2FQ3A

Structure and function of the swirm domain, a conserved protein module found in chromatin regulatory complexes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
b'SKWFNLEKIHSIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription regulatory protein SWI3
publication title Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fq3A00
3T5XA 4U0YA 4A6EA 4ZZDA 1XSDA 5DUIA 4EJWA 3TDUC 1I27A 1IN5A 2XRNA 5D6EA 4DQ2A 4HZFA 1QZZA 5CLSA 5IT3A 5FGMA 1MJ9A 3WGHA 4KNYA 2IA0A 2IRFG 2V1XA 3HRTA 1D8KA 2EWNA 4I0BA 2EFWA 4HX8A 4GXOA 4RB2C 1IN6A 2MBFA 4MNUA 3DV8A 2ZBKA 2AS5F 3RJPA 2MH2A 2YR2A 4XRFA 3RIRA 2QQBA 1R36A 3FXUA 2IT0A 1BIAA 5FD6A 1T6SA 2XAGA 3REOA 5A2QZ 3HTSB 4IRIA 1REPC 2QWWA 4GCVA 1HW5A 1LVAA 5LHHA 2Q0OA 2DU9A 1HW1A 2P7VB 1CGPA 1SD5A 3ML6A 2EA2A 2OU2A 3R4KA 1ULYA 2O0YA 3DXJF 2ZMEA 4ZH4F 1ZARA 3JTHA 3QP5A 2DPUA 1XSXA 3GZ6A 3P7NA 1SD7A 3IRQA 3GLXA 2FA5A 1ZHFA 1USTA 3BY6A 2ZMEB 1JHFA 4CDGA 2VONA 4ESJA 4L9JA 5FFZA 4ENNA 1IW7F 1ZN2A 4L5IA 1FBSA 3C18A 2PN6A 1UHWA 3VODA 3L9FA 5DD4A 2EJRA 1XGSA 2MA3A 1TQIA 4RGRA 4GGGA 3GFJA 1XSVA 2XKPA 4LGWA 3ABUA 4G7HF 4IVNA 4ASNA 1K79A 2RDPA 4BHBA 2EFQA 2XIGA 4LK1F 3ISPA 3QPTA 3HSEA 4WX9A 4O6JA 3BP8A 4G9YA 2HTJA 2OZUA 1QGPA 2VBZA 2EFNA 4M6YA 4BYYA 2H94A 1O3TA 3DPLC 1LDKB 1KGSA 5FLXZ 1U3EM 1DP7P 1EH8A 3K1MA 2NNNA 5DCFA 4IPAA 2UXNA 1XN7A 1I5ZA 2D45A 3VFZA 1KYZA 5L3GA 1AWCA 4HQEA 3W6KB 5L3DA 1J7KA 1TW3A 3T8RA 1FZPB 5H6QA 5D4RA 4I2OA 4AWXB 3ZN1A 3LFKA 1YG2A 3CJNA 2D1VA 3HRUA 1XCBA 2Z3YA 4EV0A 2F2EA 4A12A 1HKSA 1ZRCA 1I1SA 1YW9A 1HQCA 1R1VA 2X0LA 1WKMA 3HSFA 4L9NA 3C1DA 2CSOA 3ULQB 4YIFA 3IWZA 4Y13A 3QPHA 1G3YA 3BOQA 3HHHA 2DFIA 2LF7A 3HIFA 1MD0A 3KP7A 2VOPA 2HTSA 2PMHA 3QOPA 3F72A 4OIPF 4LLLA 3VOEA 3BJAA 4KIFA 1QPMA 