA 1D5VA 4KIBA 2NS8A 2ZKZA 1USTA 1JUPA 2V9PA 3MKYB 4XRMA 2A61A 2K27A 4BE1A 3BR0A 3ZCOA 1YLFA 4BQQA 2H94A 2P0WA 3G2BA 5CJ9A 4ENKA 1KZHA 1FT9A 4EJOA 4BY1J 2Q2EB 5J1UA 3Q9SA 1WI3A 1OCOH 2XAFA 4C2UA 2L54A 3IH4A 1S8NA 3I56I 3E5UA 3F8FA 2O0YA 1D5YA 2CU7A 2ID6A 2Y9ZA 1D1CA 2R7VA 3NRVA 1LEAA 1TL8A 1MMDA 1OMIA 2K5CA 3E5XA 3AG2H 5JI6A 1JGSA 1WRJA 1DDNA 3ABLH 3DTIA 3PQJA 3PFYA 4HW0A 2V1XA 2IT0A 4KJZA 3BR6A 4FX0A 1BC7C 1I3AA 3F3XA 1UCRA 3CCYA 4IX7A 4Y15A 2BXYA 2LY2A 3F6VA 4ZC3A 1R5GA 3ZQQA 1QHGA 2P5KA 3IWFA 3ZN1A 5J4YA 1T38A 3CUQC 1B4AA 3ERED 2UXXA 2BXZA 3VPRA 2H8RA 2V6EA 4F92B 1BI2A 2K40A 4XKVA 1R1UA 4N9HA 2QSFX 3QU3A 1H89C 2ZMEB 4BY7J 3RPUA 4C30A 3O6BB 4KFCA 2WB1A 5FD6A 2DXIA 1V4RA 3JREA 2VBYA 4E7KA 1YS6A 2M3AA 3ZQHA 2ZJRF 4A2UA 2CYYA 3K4LA 1U2WA 2CG4A 4B3AA 1ENHA 4XM3A 5JVGF 1MNDA 3QODA 3SZPA 3QOEA 3D5SC 2LLKA 2VKVA 4V19K 3RZOJ 1V55H 1WJFA 5GPCA 3IAM2 1XCBA 4BYYA 3HPHA 1VTNC 1QU3A 2DFFA 2W7NA 4LLLA 3ZMUA 2EWNA 2EFPA 3HC7A 1Z7LA 5ILVA 2B0LA 2DQRA 4NB5A 3IWZA 4OOIA 4KIFA 2DMTA 1SANA 2WAFA 4ZZDA 3ZOBA 3GTKJ 4HQEA 4XRSA 4DQ2A 2GA2A 3L00A 3ZMSA 5E3MA 2DA3A 3FM5A 3KLNA 3OOPA 2GWRA 1PYVA 2KKOA 3LSGA 4FHTA 2VN2A 4KT5C 3HRUA 5D4SA 2STWA 4EMSA 4BQNA 2CFOA 2CUFA 4MLOA 5E1XA 5GAHJ 3M7GA 3BTCA 5FLXZ 2XIGA 2E1MB 2KJCA 5B1BH 4M6YA 1MBFA 4KA4A 1Z7UA 2EFOA 3OYBA 1SD4A 3IH3A 2CS3A 2F4MB 3ASNH 5EDNA 4I2OA 1JKPC 4BHBA 4II2A 5ICCA 4X6AJ 2XPWA 5GP9A 1MSFC 2K9NA 5IYDJ 3HXLA 3CCRI 3H3ZA 3OYEA 3D0SA 4CZCA 4M9SA 3GMEA 3HSRA 2R7SA 1LUJB 1WVRA 1HW5A 3FMRA 5E1ZB 2IA1A 3OYGA 2P7CB 2AO9A 2NNNA 1Z3XA 1ETVA 1BR4A 2E7WA 5D4RA 4HEA2 4A93J 2OCEA 2QQAA 3E6MA 2E34A 4WXHA 4N0BA 1W1WE 2H27A 2GM4A 2X0LA 2CGPA 3L9FA 3J7YJ 4HF1A 4OIQF 4YFXF 4GXOA 5DV5A 1QA6A 1HSTA 5CVVA 2PJPA 4XQFA 9ANTA 4KIGA 3I59B 3IRQA 1BBYA 5E8GA 4JX5A 1IRFA 1HKTA 4L9VA 1RKTA 5EEGA 4YRVA 4MQ9F 1ZN2A 2PMZA 3KEOA 5FKLA 1SFEA 1Y0NA 4BL0B 3CF2A 3LA2A 3OYNA 2B9SA 4PK4A 4RS8A 2HQNA 4LLGF 3JRFA 1WH7A 2VKEA 1H0MA 2Y9YA 1HSJA 1R9TJ 1XX5A 3BR5A 3A2KA 4MTDA 2DTRA 4OAZA 3KZYA 2GOXB 3J81Z 3HG9A 5BMZA 3S93A 2A6HF 1MMSA 4IVNA 2TCTA 2VQHA 4JX6A 3LA3A 4LIUA 3OYAA 3EYIA 4D7MA 1MJAA 5J8FA 5FKOA 2XKOA 4CGZA 1MW7A 1T08B 3KPHA 1RI7A 2AHQA 3GEZA 4IOCF 5FLVA 5L3GA 3RTRA 3L09A 1JHHA 4O5VA 4C3HJ 2KMUA 3BJ6A 3QRFF 1LNWA 5JLXA 4IF4A 3K1PA 2E60A 1K6YA 3RI4A 5F1JA 3RKYA 3NEUA 2O61A 2DMNA 1R6RA 2EPFA 4XLCA 1MBEA 3I55I 2XGCA 4XKBA 3CZ6A 2OAZA 1VF9A 3M8EA 1DP3A 2WBMA 1DPUA 4BUPA 1UG0A 3AKZA 2WWYA 3TOAA 1FYLA 3ZP5A 1BW5A 5K5RA 3HKZN 4EM0B 3BG5A 4BACA 2DT7B 3P5JA 2ZJPF 2YUSA 2K9LA 1Z21A 2EV6A 4DW6A 1XGSA 1G2HA 3VYUB 1XCVA 1IAWA 2RQQA 3FBNB 5GAGJ 1LVKA 5F08A 4PUSA 3SEQA 2Z16A 4MGRA 4CO8A 1SAXA 1D0XA 2RC4A 3BROA 1IJWC 1TT5B 1IXCA 5EYRA 1ZK8A 4K2EA 3WG7H 4RA2A 3CCSI 2HXIA 1QZEA 1QVUA 2ZXJA 4M71A 3QP5A 4S04A 3E5QA 1JGGA 1X2MA 1E2XA 4BDZA 5LRRA 4D7NA 2A07F 3OWTA 5E8IA 3MZ8A 5KCMA 3CDIA 1ZQ3P 2ECBA 3JCUC 5K7ZA 1F1ZA 5M3FJ 3RKXA 2LC2A 3GZNB 2DBBA 1OISA 4NHJA 2O6GE 1FEXA 4J00A 4ETSA 2LK2A 3O8HA 3I4PA 5J1RA 2RREA 1P4AA 4QLCU 3SHFA 4RB0A 2QBYB 2MA3A 3WTXC 1FLIA 2HKXA 3ESWB 3JRBA 2ID3A 2R7OA 5IYCJ 2MH2A 2EZHA 4P55A 5HLIA 1X1DA 2LTPA 1PP7U 3DWLE 3A4CA 4M9ZA 4R8HA 1BN5A 3ZRGA 5J8CA 3MKZA 1U5TA 4NNJA 4HNTA 2YR2A 5IOZA 1L3LA 3MKLA 2UWMA 4B1RA 5D5WB 3TP3A 2EJRA 4HOBA 5CVIA 3SZTA 1MMAA 1P9QC 1YW8A 1REPC 4JOMA 3C7JA 4HZFA 3CQZJ 3FXLA 2KRFA 1EA3A 4RM2A 1BR2A 1V54H 1JUMA 2YU3A 3GFMA 1O7LA 2LVSA 3HEFA 3CMMA 1IG7A 3JTHA 4CYCA 4XLHA 5F6FA 3TEDA 5HNFA 1JTYA 2MFZA 3DFGA 3OL3A 4QSHA 4A3BJ 1FBQA 1HKQA 3KIOA 2STTA 4A3EJ 5EGOA 1P4XA 4XR6A 5ILSA 1NTCA 2DN0A 3ABKH 1HBXG 1VQ5I 2A05A 1J09A 4FT8A 3U1KA 2HVQA 3F8BA 2HQAA 5FGMA 1HLVA 1FJLA 1W4MA 3I0TA 5E79C 4LD5A 4UUTA 1EKEA 4B09A 1YHQI 3DLAA 1I6HJ 2VUMJ 3OV8A 4EEFG 2XSJC 1IN8A 2ZJ2A 3U1DA 2EA4A 1TNSA 1YG2A 5M5YJ 3KP6A 3A01A 3ECOA 3OS2A 2D5VA 4PFOA 3ZMVA 2KP6A 2ACJA 3ZQ7A 3S2WA 3CP8A 1MNEA 4QWQA 3WGHA 2ELHA 1TQIA 1H9TA 4E7HA 1VQMI 3BG6A 1SFKA 4XLFA 5GTIC 1YW9A 2W24A 1WGXA 4AYBN 4D1QA 4OIPF 2RKHA 4NC8A 2QZ8A 3R61A 1DP7P 1MH4A 1G4DA 4IJAA 3WE2A 1G3TA 4UV9A 2HDWA 4IHTA 4N4OB 4PJLA 4PJ0C 3M4OJ 3E6DA 2VIXA 4A12A 1VQ8I 1TW3A 4YELA 1MDMA 3QPSA 3CP2A 3IKTA 5DYMA 3DXJF 3FWEA 4LB5A 3HOWJ 2BBYA 1Q1HA 3CDHA 1ETKA 4Z6YA 2QQ8A 1ZREA 2E2IJ 1E3PA 1KU2A 3HOVJ 1AHDP 2XGEA 1U9NA 3A1YA 4I7HA 5DCMB 2QUFA 2GXAA 2BHYA 3O8GA 1CGPA 1KU7A 1NG6A 3O3KA 1ODDA 3FISA 2BV6A 2EB7A 2HTJA 2HOTA 1BW6A 4CCLA 3BCBA 4HV5A 1XMXA 4KMUX 2NOGA 4BXFA 2ZMEA 2W4SA 3ISPA 1USSA 1KA8A 1GDTA 3B6CA 3FHNA 1Y1WJ 5IY5H 2DOEA 2ETHA 4RMNA 4AIKA 4O3MA 1MBHA 2J5PA 4IEJA 3K4NA 3RYRA 4I09A 1BIBA 5DCFA 2QVOA 3RDIA 3CCLI 3M1CA 2R7WA 1Z05A 1V5GA 4DIQA 1GVJA 3HRSA 1WJCA 2X9DA 3FKJA 3M07A 2JQ7A 4WCGA 3H3UA 4QPQA 4A5NA 3GBGA 2XASA 3MN2A 2O5RA 3FXUA 4KISA 4Y13A 2HYJA 2ZFWA 1RKWA 3PSIA 1W7PB 3AL0C 1UFMA 4HQMA 2YS9A 1IDYA 4U0YA 6PAXA 2UV1A 1ETWA 3TGNA 1QNTA 1ETOA 5HOOA 4PFPA 1WH5A 1LFBA 2V9VA 2ISZA 4CSWA 2FNAA 2O3FA 4GGGA 5HODA 1KU3A 2JA7J 2HVRA 5HDGA 3E3VA 2GAUA 2LKSA 1R58A 1A31A 1XS9A 4RBOA 2WY8Q 3K70D 1LB2A 3CUQA 4AIDA 1K78B 2QSGX 4IHYA 2VASA 2ADUA 3M8FA 3VYTB 2V79A 3UNGC 3FXKA 3IAS2 1J9IA 3ABMH 1LPQA 2HPMA 1W7PD 1L0OC 3JRHA 3FMQA 2R5YB 1K61A 3M3YJ 3BTJA 4F52A 1YW7A 3HYIA 4UXNA 1APLC 5LD2C 2OF7A 4A0XA 3SDBA 3WU1B 2CW8A 3MAJA 2O03A 2DA2A 2V1UA 4AC0A 2ICWG 1OCTC 2NVUB 1QO0D 3EQLF 5LFAA 1JJ8C 3VWBA 3OYCA 2IS2A 3KX2A 3QWLA 3H0GJ 3H9QA 1VQPI 3ZMDA 1UZCA 1BR1A 3BPVA 4FETA 1MBJA 3PIPF 3CMAI 2YU9J 4BE0A 4CCOA 2HYFA 3R0AA 3F8NA 1LE8B 4NC6A 1OR7A 2LP0A 2E36A 4V2FA 3KYLA 4GFBA 5KHDA 4IRIA 2W57A 2DT6A 5DD8A 4EV0A 1MZBA 4BQAA 4XRFA 3QPTA 5J47A 4YFKF 2PMHA 4EJWA 4BGDA 3TO9A 4S0HB 3MKWB 4OAYA 1B6AA 2QWWA 5FB2A 4BHCA 2JZYA 2QKMB 3PO2J 1P4WA 3W6JB 1ZHFA 2QA4I 1OYWA 2IRFG 1TQMA 3BPXA 2VPRA 1I1SA 2R7DA 2ME0A 1NK3P 3BG9A 1POGA 1HF0A 2FD5A 2VC0A 1WJDA 2K86A 2RAEA 1HKSA 2XF7A 5JFRA 1MMNA 1VI0A 4AM3A 3WU2C 3HUGB 3A01B 1PVEA 2IBDA 1SMYF 2LNBA 3GFLA 1ONVA 1LE8A 1HXDA 2XB5A 2JT1A 2VONA 2XRLA 4DYRA 4CZZA 2L7MP 3HGGA 5IP6A 2WV1A 4ZYHA 2O7OA 3KCCA 5IP9J 2EH3A 4IZZA 3GFIA 2L9RA 5KAFC 3UKGA 3DTEA 1IZ1A 5BPDA 5LHHA 3F6OA 3TOBA 3BDDA 5L3BA 4A69C 1ERDA 5K5QA 5E18F 5F0HA 4DYCA 1YI2I 2IS6A 5F1RA 4CH7A 3VOEA 3S2DJ 1HW1A 3BR1A 2J5OA 3BTIA 4RAZA 2DA6A 2FF4A 2KFDA 3E7LA 2ZMEC 3BCAA 2F5EA 3FX3A 5LGNA 3C3WA 2OA4A 4G6TB 2DCEA 1FBSA 1U8RA 2FBKA 2TDXA 2FOKA 1ZAOA 2E71A 3LFKA 1WFXA 1B72B 1TNTA 4KN7X 3P9KA 3K4MA 2QKLB 2IEKA 1Z6TA 1ETQA 1ZYRF 2JRMA 2MLKA 1G6NA 5GAEJ 2K02A 4L0ZB 1Z1DA 3S1QJ 2RQPA 3GTOJ 1K4SA 2JTVA 2MABA 3CCVI 4DNCA 1ZG3A 1LDJA 3WTSC 2A5YB 4AVPA 3K0LA 4U87A 3PL8A 3I54A 3S14J 4C3IJ 1BM9A 1IDZA 5DEQA 4MEXF 5TISC 5B3SH 1ZLKA 3HTUA 2VJIA 1S5LC 5HLHA 1FOXA 5ED4A 4UNOA 2BVLA 5FKNA 3MZHA 1I3QJ 2NS7A 4MHGA 3RQ4A 1FMWA 3TW7A 1R7JA 2DU9A 1TLHB 2XUBA 1WCMJ 3D5RC 1LVAA 4XICA 4BQOA 2VBXA 2Z2SB 1LFPA 1PP8F 4I01A 4HLXA 3RPQA 1FTZA 3OSGA 1OCRH 4IHWA 3M8JA 3ZN0A 1D1BA 4PJJA 4XLEA 5D6EA 4DGWB 2LKPA 2O9LA 4WXDA 3F8CA 4XSXF 1WJAA 3LQRA 3EUHA 4HDUA 2R92J 4AYBA 2MBFA 1FP2A 5ICEA 1V5EA 4ZYEA 1TWHJ 1AOYA 4UVCA 2R5ZB 3LSKA 2Z99A 2WAQN 2X6XA 4Y7NJ 3ZQFA 1YTYA 4I02A 4AIHA 1HOMA 2R7UA 2X6OA 1K79A 5JHFA 2DLLA 4L0YB 1WPKA 1Y6IA 1W36C 3RIRA 3REOA 2DA4A 3ABTA 4E6KG 5A2QK 1K78A 3S2HJ 1QPMA 2A3SA 3T5XA 1XGMA 3IH2A 1HQCA 3ELKA 1XSDA 1A35A 5JR3A 1IXSB 5BQTA 4PGGA 3TQNA 1EH7A 2DOFA 3ML6A 4ZYAA 1U3EM 5F27A 3DPUA 3OYJA 2NAZA 3LSTA 5LGUA 2QCOA 2R5YA 3PM1A 2NVTJ 4G94A 2K3FA 4XORA 3RKQA 1V3FA 3MWMA 5CVUA 2VXZA 3SFZA 5GTHC 2PBIA 5C4XJ 4XN0A 3CCQI 1VQ9I 3PSFA 2Y31A 4D5CA 3I5UA 2XAUA 4P96A 2OQRA 1R5HA 4IHXA 4XN3A 2LOOA 1TP4A 2QSHX 2WY7Q 4CICA 2NYXA 4XK4A 3TW6A 1YS7A 2MGQA 4M6XA 2RDPA 1UELB 2OV7A 3CC4I 4M3BA 2F5FA 1XG1A 2MYSA 2OCCH 3VSLA 4EVIA 2DMQA 2XPUA 2G9WA 2R3SA 5ICFA 3FM3A 4ZDLA 5IYBJ 1GVDA 2BY1A 2DT5A 2WADA 1S7OA 1TWFJ 1OFCX 5LHIA 1B59A 3NWSA 1JTXA 1ZR2A 1M1EB 3K2ZA 5L3FA 4WWCA 3NWTA 4QPOA 4IQJA 2YX7A 5FKMA 1MGTA 1S3JA 3I3LA 3OR2C 2COMA 4AWXB 1A36A 1QGPA 2ISYA 3EDPA 3HKZA 1G59A 2PJRB 2M34A 5M5WJ 4KT6A 4Q48A 4JBAA 2M4KA 3A0BC 1BA5A 1WQ2A 2HQRA 3CDLA 1LEBA 1S6LA 2BE5F 4G7HF 2AXTC 2LBFA 4HRIA 1MKMA 3G71I 1CQTA 2LR8A 1ZKGA 5HLGA 2QEXI 2VE9A 1H9GA 4JP0A 2ESNA 3K69A 1T8IA 2FU4A 3LAPA 4CHUA 3HPGA 4HX4A 2JPCA 5L3DA 3CCUI 3KZIC 3G1OA 2DDBA 2DODA 3HTSB 5DCMA 4Y3OA 3EUAA 3QYBA 4XRSG 4P9UA 3WTTC 5L3CA 3RPUD 2R7RA 5B1AH 1Z77A 2MW8A 1EV7A 2D2WA 4D5FA 2WAEA 5DS9A 3WHCA 5E1WA 2P7VB 1G3YA 5HDKA 3T8TA 3EETA 2KISA 3T8RA 2H6BA 3VDXA 1WJEA 1I6XA 3GZ6A 5IPAA 2FUG2 3TMOA 4ZTJA 4Q47A 3JW4A 3CF5F 1BC8C 2L2OA 4AVZA 3ZMZA 1FZPB 5TGTA 2FEZA 2HZDA 1J75A 1X3WB 3KEYA 2XGDA 4RDUA 3S32A 1PUEE 2PMZN 3C1DA 4X0GA 4ENMA 2VJ5A 3FHZA 3C2BA 1B9MA 2QF7A 1U9OA 5IT3A 3Q0WA 3LNQA 1R23A 1VZ0A 4A3IJ 5J1YA 3PIOF 2Z9OA 4RGSA 3WGGA 3CC7I 4R1HA 3MFKA 2P5LC 4HDVA 4A6DA 3CCEI 3V8LA 4NUBA 2QBYA 5GADJ 2F2EA 3MEXA 3V8KA 2JSCA 5AONA 2GXGA 1OCCH 1SVMA 1GXPA 4ZDPA 1U78A 5D6FA 4LITA 3U2RA 4OIRF 4CCNA 3L2VA 1Z91A 1O3QA 1UMQA 1B9NA 3OMYA 3KZZA 3EUKL 4XBFA 2GBYA 2LD5A 3MQ0A 1JT0A 1VQKI 4HSTA 1E17A 4Q5SF 3E6BA 1A04A 3KE2A 1JHFA 4U0VA 1F36A 2VBWA 5E20A 4XNFA 1O3SA 1XC5A 5AIPA 4HPQA 4DBQA 3L2WA 4EJTA 2WB1N 2DAOA 4A3LJ 1WJ5A 1BOAA 4IPAA 3LOCA 3C2HA 1PDNC 1R36A 2ESHA 1FP1D 2MC3A 2D1VA 4C2TA 2ELKA 1FC3A 3GWZA 5D8LB 2VODA 4HX8A 3HOYJ 4A3CJ 1Y56A 1D8KA 4UUVA 1X19A 1SEUA 1XTAA 2HVSA 3OY9A 2W1OA 2DFEA 1KYZA 4EM2A 3K4CA 1E3HA 1XMKA 2ZNYA 4HYEA 1OKRA 3HOXJ 1QVTA 3OIPA 1T6SA 2EFWA 4UB8C 3I59A 4NDLA 1U8BA 2DJNA 1TBXA 3QQAA 2Y69H 3V7SA 5DM6F 1B1BA 2LMDA 2W84A 4UUSB 4WK8F 4PGHA 3GTPJ 3RKWA 3AG3H 5KVRA 1MBGA 3J80Z 3RQIA 1LDKB 2PFBA 4RGXA 3ONQA 3BG3A 2EFQA 1STZA 1IV6A 3GW2A 2L4AA 2JSPA 3LA7A 4NC7A 1G8XA 1NG7A 1E0EA 2E2HJ 1RZ4A 3PNYA 5EZGA 2KIQA 2VJ4A 3QPLA 3QOPA 4M3FA 2JVHA 2XV4S 4L5EA 4OIOF 2CWEA 4CDGA 4P9FA 1Y0UA 1UJ8A 2NRAC 3Q0VA 2EA2A 2QYOA 3DF8A 3DEEA 3IKVA 3MD2A 1VQOI 2MSYA 2M8GX 2OJED 3BP8A 1K7AA 3BQZA 1Y8RB 4ESJA 1UAAA 1ORKA 1X1PA 5TJJA 4G9YA 3DQVC 3OL4A 4RLFA 1ZGJA 4A5MA 5KNLA 3H92A 4MQVA 3VFZA 1ZRFA 3JR9A 2V1DA 2R7QA 3HIFA 3HRTA 1LFUP 1J59A 3EYYA 2DYRH 1X1CA 3VODA 4LG3A 3H35A 4JK1X 1XSVA 4BS9A 1JI8A 3IP4B 3OYLA 1YO5C 5FLXK 3DU6A 1Z67A 1N77A 2DYSH 4A0YA 1YFHA 4HF0A 2K85A 5EG0A 1EF4A 4EGYA 2D45A 1F5TA 2CSOA 2O8XA 2E1MC 2OC6A 1ULYA 2EV0A 5CQGA 4ABZA 2HOEA 2FMYA 4UY8I 3WG9A 4ZYGA 5ERIA 2F48A 1JE8A 4HSRA 2OZ6A 2ELJA 2AQEA 2IVMA 2BY3A 4LK0F 3S3MA 2D1HA 4IHSA 4PCQA 1XB4A 4GYIA 5DDGA 2M30A 1S7AA 1IN7A 2VL8A 2MC4A 3JRIA 2PJRA 1HW2A 3CLQA 4LLNA 5E17F 3FBIB 5EF6A 