4ZZLA 2IJLA 2JZYA 3N97A 4NHJA 1Z05A 4PZJA 1T98A 5HLGA 2VT3A 2O03A 3GW2A 3RKYA 1BI2A 3EYIA 1WRJA 1G3WA 5D8LB 4U0WA 1YS7A 4UVAA 2JTVA 4HF0A 3Q5FA 3CTAA 2V1DA 4UV9A 2YX4A 2NAZA 3SZTA 2CW0F 4EJTA 1VTNC 2DK5A 2LF8A 3MAJA 4CICA 5CVVA 2E1CA 2K02A 4Q48A 2A68F 3FM3A 3I5UA 4O5VA 4FX0A 4KMUX 5EEHA 1D5VA 1U8RA 3COAC 1R1UA 4NB5A 1FBUA 1OPCA 2NYXA 4LG0B 2VN2A 3LA3A 3JSPA 1F1ZA 2K4JA 3GX4X 3ZMDA 4MQVA 1QO0D 3QAHA 4PCQA 4YIIA 3R6SA 3VEPA 3MQ0A 1WSUA 4ZYHA 5CVIA 1XGMA 3RDIA 3DF8A 3L2CA 2Z99A 2QENA 2MD5A 3JAMK 4EJUA 1DPUA 5JI6A 4LB6B 3K1PA 1DDNA 5HS9A 4EGYA 3B02A 3MZYA 5DD8A 5F6FA 3LQQA 3EDPA 3CO7C 2CGPA 2NNYA 4F7ZA 2JT1A 1I6XA 4ON0A 5HVQC 1P92A 4M6XA 5L3EA 4U7DA 4BHCA 5JVTA 3DPTA 2VBYA 1IRGA 2HS5A 2W24A 2BBYA 3H92A 3ZMUA 5L3FA 1QBJA 3FXRA 5J6XA 2L01A 4I09A 4OIRF 2Y0MA 2M5WA 2UXXA 3CUOA 5AONA 1YLFA 1FY7A 5EEGA 2F5DA 2GIVA 3P9KA 4HAMA 2Y48A 1EH6A 1BC8C 2GXGA 1WI9A 4HQMA 4AIKA 5D4SA 4G8XA 3PQKA 3WGIA 1WWXA 5KVRA 3KCCA 5IT9Z 2ETHA 2HDCA 3VB2A 2L4MA 1O3QA 1ONVA 2KIFA 3O2PE 3KP5A 1KU7A 2C6YA 3F21A 2F5EA 1LJ9A 3WG9A 1B6AA 5LGNA 5HOOA 2PJPA 3QU6A 3V8JA 5HDGA 1YIOA 4A0XA 2R3SA 4MTDA 5ICEA 4RGSA 2FU4A 3M7GA 1F5TA 2LSOA 1O7LA 2AXLA 1FX7A 4A0YA 4CZZA 3HRMA 5D5UB 3C7JA 3L00A 3U9GA 3FMRA 4GO1A 4RAZA 3SZPA 5E17F 3GF2A 2ZKZA 1BC7C 5L3BA 3QRFF 5BQTA 1E17A 4R79A 1BN5A 5TRDA 3PQJA 1DPRA 1XMAA 4WXCA 2Z5UA 4GYIA 4I98B 2WC2A 1BI3A 2LKPA 2L54A 1S8NA 3IRRA 4EM0B 1GXPA 4HF1A 1LDDA 2HQRA 2BGCA 2PMUA 1FSHA 3V8LA 2K7LA 2PI0A 3R0AA 1EV7A 2DLLA 3E3VA 3JW4A 4CO8A 1O57A 1BI0A 3J7AO 3DP7A 4P96A 5DV5A 1FYKA 2XV4S 4OU0A 4U7BA 2PQ8A 2RN7A 2MLGA 2QQAA 2YPRA 2RV8A 4MQ9F 1IN8A 3I58A 1OMIA 5HLIA 3H3UA 1JHHA 1TQMA 2CO5A 5H6RA 1JE8A 5LHGA 4WK8F 3WU0A 4Y15A 1FBQA 3S2WA 1K78A 1B9MA 2E7WA 2KIUA 4HX4A 1IZ1A 5LEJA 2FE3A 4PGGA 2W57A 2HQNA 1AOYA 4Z2YA 2GA2A 1K78B 1IXRC 1O3SA 3ZMVA 3HTUA 3T8TA 3V8KA 1R5HA 3F22A 5FD5A 1IF1A 3ZMZA 4QLCU 4XLPF 3GFIA 3E6DA 2CFXA 5E1WA 3E5XA 4IXAA 3R0JA 1ZRDA 4IHTA 2XASA 4JBAA 3TGNA 2MLKA 1S6LA 2ISZA 3L7WA 1YW8A 4QWQA 2IP2A 4P9UA 2RNJA 4IF4A 4HX7A 1YS6A 1S7OA 3BJOA 2P5VA 3GO5A 1DUXC 4OMYA 2Z9OA 1OYIA 2OA4A 5ILUA 2A61A 3WTYC 5HDKA 4DNCA 1U6GA 4RB1A 5JFRA 2LNBA 4LLGF 1H0MA 3FX3A 3GYHX 1J75A 1L0OC 1R7JA 4OIQF 1R23A 4U88A 5A2QK 5KK1A 2XGXA 3BJ6A 3GFLA 3IWFA 3N4MA 3KEOA 3OOPA 4HLXA 1IAWA 4EGZA 2W85A 1PUEE 3FXQA 4HF2A 2FMLA 1ZG5A 4FT8A 3KLNA 4LK0F 2EFPA 2J5PA 3FMQA 4LMYA 1YYVA 3QU3A 1J0RA 1BBYA 2XAJA 4IRHA 1D8JA 1JGSA 3V7CA 5K5RA 3IC7A 4MGRA 3RYRA 2LDUA 2QZ8A 4KIGA 3LA7A 2HYFA 2P8TA 2KJBA 5HLHA 4FX4A 4RS8A 5LLQA 4S04A 3FMSA 1KYWA 2JPCA 2ZJ2A 3E6CC 1SAXA 2G9WA 3WODF 4KMFA 2STTA 4H0EA 2CG4A 2IPQX 1J2XA 2DPDA 4ZYGA 4HDUA 5DDGA 2XROA 4KDPA 1YTYA 4O3MA 3K1NA 3EETA 2M87A 1V4RA 2EA4A 3I4PA 4A2UA 3R60A 4LB5A 2KIMA 3SQNA 4A0ZA 5FLXK 1ZREA 4AD9A 2XUBA 3JSOA 2Z33A 4Q4ZF 1FWZA 3KP6A 1KA8A 3LQRA 3NRVA 1LNWA 4RGUA 2ISYA 1B4AA 1SFXA 2RC4A 1BI1A 1PP7U 3D0SA 3IKVA 4CXFA 4KN4X 2H27A 2QVOA 3WE3A 4XSXF 5FFXA 3E97A 4G6QA 5HS7A 3F8BA 1MGTA 1YFHA 2FEZA 3I71A 3RI4A 3V7SA 2ZXJA 2EV6A 4A5NA 2V1UA 2EV0A 3LAPA 4WWCA 2ADUA 2ELHA 3RKWA 1W4MA 3CUQA 3GWZA 2JSCA 5JHUA 1LQ1A 4NQWA 4UNOA 5L3CA 1FOKA 2D1HA 2F5CA 1BIBA 5LGTA 1KU2A 3CUQB 2P7CB 2PBIA 2A6HF 3WTSC 4LG0A 2XHKA 1ZLJA 3GVAA 5CVRA 2HEOA 3HSRA 2HYGD 2EV5A 4CHUA 1IXSB 3WTWC 1LB2A 2A3SA 4IRGA 3I53A 1SMTA 3HYIA 5DUKA 4EJVA 1TBXA 4HDVA 2OZ6A 2K27A 5F64A 2FXAA 2L4AA 1SD4A 3ELKA 1W5SA 1R5GA 4MEYF 5ICGA 3NQOA 3MWMA 3G3ZA 4ZYEA 4UVCA 5BMZA 1UFMA 3ZPLA 2M8EA 2FBHA 4BH9A 3WTXC 2FSWA 3KP3A 3O6BB 4I02A 2V9VA 1HKTA 2E7XA 3LSTA 