4FX4A 1ZH5A 4LG0B 3LFUA 2X6WA 4XMYA 3T0YA 4ESFA 1NK2P 2GLOA 2FX0A 3ZQIA 2ZB9A 2Z1DA 2IXSA 1QPIA 3LWFA 5E3OA 2Y0MA 1ZG1A 2IA0A 1T0FA 2V9KA 2MLGA 3NARA 4RAYA 3KP7A 3LSJA 2Y2ZA 3CJQB 4A0ZA 2NXNB 4G8XA 4C9YA 2K4JA 4CCKA 4XOTA 5DM7F 1B72A 3RJPA 2W25A 4O6JA 5BNGA 1TWAJ 4CXFA 2F5DA 3GTJJ 3OSFA 1MSEC 2R93J 4RLQA 3HSFA 4IQ4A 2LH9A 2L5QA 3CESA 3VB2A 2IS4A 3IHUA 2LY9A 2YX4A 3DBRB 1DQUA 5L3EA 2KZGA 2H09A 4LJZF 4RB2C 3M1EA 4KUMA 2E19A 1MMGA 2VKHA 4CCJA 4HX7A 3KYDB 2LG4A 1JXSA 4HNVA 3O2PE 3OOUA 3OYKA 5JHUA 2OBPA 2B63J 1YX5A 3BLYA 3G3ZA 2FA5A 2IP2A 2M8EA 2Q0OA 2Y0SA 3K1NA 4Y17A 4AU7A 3W3CA 2COBA 1UG2A 2HGCA 3ZQGA 5C44J 4U88A 3DEUA 3W2WA 5K5OA 2F5CA 4L9JA 1A5JA 4AUXA 4MFEA 1MNMC 1X4OA 1SFXA 2FMLA 2BZTA 2L0KA 4BJTA 4W1UA 5K1YA 2EK5A 2ZXIA 2UXNA 4LOCA 5KAIC 4D9JA 3CMYA 2VXDA 3PUFA 1XGOA 1XDSA 1SVOA 2EBIA 3E97A 4FQGA 2CJJA 5J40A 2HS5A 2R5ZA 4BNCA 3WHBA 2ZCWA 4FISA 2V6CA 2CUEA 4HLYA 4ZH4F 5K7FA 4MNUA 1HCRA 3GTLJ 3HOZJ 3TDUC 4RB3C 1N75A 5DUIA 1J7KA 2Q2EA 3CJTB 2A68F 1RRJA 1YITI 2RN7A 5J4VA 2PX9A 1FPQA 1OPCA 5IP7J 1X58A 2XAJA 3SYTA 4X1EA 1GHCA 3B73A 2X4HA 2K9MA 1VQLI 3MZYA 4I6ZA 3SZGA 1F4KA 3HOSA 5FROA 3F22A 3BG7A 4HAMA 1J0RA 1LJ9A 1UHWA 3V8JA 4N9IA 2HTSA 4M74A 4IHVA 3TO7A 4B43A 1Z9CA 4DJAA 1S29A 2AQFA 3HHGA 2VJJA 2JA2A 3WTUC 2OTLI 2CQQA 3IUOA 3LSHA 4BU2A 4XLPF 1U6GA 2DPDA 2CUZA 2KL4A 2HDCA 4B4CA 3LSRA 3CD6I 4B48A 3H36A 2M87A 1S9HA 1P92A 2LFBA 2BYVE 2X51A 1QBJA 3H3VK 1DU0A 1KU9A 2HPIA 5CVJA 5LEJA 3JRCA 2DPUA 3G1MA 2JUGA 3GLXA 4IRHA 4C2MJ 4ENJA 4ZTFA 1HC8A 2XROA 1D1AA 4A3MJ 1MDMB 3TO6A 5IT9K 3DBHB 2ZBKA 3K4KA 2BW3A 3SEZA 5D5XB 4A3JJ 1YJNI 2JA5J 4FE7A 1XPXA 3F21A 5LHGA 3KP4A 3EPZA 4LIVA 2L7ZA 4I0BA 2E1CA 1ZGAA 2BEOA 4E7SA 4IKFA 1TWCJ 5ICGA 5HLTA 2CQXA 2DI3A 5DUKA 3TL4X 2TRTA 2NNYA 1RUOA 2HZTA 1GLNA 3GUDA 4WXCA 4BAYA 4YIIA 2XAQA 1I5ZA 2R7TA 4BJ6C 2A69F 2VOPA 1K6OA 4A6EA 2M5WA 3AFHA 5CYVA 5EG0B 2EIJH 4KYWA 3DBLB 4M9XA 2X6YA 2DMUA 2FE3A 2ZXWH 3JSOA 4CA0A 3WE3A 3ULQB 1FYKA 4G7ZF 1P2FA 3V42A 2XSDC 5JLWA 1PUFA 2QGUA 3AAFA 3CMEI 4FTHA 2OTJI 2FBIA 1FOYA 5LBQA 5HNHA 1FBUA 3X2QH 2LRDA 2FOWA 4BE2A 1ZELA 2WV0A 2EIMH 3FXOA 1RC9A 2G7UA 2PQ8A 4BXUA 1T98A 1W36D 2L9SA 5BOXA 2JK3A 4OINF 4G12A 3DKWA 1T39A 2BOLA 2E2JJ 2DFIA 3J7AY 1PJRA 2G0EA 3S3OA 3F8MA 2Q8KA 2NOJB 4HNUA 4QTRA 2VB6A 1G3SA 3QP6A 4TV7A 2IGMA 1ON2A 1KYWA 2ZO4A 2CW7A 3CCJI 1IUYA 4YIRX 1BJAA 4I76A 4YEJA 3HL2A 2CFXA 1X1BA 4F55A 4F3QA 3S15J 3CJNA 1KGSA 1P7IA 3FF5A 2Y0SN 4UV8A 2GZWA 5FFXA 2RNJA 3ZQLA 4B3XA 4CUGA 3K70C 4ANJA 1E3OC 3CO6C 2E5ZA 2P6SA 4B44A 2CQKA 2F4OB 3K10A 3QAHA 3QYEA 2WC2A 3JRDA 5DTDA 2R7FA 3W2AA 1UHMA 1Y1VJ 3B02A 5AIQA 3LSPA 2P81A 2IGOA 2XDVA 3HSEA 2DK8A 4IRGA 1IN5A 2L4MA 2RVCA 3HDDA 4PDKA 2KRHA 4B47A 2MD0A 4XOPA 3GVAA 3KP3A 4P1WA 4ZZLA 4M3DA 2HR3A 2JVGA 3TKYA 4CCMA 1SD6A 3A02A 5J3LA 2KDZA 1SD7A 3J7AO 1SD5A 1LKXA 5J6XA 1TQPA 2CO5A 2DTZA 4XLNF 1XDUA 4L5IA 1YIJI 3L7WA 3ASOH 4NQWB 1FIPA 4ZDOA 1R5ID 1UHSA 2BY0A 1RR7A 2OQGA 2V4JC 2LYCA 1C0WA 3FXJA 2G7HA 1BI3A 3JAMZ 4LFUA 1T33A 5M3MJ 4KN4X 2GXBA 1T0FC 3GXOA 4PZJA 3I71A 2QENA 3OR1C 3SDGA 3L2QA 2DOAA 2JUCA 2EV5A 2JRTA 3GTMJ 5K7HA 2VQLA 3FZVA 2V26A 4M72A 3F9KA 1X2NA 1NH3A 2X1EA 2M0CA 1IW7F 2GA1A 1N25A 2XF6A 2XAHA 2Z5UA 3NAUA 4GYGA 4I98B 4N4NB 2LF7A 2OZUA 1S72I 3HOUJ 3BZCA 3R60A 1GUUA 2M0MA 2KZVA 5DD4A 4A3FJ 2GIZA 3K4BA 3FK6A 4LGWA 2HFHA 4BH9A 5CKTA 2DW4A 1LDDA 4NQWA 1JT6A 2OD5A 1O7FA 1YQAA 2PG4A 4W97A 2R7XA 3H5RA 1TZLA 2M7BA 3ECHA 5HS8A 1X3ZB 5C4JJ 2KDOA 4OMYA 4A3DJ 5E3NA 1WZ2A 2L02A 2DA5A 1X4PA 2XF5A 3HRMA 3HZJA 3Q5FA 5HS7A 1AKHB 3RZDJ 4BXXJ 1VQ6I 5H2FC 2KT0A 3N97A 2VPLA 5H20A 2VI6A 4ZJZA 2LREA 5C3EJ 3J7ZI 2KRCA 4OWRB 1D0YA 3I4MJ 1OLTA 5CQEA 2MD5A 2YSRA 2L7FP 4E7JA 5TRDA 4HBLA 2NVQJ 2DK5A 4ON0A 1AWCA 3H1CA 5IOYA 2LBFB 4GDFA 4QIWN 4EM1A 2ECCA 1MH3A 2HNHA 2WA0A 2BY2A 2EFNA 2BW3B 5BS6A 4E7ZA 3NQOA 3HGYA 1J2XA 1K4TA 2X1CA 2VOOA 3RSNA 3WTZA 4Y33A 1FX7A 2F5VA 3DPTA 2E7XA 3KEQA 2XRNA 2CV2A 2MH9A 4OU0A 2P8TA 5FKKA 1QHHD 2RNGA 1T56A 4G6QA 4LG0A 4L5JA 2ZC2A 3KETA 1RIOH 1TW2A 2ME6A 3JAMK 3W6VA 1W5CC 2M4GA 1W5TA 2HI3A 3ZR8X 1IF1A 4A3GJ 4RGRA 1R1TA 4G7OF 1WHUA 2FSWA 1W7PA 4JQFA 3Q0UA 2ZSIB 1IXRC 1DU6A 3OS0A 3FXMA 3BZKA 3KFWX 5CVRA 2C6YA 5CPRB 1JJ6C 2EZIA 3F0CA 3V7RA 1RNLA 3COAC 3HJEA 3BTLA 3DCFA 4U0WA 3FKIJ 2BHZA 3V7CA 3GCMA 2MG4A 1BJZA 5FD5A 1IV8A 4WF2A 4XL9A 3WTYC 3KP5A 3HBLA 3U9GA 2M1BA 1KONA 1IGNA 2EINH 1BIAA 2GOMA 3VYRB 3HOTA 4KNYA 4D0PA 3DP7A 3E6CC 3W6KB 2I8DA 3PFIA 3OYFA 3OIOA 2QLZA 1SVLA 2B7EA 1TTYA 1AA7A 3SXYA 4AIJA 3ZGKA 4DZPA 2IS1A 2E5NA 3GO5A 3CC2I 5JVTA 1P7JA 4P5OA 4JX4A 3T1BA 2XC7A 5LLQA 2HOSA 1S7EA 4Q4ZF 3DKYA 1HDDC 1Y8QB 2YPRA 3M9AA 3DKXA 4Y52J 1RETA 5HS9A 4Z2YA 4UHTA 1FOWA 1GV2A 2FBHA 2FQ4A 3F72A 1QRYA 1YRNB 2K3PA 1F43A 3I53A 2DO7A 4BJ5C 3ROUA 3BOQA 2Y48A 1O3RA 2GIVA 2H1KA 3LSIA 3BY6A 2DA1A 2H1LA 5HVQC 1WJBA 4LK1F 2XVCA 4U7BA 1FMVA 1Z6RA 4B8XA 2LY1A 1H8AC 4Y4RA 2FQ3A 3Q9VA 5EEHA 3ZMTA 4I99C 3WTWC 3G4SI 3KP2A 3U21A 2LDUA 5LRSA 2UUZA 3K2AA 4E70A 2DJIA 4U7DA 1TWGJ 5D5VB 3A03A 3BT9A 3AL0B 2L9VA 4M73A 2EIKH 3IL2A 1IUFA 5EEAA 3K7AJ 2HQ5A 1K83J 2K7LA 1RUNA 1FY7A 3EUHC 5F04A 3H5NA 4BEHB 2R0QC 1BL0A 4PSXA 2CRGA 3H5AA 3G6EI 3FK7A 2IA2A 4UUSA 5B5EC 1YJWI 1KQ9A 2F6CA 5FFZA 2UZKA 4E4HA 4DYQA 1R22A 3S3NA 1GT0C 1JKQC 2CH0A 2QQBA 4V2GA 3UR3C 3L2UA 1UB9A 1I1GA 3JRAA 2EQRA 1ACIA 1QQIA 2IJLA 1IRGA 1FWZA 4PJNA 3K1MA 3N05A 3QYFA 3OYHA 1CF7B 3Q3SA 3GLLA 3DPLC 2HWVA 4GRIA 2P6TA 3L1PA 4WX9A 1FNNA 3D1NI 2O8KA 3GTGJ 4XSZF 2KIFA 1H88C 2DDAA 4ZYDA 1AU7A 2PI0A 4BEHA 3LL7A 3PNTA 4DOZA 4DBRA 4KICA 3WTVC 2KLOA 2LF8A 3J80K 3DEWA 1FSEA 2PLYA 2R7ZJ 2IW5A 2PMUA 2L3DA 3CTAA 3E0JB 4RAGA 3S8PA 3PO3J 1XSXA 1O57A 5FRNA 4BKXA 1ZG5A 2QQ9A 2AS5F 4ESBA 1JKOC 1MJBA 2K9QA 4IL6C 2W00A 1AKHA 3ABUA 2X48A 3BR3A 2CV1A 2BGCA 1Q1VA 2HKOA 3FDYA 1ZARA 2Y75A 1FTTA 1R00A 1CF7A 5F0FA 1O4XA 4GCVA 2IPQX 1BI1A 4BBSJ 1ETYA 4HA8A 3LQQA 4L18B 2OU2A 4NBQA 3V4GA 4UVAA 1FIAA 4YG2F 3K4JA 4L9NA 3R6SA 3B6AA 4UVBA 3DTKA 4KITB 3S1RJ 2VQGA 2JWTA 2H8WA 5HDNA 3BJAA 4L9TA 4E7IA 1ZRDA 3VSKA 3PNVA 1Z0XA 1XD7A 5IT9Z 1PUFB 1EH8A 2VT3A 3KLOA 4IOAF 2PEXA 3MMYB 1I39A 2EILH 2FRHA 2KHMA 1I50J 2IGNA 1U5TB 2KJBA 2VBZA 2EZLA 3WODF 1DGWY 4MEYF 4MO7A 3L2CA 4IO9F 3S1MJ 2JMWA 2VC1A 1U0JA 3CUQB 4C3JJ 3F23A 3BR2A 1IC8A 2AXLA 2KQRA 4AD9A 3I9V2 2JPBA 1N78A 2VE8A 3J81K 5LEKA 3GYHX 1D3YA 2A6TA 3WGIA 3S17J 1JKRC 4R79A 3S16J 4EATA 3PQKA 4F91B 2R4GA 3OYIA 1TC3C 1B8IA 1IO2A 3GX4X 3BQYA 5EGOB 4ENNA 5FO5A 1NHAA 2JN6A 3C18A 2P5VA 1DUXC 1EJ9A 1R71A 4CYCB 1BOBA 1ZGWA 2EZKA 3K9TA 4I0AA 2P4WA 2A5WA 3H0DA 4LMYA 5GPAA 4YIFA 4BBRJ 1YOVB 3N4MA 3BC8A 2JA6J 1YYVA 4MFDA 1ZLJA 3H9GA 1MJ9A 2HEOA 2RGVA 5H6QA 3DU5A 3GFJA 1VQNI 1WKMA 3BZ6A 4EJVA 4RAFA 3OYDA 4RM3A 3AG4H 1V5FA 2CV0A 1FYMA 1P6RA 4HV6A 2L9NA 1DGRM 2M45A 2X85A 3I64A 3OS1A 5KK1A 2XPVA 1OYIA 2ZFUA 1ON1A 1SAUA 4GO1A 2DFHA 3LMMA 3TBIA 5B66C 1YRNA 5LGTA 1RPWA 4RGUA 2M7AA 3CJRB 1X1AA 4UB6C 1WI9A 5ILUA 2W85A 1VQ7I 1J5YA 2V7FA 3S1NJ 1OQYA 2X1DA 2VKDA 4EQQA 1R49A 3HUGA 1R4MB 1VQ4I 1OCZH 1MIJA 1FOKA 1MD0A 3LSMA 2K9SA 1WSUA 5CLSA 4ITVA 3WU0A 1OCPA 3IRRA 5EZHA 1LQ1A 3PUBA 3PJRA 1IN6A 2ZSHB 4XIDA 3G1LA 2FXAA 3RYPA 3HB9A 1VNDA 1QZZA 3C2GA 3R4KA 1YJ9I 2KPMA 4LB6B 1IRZA 1T2KA 1ITYA 3DV8A 1HDPA 3IV5A 3ZPLA 2N8GA 3CCMI 5EJCA 3ZXSA 2RV8A 2LSOA 4DZJA 3RCOA 2OPTA 3FIWA 4HG2A 1IN4A 1I27A 1GXQA 3JSPA 2BVMA 3TDZC 1DPRA 2GQQA 5A2QZ 5D5UB 1EH6A 4YFNF 3GZ5A 2DQLA 4XKCA 2Q1ZB 2E35A 1QZYA 1SFOJ 3BWGA 3HHHA 3CLOA 4M3EA 1YIOA 5D8KB 1RR8C 4H4KC 1RESA 2WTEA 2FNPA 4KDPA 2XB0X 1VFCA 2A6EF 2DMPA 3P9CA 4BDYA 2ZXHA 3FMSA 3CO7C 2W48A 4XONA 3K6GA 3KYCB 4J01A 1IRXA 3MVPA 1D8JA 1TT0A 1WWXA 4EJUA 1A6QA 3W2VA 3SQNA 2XKPA 1A6IA 2LKXA 2XAGA 3QU6A 2Y30A 3ZQCA 3FXRA 4HF2A 2QM3A 4MIMA 4II3A 2IAIA 2CQNA 2CUJA 1W5SA 3CUOA 1GV5A 1U5TC 3G73A 1W0TA 1R1VA 2NS0A 4BHPA 1XN7A 3SFIA 2JA8J 2VLAA 2ZNZA 3MCZA 2KIUA 3OIQA 3JTGA 2OUMA 2E1NA 1OR7C 2V1NA 5FLMJ 1W0UA 4FE4A 4XKWA 4OMZA 4F93B 3TP0A 2HOAA 4ASNA 2H6CA 2CW0F 2I5UA 2KIMA 1SC7A 3A0HC 1ZTRA 3GF2A 3P9IA 5FRMA 4A3KJ 3VYSB 5E3LA 1Z3YA 2E1OA 1SFUA 3BJOA 3L2RA 1R4NB 2L7KA 2ZJQF 2VQCA 3SJMA 3GTQJ 4MTEA 2Z3YA 2PN6A 3H9JA 2FJ1A 2HDDA 2XHKA 1X3UA 3P7NA 1SMTA 2HU9A 2F4IA 4M3GA 3D5LA 4RB1A 1JUSA 1XMAA 3AG1H 4FCYA 1O3TA 2NVXJ 1ZRCA 3IC7A 3LAJA 2JJ7A 1XGNA 4G6DA 4JYKA 5F64A 2CQ7A 2Z33A 4H0EA 1BI0A 1YX3A 5M5XJ 4KMFA 1F9NA 3R0JA 1OJLA 3DLLF 3ERMA 5BPIA 3FXQA 5F0CA 4FASD
chains in the Genus database with same CATH topology
2L01A 2VT2A 4CYDA 3VEPA 1FSHA 1OYYA 4S05A 5H6RA 3I58A 1G3WA 1KQ0A 2HYGD 4IXAA 2K4BA 4EGZA 4F7ZA 1KQ8A 3QPHA 2XGXA 1D5VA 4KIBA 2ZKZA 1USTA 2A61A 2K27A 1YLFA 2H94A 5CJ9A 4ENKA 1FT9A 4EJOA 3Q9SA 2XAFA 2L54A 1S8NA 3E5UA 3F8FA 2O0YA 3NRVA 1LEAA 1OMIA 3E5XA 5JI6A 1JGSA 1WRJA 1DDNA 3PQJA 4HW0A 2V1XA 2IT0A 4FX0A 1BC7C 3F3XA 1UCRA 4Y15A 3F6VA 1R5GA 2P5KA 3IWFA 3ZN1A 1T38A 3CUQC 1B4AA 3ERED 2UXXA 1BI2A 1R1UA 4N9HA 3QU3A 2ZMEB 3RPUA 3O6BB 4KFCA 5FD6A 1V4RA 2VBYA 1YS6A 4A2UA 2CYYA 1U2WA 2CG4A 3SZPA 1XCBA 4BYYA 1VTNC 4LLLA 3ZMUA 2EWNA 2EFPA 5ILVA 2B0LA 2DQRA 4NB5A 3IWZA 4OOIA 4KIFA 4ZZDA 4HQEA 4DQ2A 2GA2A 3L00A 3ZMSA 3FM5A 3KLNA 3OOPA 2GWRA 2KKOA 4FHTA 4KT5C 5D4SA 2VN2A 2STWA 3HRUA 4EMSA 5E1XA 3M7GA 5FLXZ 2XIGA 2KJCA 4M6YA 4KA4A 1Z7UA 2EFOA 1SD4A 4I2OA 4BHBA 5ICCA 3H3ZA 3D0SA 4M9SA 3HSRA 5E1ZB 3FMRA 1HW5A 2P7CB 2IA1A 2NNNA 2E7WA 5D4RA 2QQAA 3E6MA 4WXHA 4N0BA 2H27A 2X0LA 2CGPA 3L9FA 4HF1A 4OIQF 4YFXF 4GXOA 5DV5A 1HSTA 5CVVA 2PJPA 4KIGA 3I59B 3IRQA 1BBYA 5E8GA 1IRFA 1HKTA 4L9VA 5EEGA 4MQ9F 1ZN2A 3KEOA 1SFEA 3LA2A 4RS8A 2HQNA 4LLGF 1H0MA 1HSJA 4MTDA 2DTRA 3KZYA 3J81Z 5BMZA 2A6HF 4IVNA 3LA3A 3EYIA 1MJAA 5J8FA 2XKOA 4CGZA 1RI7A 3GEZA 5L3GA 3RTRA 3L09A 1JHHA 4O5VA 3BJ6A 3QRFF 1LNWA 4IF4A 3K1PA 3RI4A 3RKYA 3NEUA 2O61A 2OAZA 3M8EA 1DPUA 2WWYA 3TOAA 1FYLA 3ZP5A 5K5RA 4EM0B 2EV6A 1XGSA 1XCVA 1IAWA 4MGRA 4CO8A 1SAXA 2RC4A 3BROA 1IXCA 4K2EA 2ZXJA 4M71A 3QP5A 4S04A 3E5QA 1E2XA 5LRRA 2A07F 5E8IA 1F1ZA 3RKXA 4NHJA 2DBBA 2O6GE 4ETSA 3I4PA 1P4AA 4QLCU 3SHFA 4RB0A 2QBYB 2MA3A 3WTXC 1FLIA 2HKXA 2MH2A 4P55A 5HLIA 1PP7U 4R8HA 4M9ZA 1BN5A 5J8CA 1L3LA 1U5TA 2YR2A 2UWMA 5D5WB 2EJRA 4HOBA 5CVIA 3SZTA 1YW8A 1REPC 3C7JA 4HZFA 2KRFA 2YU3A 3GFMA 1O7LA 3JTHA 5F6FA 3DFGA 1FBQA 1HKQA 2STTA 1P4XA 5ILSA 1HBXG 4FT8A 3F8BA 5FGMA 1W4MA 3I0TA 4LD5A 4B09A 3OV8A 1IN8A 3U1DA 2ZJ2A 2EA4A 1TNSA 1YG2A 3KP6A 3ECOA 3ZMVA 2ACJA 3ZQ7A 3S2WA 4QWQA 3WGHA 2ELHA 1TQIA 1H9TA 1YW9A 2W24A 4OIPF 2RKHA 1DP7P 2QZ8A 3R61A 1G4DA 4IJAA 3WE2A 1G3TA 4UV9A 4IHTA 3E6DA 4A12A 1TW3A 1MDMA 3IKTA 5DYMA 3DXJF 4LB5A 3FWEA 2BBYA 1Q1HA 3CDHA 1ZREA 1KU2A 4I7HA 5DCMB 2QUFA 1CGPA 1KU7A 3O3KA 1ODDA 2BV6A 2EB7A 2HTJA 4HV5A 4KMUX 2ZMEA 3ISPA 1USSA 1KA8A 2ETHA 4AIKA 4O3MA 2J5PA 3RYRA 4I09A 1BIBA 5DCFA 2QVOA 3RDIA 1Z05A 1GVJA 3HRSA 4WCGA 3H3UA 4A5NA 2XASA 3FXUA 4Y13A 2ZFWA 1W7PB 1UFMA 4HQMA 4U0YA 6PAXA 3TGNA 1QNTA 5HOOA 2V9VA 2ISZA 2FNAA 2O3FA 4GGGA 1KU3A 5HDGA 3E3VA 2GAUA 1R58A 1LB2A 3CUQA 1K78B 2ADUA 3M8FA 2V79A 1J9IA 1W7PD 1L0OC 3FMQA 1YW7A 3HYIA 4UXNA 4A0XA 3WU1B 3MAJA 2O03A 2V1UA 1QO0D 3EQLF 3ZMDA 3BPVA 2HYFA 3R0AA 3F8NA 1OR7A 4IRIA 2W57A 5DD8A 4EV0A 1MZBA 4BQAA 4XRFA 3QPTA 4YFKF 2PMHA 4EJWA 3TO9A 1B6AA 2QWWA 5FB2A 4BHCA 2JZYA 1P4WA 3W6JB 1ZHFA 2IRFG 1OYWA 1TQMA 3BPXA 1I1SA 2R7DA 2VC0A 2K86A 1HKSA 5JFRA 2LNBA 3GFLA 1SMYF 1ONVA 1HXDA 2JT1A 2VONA 4CZZA 4ZYHA 3KCCA 3GFIA 1IZ1A 5BPDA 5LHHA 3F6OA 3TOBA 3BDDA 5L3BA 5K5QA 5E18F 5F1RA 3VOEA 1HW1A 2J5OA 4RAZA 2FF4A 2F5EA 3FX3A 5LGNA 3C3WA 2OA4A 1FBSA 1U8RA 2FBKA 2TDXA 2FOKA 1ZAOA 3LFKA 1TNTA 4KN7X 3P9KA 1Z6TA 1ZYRF 2MLKA 1G6NA 2K02A 4L0ZB 1Z1DA 2RQPA 2JTVA 4DNCA 1ZG3A 1LDJA 3WTSC 2A5YB 4AVPA 3K0LA 3I54A 1BM9A 5DEQA 4MEXF 1ZLKA 3HTUA 5HLHA 5ED4A 4UNOA 3MZHA 4MHGA 1R7JA 2DU9A 1TLHB 2XUBA 1LVAA 2VBXA 1PP8F 4I01A 4HLXA 3RPQA 3ZN0A 5D6EA 2LKPA 4WXDA 3F8CA 4XSXF 3LQRA 3EUHA 4HDUA 2MBFA 1FP2A 5ICEA 4ZYEA 1AOYA 4UVCA 2Z99A 1YTYA 4I02A 4AIHA 1K79A 2DLLA 4L0YB 3RIRA 3REOA 3ABTA 5A2QK 1K78A 2A3SA 1QPMA 3T5XA 1XGMA 1HQCA 3ELKA 1XSDA 5JR3A 1IXSB 5BQTA 4PGGA 3TQNA 1EH7A 3ML6A 1U3EM 2NAZA 3LSTA 5LGUA 4G94A 1V3FA 3MWMA 5CVUA 2VXZA 3SFZA 2PBIA 3I5UA 4P96A 2OQRA 1R5HA 4CICA 2NYXA 1YS7A 4M6XA 2RDPA 4EVIA 2F5FA 2G9WA 2R3SA 5ICFA 3FM3A 2DT5A 1S7OA 5LHIA 1B59A 3K2ZA 5L3FA 4WWCA 2YX7A 1MGTA 1S3JA 2COMA 4AWXB 1QGPA 2ISYA 3EDPA 4Q48A 4JBAA 1WQ2A 2HQRA 1LEBA 1S6LA 2BE5F 4G7HF 1MKMA 5HLGA 2VE9A 1H9GA 2ESNA 3K69A 2FU4A 3LAPA 4CHUA 4HX4A 2JPCA 5L3DA 3HTSB 5DCMA 3WTTC 4P9UA 5L3CA 1EV7A 2D2WA 5E1WA 2P7VB 1G3YA 5HDKA 3T8TA 3EETA 3T8RA 2H6BA 1I6XA 3GZ6A 4Q47A 3JW4A 1BC8C 1FZPB 3ZMZA 2FEZA 1J75A 1PUEE 3C1DA 4ENMA 3FHZA 1B9MA 5IT3A 1R23A 2Z9OA 4RGSA 3WGGA 4R1HA 3MFKA 2P5LC 4HDVA 4A6DA 3V8LA 2QBYA 2F2EA 3MEXA 3V8KA 2JSCA 5AONA 2GXGA 1GXPA 1U78A 5D6FA 3U2RA 4OIRF 1Z91A 1O3QA 1B9NA 3KZZA 4XBFA 3MQ0A 1E17A 4Q5SF 3E6BA 1A04A 3KE2A 1JHFA 4U0VA 2VBWA 5E20A 1O3SA 5AIPA 4EJTA 2DAOA 1BOAA 4IPAA 1PDNC 1R36A 2ESHA 1FP1D 2MC3A 2D1VA 1FC3A 3GWZA 5D8LB 2VODA 4HX8A 1D8KA 4UUVA 4EM2A 1KYZA 1XMKA 2ZNYA 4HYEA 1OKRA 1T6SA 2EFWA 3I59A 1TBXA 3V7SA 1B1BA 2W84A 4WK8F 4PGHA 3RKWA 5KVRA 3J80Z 1LDKB 2PFBA 4RGXA 2EFQA 1STZA 3GW2A 2L4AA 3LA7A 1RZ4A 3QOPA 2XV4S 4OIOF 2CWEA 4CDGA 4P9FA 1Y0UA 2NRAC 2EA2A 2QYOA 3DF8A 3IKVA 3BP8A 1K7AA 4ESJA 5TJJA 4G9YA 3DQVC 4A5MA 1ZGJA 3H92A 4MQVA 3VFZA 1ZRFA 2V1DA 3HIFA 3HRTA 1J59A 3EYYA 3VODA 4JK1X 1XSVA 1YO5C 5FLXK 4A0YA 1YFHA 4HF0A 4EGYA 2D45A 1F5TA 2CSOA 2O8XA 1ULYA 2EV0A 2HOEA 2FMYA 3WG9A 4ZYGA 5ERIA 1JE8A 2OZ6A 2IVMA 4LK0F 2D1HA 4IHSA 4PCQA 1XB4A 4GYIA 5DDGA 2M30A 1S7AA 1IN7A 1HW2A 4LLNA 5E17F 4FX4A 1ZH5A 4LG0B 3T0YA 4ESFA 3LWFA 2Y0MA 1ZG1A 2IA0A 1T0FA 2MLGA 4RAYA 3KP7A 4A0ZA 4G8XA 2K4JA 3RJPA 2W25A 4O6JA 4CXFA 2F5DA 3HSFA 3VB2A 3IHUA 2YX4A 5L3EA 2H09A 4LJZF 4RB2C 3M1EA 4KUMA 4HX7A 1JXSA 3O2PE 5JHUA 2OBPA 2Q0OA 2M8EA 3G3ZA 2FA5A 2IP2A 3K1NA 4Y17A 2HGCA 4U88A 3DEUA 5K5OA 2F5CA 4L9JA 1SFXA 2FMLA 5K1YA 2EK5A 2UXNA 1XGOA 1XDSA 3E97A 2HS5A 4BNCA 2ZCWA 2V6CA 4HLYA 4ZH4F 4MNUA 3TDUC 4RB3C 5DUIA 1J7KA 2Q2EA 2A68F 2RN7A 1FPQA 1OPCA 2XAJA 1GHCA 3B73A 2X4HA 3MZYA 1F4KA 3HOSA 3F22A 4HAMA 1J0RA 1LJ9A 1UHWA 3V8JA 4N9IA 2HTSA 4M74A 3TO7A 1Z9CA 1S29A 3HHGA 3WTUC 4XLPF 1U6GA 2DPDA 2HDCA 2M87A 1P92A 1QBJA 2BYVE 1KU9A 5CVJA 5LEJA 2DPUA 3GLXA 4IRHA 4ENJA 2XROA 1MDMB 3TO6A 5IT9K 2ZBKA 5D5XB 3F21A 5LHGA 3KP4A 4I0BA 2E1CA 1ZGAA 2BEOA 5ICGA 2DI3A 5DUKA 1RUOA 2NNYA 2HZTA 3GUDA 4WXCA 4BAYA 4YIIA 2XAQA 1I5ZA 2A69F 2VOPA 1K6OA 4A6EA 2M5WA 5CYVA 4KYWA 4M9XA 2FE3A 3JSOA 3WE3A 3ULQB 1FYKA 4G7ZF 1P2FA 3AAFA 2FBIA 5LBQA 1FBUA 2WV0A 2PQ8A 2G7UA 4BXUA 1T98A 5BOXA 4OINF 3DKWA 1T39A 2DFIA 3F8MA 2Q8KA 1G3SA 3QP6A 4TV7A 1ON2A 1KYWA 2ZO4A 1IUYA 1BJAA 2CFXA 3CJNA 1KGSA 3FF5A 4UV8A 2GZWA 5FFXA 2RNJA 3CO6C 2P6SA 2CQKA 3QAHA 2WC2A 2R7FA 1UHMA 3B02A 5AIQA 4IRGA 3HSEA 2DK8A 1IN5A 2L4MA 2RVCA 4PDKA 3GVAA 3KP3A 4ZZLA 2HR3A 3TKYA 1SD6A 1SD7A 3J7AO 1SD5A 5J6XA 1TQPA 2CO5A 4XLNF 1XDUA 4L5IA 3L7WA 2OQGA 1C0WA 2G7HA 1BI3A 3JAMZ 4LFUA 4KN4X 2GXBA 3GXOA 4PZJA 3I71A 2QENA 2EV5A 2JRTA 3FZVA 4M72A 1IW7F 2GA1A 2XAHA 2Z5UA 4GYGA 4I98B 2LF7A 2OZUA 3R60A 5DD4A 4LGWA 2HFHA 4BH9A 2DW4A 1LDDA 4NQWA 2OD5A 1O7FA 1YQAA 2PG4A 3ECHA 5HS8A 4OMYA 2L02A 3HRMA 3Q5FA 5HS7A 3N97A 5H20A 2MD5A 2YSRA 5TRDA 4HBLA 2DK5A 4ON0A 1AWCA 4EM1A 2EFNA 5BS6A 3NQOA 1J2XA 2VOOA 3WTZA 1FX7A 3DPTA 2E7XA 3KEQA 2XRNA 2MH9A 4OU0A 2P8TA 4G6QA 4LG0A 4L5JA 3KETA 1RIOH 1TW2A 3JAMK 1W5TA 1IF1A 4RGRA 1R1TA 4G7OF 2FSWA 1W7PA 4JQFA 1IXRC 3KFWX 5CVRA 2C6YA 3V7RA 1RNLA 3COAC 4U0WA 3V7CA 5FD5A 4WF2A 3WTYC 3KP5A 3U9GA 2M1BA 1BIAA 3HOTA 4KNYA 4D0PA 3DP7A 3E6CC 3W6KB 3PFIA 2QLZA 1TTYA 3SXYA 4AIJA 3GO5A 5JVTA 4P5OA 3T1BA 5LLQA 4Q4ZF 2YPRA 3M9AA 5HS9A 4Z2YA 4UHTA 2FBHA 3F72A 3I53A 2DO7A 3ROUA 3BOQA 2Y48A 1O3RA 2GIVA 3BY6A 5HVQC 4LK1F 2XVCA 4U7BA 1Z6RA 4B8XA 2FQ3A 3Q9VA 5EEHA 3ZMTA 3WTWC 3KP2A 2LDUA 5LRSA 4E70A 4U7DA 5D5VB 4M73A 3IL2A 2K7LA 1RUNA 1FY7A 2IA2A 1KQ9A 5FFZA 2UZKA 1R22A 2QQBA 1UB9A 1I1GA 1QQIA 2IJLA 1IRGA 1FWZA 3K1MA 1CF7B 3DPLC 2HWVA 2P6TA 4WX9A 1FNNA 4XSZF 2KIFA 4ZYDA 2PI0A 3WTVC 4KICA 2LF8A 3J80K 1FSEA 2PLYA 2IW5A 2PMUA 2L3DA 3CTAA 1XSXA 1O57A 1ZG5A 2QQ9A 2AS5F 4ESBA 1MJBA 3ABUA 2BGCA 2HKOA 1ZARA 2Y75A 1R00A 1CF7A 4GCVA 2IPQX 1BI1A 4HA8A 3LQQA 4L18B 2OU2A 3V4GA 4UVAA 4YG2F 4L9NA 3R6SA 4UVBA 5HDNA 3BJAA 4L9TA 1ZRDA 1XD7A 5IT9Z 1EH8A 2VT3A 3KLOA 2PEXA 2FRHA 2KJBA 1U5TB 2VBZA 3WODF 4MEYF 3L2CA 2VC1A 3CUQB 3F23A 2AXLA 4AD9A 2JPBA 2VE8A 3J81K 5LEKA 3GYHX 1D3YA 3WGIA 4R79A 3PQKA 3GX4X 4ENNA 5FO5A 1NHAA 3C18A 2P5VA 1DUXC 3K9TA 4I0AA 2P4WA 4LMYA 4YIFA 3N4MA 1YYVA 1ZLJA 1MJ9A 2HEOA 2RGVA 5H6QA 3GFJA 1WKMA 3BZ6A 4EJVA 1FYMA 1P6RA 4HV6A 2M45A 3I64A 5KK1A 1OYIA 1ON1A 4GO1A 5LGTA 4RGUA 5ILUA 1WI9A 2W85A 1J5YA 4EQQA 3HUGA 1FOKA 1MD0A 1WSUA 5CLSA 3WU0A 3IRRA 1LQ1A 1IN6A 2FXAA 3RYPA 1QZZA 3R4KA 4LB6B 1T2KA 3DV8A 3ZPLA 2RV8A 2LSOA 1IN4A 1I27A 1GXQA 3JSPA 3TDZC 1DPRA 2GQQA 5A2QZ 5D5UB 1EH6A 4YFNF 3GZ5A 2DQLA 1QZYA 3BWGA 3HHHA 3CLOA 1YIOA 5D8KB 2WTEA 2FNPA 4KDPA 2A6EF 3P9CA 3FMSA 3CO7C 1D8JA 1WWXA 4EJUA 3SQNA 2XKPA 2XAGA 3QU6A 3FXRA 4HF2A 2QM3A 1W5SA 3CUOA 1U5TC 3G73A 1R1VA 2NS0A 4BHPA 1XN7A 2ZNZA 3MCZA 2KIUA 3JTGA 2E1NA 4OMZA 4ASNA 2H6CA 2CW0F 2KIMA 3GF2A 3P9IA 1SFUA 3BJOA 4MTEA 2Z3YA 2PN6A 2XHKA 1X3UA 3P7NA 1SMTA 3D5LA 4RB1A 1XMAA 1O3TA 1ZRCA 3IC7A 3LAJA 1XGNA 4G6DA 5F64A 2Z33A 4H0EA 1BI0A 4KMFA 1F9NA 3R0JA 5BPIA 3FXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L01 A;  2VT2 A;  4CYD A;  3VEP A;  1FSH A;  1OYY A;  4S05 A;  5H6R A;  3I58 A;  1G3W A;  1KQ0 A;  2HYG D;  4IXA A;  2K4B A;  4EGZ A;  4F7Z A;  1KQ8 A;  3QPH A;  2XGX A;  1D5V A;  4KIB A;  2ZKZ A;  1UST A;  2A61 A;  2K27 A;  1YLF A;  2H94 A;  5CJ9 A;  4ENK A;  1FT9 A;  4EJO A;  3Q9S A;  2XAF A;  2L54 A;  1S8N A;  3E5U A;  3F8F A;  2O0Y A;  3NRV A;  1LEA A;  1OMI A;  3E5X A;  5JI6 A;  1JGS A;  1WRJ A;  1DDN A;  3PQJ A;  4HW0 A;  2V1X A;  2IT0 A;  4FX0 A;  1BC7 C;  3F3X A;  1UCR A;  4Y15 A;  3F6V A;  1R5G A;  2P5K A;  3IWF A;  3ZN1 A;  1T38 A;  3CUQ C;  1B4A A;  3ERE D;  2UXX A;  1BI2 A;  1R1U A;  4N9H A;  3QU3 A;  2ZME B;  3RPU A;  3O6B B;  4KFC A;  5FD6 A;  1V4R A;  2VBY A;  1YS6 A;  4A2U A;  2CYY A;  1U2W A;  2CG4 A;  3SZP A;  1XCB A;  4BYY A;  1VTN C;  4LLL A;  3ZMU A;  2EWN A;  2EFP A;  5ILV A;  2B0L A;  2DQR A;  4NB5 A;  3IWZ A;  4OOI A;  4KIF A;  4ZZD A;  4HQE A;  4DQ2 A;  2GA2 A;  3L00 A;  3ZMS A;  3FM5 A;  3KLN A;  3OOP A;  2GWR A;  2KKO A;  4FHT A;  4KT5 C;  5D4S A;  2VN2 A;  2STW A;  3HRU A;  4EMS A;  5E1X A;  3M7G A;  5FLX Z;  2XIG A;  2KJC A;  4M6Y A;  4KA4 A;  1Z7U A;  2EFO A;  1SD4 A;  4I2O A;  4BHB A;  5ICC A;  3H3Z A;  3D0S A;  4M9S A;  3HSR A;  5E1Z B;  3FMR A;  1HW5 A;  2P7C B;  2IA1 A;  2NNN A;  2E7W A;  5D4R A;  2QQA A;  3E6M A;  4WXH A;  4N0B A;  2H27 A;  2X0L A;  2CGP A;  3L9F A;  4HF1 A;  4OIQ F;  4YFX F;  4GXO A;  5DV5 A;  1HST A;  5CVV A;  2PJP A;  4KIG A;  3I59 B;  3IRQ A;  1BBY A;  5E8G A;  1IRF A;  1HKT A;  4L9V A;  5EEG A;  4MQ9 F;  1ZN2 A;  3KEO A;  1SFE A;  3LA2 A;  4RS8 A;  2HQN A;  4LLG F;  1H0M A;  1HSJ A;  4MTD A;  2DTR A;  3KZY A;  3J81 Z;  5BMZ A;  2A6H F;  4IVN A;  3LA3 A;  3EYI A;  1MJA A;  5J8F A;  2XKO A;  4CGZ A;  1RI7 A;  3GEZ A;  5L3G A;  3RTR A;  3L09 A;  1JHH A;  4O5V A;  3BJ6 A;  3QRF F;  1LNW A;  4IF4 A;  3K1P A;  3RI4 A;  3RKY A;  3NEU A;  2O61 A;  2OAZ A;  3M8E A;  1DPU A;  2WWY A;  3TOA A;  1FYL A;  3ZP5 A;  5K5R A;  4EM0 B;  2EV6 A;  1XGS A;  1XCV A;  1IAW A;  4MGR A;  4CO8 A;  1SAX A;  2RC4 A;  3BRO A;  1IXC A;  4K2E A;  2ZXJ A;  4M71 A;  3QP5 A;  4S04 A;  3E5Q A;  1E2X A;  5LRR A;  2A07 F;  5E8I A;  1F1Z A;  3RKX A;  4NHJ A;  2DBB A;  2O6G E;  4ETS A;  3I4P A;  1P4A A;  4QLC U;  3SHF A;  4RB0 A;  2QBY B;  2MA3 A;  3WTX C;  1FLI A;  2HKX A;  2MH2 A;  4P55 A;  5HLI A;  1PP7 U;  4R8H A;  4M9Z A;  1BN5 A;  5J8C A;  1L3L A;  1U5T A;  2YR2 A;  2UWM A;  5D5W B;  2EJR A;  4HOB A;  5CVI A;  3SZT A;  1YW8 A;  1REP C;  3C7J A;  4HZF A;  2KRF A;  2YU3 A;  3GFM A;  1O7L A;  3JTH A;  5F6F A;  3DFG A;  1FBQ A;  1HKQ A;  2STT A;  1P4X A;  5ILS A;  1HBX G;  4FT8 A;  3F8B A;  5FGM A;  1W4M A;  3I0T A;  4LD5 A;  4B09 A;  3OV8 A;  1IN8 A;  3U1D A;  2ZJ2 A;  2EA4 A;  1TNS A;  1YG2 A;  3KP6 A;  3ECO A;  3ZMV A;  2ACJ A;  3ZQ7 A;  3S2W A;  4QWQ A;  3WGH A;  2ELH A;  1TQI A;  1H9T A;  1YW9 A;  2W24 A;  4OIP F;  2RKH A;  1DP7 P;  2QZ8 A;  3R61 A;  1G4D A;  4IJA A;  3WE2 A;  1G3T A;  4UV9 A;  4IHT A;  3E6D A;  4A12 A;  1TW3 A;  1MDM A;  3IKT A;  5DYM A;  3DXJ F;  4LB5 A;  3FWE A;  2BBY A;  1Q1H A;  3CDH A;  1ZRE A;  1KU2 A;  4I7H A;  5DCM B;  2QUF A;  1CGP A;  1KU7 A;  3O3K A;  1ODD A;  2BV6 A;  2EB7 A;  2HTJ A;  4HV5 A;  4KMU X;  2ZME A;  3ISP A;  1USS A;  1KA8 A;  2ETH A;  4AIK A;  4O3M A;  2J5P A;  3RYR A;  4I09 A;  1BIB A;  5DCF A;  2QVO A;  3RDI A;  1Z05 A;  