5CYVA 3MZHA 1F9NA 3OV8A 4HA8A 4A6DA 3MFKA 1FYLA 2VT2A 2YSRA 3KP2A 3BZ6A 3V7RA 2XKOA 2Q8KA 1P6RA 4UUVA 5FB2A 4P9FA 4AIHA 3F8CA 1XD7A 1EH7A 1R00A 3TO6A 1Z6TA 1V3FA 2MC3A 4ESFA 4HV5A 1R58A 3G73A 2A69F 2DW4A 1B59A 4XBFA 3K69A 1YO5C 2QUFA 5LBQA 1A04A 2P5KA 5FO5A 4XLNF 1HKQA 3WTTC 4ZYDA 3CDHA 5K5QA 3Q9VA 3B73A 4OOIA 3ZP5A 4R8HA 2ZCWA 1FPQA 1TW2A 5D5XB 2W84A 1I1GA 5K5OA 2NS0A 4L9TA 1UCRA 3W6JB 4LFUA 5CJ9A 1ZYRF 2ACJA 2FNPA 1R1TA 1TNSA 4IJAA 5ICFA 3GFMA 5HDNA 3J80Z 4GYGA 2M1BA 1SFEA 1H9TA 3KFWX 4OIOF 1MJBA 3ECHA 4BHPA 2EFOA 2G7HA 4B09A 2IA2A 4YFNF 1G3TA 1RUNA 2PLYA 1P2FA 1P4XA 1ZAOA 2YX7A 3ECOA 4ENMA 4MTEA 1FNNA 1KQ9A 5E1ZB 1B9NA 5LRSA 3F8NA 1FT9A 2EB7A 1O7FA 2KJCA 5BS6A 4M9ZA 1ZLKA 4HYEA 4EQQA 4BQAA 1G6NA 5IT9K 1ZRFA 2ZNZA 2GWRA 2RQPA 2BYVE 2HKOA 3AAFA 3HRSA 5CVJA 1U78A 4L0ZB 4UXNA 1S3JA 2VBWA 1Z9CA 1XMKA 3RPQA 3K0LA 3V4GA 3TQNA 4JK1X 2ESHA 5HS8A 1O3RA 1MKMA 4WXHA 2DI3A 2WV0A 2OBPA 1BM9A 5E8GA 1Z1DA 3RTRA 4AIJA 3ABTA 2A07F 4S05A 4JQFA 3J81Z 1SMYF 1KQ8A 1TLHB 3IKTA 1X3UA 2QM3A 5ED4A 1SD6A 2JPBA 1T0FA 5LEKA 2DBBA 3I59A 1W7PD 1STZA 1OR7A 2Q2EA 1BOAA 4OMZA 3EYYA 3RYPA 3I59B 2OQGA 3ZMTA 2H09A 2VE8A 2M45A 4HLYA 2VXZA 4N9IA 2ZNYA 2VC1A 1Z91A 1RZ4A 1S29A 1IN7A 3E6BA 5D5WB 1YQAA 4KIBA 4KT5C 4KA4A 1ZH5A 4LD5A 2P6TA 1UB9A 1IN4A 3DQVC 4I7HA 3R61A 2FQ3A 2DO7A 3RPUA 3E5UA 3KEQA 1JXSA 1LDJA 2L3DA 4RB0A 4G94A 4L0YB 2B0LA 3E5QA 2QLZA 5ICCA 3BDDA 3M8EA 2K86A 2DK8A 2IA1A 3GZ5A 1T38A 3FM5A 4M72A 4I0AA 3SFZA 1HBXG 4N0BA 1XGOA 4KFCA 2RKHA 2QBYA 3ZN0A 4M73A 4G6DA 4U0VA 3WTVC 3F23A 2QBYB 1GXQA 4IHSA 1ZG1A 5D6FA 6PAXA 2CYYA 2H6CA 2V79A 4ETSA 2L02A 1K6OA 3F8FA 3BROA 5LHIA 3I64A 5D5VB 1SFUA 2IVMA 3Q9SA 3C3WA 2GAUA 4PDKA 5E8IA 2DQRA 1BJAA 3T1BA 2VOOA 4CGZA 1ZGJA 5DYMA 3H3ZA 5ILVA 