1GVJ A;  3HRS A;  4WCG A;  3H3U A;  4A5N A;  2XAS A;  3FXU A;  4Y13 A;  2ZFW A;  1W7P B;  1UFM A;  4HQM A;  4U0Y A;  6PAX A;  3TGN A;  1QNT A;  5HOO A;  2V9V A;  2ISZ A;  2FNA A;  2O3F A;  4GGG A;  1KU3 A;  5HDG A;  3E3V A;  2GAU A;  1R58 A;  1LB2 A;  3CUQ A;  1K78 B;  2ADU A;  3M8F A;  2V79 A;  1J9I A;  1W7P D;  1L0O C;  3FMQ A;  1YW7 A;  3HYI A;  4UXN A;  4A0X A;  3WU1 B;  3MAJ A;  2O03 A;  2V1U A;  1QO0 D;  3EQL F;  3ZMD A;  3BPV A;  2HYF A;  3R0A A;  3F8N A;  1OR7 A;  4IRI A;  2W57 A;  5DD8 A;  4EV0 A;  1MZB A;  4BQA A;  4XRF A;  3QPT A;  4YFK F;  2PMH A;  4EJW A;  3TO9 A;  1B6A A;  2QWW A;  5FB2 A;  4BHC A;  2JZY A;  1P4W A;  3W6J B;  1ZHF A;  2IRF G;  1OYW A;  1TQM A;  3BPX A;  1I1S A;  2R7D A;  2VC0 A;  2K86 A;  1HKS A;  5JFR A;  2LNB A;  3GFL A;  1SMY F;  1ONV A;  1HXD A;  2JT1 A;  2VON A;  4CZZ A;  4ZYH A;  3KCC A;  3GFI A;  1IZ1 A;  5BPD A;  5LHH A;  3F6O A;  3TOB A;  3BDD A;  5L3B A;  5K5Q A;  5E18 F;  5F1R A;  3VOE A;  1HW1 A;  2J5O A;  4RAZ A;  2FF4 A;  2F5E A;  3FX3 A;  5LGN A;  3C3W A;  2OA4 A;  1FBS A;  1U8R A;  2FBK A;  2TDX A;  2FOK A;  1ZAO A;  3LFK A;  1TNT A;  4KN7 X;  3P9K A;  1Z6T A;  1ZYR F;  2MLK A;  1G6N A;  2K02 A;  4L0Z B;  1Z1D A;  2RQP A;  2JTV A;  4DNC A;  1ZG3 A;  1LDJ A;  3WTS C;  2A5Y B;  4AVP A;  3K0L A;  3I54 A;  1BM9 A;  5DEQ A;  4MEX F;  1ZLK A;  3HTU A;  5HLH A;  5ED4 A;  4UNO A;  3MZH A;  4MHG A;  1R7J A;  2DU9 A;  1TLH B;  2XUB A;  1LVA A;  2VBX A;  1PP8 F;  4I01 A;  4HLX A;  3RPQ A;  3ZN0 A;  5D6E A;  2LKP A;  4WXD A;  3F8C A;  4XSX F;  3LQR A;  3EUH A;  4HDU A;  2MBF A;  1FP2 A;  5ICE A;  4ZYE A;  1AOY A;  4UVC A;  2Z99 A;  1YTY A;  4I02 A;  4AIH A;  1K79 A;  2DLL A;  4L0Y B;  3RIR A;  3REO A;  3ABT A;  5A2Q K;  1K78 A;  2A3S A;  1QPM A;  3T5X A;  1XGM A;  1HQC A;  3ELK A;  1XSD A;  5JR3 A;  1IXS B;  5BQT A;  4PGG A;  3TQN A;  1EH7 A;  3ML6 A;  1U3E M;  2NAZ A;  3LST A;  5LGU A;  4G94 A;  1V3F A;  3MWM A;  5CVU A;  2VXZ A;  3SFZ A;  2PBI A;  3I5U A;  4P96 A;  2OQR A;  1R5H A;  4CIC A;  2NYX A;  1YS7 A;  4M6X A;  2RDP A;  4EVI A;  2F5F A;  2G9W A;  2R3S A;  5ICF A;  3FM3 A;  2DT5 A;  1S7O A;  5LHI A;  1B59 A;  3K2Z A;  5L3F A;  4WWC A;  2YX7 A;  1MGT A;  1S3J A;  2COM A;  4AWX B;  1QGP A;  2ISY A;  3EDP A;  4Q48 A;  4JBA A;  1WQ2 A;  2HQR A;  1LEB A;  1S6L A;  2BE5 F;  4G7H F;  1MKM A;  5HLG A;  2VE9 A;  1H9G A;  2ESN A;  3K69 A;  2FU4 A;  3LAP A;  4CHU A;  4HX4 A;  2JPC A;  5L3D A;  3HTS B;  5DCM A;  3WTT C;  4P9U A;  5L3C A;  1EV7 A;  2D2W A;  5E1W A;  2P7V B;  1G3Y A;  5HDK A;  3T8T A;  3EET A;  3T8R A;  2H6B A;  1I6X A;  3GZ6 A;  4Q47 A;  3JW4 A;  1BC8 C;  1FZP B;  3ZMZ A;  2FEZ A;  1J75 A;  1PUE E;  3C1D A;  4ENM A;  3FHZ A;  1B9M A;  5IT3 A;  1R23 A;  2Z9O A;  4RGS A;  3WGG A;  4R1H A;  3MFK A;  2P5L C;  4HDV A;  4A6D A;  3V8L A;  2QBY A;  2F2E A;  3MEX A;  3V8K A;  2JSC A;  5AON A;  2GXG A;  1GXP A;  1U78 A;  5D6F A;  3U2R A;  4OIR F;  1Z91 A;  1O3Q A;  1B9N A;  3KZZ A;  4XBF A;  3MQ0 A;  1E17 A;  4Q5S F;  3E6B A;  1A04 A;  3KE2 A;  1JHF A;  4U0V A;  2VBW A;  5E20 A;  1O3S A;  5AIP A;  4EJT A;  2DAO A;  1BOA A;  4IPA A;  1PDN C;  1R36 A;  2ESH A;  1FP1 D;  2MC3 A;  2D1V A;  1FC3 A;  3GWZ A;  5D8L B;  2VOD A;  4HX8 A;  1D8K A;  4UUV A;  4EM2 A;  1KYZ A;  1XMK A;  2ZNY A;  4HYE A;  1OKR A;  1T6S A;  2EFW A;  3I59 A;  1TBX A;  3V7S A;  1B1B A;  2W84 A;  4WK8 F;  4PGH A;  3RKW A;  5KVR A;  3J80 Z;  1LDK B;  2PFB A;  4RGX A;  2EFQ A;  1STZ A;  3GW2 A;  2L4A A;  3LA7 A;  1RZ4 A;  3QOP A;  2XV4 S;  4OIO F;  2CWE A;  4CDG A;  4P9F A;  1Y0U A;  2NRA C;  2EA2 A;  2QYO A;  3DF8 A;  3IKV A;  3BP8 A;  1K7A A;  4ESJ A;  5TJJ A;  4G9Y A;  3DQV C;  4A5M A;  1ZGJ A;  3H92 A;  4MQV A;  3VFZ A;  1ZRF A;  2V1D A;  3HIF A;  3HRT A;  1J59 A;  3EYY A;  3VOD A;  4JK1 X;  1XSV A;  1YO5 C;  5FLX K;  4A0Y A;  1YFH A;  4HF0 A;  4EGY A;  2D45 A;  1F5T A;  2CSO A;  2O8X A;  1ULY A;  2EV0 A;  2HOE A;  2FMY A;  3WG9 A;  4ZYG A;  5ERI A;  1JE8 A;  2OZ6 A;  2IVM A;  4LK0 F;  2D1H A;  4IHS A;  4PCQ A;  1XB4 A;  4GYI A;  5DDG A;  2M30 A;  1S7A A;  1IN7 A;  1HW2 A;  4LLN A;  5E17 F;  4FX4 A;  1ZH5 A;  4LG0 B;  3T0Y A;  4ESF A;  3LWF A;  2Y0M A;  1ZG1 A;  2IA0 A;  1T0F A;  2MLG A;  4RAY A;  3KP7 A;  4A0Z A;  4G8X A;  2K4J A;  3RJP A;  2W25 A;  4O6J A;  4CXF A;  2F5D A;  3HSF A;  3VB2 A;  3IHU A;  2YX4 A;  5L3E A;  2H09 A;  4LJZ F;  4RB2 C;  3M1E A;  4KUM A;  4HX7 A;  1JXS A;  3O2P E;  5JHU A;  2OBP A;  2Q0O A;  2M8E A;  3G3Z A;  2FA5 A;  2IP2 A;  3K1N A;  4Y17 A;  2HGC A;  4U88 A;  3DEU A;  5K5O A;  2F5C A;  4L9J A;  1SFX A;  2FML A;  5K1Y A;  2EK5 A;  2UXN A;  1XGO A;  1XDS A;  3E97 A;  2HS5 A;  4BNC A;  2ZCW A;  2V6C A;  4HLY A;  4ZH4 F;  4MNU A;  3TDU C;  4RB3 C;  5DUI A;  1J7K A;  2Q2E A;  2A68 F;  2RN7 A;  1FPQ A;  1OPC A;  2XAJ A;  1GHC A;  3B73 A;  2X4H A;  3MZY A;  1F4K A;  3HOS A;  3F22 A;  4HAM A;  1J0R A;  1LJ9 A;  1UHW A;  3V8J A;  4N9I A;  2HTS A;  4M74 A;  3TO7 A;  1Z9C A;  1S29 A;  3HHG A;  3WTU C;  4XLP F;  1U6G A;  2DPD A;  2HDC A;  2M87 A;  1P92 A;  1QBJ A;  2BYV E;  1KU9 A;  5CVJ A;  5LEJ A;  2DPU A;  3GLX A;  4IRH A;  4ENJ A;  2XRO A;  1MDM B;  3TO6 A;  5IT9 K;  2ZBK A;  5D5X B;  3F21 A;  5LHG A;  3KP4 A;  4I0B A;  2E1C A;  1ZGA A;  2BEO A;  5ICG A;  2DI3 A;  5DUK A;  1RUO A;  2NNY A;  2HZT A;  3GUD A;  4WXC A;  4BAY A;  4YII A;  2XAQ A;  1I5Z A;  2A69 F;  2VOP A;  1K6O A;  4A6E A;  2M5W A;  5CYV A;  4KYW A;  4M9X A;  2FE3 A;  3JSO A;  3WE3 A;  3ULQ B;  1FYK A;  4G7Z F;  1P2F A;  3AAF A;  2FBI A;  5LBQ A;  1FBU A;  2WV0 A;  2PQ8 A;  2G7U A;  4BXU A;  1T98 A;  5BOX A;  4OIN F;  3DKW A;  1T39 A;  2DFI A;  3F8M A;  2Q8K A;  1G3S A;  3QP6 A;  4TV7 A;  1ON2 A;  1KYW A;  2ZO4 A;  1IUY A;  1BJA A;  2CFX A;  3CJN A;  1KGS A;  3FF5 A;  4UV8 A;  2GZW A;  5FFX A;  2RNJ A;  3CO6 C;  2P6S A;  2CQK A;  3QAH A;  2WC2 A;  2R7F A;  1UHM A;  3B02 A;  5AIQ A;  4IRG A;  3HSE A;  2DK8 A;  1IN5 A;  2L4M A;  2RVC A;  4PDK A;  3GVA A;  3KP3 A;  4ZZL A;  2HR3 A;  3TKY A;  1SD6 A;  1SD7 A;  3J7A O;  1SD5 A;  5J6X A;  1TQP A;  2CO5 A;  4XLN F;  1XDU A;  4L5I A;  3L7W A;  2OQG A;  1C0W A;  2G7H A;  1BI3 A;  3JAM Z;  4LFU A;  4KN4 X;  2GXB A;  3GXO A;  4PZJ A;  3I71 A;  2QEN A;  2EV5 A;  2JRT A;  3FZV A;  4M72 A;  1IW7 F;  2GA1 A;  2XAH A;  2Z5U A;  4GYG A;  4I98 B;  2LF7 A;  2OZU A;  3R60 A;  5DD4 A;  4LGW A;  2HFH A;  4BH9 A;  2DW4 A;  1LDD A;  4NQW A;  2OD5 A;  1O7F A;  1YQA A;  2PG4 A;  3ECH A;  5HS8 A;  4OMY A;  2L02 A;  3HRM A;  3Q5F A;  5HS7 A;  3N97 A;  5H20 A;  2MD5 A;  2YSR A;  5TRD A;  4HBL A;  2DK5 A;  4ON0 A;  1AWC A;  4EM1 A;  2EFN A;  5BS6 A;  3NQO A;  1J2X A;  2VOO A;  3WTZ A;  1FX7 A;  3DPT A;  2E7X A;  3KEQ A;  2XRN A;  2MH9 A;  4OU0 A;  2P8T A;  4G6Q A;  4LG0 A;  4L5J A;  3KET A;  1RIO H;  1TW2 A;  3JAM K;  1W5T A;  1IF1 A;  4RGR A;  1R1T A;  4G7O F;  2FSW A;  1W7P A;  4JQF A;  1IXR C;  3KFW X;  5CVR A;  2C6Y A;  3V7R A;  1RNL A;  3COA C;  4U0W A;  3V7C A;  5FD5 A;  4WF2 A;  3WTY C;  3KP5 A;  3U9G A;  2M1B A;  1BIA A;  3HOT A;  4KNY A;  4D0P A;  3DP7 A;  3E6C C;  3W6K B;  3PFI A;  2QLZ A;  1TTY A;  3SXY A;  4AIJ A;  3GO5 A;  5JVT A;  4P5O A;  3T1B A;  5LLQ A;  4Q4Z F;  2YPR A;  3M9A A;  5HS9 A;  4Z2Y A;  4UHT A;  2FBH A;  3F72 A;  3I53 A;  2DO7 A;  3ROU A;  3BOQ A;  2Y48 A;  1O3R A;  2GIV A;  3BY6 A;  5HVQ C;  4LK1 F;  2XVC A;  4U7B A;  1Z6R A;  4B8X A;  2FQ3 A;  3Q9V A;  5EEH A;  3ZMT A;  3WTW C;  3KP2 A;  2LDU A;  5LRS A;  4E70 A;  4U7D A;  5D5V B;  4M73 A;  3IL2 A;  2K7L A;  1RUN A;  1FY7 A;  2IA2 A;  1KQ9 A;  5FFZ A;  2UZK A;  1R22 A;  2QQB A;  1UB9 A;  1I1G A;  1QQI A;  2IJL A;  1IRG A;  1FWZ A;  3K1M A;  1CF7 B;  3DPL C;  2HWV A;  2P6T A;  4WX9 A;  1FNN A;  4XSZ F;  2KIF A;  4ZYD A;  2PI0 A;  3WTV C;  4KIC A;  2LF8 A;  3J80 K;  1FSE A;  2PLY A;  2IW5 A;  2PMU A;  2L3D A;  3CTA A;  1XSX A;  1O57 A;  1ZG5 A;  2QQ9 A;  2AS5 F;  4ESB A;  1MJB A;  3ABU A;  2BGC A;  2HKO A;  1ZAR A;  2Y75 A;  1R00 A;  1CF7 A;  4GCV A;  2IPQ X;  1BI1 A;  4HA8 A;  3LQQ A;  4L18 B;  2OU2 A;  3V4G A;  4UVA A;  4YG2 F;  4L9N A;  3R6S A;  4UVB A;  5HDN A;  3BJA A;  4L9T A;  1ZRD A;  1XD7 A;  5IT9 Z;  1EH8 A;  2VT3 A;  3KLO A;  2PEX A;  2FRH A;  2KJB A;  1U5T B;  2VBZ A;  3WOD F;  4MEY F;  3L2C A;  2VC1 A;  3CUQ B;  3F23 A;  2AXL A;  4AD9 A;  2JPB A;  2VE8 A;  3J81 K;  5LEK A;  3GYH X;  1D3Y A;  3WGI A;  4R79 A;  3PQK A;  3GX4 X;  4ENN A;  5FO5 A;  1NHA A;  3C18 A;  2P5V A;  1DUX C;  3K9T A;  4I0A A;  2P4W A;  4LMY A;  4YIF A;  3N4M A;  1YYV A;  1ZLJ A;  1MJ9 A;  2HEO A;  2RGV A;  5H6Q A;  3GFJ A;  1WKM A;  3BZ6 A;  4EJV A;  1FYM A;  1P6R A;  4HV6 A;  2M45 A;  3I64 A;  5KK1 A;  1OYI A;  1ON1 A;  4GO1 A;  5LGT A;  4RGU A;  5ILU A;  1WI9 A;  2W85 A;  1J5Y A;  4EQQ A;  3HUG A;  1FOK A;  1MD0 A;  1WSU A;  5CLS A;  3WU0 A;  3IRR A;  1LQ1 A;  1IN6 A;  2FXA A;  3RYP A;  1QZZ A;  3R4K A;  4LB6 B;  1T2K A;  3DV8 A;  3ZPL A;  2RV8 A;  2LSO A;  1IN4 A;  1I27 A;  1GXQ A;  3JSP A;  3TDZ C;  1DPR A;  2GQQ A;  5A2Q Z;  5D5U B;  1EH6 A;  4YFN F;  3GZ5 A;  2DQL A;  1QZY A;  3BWG A;  3HHH A;  3CLO A;  1YIO A;  5D8K B;  2WTE A;  2FNP A;  4KDP A;  2A6E F;  3P9C A;  3FMS A;  3CO7 C;  1D8J A;  1WWX A;  4EJU A;  3SQN A;  2XKP A;  2XAG A;  3QU6 A;  3FXR A;  4HF2 A;  2QM3 A;  1W5S A;  3CUO A;  1U5T C;  3G73 A;  1R1V A;  2NS0 A;  4BHP A;  1XN7 A;  2ZNZ A;  3MCZ A;  2KIU A;  3JTG A;  2E1N A;  4OMZ A;  4ASN A;  2H6C A;  2CW0 F;  2KIM A;  3GF2 A;  3P9I A;  1SFU A;  3BJO A;  4MTE A;  2Z3Y A;  2PN6 A;  2XHK A;  1X3U A;  3P7N A;  1SMT A;  3D5L A;  4RB1 A;  1XMA A;  1O3T A;  1ZRC A;  3IC7 A;  3LAJ A;  1XGN A;  4G6D A;  5F64 A;  2Z33 A;  4H0E A;  1BI0 A;  4KMF A;  1F9N A;  3R0J A;  5BPI A;  3FXQ A; 
#chains in the Genus database with same CATH topology