4EM1A 4I01A 3BPXA 3HHGA 3TDZC 1QNTA 3GEZA 2FMYA 5AIPA 2O61A 2NRAC 3WGGA 2JRTA 1XCVA 1D3YA 2DQLA 3GUDA 4BAYA 1FSEA 3QP6A 1U2WA 1TTYA 1HSJA 1IXCA 4Q5SF 3PFIA 1RI7A 4M71A 5JR3A 3WE2A 1USSA 2YU3A 4MHGA 2FNAA 2COMA 1C0WA 1E2XA 2OQRA 2GA1A 2HR3A 4D0PA 2XAHA 1ON1A 2FF4A 1LEAA 2QYOA 4L5JA 4A5MA 1RUOA 2GXBA 4HBLA 2HOEA 1RNLA 1IRFA 5DEQA 1FP2A 2H6BA 3K9TA 3CUQC 2P4WA 3U1DA 3NEUA 1MJAA 1ODDA 2K4BA 2VE9A 1P4AA 3F6VA 2V6CA 1PDNC 5LRRA 1UHMA 5J8CA 1CF7A 3F8MA 4ESBA 1WQ2A 1KQ0A 2EK5A 1CF7B 2RGVA 2BV6A 2O3FA 2HGCA 2W25A 2R7DA 4RGXA 5K1YA 4XSZF 2DT5A 2TDXA 3LWFA 2HWVA 1B1BA 4RAYA 1Z7UA 5DCMA 2CQKA 1TNTA 2M30A 1K7AA 3TO9A 4G7ZF 1GHCA 2FBIA 1Q1HA 5F1RA 3K2ZA 2ZO4A 5CVUA 2ESNA 3MEXA 3WTZA 5DCMB 2KKOA 3HOSA 4L18B 4HV6A 3TOAA 2GZWA 3TO7A 2VBXA 4EVIA 4YG2F 4FHTA 2BE5F 1U5TC 1HXDA 1J9IA 1OYWA 1YW7A 5E20A 4YFXF 1QZYA 3IHUA 1NHAA 2FRHA 3ROUA 3JTGA 1T39A 3E6MA 1KU9A 1XB4A 4P5OA 3M8FA 3ZQ7A 1FP1D 3FF5A 3JAMZ 2A5YB 4KUMA 1S7AA 3KZYA 3TKYA 1MDMA 1XDUA 5J8FA 5H20A 3TOBA 4R1HA 1IUYA 1H9GA 4Q47A 1LEBA 4M9SA 3P9CA 4WCGA 3D5LA 2HKXA 1MDMB 3EQLF 3WU1B 1MZBA 2KRFA 4Y17A 3DFGA 2PFBA 2DTRA 2XVCA 2G7UA 3RKXA 3SHFA 2FBKA 4ENKA 1R22A 1T2KA 3LAJA 1W7PA 4UVBA 3KP4A 1U5TA 3SXYA 3KLOA 3ERED 2UWMA 4OINF 1W7PB 4AVPA 2HZTA 3DKWA 2DAOA 1U5TB 1P4WA 4L9VA 2Y75A 3I0TA 1Z6RA 5BPDA 2R7FA 1GVJA 4RB3C 2ZFWA 4CYDA 4P55A 2XAQA 1XDSA 4E70A 1FYMA 1Y0UA 5D8KB 1G4DA 3F6OA 5BOXA 2HFHA 3BPVA 3EUHA 4KN7X 3HOTA 2F5FA 3FWEA 4UHTA 5BPIA 2XAFA 3M1EA 4KICA 4UV8A 2GQQA 3CO6C 4EMSA 4M9XA 2P6SA 3I54A 3KE2A 3T0YA 3DEUA 4EJOA 1OYYA 1PP8F 1FC3A 3P9IA 4M74A 5ERIA 1RIOH 3F3XA 5ILSA 3MCZA 1ZGAA 3U2RA 4MEXF 2A6EF 3BWGA 1J59A 1G3SA 2MH9A 2FOKA 4N9HA 5AIQA 3J80K 1ON2A 3HUGA 2RVCA 5LGUA 4G7OF 2P5LC 4LJZF 2IW5A 1XGNA 2VC0A 4BXUA 1QQIA 3IL2A 4WXDA 4KYWA 5E18F 4HOBA 5TJJA 2OAZA 4WF2A 2OD5A 1FLIA 4ENJA 1F4KA 1KU3A 3WTUC 4EM2A 2X4HA 3LA2A 3L09A 4PGHA 2PEXA 4B8XA 2WWYA 2D2WA 2PG4A 3ZMSA 4YFKF 4LLNA 1OKRA 1TQPA 3KETA 4HW0A 4K2EA 2VODA 4BNCA 2O6GE 3KZZA 1L3LA 1HW2A 3FZVA 1W5TA 2UZKA 2BEOA 2O8XA 3M9AA 3FHZA 2J5OA 3J81K 3GXOA 1J5YA 5E1XA 2STWA 3O3KA 4TV7A 2CWEA 3CLOA 1ZG3A 2E1NA 1HSTA 2QQ9A 2WTEA
chains in the Genus database with same CATH superfamily
3CMYA 3T5XA 4A93J 2QGUA 1YJ9I 4U0YA 1QHHD 4OAYA 4RDUA 1IV6A 3FISA 3J7YJ 3BR0A 2MYSA 4IQ4A 4A6EA 4ZZDA 1XSDA 3A2KA 2W1OA 1VZ0A 4M3BA 5DUIA 1RR8C 4EJWA 3TDUC 1G59A 2NVXJ 1I27A 1IN5A 5F0CA 2DFHA 2XRNA 3ZQLA 5D6EA 4DQ2A 1UHSA 4HZFA 1QZZA 1SFOJ 2L9NA 2H1KA 3G2BA 5CLSA 4JOMA 1U9NA 4C3IJ 3CDIA 5IT3A 3G1LA 3BLYA 5FGMA 1MJ9A 3WGHA 1JJ8C 4KNYA 1F36A 2IA0A 4JX6A 1KONA 2IRFG 2V1XA 3KYCB 4N4OB 3HRTA 5FRMA 1D8KA 2EWNA 4I0BA 1ETOA 2DA7A 3FBNB 5GPAA 2MD0A 2EFWA 4HX8A 3HDDA 4GXOA 4RB2C 1IN6A 2MBFA 4MNUA 4KJZA 4FASD 2IS1A 3DV8A 2ZBKA 3TMOA 3PM1A 3C2HA 2AS5F 2HPMA 2QKMB 4RAGA 3RJPA 1KZHA 2MH2A 3KEYA 2YR2A 4XRFA 3RIRA 4AVZA 3V42A 2W00A 2LREA 1G8XA 2QQBA 2XF5A 4DOZA 1R36A 3CMEI 3FXUA 2IT0A 1BIAA 5FD6A 1T6SA 3D1NI 2XAGA 3REOA 5A2QZ 3MVPA 4PJ0C 3HTSB 4IRIA 5EG0A 2HPIA 1ZK8A 1REPC 2QWWA 2D5VA 1WGXA 4GCVA 2ZSHB 1HW5A 5EYRA 1OISA 1LVAA 5LHHA 2Q0OA 2DU9A 1HW1A 3I4MJ 1TWGJ 5GADJ 4B4CA 2P7VB 1CGPA 1SD5A 3ML6A 2R4GA 2R7WA 1Y8QB 2EA2A 3PO2J 2OU2A 1WJFA 2TCTA 3R4KA 1MMDA 1ULYA 2O0YA 3DXJF 2ZMEA 4ZH4F 1ZARA 2IGNA 3AG1H 3JTHA 3QP5A 3OS0A 3M8JA 2DPUA 4M3GA 4RMNA 1XSXA 1RR7A 3GZ6A 3P7NA 1SD7A 3IRQA 1VQ5I 3GLXA 2FUG2 2LYCA 3S3MA 2FA5A 1ZHFA 1USTA 3BY6A 1UELB 2ZMEB 1ZQ3P 1JHFA 2OV7A 4CDGA 3HOWJ 2VONA 4ESJA 1Y8RB 4L9JA 3ZQFA 2KPMA 5FFZA 4ENNA 1IW7F 1ZN2A 4L5IA 2CUFA 5FKNA 