 2L01 A;  2VT2 A;  4PJM A;  3HM5 A;  4CYD A;  4XLA A;  2IGK A;  3VEP A;  1ETX A;  1FSH A;  4E7L A;  1OYY A;  4S05 A;  5H6R A;  3JRG A;  2I10 A;  2WAQ A;  3I58 A;  1HA8 A;  1G3W A;  1KQ0 A;  1T95 A;  2HXO A;  2HYG D;  2M9H A;  2DA7 A;  4M6V A;  3I4N J;  3OYM A;  4IXA A;  2CMP A;  2K4B A;  2NVY J;  3E1S A;  4EGZ A;  1Y39 A;  1D0Z A;  4F7Z A;  1KQ8 A;  1ZR4 A;  1MBK A;  5FJ8 J;  4J19 A;  2W82 A;  1B8I B;  2M2E A;  2XGX A;  3QPH A;  1YE9 A;  4PSW A;  1D5V A;  4KIB A;  2NS8 A;  2ZKZ A;  1UST A;  1JUP A;  2V9P A;  3MKY B;  4XRM A;  2A61 A;  2K27 A;  4BE1 A;  3BR0 A;  3ZCO A;  1YLF A;  4BQQ A;  2H94 A;  2P0W A;  3G2B A;  5CJ9 A;  4ENK A;  1KZH A;  1FT9 A;  4EJO A;  4BY1 J;  2Q2E B;  5J1U A;  3Q9S A;  1WI3 A;  1OCO H;  2XAF A;  4C2U A;  2L54 A;  3IH4 A;  1S8N A;  3I56 I;  3E5U A;  3F8F A;  2O0Y A;  1D5Y A;  2CU7 A;  2ID6 A;  2Y9Z A;  1D1C A;  2R7V A;  3NRV A;  1LEA A;  1TL8 A;  1MMD A;  1OMI A;  2K5C A;  3E5X A;  3AG2 H;  5JI6 A;  1JGS A;  1WRJ A;  1DDN A;  3ABL H;  3DTI A;  3PQJ A;  3PFY A;  4HW0 A;  2V1X A;  2IT0 A;  4KJZ A;  3BR6 A;  4FX0 A;  1BC7 C;  1I3A A;  3F3X A;  1UCR A;  3CCY A;  4IX7 A;  4Y15 A;  2BXY A;  2LY2 A;  3F6V A;  4ZC3 A;  1R5G A;  3ZQQ A;  1QHG A;  2P5K A;  3IWF A;  3ZN1 A;  5J4Y A;  1T38 A;  3CUQ C;  1B4A A;  3ERE D;  2UXX A;  2BXZ A;  3VPR A;  2H8R A;  2V6E A;  4F92 B;  1BI2 A;  2K40 A;  4XKV A;  1R1U A;  4N9H A;  2QSF X;  3QU3 A;  1H89 C;  2ZME B;  4BY7 J;  3RPU A;  4C30 A;  3O6B B;  4KFC A;  2WB1 A;  5FD6 A;  2DXI A;  1V4R A;  3JRE A;  2VBY A;  4E7K A;  1YS6 A;  2M3A A;  3ZQH A;  2ZJR F;  4A2U A;  2CYY A;  3K4L A;  1U2W A;  2CG4 A;  4B3A A;  1ENH A;  4XM3 A;  5JVG F;  1MND A;  3QOD A;  3SZP A;  3QOE A;  3D5S C;  2LLK A;  2VKV A;  4V19 K;  3RZO J;  1V55 H;  1WJF A;  5GPC A;  3IAM 2;  1XCB A;  4BYY A;  3HPH A;  1VTN C;  1QU3 A;  2DFF A;  2W7N A;  4LLL A;  3ZMU A;  2EWN A;  2EFP A;  3HC7 A;  1Z7L A;  5ILV A;  2B0L A;  2DQR A;  4NB5 A;  3IWZ A;  4OOI A;  4KIF A;  2DMT A;  1SAN A;  2WAF A;  4ZZD A;  3ZOB A;  3GTK J;  4HQE A;  4XRS A;  4DQ2 A;  2GA2 A;  3L00 A;  3ZMS A;  5E3M A;  2DA3 A;  3FM5 A;  3KLN A;  3OOP A;  2GWR A;  1PYV A;  2KKO A;  3LSG A;  4FHT A;  2VN2 A;  4KT5 C;  3HRU A;  5D4S A;  2STW A;  4EMS A;  4BQN A;  2CFO A;  2CUF A;  4MLO A;  5E1X A;  5GAH J;  3M7G A;  3BTC A;  5FLX Z;  2XIG A;  2E1M B;  2KJC A;  5B1B H;  4M6Y A;  1MBF A;  4KA4 A;  1Z7U A;  2EFO A;  3OYB A;  1SD4 A;  3IH3 A;  2CS3 A;  2F4M B;  3ASN H;  5EDN A;  4I2O A;  1JKP C;  4BHB A;  4II2 A;  5ICC A;  4X6A J;  2XPW A;  5GP9 A;  1MSF C;  2K9N A;  5IYD J;  3HXL A;  3CCR I;  3H3Z A;  3OYE A;  3D0S A;  4CZC A;  4M9S A;  3GME A;  3HSR A;  2R7S A;  1LUJ B;  1WVR A;  1HW5 A;  3FMR A;  5E1Z B;  2IA1 A;  3OYG A;  2P7C B;  2AO9 A;  2NNN A;  1Z3X A;  1ETV A;  1BR4 A;  2E7W A;  5D4R A;  4HEA 2;  4A93 J;  2OCE A;  2QQA A;  3E6M A;  2E34 A;  4WXH A;  4N0B A;  1W1W E;  2H27 A;  2GM4 A;  2X0L A;  2CGP A;  3L9F A;  3J7Y J;  4HF1 A;  4OIQ F;  4YFX F;  4GXO A;  5DV5 A;  1QA6 A;  1HST A;  5CVV A;  2PJP A;  4XQF A;  9ANT A;  4KIG A;  3I59 B;  3IRQ A;  1BBY A;  5E8G A;  4JX5 A;  1IRF A;  1HKT A;  4L9V A;  1RKT A;  5EEG A;  4YRV A;  4MQ9 F;  1ZN2 A;  2PMZ A;  3KEO A;  5FKL A;  1SFE A;  1Y0N A;  4BL0 B;  3CF2 A;  3LA2 A;  3OYN A;  2B9S A;  4PK4 A;  4RS8 A;  2HQN A;  4LLG F;  3JRF A;  1WH7 A;  2VKE A;  1H0M A;  2Y9Y A;  1HSJ A;  1R9T J;  1XX5 A;  3BR5 A;  3A2K A;  4MTD A;  2DTR A;  4OAZ A;  3KZY A;  2GOX B;  3J81 Z;  3HG9 A;  5BMZ A;  3S93 A;  2A6H F;  1MMS A;  4IVN A;  2TCT A;  2VQH A;  4JX6 A;  3LA3 A;  4LIU A;  3OYA A;  3EYI A;  4D7M A;  1MJA A;  5J8F A;  5FKO A;  2XKO A;  4CGZ A;  1MW7 A;  1T08 B;  3KPH A;  1RI7 A;  2AHQ A;  3GEZ A;  4IOC F;  5FLV A;  5L3G A;  3RTR A;  3L09 A;  1JHH A;  4O5V A;  4C3H J;  2KMU A;  3BJ6 A;  3QRF F;  1LNW A;  5JLX A;  4IF4 A;  3K1P A;  2E60 A;  1K6Y A;  3RI4 A;  5F1J A;  3RKY A;  3NEU A;  2O61 A;  2DMN A;  1R6R A;  2EPF A;  4XLC A;  1MBE A;  3I55 I;  2XGC A;  4XKB A;  3CZ6 A;  2OAZ A;  1VF9 A;  3M8E A;  1DP3 A;  2WBM A;  1DPU A;  4BUP A;  1UG0 A;  3AKZ A;  2WWY A;  3TOA A;  1FYL A;  3ZP5 A;  1BW5 A;  5K5R A;  3HKZ N;  4EM0 B;  3BG5 A;  4BAC A;  2DT7 B;  3P5J A;  2ZJP F;  2YUS A;  2K9L A;  1Z21 A;  2EV6 A;  4DW6 A;  1XGS A;  1G2H A;  3VYU B;  1XCV A;  1IAW A;  2RQQ A;  3FBN B;  5GAG J;  1LVK A;  5F08 A;  4PUS A;  3SEQ A;  2Z16 A;  4MGR A;  4CO8 A;  1SAX A;  1D0X A;  2RC4 A;  3BRO A;  1IJW C;  1TT5 B;  1IXC A;  5EYR A;  1ZK8 A;  4K2E A;  3WG7 H;  4RA2 A;  3CCS I;  2HXI A;  1QZE A;  1QVU A;  2ZXJ A;  4M71 A;  3QP5 A;  4S04 A;  3E5Q A;  1JGG A;  1X2M A;  1E2X A;  4BDZ A;  5LRR A;  4D7N A;  2A07 F;  3OWT A;  5E8I A;  3MZ8 A;  5KCM A;  3CDI A;  1ZQ3 P;  2ECB A;  3JCU C;  5K7Z A;  1F1Z A;  5M3F J;  3RKX A;  2LC2 A;  3GZN B;  2DBB A;  1OIS A;  4NHJ A;  2O6G E;  1FEX A;  4J00 A;  4ETS A;  2LK2 A;  3O8H A;  3I4P A;  5J1R A;  2RRE A;  1P4A A;  4QLC U;  3SHF A;  4RB0 A;  2QBY B;  2MA3 A;  3WTX C;  1FLI A;  2HKX A;  3ESW B;  3JRB A;  2ID3 A;  2R7O A;  5IYC J;  2MH2 A;  2EZH A;  4P55 A;  5HLI A;  1X1D A;  2LTP A;  1PP7 U;  3DWL E;  3A4C A;  4M9Z A;  4R8H A;  1BN5 A;  3ZRG A;  5J8C A;  3MKZ A;  1U5T A;  4NNJ A;  4HNT A;  2YR2 A;  5IOZ A;  1L3L A;  3MKL A;  2UWM A;  4B1R A;  5D5W B;  3TP3 A;  2EJR A;  4HOB A;  5CVI A;  3SZT A;  1MMA A;  1P9Q C;  1YW8 A;  1REP C;  4JOM A;  3C7J A;  4HZF A;  3CQZ J;  3FXL A;  2KRF A;  1EA3 A;  4RM2 A;  1BR2 A;  1V54 H;  1JUM A;  2YU3 A;  3GFM A;  1O7L A;  2LVS A;  3HEF A;  3CMM A;  1IG7 A;  3JTH A;  4CYC A;  4XLH A;  5F6F A;  3TED A;  5HNF A;  1JTY A;  2MFZ A;  3DFG A;  3OL3 A;  4QSH A;  4A3B J;  1FBQ A;  1HKQ A;  3KIO A;  2STT A;  4A3E J;  5EGO A;  1P4X A;  4XR6 A;  5ILS A;  1NTC A;  2DN0 A;  3ABK H;  1HBX G;  1VQ5 I;  2A05 A;  1J09 A;  4FT8 A;  3U1K A;  2HVQ A;  3F8B A;  2HQA A;  5FGM A;  1HLV A;  1FJL A;  1W4M A;  3I0T A;  5E79 C;  4LD5 A;  4UUT A;  1EKE A;  4B09 A;  1YHQ I;  3DLA A;  1I6H J;  2VUM J;  3OV8 A;  4EEF G;  2XSJ C;  1IN8 A;  2ZJ2 A;  3U1D A;  2EA4 A;  1TNS A;  1YG2 A;  5M5Y J;  3KP6 A;  3A01 A;  3ECO A;  3OS2 A;  2D5V A;  4PFO A;  3ZMV A;  2KP6 A;  2ACJ A;  3ZQ7 A;  3S2W A;  3CP8 A;  1MNE A;  4QWQ A;  3WGH A;  2ELH A;  1TQI A;  1H9T A;  4E7H A;  1VQM I;  3BG6 A;  1SFK A;  4XLF A;  5GTI C;  1YW9 A;  2W24 A;  1WGX A;  4AYB N;  4D1Q A;  4OIP F;  2RKH A;  4NC8 A;  2QZ8 A;  3R61 A;  1DP7 P;  1MH4 A;  1G4D A;  4IJA A;  3WE2 A;  1G3T A;  4UV9 A;  2HDW A;  4IHT A;  4N4O B;  4PJL A;  4PJ0 C;  3M4O J;  3E6D A;  2VIX A;  4A12 A;  1VQ8 I;  1TW3 A;  4YEL A;  1MDM A;  3QPS A;  3CP2 A;  3IKT A;  5DYM A;  3DXJ F;  3FWE A;  4LB5 A;  3HOW J;  2BBY A;  1Q1H A;  3CDH A;  1ETK A;  4Z6Y A;  2QQ8 A;  1ZRE A;  2E2I J;  1E3P A;  1KU2 A;  3HOV J;  1AHD P;  2XGE A;  1U9N A;  3A1Y A;  4I7H A;  5DCM B;  2QUF A;  2GXA A;  2BHY A;  3O8G A;  1CGP A;  1KU7 A;  1NG6 A;  3O3K A;  1ODD A;  3FIS A;  2BV6 A;  2EB7 A;  2HTJ A;  2HOT A;  1BW6 A;  4CCL A;  3BCB A;  4HV5 A;  1XMX A;  4KMU X;  2NOG A;  4BXF A;  2ZME A;  2W4S A;  3ISP A;  1USS A;  1KA8 A;  1GDT A;  3B6C A;  3FHN A;  1Y1W J;  5IY5 H;  2DOE A;  2ETH A;  4RMN A;  4AIK A;  4O3M A;  1MBH A;  2J5P A;  4IEJ A;  3K4N A;  3RYR A;  4I09 A;  1BIB A;  5DCF A;  2QVO A;  3RDI A;  3CCL I;  3M1C A;  2R7W A;  1Z05 A;  1V5G A;  4DIQ A;  1GVJ A;  3HRS A;  1WJC A;  2X9D A;  3FKJ A;  3M07 A;  2JQ7 A;  4WCG A;  3H3U A;  4QPQ A;  4A5N A;  3GBG A;  2XAS A;  3MN2 A;  2O5R A;  3FXU A;  4KIS A;  4Y13 A;  2HYJ A;  2ZFW A;  1RKW A;  3PSI A;  1W7P B;  3AL0 C;  1UFM A;  4HQM A;  2YS9 A;  1IDY A;  4U0Y A;  6PAX A;  2UV1 A;  1ETW A;  3TGN A;  1QNT A;  1ETO A;  5HOO A;  4PFP A;  1WH5 A;  1LFB A;  2V9V A;  2ISZ A;  4CSW A;  2FNA A;  2O3F A;  4GGG A;  5HOD A;  1KU3 A;  2JA7 J;  2HVR A;  5HDG A;  3E3V A;  2GAU A;  2LKS A;  1R58 A;  1A31 A;  1XS9 A;  4RBO A;  2WY8 Q;  3K70 D;  1LB2 A;  3CUQ A;  4AID A;  1K78 B;  2QSG X;  4IHY A;  2VAS A;  2ADU A;  3M8F A;  3VYT B;  2V79 A;  3UNG C;  3FXK A;  3IAS 2;  1J9I A;  3ABM H;  1LPQ A;  2HPM A;  1W7P D;  1L0O C;  3JRH A;  3FMQ A;  2R5Y B;  1K61 A;  3M3Y J;  3BTJ A;  4F52 A;  1YW7 A;  3HYI A;  4UXN A;  1APL C;  5LD2 C;  2OF7 A;  4A0X A;  3SDB A;  3WU1 B;  2CW8 A;  3MAJ A;  2O03 A;  2DA2 A;  2V1U A;  4AC0 A;  2ICW G;  1OCT C;  2NVU B;  1QO0 D;  3EQL F;  5LFA A;  1JJ8 C;  3VWB A;  3OYC A;  2IS2 A;  3KX2 A;  3QWL A;  3H0G J;  3H9Q A;  1VQP I;  3ZMD A;  1UZC A;  1BR1 A;  3BPV A;  4FET A;  1MBJ A;  3PIP F;  3CMA I;  2YU9 J;  4BE0 A;  4CCO A;  2HYF A;  3R0A A;  3F8N A;  1LE8 B;  4NC6 A;  1OR7 A;  2LP0 A;  2E36 A;  4V2F A;  3KYL A;  4GFB A;  5KHD A;  4IRI A;  2W57 A;  2DT6 A;  5DD8 A;  4EV0 A;  1MZB A;  4BQA A;  4XRF A;  3QPT A;  5J47 A;  4YFK F;  2PMH A;  4EJW A;  4BGD A;  3TO9 A;  4S0H B;  3MKW B;  4OAY A;  1B6A A;  2QWW A;  5FB2 A;  4BHC A;  2JZY A;  2QKM B;  3PO2 J;  1P4W A;  3W6J B;  1ZHF A;  2QA4 I;  1OYW A;  2IRF G;  1TQM A;  3BPX A;  2VPR A;  1I1S A;  2R7D A;  2ME0 A;  1NK3 P;  3BG9 A;  1POG A;  1HF0 A;  2FD5 A;  2VC0 A;  1WJD A;  2K86 A;  2RAE A;  1HKS A;  2XF7 A;  5JFR A;  1MMN A;  1VI0 A;  4AM3 A;  3WU2 C;  3HUG B;  3A01 B;  1PVE A;  2IBD A;  1SMY F;  2LNB A;  3GFL A;  1ONV A;  1LE8 A;  1HXD A;  2XB5 A;  2JT1 A;  2VON A;  2XRL A;  4DYR A;  4CZZ A;  2L7M P;  3HGG A;  5IP6 A;  2WV1 A;  4ZYH A;  2O7O A;  3KCC A;  5IP9 J;  2EH3 A;  4IZZ A;  3GFI A;  2L9R A;  5KAF C;  3UKG A;  3DTE A;  1IZ1 A;  5BPD A;  5LHH A;  3F6O A;  3TOB A;  3BDD A;  5L3B A;  4A69 C;  1ERD A;  5K5Q A;  5E18 F;  5F0H A;  4DYC A;  1YI2 I;  2IS6 A;  5F1R A;  4CH7 A;  3VOE A;  3S2D J;  1HW1 A;  3BR1 A;  2J5O A;  3BTI A;  4RAZ A;  2DA6 A;  2FF4 A;  2KFD A;  3E7L A;  2ZME C;  3BCA A;  2F5E A;  3FX3 A;  5LGN A;  3C3W A;  2OA4 A;  4G6T B;  2DCE A;  1FBS A;  1U8R A;  2FBK A;  2TDX A;  2FOK A;  1ZAO A;  2E71 A;  3LFK A;  1WFX A;  1B72 B;  1TNT A;  4KN7 X;  3P9K A;  3K4M A;  2QKL B;  2IEK A;  1Z6T A;  1ETQ A;  1ZYR F;  2JRM A;  2MLK A;  1G6N A;  5GAE J;  2K02 A;  4L0Z B;  1Z1D A;  3S1Q J;  2RQP A;  3GTO J;  1K4S A;  2JTV A;  2MAB A;  3CCV I;  4DNC A;  1ZG3 A;  1LDJ A;  3WTS C;  2A5Y B;  4AVP A;  3K0L A;  4U87 A;  3PL8 A;  3I54 A;  3S14 J;  4C3I J;  1BM9 A;  1IDZ A;  5DEQ A;  4MEX F;  5TIS C;  5B3S H;  1ZLK A;  3HTU A;  2VJI A;  1S5L C;  5HLH A;  1FOX A;  5ED4 A;  4UNO A;  2BVL A;  5FKN A;  3MZH A;  1I3Q J;  2NS7 A;  4MHG A;  3RQ4 A;  1FMW A;  3TW7 A;  1R7J A;  2DU9 A;  1TLH B;  2XUB A;  1WCM J;  3D5R C;  1LVA A;  4XIC A;  4BQO A;  2VBX A;  2Z2S B;  1LFP A;  1PP8 F;  4I01 A;  4HLX A;  3RPQ A;  1FTZ A;  3OSG A;  1OCR H;  4IHW A;  3M8J A;  3ZN0 A;  1D1B A;  4PJJ A;  4XLE A;  5D6E A;  4DGW B;  2LKP A;  2O9L A;  4WXD A;  3F8C A;  4XSX F;  1WJA A;  3LQR A;  3EUH A;  4HDU A;  2R92 J;  4AYB A;  2MBF A;  1FP2 A;  5ICE A;  1V5E A;  4ZYE A;  1TWH J;  1AOY A;  4UVC A;  2R5Z B;  3LSK A;  2Z99 A;  2WAQ N;  2X6X A;  4Y7N J;  3ZQF A;  1YTY A;  4I02 A;  4AIH A;  1HOM A;  2R7U A;  2X6O A;  1K79 A;  5JHF A;  2DLL A;  4L0Y B;  1WPK A;  1Y6I A;  1W36 C;  3RIR A;  3REO A;  2DA4 A;  3ABT A;  4E6K G;  5A2Q K;  1K78 A;  3S2H J;  1QPM A;  2A3S A;  3T5X A;  1XGM A;  3IH2 A;  1HQC A;  3ELK A;  1XSD A;  1A35 A;  5JR3 A;  1IXS B;  5BQT A;  4PGG A;  3TQN A;  1EH7 A;  2DOF A;  3ML6 A;  4ZYA A;  1U3E M;  5F27 A;  3DPU A;  3OYJ A;  2NAZ A;  3LST A;  5LGU A;  2QCO A;  2R5Y A;  3PM1 A;  2NVT J;  4G94 A;  2K3F A;  4XOR A;  3RKQ A;  1V3F A;  3MWM A;  5CVU A;  2VXZ A;  3SFZ A;  5GTH C;  2PBI A;  5C4X J;  4XN0 A;  3CCQ I;  1VQ9 I;  3PSF A;  2Y31 A;  4D5C A;  3I5U A;  2XAU A;  4P96 A;  2OQR A;  1R5H A;  4IHX A;  4XN3 A;  2LOO A;  1TP4 A;  2QSH X;  2WY7 Q;  4CIC A;  2NYX A;  4XK4 A;  3TW6 A;  1YS7 A;  2MGQ A;  4M6X A;  2RDP A;  1UEL B;  2OV7 A;  3CC4 I;  4M3B A;  2F5F A;  1XG1 A;  2MYS A;  2OCC H;  3VSL A;  4EVI A;  2DMQ A;  2XPU A;  2G9W A;  2R3S A;  5ICF A;  3FM3 A;  4ZDL A;  5IYB J;  1GVD A;  2BY1 A;  2DT5 A;  2WAD A;  1S7O A;  1TWF J;  1OFC X;  5LHI A;  1B59 A;  3NWS A;  1JTX A;  1ZR2 A;  1M1E B;  3K2Z A;  5L3F A;  4WWC A;  3NWT A;  4QPO A;  4IQJ A;  2YX7 A;  5FKM A;  1MGT A;  1S3J A;  3I3L A;  3OR2 C;  2COM A;  4AWX B;  1A36 A;  1QGP A;  2ISY A;  3EDP A;  3HKZ A;  1G59 A;  2PJR B;  2M34 A;  5M5W J;  4KT6 A;  4Q48 A;  4JBA A;  2M4K A;  3A0B C;  1BA5 A;  1WQ2 A;  2HQR A;  3CDL A;  1LEB A;  1S6L A;  2BE5 F;  4G7H F;  2AXT C;  2LBF A;  4HRI A;  1MKM A;  3G71 I;  1CQT A;  2LR8 A;  1ZKG A;  5HLG A;  2QEX I;  2VE9 A;  1H9G A;  4JP0 A;  2ESN A;  3K69 A;  1T8I A;  2FU4 A;  3LAP A;  4CHU A;  3HPG A;  4HX4 A;  2JPC A;  5L3D A;  3CCU I;  3KZI C;  3G1O A;  2DDB A;  2DOD A;  3HTS B;  5DCM A;  4Y3O A;  3EUA A;  3QYB A;  4XRS G;  4P9U A;  3WTT C;  5L3C A;  3RPU D;  2R7R A;  5B1A H;  1Z77 A;  2MW8 A;  1EV7 A;  2D2W A;  4D5F A;  2WAE A;  5DS9 A;  3WHC A;  5E1W A;  2P7V B;  1G3Y A;  5HDK A;  3T8T A;  3EET A;  2KIS A;  3T8R A;  2H6B A;  3VDX A;  1WJE A;  1I6X A;  3GZ6 A;  5IPA A;  2FUG 2;  3TMO A;  4ZTJ A;  4Q47 A;  3JW4 A;  3CF5 F;  1BC8 C;  2L2O A;  4AVZ A;  3ZMZ A;  1FZP B;  5TGT A;  2FEZ A;  2HZD A;  1J75 A;  1X3W B;  3KEY A;  2XGD A;  4RDU A;  3S32 A;  1PUE E;  2PMZ N;  3C1D A;  4X0G A;  4ENM A;  2VJ5 A;  3FHZ A;  3C2B A;  1B9M A;  2QF7 A;  1U9O A;  5IT3 A;  3Q0W A;  3LNQ A;  1R23 A;  1VZ0 A;  4A3I J;  5J1Y A;  3PIO F;  2Z9O A;  4RGS A;  3WGG A;  3CC7 I;  4R1H A;  3MFK A;  2P5L C;  4HDV A;  4A6D A;  3CCE I;  3V8L A;  4NUB A;  2QBY A;  5GAD J;  2F2E A;  3MEX A;  3V8K A;  2JSC A;  5AON A;  2GXG A;  1OCC H;  1SVM A;  1GXP A;  4ZDP A;  1U78 A;  5D6F A;  4LIT A;  3U2R A;  4OIR F;  4CCN A;  3L2V A;  1Z91 A;  1O3Q A;  1UMQ A;  1B9N A;  3OMY A;  3KZZ A;  3EUK L;  4XBF A;  2GBY A;  2LD5 A;  3MQ0 A;  1JT0 A;  1VQK I;  4HST A;  1E17 A;  4Q5S F;  3E6B A;  1A04 A;  3KE2 A;  1JHF A;  4U0V A;  1F36 A;  2VBW A;  5E20 A;  4XNF A;  1O3S A;  1XC5 A;  5AIP A;  4HPQ A;  4DBQ A;  3L2W A;  4EJT A;  2WB1 N;  2DAO A;  4A3L J;  1WJ5 A;  1BOA A;  4IPA A;  3LOC A;  3C2H A;  1PDN C;  1R36 A;  2ESH A;  1FP1 D;  2MC3 A;  2D1V A;  4C2T A;  2ELK A;  1FC3 A;  3GWZ A;  5D8L B;  2VOD A;  4HX8 A;  3HOY J;  4A3C J;  1Y56 A;  1D8K A;  4UUV A;  1X19 A;  1SEU A;  1XTA A;  2HVS A;  3OY9 A;  2W1O A;  2DFE A;  1KYZ A;  4EM2 A;  3K4C A;  1E3H A;  1XMK A;  2ZNY A;  4HYE A;  1OKR A;  3HOX J;  1QVT A;  3OIP A;  1T6S A;  2EFW A;  4UB8 C;  3I59 A;  4NDL A;  1U8B A;  2DJN A;  1TBX A;  3QQA A;  2Y69 H;  3V7S A;  5DM6 F;  1B1B A;  2LMD A;  2W84 A;  4UUS B;  4WK8 F;  4PGH A;  3GTP J;  3RKW A;  3AG3 H;  5KVR A;  1MBG A;  3J80 Z;  3RQI A;  1LDK B;  2PFB A;  4RGX A;  3ONQ A;  3BG3 A;  2EFQ A;  1STZ A;  1IV6 A;  3GW2 A;  2L4A A;  2JSP A;  3LA7 A;  4NC7 A;  1G8X A;  1NG7 A;  1E0E A;  2E2H J;  1RZ4 A;  3PNY A;  5EZG A;  2KIQ A;  2VJ4 A;  3QPL A;  3QOP A;  4M3F A;  2JVH A;  2XV4 S;  4L5E A;  4OIO F;  2CWE A;  4CDG A;  4P9F A;  1Y0U A;  1UJ8 A;  2NRA C;  3Q0V A;  2EA2 A;  2QYO A;  3DF8 A;  3DEE A;  3IKV A;  3MD2 A;  1VQO I;  2MSY A;  2M8G X;  2OJE D;  3BP8 A;  1K7A A;  3BQZ A;  1Y8R B;  4ESJ A;  1UAA A;  1ORK A;  1X1P A;  5TJJ A;  4G9Y A;  3DQV C;  3OL4 A;  4RLF A;  1ZGJ A;  4A5M A;  5KNL A;  3H92 A;  4MQV A;  3VFZ A;  1ZRF A;  3JR9 A;  2V1D A;  2R7Q A;  3HIF A;  3HRT A;  1LFU P;  1J59 A;  3EYY A;  2DYR H;  1X1C A;  3VOD A;  4LG3 A;  3H35 A;  4JK1 X;  1XSV A;  4BS9 A;  1JI8 A;  3IP4 B;  3OYL A;  1YO5 C;  5FLX K;  3DU6 A;  1Z67 A;  1N77 A;  2DYS H;  4A0Y A;  1YFH A;  4HF0 A;  2K85 A;  5EG0 A;  1EF4 A;  4EGY A;  2D45 A;  1F5T A;  2CSO A;  2O8X A;  2E1M C;  2OC6 A;  1ULY A;  2EV0 A;  5CQG A;  4ABZ A;  2HOE A;  2FMY A;  4UY8 I;  3WG9 A;  4ZYG A;  5ERI A;  2F48 A;  1JE8 A;  4HSR A;  2OZ6 A;  2ELJ A;  2AQE A;  2IVM A;  2BY3 A;  4LK0 F;  3S3M A;  2D1H A;  4IHS A;  4PCQ A;  1XB4 A;  4GYI A;  5DDG A;  2M30 A;  1S7A A;  1IN7 A;  2VL8 A;  2MC4 A;  3JRI A;  2PJR A;  1HW2 A;  3CLQ A;  4LLN A;  5E17 F;  3FBI B;  5EF6 A;  4FX4 A;  1ZH5 A;  4LG0 B;  3LFU A;  2X6W A;  4XMY A;  3T0Y A;  4ESF A;  1NK2 P;  2GLO A;  2FX0 A;  3ZQI A;  2ZB9 A;  2Z1D A;  2IXS A;  1QPI A;  3LWF A;  5E3O A;  2Y0M A;  1ZG1 A;  2IA0 A;  1T0F A;  2V9K A;  2MLG A;  3NAR A;  4RAY A;  3KP7 A;  3LSJ A;  2Y2Z A;  3CJQ B;  4A0Z A;  2NXN B;  4G8X A;  4C9Y A;  2K4J A;  4CCK A;  4XOT A;  5DM7 F;  1B72 A;  3RJP A;  2W25 A;  4O6J A;  5BNG A;  1TWA J;  4CXF A;  2F5D A;  3GTJ J;  3OSF A;  1MSE C;  2R93 J;  4RLQ A;  3HSF A;  4IQ4 A;  2LH9 A;  2L5Q A;  3CES A;  3VB2 A;  2IS4 A;  3IHU A;  2LY9 A;  2YX4 A;  3DBR B;  1DQU A;  5L3E A;  2KZG A;  2H09 A;  4LJZ F;  4RB2 C;  3M1E A;  4KUM A;  2E19 A;  1MMG A;  2VKH A;  4CCJ A;  4HX7 A;  3KYD B;  2LG4 A;  1JXS A;  4HNV A;  3O2P E;  3OOU A;  3OYK A;  5JHU A;  2OBP A;  2B63 J;  1YX5 A;  3BLY A;  3G3Z A;  2FA5 A;  2IP2 A;  2M8E A;  2Q0O A;  2Y0S A;  3K1N A;  4Y17 A;  4AU7 A;  3W3C A;  2COB A;  1UG2 A;  2HGC A;  3ZQG A;  5C44 J;  4U88 A;  3DEU A;  3W2W A;  5K5O A;  2F5C A;  4L9J A;  1A5J A;  4AUX A;  4MFE A;  1MNM C;  1X4O A;  1SFX A;  2FML A;  2BZT A;  2L0K A;  4BJT A;  4W1U A;  5K1Y A;  2EK5 A;  2ZXI A;  2UXN A;  4LOC A;  5KAI C;  4D9J A;  3CMY A;  2VXD A;  3PUF A;  1XGO A;  1XDS A;  1SVO A;  2EBI A;  3E97 A;  4FQG A;  2CJJ A;  5J40 A;  2HS5 A;  2R5Z A;  4BNC A;  3WHB A;  2ZCW A;  4FIS A;  2V6C A;  2CUE A;  4HLY A;  4ZH4 F;  5K7F A;  4MNU A;  1HCR A;  3GTL J;  3HOZ J;  3TDU C;  4RB3 C;  1N75 A;  5DUI A;  1J7K A;  2Q2E A;  3CJT B;  2A68 F;  1RRJ A;  1YIT I;  2RN7 A;  5J4V A;  2PX9 A;  1FPQ A;  1OPC A;  5IP7 J;  1X58 A;  2XAJ A;  3SYT A;  4X1E A;  1GHC A;  3B73 A;  2X4H A;  2K9M A;  1VQL I;  3MZY A;  4I6Z A;  3SZG A;  1F4K A;  3HOS A;  5FRO A;  3F22 A;  3BG7 A;  4HAM A;  1J0R A;  1LJ9 A;  1UHW A;  3V8J A;  4N9I A;  2HTS A;  4M74 A;  4IHV A;  3TO7 A;  4B43 A;  1Z9C A;  4DJA A;  1S29 A;  2AQF A;  3HHG A;  2VJJ A;  2JA2 A;  3WTU C;  2OTL I;  2CQQ A;  3IUO A;  3LSH A;  4BU2 A;  4XLP F;  1U6G A;  2DPD A;  2CUZ A;  2KL4 A;  2HDC A;  4B4C A;  3LSR A;  3CD6 I;  4B48 A;  3H36 A;  2M87 A;  1S9H A;  1P92 A;  2LFB A;  2BYV E;  2X51 A;  1QBJ A;  3H3V K;  1DU0 A;  1KU9 A;  2HPI A;  5CVJ A;  5LEJ A;  3JRC A;  2DPU A;  3G1M A;  2JUG A;  3GLX A;  4IRH A;  4C2M J;  4ENJ A;  4ZTF A;  1HC8 A;  2XRO A;  1D1A A;  4A3M J;  1MDM B;  3TO6 A;  5IT9 K;  3DBH B;  2ZBK A;  3K4K A;  2BW3 A;  3SEZ A;  5D5X B;  4A3J J;  1YJN I;  2JA5 J;  4FE7 A;  1XPX A;  3F21 A;  5LHG A;  3KP4 A;  3EPZ A;  4LIV A;  2L7Z A;  4I0B A;  2E1C A;  1ZGA A;  2BEO A;  4E7S A;  4IKF A;  1TWC J;  5ICG A;  5HLT A;  2CQX A;  2DI3 A;  5DUK A;  3TL4 X;  2TRT A;  2NNY A;  1RUO A;  2HZT A;  1GLN A;  3GUD A;  4WXC A;  4BAY A;  4YII A;  2XAQ A;  1I5Z A;  2R7T A;  4BJ6 C;  2A69 F;  2VOP A;  1K6O A;  4A6E A;  2M5W A;  3AFH A;  5CYV A;  5EG0 B;  2EIJ H;  4KYW A;  3DBL B;  4M9X A;  2X6Y A;  2DMU A;  2FE3 A;  2ZXW H;  3JSO A;  4CA0 A;  3WE3 A;  3ULQ B;  1FYK A;  4G7Z F;  1P2F A;  3V42 A;  2XSD C;  5JLW A;  1PUF A;  2QGU A;  3AAF A;  3CME I;  4FTH A;  2OTJ I;  2FBI A;  1FOY A;  5LBQ A;  5HNH A;  1FBU A;  3X2Q H;  2LRD A;  2FOW A;  4BE2 A;  1ZEL A;  2WV0 A;  2EIM H;  3FXO A;  1RC9 A;  2G7U A;  2PQ8 A;  4BXU A;  1T98 A;  1W36 D;  2L9S A;  5BOX A;  2JK3 A;  4OIN F;  4G12 A;  3DKW A;  1T39 A;  2BOL A;  2E2J J;  2DFI A;  3J7A Y;  1PJR A;  2G0E A;  3S3O A;  3F8M A;  2Q8K A;  2NOJ B;  4HNU A;  4QTR A;  2VB6 A;  1G3S A;  3QP6 A;  4TV7 A;  2IGM A;  1ON2 A;  1KYW A;  2ZO4 A;  2CW7 A;  3CCJ I;  1IUY A;  4YIR X;  1BJA A;  4I76 A;  4YEJ A;  3HL2 A;  2CFX A;  1X1B A;  4F55 A;  4F3Q A;  3S15 J;  3CJN A;  1KGS A;  1P7I A;  3FF5 A;  2Y0S N;  4UV8 A;  2GZW A;  5FFX A;  2RNJ A;  3ZQL A;  4B3X A;  4CUG A;  3K70 C;  4ANJ A;  1E3O C;  3CO6 C;  2E5Z A;  2P6S A;  4B44 A;  2CQK A;  2F4O B;  3K10 A;  3QAH A;  3QYE A;  2WC2 A;  3JRD A;  5DTD A;  2R7F A;  3W2A A;  1UHM A;  1Y1V J;  3B02 A;  5AIQ A;  3LSP A;  2P81 A;  2IGO A;  2XDV A;  3HSE A;  2DK8 A;  4IRG A;  1IN5 A;  2L4M A;  2RVC A;  3HDD A;  4PDK A;  2KRH A;  4B47 A;  2MD0 A;  4XOP A;  3GVA A;  3KP3 A;  4P1W A;  4ZZL A;  4M3D A;  2HR3 A;  2JVG A;  3TKY A;  4CCM A;  1SD6 A;  3A02 A;  5J3L A;  2KDZ A;  1SD7 A;  3J7A O;  1SD5 A;  1LKX A;  5J6X A;  1TQP A;  2CO5 A;  2DTZ A;  4XLN F;  1XDU A;  4L5I A;  1YIJ I;  3L7W A;  3ASO H;  4NQW B;  1FIP A;  4ZDO A;  1R5I D;  1UHS A;  2BY0 A;  1RR7 A;  2OQG A;  2V4J C;  2LYC A;  1C0W A;  3FXJ A;  2G7H A;  1BI3 A;  3JAM Z;  4LFU A;  1T33 A;  5M3M J;  4KN4 X;  2GXB A;  1T0F C;  3GXO A;  4PZJ A;  3I71 A;  2QEN A;  3OR1 C;  3SDG A;  3L2Q A;  2DOA A;  2JUC A;  2EV5 A;  2JRT A;  3GTM J;  5K7H A;  2VQL A;  3FZV A;  2V26 A;  4M72 A;  3F9K A;  1X2N A;  1NH3 A;  2X1E A;  2M0C A;  1IW7 F;  2GA1 A;  1N25 A;  2XF6 A;  2XAH A;  2Z5U A;  3NAU A;  4GYG A;  4I98 B;  4N4N B;  2LF7 A;  2OZU A;  1S72 I;  3HOU J;  3BZC A;  3R60 A;  1GUU A;  2M0M A;  2KZV A;  5DD4 A;  4A3F J;  2GIZ A;  3K4B A;  3FK6 A;  4LGW A;  2HFH A;  4BH9 A;  5CKT A;  2DW4 A;  1LDD A;  4NQW A;  1JT6 A;  2OD5 A;  1O7F A;  1YQA A;  2PG4 A;  4W97 A;  2R7X A;  3H5R A;  1TZL A;  2M7B A;  3ECH A;  5HS8 A;  