1FBSA 2XGCA 1E3OC 3C18A 2V9KA 1PJRA 2A5WA 3BT9A 2PN6A 1UHWA 3VODA 3L9FA 4CCJA 2QCOA 5DD4A 5J1RA 2EJRA 1XGSA 2MA3A 4DYRA 4IHVA 1TQIA 4RGRA 2ZB9A 2JN6A 4GGGA 3GFJA 1T8IA 3VYSB 2HOAA 1XSVA 2XKPA 4LGWA 1D5YA 1Y6IA 3ABUA 4C30A 4G7HF 4IVNA 4ASNA 1K79A 2RDPA 2VQCA 4BHBA 2EFQA 2XIGA 4LK1F 1FTZA 3KZIC 1RKTA 2TRTA 3ISPA 3QPTA 1D0XA 2Q1ZB 3HSEA 3OYHA 4WX9A 2JVHA 4O6JA 2Y9ZA 3BP8A 4PJLA 4G9YA 2HTJA 1MMAA 4BS9A 2KMUA 3NARA 1V55H 2OZUA 2DA3A 1QGPA 2VBZA 2EFNA 4M6YA 4DZJA 5E3MA 2DOFA 4XKWA 3H5NA 4BYYA 3GBGA 4C2UA 2H94A 2DODA 1YE9A 1O3TA 3DPLC 1LDKB 2F4MB 2XB0X 3CESA 3OYKA 3S1QJ 1KGSA 2HXIA 5FLXZ 1U3EM 3OYLA 2K3PA 1DP7P 1EH8A 3K1MA 2NNNA 5DCFA 4IPAA 2XRLA 3I56I 2UXNA 1XN7A 1I5ZA 4XKVA 1I3AA 3VFZA 1KYZA 2D45A 3BG6A 5L3GA 4LITA 1HLVA 1JKOC 1AWCA 2K9QA 2OCEA 4HQEA 5K7ZA 3DTIA 3W6KB 3VPRA 5L3DA 1J7KA 1TW3A 1OCOH 1UAAA 2QQ8A 1R71A 3T8RA 1FZPB 5H6QA 1HC8A 5D4RA 4I2OA 4AWXB 3ZN1A 3LFKA 1YG2A 1ZR4A 3CJNA 4D1QA 2D1VA 4IHWA 3AKZA 3S15J 4LG3A 1I3QJ 3HRUA 4AUXA 1XCBA 2Z3YA 4EV0A 2F2EA 4A12A 1HKSA 1ZRCA 1Z77A 3HGGA 4DJAA 3OR1C 1YW9A 1I1SA 3HB9A 4RAFA 1HQCA 1R1VA 2X0LA 3JCUC 1WKMA 3HSFA 1SVMA 2F4OB 3N05A 5J40A 4L9NA 1JUSA 5C3EJ 3C1DA 4CCMA 2CSOA 3ULQB 4YIFA 3IWZA 3PNYA 4HNTA 4Y13A 3C2BA 3QPHA 1G3YA 3BOQA 3HHHA 4F3QA 2NVYJ 2DFIA 2OTJI 3ABLH 2EZHA 2LF7A 3HIFA 3ABMH 1MD0A 4CCLA 3KP7A 2AO9A 3QYFA 1X1DA 1EJ9A 4BDYA 1TC3C 5GTIC 2VOPA 2LOOA 3OR2C 2HTSA 2PMHA 3QOPA 3F72A 4OIPF 4LLLA 3VOEA 3BJAA 4KIFA 1MBJA 2JSPA 1JTXA 3EUKL 2FD5A 1UZCA 1QPMA 4BQQA 1TWHJ 3OL4A 4ZZLA 2BW3A 2IJLA 2JZYA 3N97A 4NHJA 1Y1VJ 4JYKA 1Z05A 4PZJA 1T98A 5HLGA 3QODA 3DBHB 2VT3A 4FCYA 2O03A 2M9HA 1UJ8A 2VKHA 4F91B 3GW2A 3RKYA 1BI2A 3EYIA 1WRJA 1G3WA 5D8LB 4U0WA 1YS7A 4UVAA 1TT5B 2JTVA 2V9PA 3JRAA 4HF0A 3Q5FA 3CTAA 