1X3Z B;  5C4J J;  2KDO A;  4OMY A;  4A3D J;  5E3N A;  1WZ2 A;  2L02 A;  2DA5 A;  1X4P A;  2XF5 A;  3HRM A;  3HZJ A;  3Q5F A;  5HS7 A;  1AKH B;  3RZD J;  4BXX J;  1VQ6 I;  5H2F C;  2KT0 A;  3N97 A;  2VPL A;  5H20 A;  2VI6 A;  4ZJZ A;  2LRE A;  5C3E J;  3J7Z I;  2KRC A;  4OWR B;  1D0Y A;  3I4M J;  1OLT A;  5CQE A;  2MD5 A;  2YSR A;  2L7F P;  4E7J A;  5TRD A;  4HBL A;  2NVQ J;  2DK5 A;  4ON0 A;  1AWC A;  3H1C A;  5IOY A;  2LBF B;  4GDF A;  4QIW N;  4EM1 A;  2ECC A;  1MH3 A;  2HNH A;  2WA0 A;  2BY2 A;  2EFN A;  2BW3 B;  5BS6 A;  4E7Z A;  3NQO A;  3HGY A;  1J2X A;  1K4T A;  2X1C A;  2VOO A;  3RSN A;  3WTZ A;  4Y33 A;  1FX7 A;  2F5V A;  3DPT A;  2E7X A;  3KEQ A;  2XRN A;  2CV2 A;  2MH9 A;  4OU0 A;  2P8T A;  5FKK A;  1QHH D;  2RNG A;  1T56 A;  4G6Q A;  4LG0 A;  4L5J A;  2ZC2 A;  3KET A;  1RIO H;  1TW2 A;  2ME6 A;  3JAM K;  3W6V A;  1W5C C;  2M4G A;  1W5T A;  2HI3 A;  3ZR8 X;  1IF1 A;  4A3G J;  4RGR A;  1R1T A;  4G7O F;  1WHU A;  2FSW A;  1W7P A;  4JQF A;  3Q0U A;  2ZSI B;  1IXR C;  1DU6 A;  3OS0 A;  3FXM A;  3BZK A;  3KFW X;  5CVR A;  2C6Y A;  5CPR B;  1JJ6 C;  2EZI A;  3F0C A;  3V7R A;  1RNL A;  3COA C;  3HJE A;  3BTL A;  3DCF A;  4U0W A;  3FKI J;  2BHZ A;  3V7C A;  3GCM A;  2MG4 A;  1BJZ A;  5FD5 A;  1IV8 A;  4WF2 A;  4XL9 A;  3WTY C;  3KP5 A;  3HBL A;  3U9G A;  2M1B A;  1KON A;  1IGN A;  2EIN H;  1BIA A;  2GOM A;  3VYR B;  3HOT A;  4KNY A;  4D0P A;  3DP7 A;  3E6C C;  3W6K B;  2I8D A;  3PFI A;  3OYF A;  3OIO A;  2QLZ A;  1SVL A;  2B7E A;  1TTY A;  1AA7 A;  3SXY A;  4AIJ A;  3ZGK A;  4DZP A;  2IS1 A;  2E5N A;  3GO5 A;  3CC2 I;  5JVT A;  1P7J A;  4P5O A;  4JX4 A;  3T1B A;  2XC7 A;  5LLQ A;  2HOS A;  1S7E A;  4Q4Z F;  3DKY A;  1HDD C;  1Y8Q B;  2YPR A;  3M9A A;  3DKX A;  4Y52 J;  1RET A;  5HS9 A;  4Z2Y A;  4UHT A;  1FOW A;  1GV2 A;  2FBH A;  2FQ4 A;  3F72 A;  1QRY A;  1YRN B;  2K3P A;  1F43 A;  3I53 A;  2DO7 A;  4BJ5 C;  3ROU A;  3BOQ A;  2Y48 A;  1O3R A;  2GIV A;  2H1K A;  3LSI A;  3BY6 A;  2DA1 A;  2H1L A;  5HVQ C;  1WJB A;  4LK1 F;  2XVC A;  4U7B A;  1FMV A;  1Z6R A;  4B8X A;  2LY1 A;  1H8A C;  4Y4R A;  2FQ3 A;  3Q9V A;  5EEH A;  3ZMT A;  4I99 C;  3WTW C;  3G4S I;  3KP2 A;  3U21 A;  2LDU A;  5LRS A;  2UUZ A;  3K2A A;  4E70 A;  2DJI A;  4U7D A;  1TWG J;  5D5V B;  3A03 A;  3BT9 A;  3AL0 B;  2L9V A;  4M73 A;  2EIK H;  3IL2 A;  1IUF A;  5EEA A;  3K7A J;  2HQ5 A;  1K83 J;  2K7L A;  1RUN A;  1FY7 A;  3EUH C;  5F04 A;  3H5N A;  4BEH B;  2R0Q C;  1BL0 A;  4PSX A;  2CRG A;  3H5A A;  3G6E I;  3FK7 A;  2IA2 A;  4UUS A;  5B5E C;  1YJW I;  1KQ9 A;  2F6C A;  5FFZ A;  2UZK A;  4E4H A;  4DYQ A;  1R22 A;  3S3N A;  1GT0 C;  1JKQ C;  2CH0 A;  2QQB A;  4V2G A;  3UR3 C;  3L2U A;  1UB9 A;  1I1G A;  3JRA A;  2EQR A;  1ACI A;  1QQI A;  2IJL A;  1IRG A;  1FWZ A;  4PJN A;  3K1M A;  3N05 A;  3QYF A;  3OYH A;  1CF7 B;  3Q3S A;  3GLL A;  3DPL C;  2HWV A;  4GRI A;  2P6T A;  3L1P A;  4WX9 A;  1FNN A;  3D1N I;  2O8K A;  3GTG J;  4XSZ F;  2KIF A;  1H88 C;  2DDA A;  4ZYD A;  1AU7 A;  2PI0 A;  4BEH A;  3LL7 A;  3PNT A;  4DOZ A;  4DBR A;  4KIC A;  3WTV C;  2KLO A;  2LF8 A;  3J80 K;  3DEW A;  1FSE A;  2PLY A;  2R7Z J;  2IW5 A;  2PMU A;  2L3D A;  3CTA A;  3E0J B;  4RAG A;  3S8P A;  3PO3 J;  1XSX A;  1O57 A;  5FRN A;  4BKX A;  1ZG5 A;  2QQ9 A;  2AS5 F;  4ESB A;  1JKO C;  1MJB A;  2K9Q A;  4IL6 C;  2W00 A;  1AKH A;  3ABU A;  2X48 A;  3BR3 A;  2CV1 A;  2BGC A;  1Q1V A;  2HKO A;  3FDY A;  1ZAR A;  2Y75 A;  1FTT A;  1R00 A;  1CF7 A;  5F0F A;  1O4X A;  4GCV A;  2IPQ X;  1BI1 A;  4BBS J;  1ETY A;  4HA8 A;  3LQQ A;  4L18 B;  2OU2 A;  4NBQ A;  3V4G A;  4UVA A;  1FIA A;  4YG2 F;  3K4J A;  4L9N A;  3R6S A;  3B6A A;  4UVB A;  3DTK A;  4KIT B;  3S1R J;  2VQG A;  2JWT A;  2H8W A;  5HDN A;  3BJA A;  4L9T A;  4E7I A;  1ZRD A;  3VSK A;  3PNV A;  1Z0X A;  1XD7 A;  5IT9 Z;  1PUF B;  1EH8 A;  2VT3 A;  3KLO A;  4IOA F;  2PEX A;  3MMY B;  1I39 A;  2EIL H;  2FRH A;  2KHM A;  1I50 J;  2IGN A;  1U5T B;  2KJB A;  2VBZ A;  2EZL A;  3WOD F;  1DGW Y;  4MEY F;  4MO7 A;  3L2C A;  4IO9 F;  3S1M J;  2JMW A;  2VC1 A;  1U0J A;  3CUQ B;  4C3J J;  3F23 A;  3BR2 A;  1IC8 A;  2AXL A;  2KQR A;  4AD9 A;  3I9V 2;  2JPB A;  1N78 A;  2VE8 A;  3J81 K;  5LEK A;  3GYH X;  1D3Y A;  2A6T A;  3WGI A;  3S17 J;  1JKR C;  4R79 A;  3S16 J;  4EAT A;  3PQK A;  4F91 B;  2R4G A;  3OYI A;  1TC3 C;  1B8I A;  1IO2 A;  3GX4 X;  3BQY A;  5EGO B;  4ENN A;  5FO5 A;  1NHA A;  2JN6 A;  3C18 A;  2P5V A;  1DUX C;  1EJ9 A;  1R71 A;  4CYC B;  1BOB A;  1ZGW A;  2EZK A;  3K9T A;  4I0A A;  2P4W A;  2A5W A;  3H0D A;  4LMY A;  5GPA A;  4YIF A;  4BBR J;  1YOV B;  3N4M A;  3BC8 A;  2JA6 J;  1YYV A;  4MFD A;  1ZLJ A;  3H9G A;  1MJ9 A;  2HEO A;  2RGV A;  5H6Q A;  3DU5 A;  3GFJ A;  1VQN I;  1WKM A;  3BZ6 A;  4EJV A;  4RAF A;  3OYD A;  4RM3 A;  3AG4 H;  1V5F A;  2CV0 A;  1FYM A;  1P6R A;  4HV6 A;  2L9N A;  1DGR M;  2M45 A;  2X85 A;  3I64 A;  3OS1 A;  5KK1 A;  2XPV A;  1OYI A;  2ZFU A;  1ON1 A;  1SAU A;  4GO1 A;  2DFH A;  3LMM A;  3TBI A;  5B66 C;  1YRN A;  5LGT A;  1RPW A;  4RGU A;  2M7A A;  3CJR B;  1X1A A;  4UB6 C;  1WI9 A;  5ILU A;  2W85 A;  1VQ7 I;  1J5Y A;  2V7F A;  3S1N J;  1OQY A;  2X1D A;  2VKD A;  4EQQ A;  1R49 A;  3HUG A;  1R4M B;  1VQ4 I;  1OCZ H;  1MIJ A;  1FOK A;  1MD0 A;  3LSM A;  2K9S A;  1WSU A;  5CLS A;  4ITV A;  3WU0 A;  1OCP A;  3IRR A;  5EZH A;  1LQ1 A;  3PUB A;  3PJR A;  1IN6 A;  2ZSH B;  4XID A;  3G1L A;  2FXA A;  3RYP A;  3HB9 A;  1VND A;  1QZZ A;  3C2G A;  3R4K A;  1YJ9 I;  2KPM A;  4LB6 B;  1IRZ A;  1T2K A;  1ITY A;  3DV8 A;  1HDP A;  3IV5 A;  3ZPL A;  2N8G A;  3CCM I;  5EJC A;  3ZXS A;  2RV8 A;  2LSO A;  4DZJ A;  3RCO A;  2OPT A;  3FIW A;  4HG2 A;  1IN4 A;  1I27 A;  1GXQ A;  3JSP A;  2BVM A;  3TDZ C;  1DPR A;  2GQQ A;  5A2Q Z;  5D5U B;  1EH6 A;  4YFN F;  3GZ5 A;  2DQL A;  4XKC A;  2Q1Z B;  2E35 A;  1QZY A;  1SFO J;  3BWG A;  3HHH A;  3CLO A;  4M3E A;  1YIO A;  5D8K B;  1RR8 C;  4H4K C;  1RES A;  2WTE A;  2FNP A;  4KDP A;  2XB0 X;  1VFC A;  2A6E F;  2DMP A;  3P9C A;  4BDY A;  2ZXH A;  3FMS A;  3CO7 C;  2W48 A;  4XON A;  3K6G A;  3KYC B;  4J01 A;  1IRX A;  3MVP A;  1D8J A;  1TT0 A;  1WWX A;  4EJU A;  1A6Q A;  3W2V A;  3SQN A;  2XKP A;  1A6I A;  2LKX A;  2XAG A;  3QU6 A;  2Y30 A;  3ZQC A;  3FXR A;  4HF2 A;  2QM3 A;  4MIM A;  4II3 A;  2IAI A;  2CQN A;  2CUJ A;  1W5S A;  3CUO A;  1GV5 A;  1U5T C;  3G73 A;  1W0T A;  1R1V A;  2NS0 A;  4BHP A;  1XN7 A;  3SFI A;  2JA8 J;  2VLA A;  2ZNZ A;  3MCZ A;  2KIU A;  3OIQ A;  3JTG A;  2OUM A;  2E1N A;  1OR7 C;  2V1N A;  5FLM J;  1W0U A;  4FE4 A;  4XKW A;  4OMZ A;  4F93 B;  3TP0 A;  2HOA A;  4ASN A;  2H6C A;  2CW0 F;  2I5U A;  2KIM A;  1SC7 A;  3A0H C;  1ZTR A;  3GF2 A;  3P9I A;  5FRM A;  4A3K J;  3VYS B;  5E3L A;  1Z3Y A;  2E1O A;  1SFU A;  3BJO A;  3L2R A;  1R4N B;  2L7K A;  2ZJQ F;  2VQC A;  3SJM A;  3GTQ J;  4MTE A;  2Z3Y A;  2PN6 A;  3H9J A;  2FJ1 A;  2HDD A;  2XHK A;  1X3U A;  3P7N A;  1SMT A;  2HU9 A;  2F4I A;  4M3G A;  3D5L A;  4RB1 A;  1JUS A;  1XMA A;  3AG1 H;  4FCY A;  1O3T A;  2NVX J;  1ZRC A;  3IC7 A;  3LAJ A;  2JJ7 A;  1XGN A;  4G6D A;  4JYK A;  5F64 A;  2CQ7 A;  2Z33 A;  4H0E A;  1BI0 A;  1YX3 A;  5M5X J;  4KMF A;  1F9N A;  3R0J A;  1OJL A;  3DLL F;  3ERM A;  5BPI A;  3FXQ A;  5F0C A;  4FAS D; 
#chains in the Genus database with same CATH homology
 2L01 A;  2VT2 A;  4CYD A;  3VEP A;  1FSH A;  1OYY A;  4S05 A;  5H6R A;  3I58 A;  1G3W A;  1KQ0 A;  2HYG D;  4IXA A;  2K4B A;  4EGZ A;  4F7Z A;  1KQ8 A;  3QPH A;  2XGX A;  1D5V A;  4KIB A;  2ZKZ A;  1UST A;  2A61 A;  2K27 A;  1YLF A;  2H94 A;  5CJ9 A;  4ENK A;  1FT9 A;  4EJO A;  3Q9S A;  2XAF A;  2L54 A;  1S8N A;  3E5U A;  3F8F A;  2O0Y A;  3NRV A;  1LEA A;  1OMI A;  3E5X A;  5JI6 A;  1JGS A;  1WRJ A;  1DDN A;  3PQJ A;  4HW0 A;  2V1X A;  2IT0 A;  4FX0 A;  1BC7 C;  3F3X A;  1UCR A;  4Y15 A;  3F6V A;  1R5G A;  2P5K A;  3IWF A;  3ZN1 A;  1T38 A;  3CUQ C;  1B4A A;  3ERE D;  2UXX A;  1BI2 A;  1R1U A;  4N9H A;  3QU3 A;  2ZME B;  3RPU A;  3O6B B;  4KFC A;  5FD6 A;  1V4R A;  2VBY A;  1YS6 A;  4A2U A;  2CYY A;  1U2W A;  2CG4 A;  3SZP A;  1XCB A;  4BYY A;  1VTN C;  4LLL A;  3ZMU A;  2EWN A;  2EFP A;  5ILV A;  2B0L A;  2DQR A;  4NB5 A;  3IWZ A;  4OOI A;  4KIF A;  4ZZD A;  4HQE A;  4DQ2 A;  2GA2 A;  3L00 A;  3ZMS A;  3FM5 A;  3KLN A;  3OOP A;  2GWR A;  2KKO A;  4FHT A;  4KT5 C;  5D4S A;  2VN2 A;  2STW A;  3HRU A;  4EMS A;  5E1X A;  3M7G A;  5FLX Z;  2XIG A;  2KJC A;  4M6Y A;  4KA4 A;  1Z7U A;  2EFO A;  1SD4 A;  4I2O A;  4BHB A;  5ICC A;  3H3Z A;  3D0S A;  4M9S A;  3HSR A;  5E1Z B;  3FMR A;  1HW5 A;  2P7C B;  2IA1 A;  2NNN A;  2E7W A;  5D4R A;  2QQA A;  3E6M A;  4WXH A;  4N0B A;  2H27 A;  2X0L A;  2CGP A;  3L9F A;  4HF1 A;  4OIQ F;  4YFX F;  4GXO A;  5DV5 A;  1HST A;  5CVV A;  2PJP A;  4KIG A;  3I59 B;  3IRQ A;  1BBY A;  5E8G A;  1IRF A;  1HKT A;  4L9V A;  5EEG A;  4MQ9 F;  1ZN2 A;  3KEO A;  1SFE A;  3LA2 A;  4RS8 A;  2HQN A;  4LLG F;  1H0M A;  1HSJ A;  4MTD A;  2DTR A;  3KZY A;  3J81 Z;  5BMZ A;  2A6H F;  4IVN A;  3LA3 A;  3EYI A;  1MJA A;  5J8F A;  2XKO A;  4CGZ A;  1RI7 A;  3GEZ A;  5L3G A;  3RTR A;  3L09 A;  1JHH A;  4O5V A;  3BJ6 A;  3QRF F;  1LNW A;  4IF4 A;  3K1P A;  3RI4 A;  3RKY A;  3NEU A;  2O61 A;  2OAZ A;  3M8E A;  1DPU A;  2WWY A;  3TOA A;  1FYL A;  3ZP5 A;  5K5R A;  4EM0 B;  2EV6 A;  1XGS A;  1XCV A;  1IAW A;  4MGR A;  4CO8 A;  1SAX A;  2RC4 A;  3BRO A;  1IXC A;  4K2E A;  2ZXJ A;  4M71 A;  3QP5 A;  4S04 A;  3E5Q A;  1E2X A;  5LRR A;  2A07 F;  5E8I A;  1F1Z A;  3RKX A;  4NHJ A;  2DBB A;  2O6G E;  4ETS A;  3I4P A;  1P4A A;  4QLC U;  3SHF A;  4RB0 A;  2QBY B;  2MA3 A;  3WTX C;  1FLI A;  2HKX A;  2MH2 A;  4P55 A;  5HLI A;  1PP7 U;  4R8H A;  4M9Z A;  1BN5 A;  5J8C A;  1L3L A;  1U5T A;  2YR2 A;  2UWM A;  5D5W B;  2EJR A;  4HOB A;  5CVI A;  3SZT A;  1YW8 A;  1REP C;  3C7J A;  4HZF A;  2KRF A;  2YU3 A;  3GFM A;  1O7L A;  3JTH A;  5F6F A;  3DFG A;  1FBQ A;  1HKQ A;  2STT A;  1P4X A;  5ILS A;  1HBX G;  4FT8 A;  3F8B A;  5FGM A;  1W4M A;  3I0T A;  4LD5 A;  4B09 A;  3OV8 A;  1IN8 A;  3U1D A;  2ZJ2 A;  2EA4 A;  1TNS A;  1YG2 A;  3KP6 A;  3ECO A;  3ZMV A;  2ACJ A;  3ZQ7 A;  3S2W A;  4QWQ A;  3WGH A;  2ELH A;  1TQI A;  1H9T A;  1YW9 A;  2W24 A;  4OIP F;  2RKH A;  1DP7 P;  2QZ8 A;  3R61 A;  1G4D A;  4IJA A;  3WE2 A;  1G3T A;  4UV9 A;  4IHT A;  3E6D A;  4A12 A;  1TW3 A;  1MDM A;  3IKT A;  5DYM A;  3DXJ F;  4LB5 A;  3FWE A;  2BBY A;  1Q1H A;  3CDH A;  1ZRE A;  1KU2 A;  4I7H A;  5DCM B;  2QUF A;  1CGP A;  1KU7 A;  3O3K A;  1ODD A;  2BV6 A;  2EB7 A;  2HTJ A;  4HV5 A;  4KMU X;  2ZME A;  3ISP A;  1USS A;  1KA8 A;  2ETH A;  4AIK A;  4O3M A;  2J5P A;  3RYR A;  4I09 A;  1BIB A;  5DCF A;  2QVO A;  3RDI A;  1Z05 A;  1GVJ A;  3HRS A;  4WCG A;  3H3U A;  4A5N A;  2XAS A;  3FXU A;  4Y13 A;  2ZFW A;  1W7P B;  1UFM A;  4HQM A;  4U0Y A;  6PAX A;  3TGN A;  1QNT A;  5HOO A;  2V9V A;  2ISZ A;  2FNA A;  2O3F A;  4GGG A;  1KU3 A;  5HDG A;  3E3V A;  2GAU A;  1R58 A;  1LB2 A;  3CUQ A;  1K78 B;  2ADU A;  3M8F A;  2V79 A;  1J9I A;  1W7P D;  1L0O C;  3FMQ A;  1YW7 A;  3HYI A;  4UXN A;  4A0X A;  3WU1 B;  3MAJ A;  2O03 A;  2V1U A;  1QO0 D;  3EQL F;  3ZMD A;  3BPV A;  2HYF A;  3R0A A;  3F8N A;  1OR7 A;  4IRI A;  2W57 A;  5DD8 A;  4EV0 A;  1MZB A;  4BQA A;  4XRF A;  3QPT A;  4YFK F;  2PMH A;  4EJW A;  3TO9 A;  1B6A A;  2QWW A;  5FB2 A;  4BHC A;  2JZY A;  1P4W A;  3W6J B;  1ZHF A;  2IRF G;  1OYW A;  1TQM A;  3BPX A;  1I1S A;  2R7D A;  2VC0 A;  2K86 A;  1HKS A;  5JFR A;  2LNB A;  3GFL A;  1SMY F;  1ONV A;  1HXD A;  2JT1 A;  2VON A;  4CZZ A;  4ZYH A;  3KCC A;  3GFI A;  1IZ1 A;  5BPD A;  5LHH A;  3F6O A;  3TOB A;  3BDD A;  5L3B A;  5K5Q A;  5E18 F;  5F1R A;  3VOE A;  1HW1 A;  2J5O A;  4RAZ A;  2FF4 A;  2F5E A;  3FX3 A;  5LGN A;  3C3W A;  2OA4 A;  1FBS A;  1U8R A;  2FBK A;  2TDX A;  2FOK A;  1ZAO A;  3LFK A;  1TNT A;  4KN7 X;  3P9K A;  1Z6T A;  1ZYR F;  2MLK A;  1G6N A;  2K02 A;  4L0Z B;  1Z1D A;  2RQP A;  2JTV A;  4DNC A;  1ZG3 A;  1LDJ A;  3WTS C;  2A5Y B;  4AVP A;  3K0L A;  3I54 A;  1BM9 A;  5DEQ A;  4MEX F;  1ZLK A;  3HTU A;  5HLH A;  5ED4 A;  4UNO A;  3MZH A;  4MHG A;  1R7J A;  2DU9 A;  1TLH B;  2XUB A;  1LVA A;  2VBX A;  1PP8 F;  4I01 A;  4HLX A;  3RPQ A;  3ZN0 A;  5D6E A;  2LKP A;  4WXD A;  3F8C A;  4XSX F;  3LQR A;  3EUH A;  4HDU A;  2MBF A;  1FP2 A;  5ICE A;  4ZYE A;  1AOY A;  4UVC A;  2Z99 A;  1YTY A;  4I02 A;  4AIH A;  1K79 A;  2DLL A;  4L0Y B;  3RIR A;  3REO A;  3ABT A;  5A2Q K;  1K78 A;  2A3S A;  1QPM A;  3T5X A;  1XGM A;  1HQC A;  3ELK A;  1XSD A;  5JR3 A;  1IXS B;  5BQT A;  4PGG A;  3TQN A;  1EH7 A;  3ML6 A;  1U3E M;  2NAZ A;  3LST A;  5LGU A;  4G94 A;  1V3F A;  3MWM A;  5CVU A;  2VXZ A;  3SFZ A;  2PBI A;  3I5U A;  4P96 A;  2OQR A;  1R5H A;  4CIC A;  2NYX A;  1YS7 A;  4M6X A;  2RDP A;  4EVI A;  2F5F A;  2G9W A;  2R3S A;  5ICF A;  3FM3 A;  2DT5 A;  1S7O A;  5LHI A;  1B59 A;  3K2Z A;  5L3F A;  4WWC A;  2YX7 A;  1MGT A;  1S3J A;  2COM A;  4AWX B;  1QGP A;  2ISY A;  3EDP A;  4Q48 A;  4JBA A;  1WQ2 A;  2HQR A;  1LEB A;  1S6L A;  2BE5 F;  4G7H F;  1MKM A;  5HLG A;  2VE9 A;  1H9G A;  2ESN A;  3K69 A;  2FU4 A;  3LAP A;  4CHU A;  4HX4 A;  2JPC A;  5L3D A;  3HTS B;  5DCM A;  3WTT C;  4P9U A;  5L3C A;  1EV7 A;  2D2W A;  5E1W A;  2P7V B;  1G3Y A;  5HDK A;  3T8T A;  3EET A;  3T8R A;  2H6B A;  1I6X A;  3GZ6 A;  4Q47 A;  3JW4 A;  1BC8 C;  1FZP B;  3ZMZ A;  2FEZ A;  1J75 A;  1PUE E;  3C1D A;  4ENM A;  3FHZ A;  1B9M A;  5IT3 A;  1R23 A;  2Z9O A;  4RGS A;  3WGG A;  4R1H A;  3MFK A;  2P5L C;  4HDV A;  4A6D A;  3V8L A;  2QBY A;  2F2E A;  3MEX A;  3V8K A;  2JSC A;  5AON A;  2GXG A;  1GXP A;  1U78 A;  5D6F A;  3U2R A;  4OIR F;  1Z91 A;  1O3Q A;  1B9N A;  3KZZ A;  4XBF A;  3MQ0 A;  1E17 A;  4Q5S F;  3E6B A;  1A04 A;  3KE2 A;  1JHF A;  4U0V A;  2VBW A;  5E20 A;  1O3S A;  5AIP A;  4EJT A;  2DAO A;  1BOA A;  4IPA A;  1PDN C;  1R36 A;  2ESH A;  1FP1 D;  2MC3 A;  2D1V A;  1FC3 A;  3GWZ A;  5D8L B;  2VOD A;  4HX8 A;  1D8K A;  4UUV A;  4EM2 A;  1KYZ A;  1XMK A;  2ZNY A;  4HYE A;  1OKR A;  1T6S A;  2EFW A;  3I59 A;  1TBX A;  3V7S A;  1B1B A;  2W84 A;  4WK8 F;  4PGH A;  3RKW A;  5KVR A;  3J80 Z;  1LDK B;  2PFB A;  4RGX A;  2EFQ A;  1STZ A;  3GW2 A;  2L4A A;  3LA7 A;  1RZ4 A;  3QOP A;  2XV4 S;  4OIO F;  2CWE A;  4CDG A;  4P9F A;  1Y0U A;  2NRA C;  2EA2 A;  2QYO A;  3DF8 A;  3IKV A;  3BP8 A;  1K7A A;  4ESJ A;  5TJJ A;  4G9Y A;  3DQV C;  4A5M A;  1ZGJ A;  3H92 A;  4MQV A;  3VFZ A;  1ZRF A;  2V1D A;  3HIF A;  3HRT A;  1J59 A;  3EYY A;  3VOD A;  4JK1 X;  1XSV A;  1YO5 C;  5FLX K;  4A0Y A;  1YFH A;  4HF0 A;  4EGY A;  2D45 A;  1F5T A;  2CSO A;  2O8X A;  1ULY A;  2EV0 A;  2HOE A;  2FMY A;  3WG9 A;  4ZYG A;  5ERI A;  1JE8 A;  2OZ6 A;  2IVM A;  4LK0 F;  2D1H A;  4IHS A;  4PCQ A;  1XB4 A;  4GYI A;  5DDG A;  2M30 A;  1S7A A;  1IN7 A;  1HW2 A;  4LLN A;  5E17 F;  4FX4 A;  1ZH5 A;  4LG0 B;  3T0Y A;  4ESF A;  3LWF A;  2Y0M A;  1ZG1 A;  2IA0 A;  1T0F A;  2MLG A;  4RAY A;  3KP7 A;  4A0Z A;  4G8X A;  2K4J A;  3RJP A;  2W25 A;  4O6J A;  4CXF A;  2F5D A;  3HSF A;  3VB2 A;  3IHU A;  2YX4 A;  5L3E A;  2H09 A;  4LJZ F;  4RB2 C;  3M1E A;  4KUM A;  4HX7 A;  1JXS A;  3O2P E;  5JHU A;  2OBP A;  2Q0O A;  2M8E A;  3G3Z A;  2FA5 A;  2IP2 A;  3K1N A;  4Y17 A;  2HGC A;  4U88 A;  3DEU A;  5K5O A;  2F5C A;  4L9J A;  1SFX A;  2FML A;  5K1Y A;  2EK5 A;  2UXN A;  1XGO A;  1XDS A;  3E97 A;  2HS5 A;  4BNC A;  2ZCW A;  2V6C A;  4HLY A;  4ZH4 F;  4MNU A;  3TDU C;  4RB3 C;  5DUI A;  1J7K A;  2Q2E A;  2A68 F;  2RN7 A;  1FPQ A;  1OPC A;  2XAJ A;  1GHC A;  3B73 A;  2X4H A;  3MZY A;  1F4K A;  3HOS A;  3F22 A;  4HAM A;  1J0R A;  1LJ9 A;  1UHW A;  3V8J A;  4N9I A;  2HTS A;  4M74 A;  3TO7 A;  1Z9C A;  1S29 A;  3HHG A;  3WTU C;  4XLP F;  1U6G A;  2DPD A;  2HDC A;  2M87 A;  1P92 A;  1QBJ A;  2BYV E;  1KU9 A;  5CVJ A;  5LEJ A;  2DPU A;  3GLX A;  4IRH A;  4ENJ A;  2XRO A;  1MDM B;  3TO6 A;  5IT9 K;  2ZBK A;  5D5X B;  3F21 A;  5LHG A;  3KP4 A;  4I0B A;  2E1C A;  1ZGA A;  2BEO A;  5ICG A;  2DI3 A;  5DUK A;  1RUO A;  2NNY A;  2HZT A;  3GUD A;  4WXC A;  4BAY A;  4YII A;  2XAQ A;  1I5Z A;  2A69 F;  2VOP A;  1K6O A;  4A6E A;  2M5W A;  5CYV A;  4KYW A;  4M9X A;  2FE3 A;  3JSO A;  3WE3 A;  3ULQ B;  1FYK A;  4G7Z F;  1P2F A;  3AAF A;  2FBI A;  5LBQ A;  1FBU A;  2WV0 A;  2PQ8 A;  2G7U A;  4BXU A;  1T98 A;  5BOX A;  4OIN F;  3DKW A;  1T39 A;  2DFI A;  3F8M A;  2Q8K A;  1G3S A;  3QP6 A;  4TV7 A;  1ON2 A;  1KYW A;  2ZO4 A;  1IUY A;  1BJA A;  2CFX A;  3CJN A;  1KGS A;  3FF5 A;  4UV8 A;  2GZW A;  5FFX A;  2RNJ A;  3CO6 C;  2P6S A;  2CQK A;  3QAH A;  2WC2 A;  2R7F A;  1UHM A;  3B02 A;  5AIQ A;  4IRG A;  3HSE A;  2DK8 A;  1IN5 A;  2L4M A;  2RVC A;  4PDK A;  3GVA A;  3KP3 A;  4ZZL A;  2HR3 A;  3TKY A;  1SD6 A;  1SD7 A;  3J7A O;  1SD5 A;  5J6X A;  1TQP A;  2CO5 A;  4XLN F;  1XDU A;  4L5I A;  3L7W A;  2OQG A;  1C0W A;  2G7H A;  1BI3 A;  3JAM Z;  4LFU A;  4KN4 X;  2GXB A;  3GXO A;  4PZJ A;  3I71 A;  2QEN A;  2EV5 A;  2JRT A;  3FZV A;  4M72 A;  1IW7 F;  2GA1 A;  2XAH A;  2Z5U A;  4GYG A;  4I98 B;  2LF7 A;  2OZU A;  3R60 A;  5DD4 A;  4LGW A;  2HFH A;  4BH9 A;  2DW4 A;  1LDD A;  4NQW A;  2OD5 A;  1O7F A;  1YQA A;  2PG4 A;  3ECH A;  5HS8 A;  4OMY A;  2L02 A;  3HRM A;  3Q5F A;  5HS7 A;  3N97 A;  5H20 A;  2MD5 A;  2YSR A;  5TRD A;  4HBL A;  2DK5 A;  4ON0 A;  1AWC A;  4EM1 A;  2EFN A;  5BS6 A;  3NQO A;  1J2X A;  2VOO A;  3WTZ A;  1FX7 A;  3DPT A;  2E7X A;  3KEQ A;  2XRN A;  2MH9 A;  4OU0 A;  2P8T A;  4G6Q A;  4LG0 A;  4L5J A;  3KET A;  1RIO H;  1TW2 A;  3JAM K;  1W5T A;  1IF1 A;  4RGR A;  1R1T A;  4G7O F;  2FSW A;  1W7P A;  4JQF A;  1IXR C;  3KFW X;  5CVR A;  2C6Y A;  3V7R A;  1RNL A;  3COA C;  4U0W A;  3V7C A;  5FD5 A;  4WF2 A;  3WTY C;  3KP5 A;  3U9G A;  2M1B A;  1BIA A;  3HOT A;  4KNY A;  4D0P A;  3DP7 A;  3E6C C;  3W6K B;  3PFI A;  2QLZ A;  1TTY A;  3SXY A;  4AIJ A;  3GO5 A;  5JVT A;  4P5O A;  3T1B A;  5LLQ A;  4Q4Z F;  2YPR A;  3M9A A;  5HS9 A;  4Z2Y A;  4UHT A;  2FBH A;  3F72 A;  3I53 A;  2DO7 A;  3ROU A;  3BOQ A;  2Y48 A;  1O3R A;  2GIV A;  3BY6 A;  5HVQ C;  4LK1 F;  2XVC A;  4U7B A;  1Z6R A;  4B8X A;  2FQ3 A;  3Q9V A;  5EEH A;  3ZMT A;  3WTW C;  3KP2 A;  2LDU A;  5LRS A;  4E70 A;  4U7D A;  5D5V B;  4M73 A;  3IL2 A;  2K7L A;  1RUN A;  1FY7 A;  2IA2 A;  1KQ9 A;  5FFZ A;  2UZK A;  1R22 A;  2QQB A;  1UB9 A;  1I1G A;  1QQI A;  2IJL A;  1IRG A;  1FWZ A;  3K1M A;  1CF7 B;  3DPL C;  2HWV A;  2P6T A;  4WX9 A;  1FNN A;  4XSZ F;  2KIF A;  4ZYD A;  2PI0 A;  3WTV C;  4KIC A;  2LF8 A;  3J80 K;  1FSE A;  2PLY A;  2IW5 A;  2PMU A;  2L3D A;  3CTA A;  1XSX A;  1O57 A;  1ZG5 A;  2QQ9 A;  2AS5 F;  4ESB A;  1MJB A;  3ABU A;  2BGC A;  2HKO A;  1ZAR A;  2Y75 A;  1R00 A;  1CF7 A;  4GCV A;  2IPQ X;  1BI1 A;  4HA8 A;  3LQQ A;  4L18 B;  2OU2 A;  3V4G A;  4UVA A;  4YG2 F;  4L9N A;  3R6S A;  4UVB A;  5HDN A;  3BJA A;  4L9T A;  1ZRD A;  1XD7 A;  5IT9 Z;  1EH8 A;  2VT3 A;  3KLO A;  2PEX A;  2FRH A;  2KJB A;  1U5T B;  2VBZ A;  3WOD F;  4MEY F;  3L2C A;  2VC1 A;  3CUQ B;  3F23 A;  2AXL A;  4AD9 A;  2JPB A;  2VE8 A;  3J81 K;  5LEK A;  3GYH X;  1D3Y A;  3WGI A;  4R79 A;  3PQK A;  3GX4 X;  4ENN A;  5FO5 A;  1NHA A;  3C18 A;  2P5V A;  1DUX C;  3K9T A;  4I0A A;  2P4W A;  4LMY A;  4YIF A;  3N4M A;  1YYV A;  1ZLJ A;  1MJ9 A;  2HEO A;  2RGV A;  5H6Q A;  3GFJ A;  1WKM A;  3BZ6 A;  4EJV A;  1FYM A;  1P6R A;  4HV6 A;  2M45 A;  3I64 A;  5KK1 A;  1OYI A;  1ON1 A;  4GO1 A;  5LGT A;  4RGU A;  5ILU A;  1WI9 A;  2W85 A;  1J5Y A;  4EQQ A;  3HUG A;  1FOK A;  1MD0 A;  1WSU A;  5CLS A;  3WU0 A;  3IRR A;  1LQ1 A;  1IN6 A;  2FXA A;  3RYP A;  1QZZ A;  3R4K A;  4LB6 B;  1T2K A;  3DV8 A;  3ZPL A;  2RV8 A;  2LSO A;  1IN4 A;  1I27 A;  1GXQ A;  3JSP A;  3TDZ C;  1DPR A;  2GQQ A;  5A2Q Z;  5D5U B;  1EH6 A;  4YFN F;  3GZ5 A;  2DQL A;  1QZY A;  3BWG A;  3HHH A;  3CLO A;  1YIO A;  5D8K B;  2WTE A;  2FNP A;  4KDP A;  2A6E F;  3P9C A;  3FMS A;  3CO7 C;  1D8J A;  1WWX A;  4EJU A;  3SQN A;  2XKP A;  2XAG A;  3QU6 A;  3FXR A;  4HF2 A;  2QM3 A;  1W5S A;  3CUO A;  1U5T C;  3G73 A;  1R1V A;  2NS0 A;  4BHP A;  1XN7 A;  2ZNZ A;  3MCZ A;  2KIU A;  3JTG A;  2E1N A;  4OMZ A;  4ASN A;  2H6C A;  2CW0 F;  2KIM A;  3GF2 A;  3P9I A;  1SFU A;  3BJO A;  4MTE A;  2Z3Y A;  2PN6 A;  2XHK A;  1X3U A;  3P7N A;  1SMT A;  3D5L A;  4RB1 A;  1XMA A;  1O3T A;  1ZRC A;  3IC7 A;  3LAJ A;  1XGN A;  4G6D A;  5F64 A;  2Z33 A;  4H0E A;  1BI0 A;  4KMF A;  1F9N A;  3R0J A;  5BPI A;  3FXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...