1X2NA 2V1DA 3DU6A 2BW3B 4XOTA 4UV9A 4Y52J 2YX4A 4C2TA 2NAZA 2NVQJ 2XSJC 3SZTA 3ONQA 2CW0F 4EJTA 4W97A 1VTNC 2KHMA 2WBMA 2DK5A 5K7FA 1N25A 1NH3A 2LF8A 3MAJA 2E1MB 3PNTA 4CICA 1X4PA 2M4GA 5CVVA 2E1CA 4JP0A 1K61A 2E2JJ 2K02A 4Q48A 2A68F 3FK7A 3J7ZI 4ZTFA 4CCOA 1JT0A 1QVUA 3FM3A 3I5UA 3HPHA 4O5VA 3OYMA 4NNJA 3BG9A 3GTOJ 4FX0A 2R5ZA 5IP9J 2FQ4A 4KMUX 5EEHA 1D5VA 1U8RA 3COAC 2VPRA 1R1UA 1U0JA 2EINH 2HI3A 4NB5A 1TP4A 1VQ9I 1FBUA 1OPCA 4BBSJ 2NYXA 4Y4RA 4LG0B 2VN2A 3OYGA 2VKVA 3LA3A 3JSPA 1F1ZA 2K4JA 2R5ZB 3L2UA 3GX4X 2ZJPF 4FE7A 3ZMDA 4MQVA 1LUJB 2WAQA 3EUHC 1QO0D 3QAHA 1X3ZB 3S93A 2M0CA 5KAIC 2DJIA 4PCQA 4YIIA 3R6SA 3VEPA 4UB6C 3MQ0A 1WSUA 4ZYHA 3D5SC 4B43A 5CVIA 1XGMA 3RDIA 1VQ7I 3DF8A 1YX5A 3L2CA 2Z99A 2QENA 2MD5A 1MW7A 3GTMJ 3JAMK 4AYBN 4EJUA 1DPUA 5JI6A 4LB6B 4Y7NJ 3K1PA 3OYAA 1DDNA 5GAHJ 1OJLA 1IG7A 5HS9A 4EGYA 3HJEA 3B02A 3MZYA 5KHDA 5DD8A 3WU2C 3JRFA 3JRDA 2RAEA 2ME0A 5F6FA 3LQQA 3EDPA 3CO7C 1NG7A 3ZQGA 4D7MA 2CGPA 2NNYA 4GDFA 4F7ZA 3IP4B 2JT1A 4DYQA 4CA0A 1I6XA 4ON0A 3RKQA 5HVQC 1P92A 4M6XA 3HZJA 5L3EA 3VYTB 2QEXI 3DWLE 3FIWA 5F0FA 1NTCA 4BHCA 2MW8A 2L7ZA 5JVTA 4U7DA 3DPTA 2VBYA 4XQFA 1AKHB 4BDZA 1IRGA 2RNGA 2HS5A 2W24A 1EA3A 2BBYA 1W1WE 3BC8A 3H92A 1N78A 1V54H 1WVRA 3BTCA 2IGMA 3NWSA 3H5RA 3ZMUA 5L3FA 1X1CA 1V5EA 4RA2A 1QBJA 1R9TJ 4KISA 3FXRA 5J6XA 2L01A 4I09A 2WB1N 4OIRF 3S1RJ 3K4CA 3BR5A 3FKJA 1LFBA 2P0WA 2Y0MA 1HA8A 2M5WA 2UXXA 3CUOA 4AYBA 5AONA 3DTEA 2DJNA 1YLFA 4AU7A 1FY7A 2KP6A 2KRHA 5EEGA 2F5DA 2LKSA 1A5JA 2GIVA 1NK2P 1GV2A 4BY1J 3P9KA 3W2WA 3E0JB 1Z0XA 4HAMA 2LLKA 4XM3A 2LC2A 5EZGA 4BKXA 2Y48A 1EH6A 4PUSA 4XORA 3HOVJ 1Y39A 1BC8C 2GXGA 1WI9A 1SAUA 4HQMA 4AIKA 5D4SA 4G8XA 2ZXIA 4E7KA 2WA0A 3PQKA 4HNUA 1WWXA 5KVRA 3KCCA 3WGIA 5IT9Z 2ETHA 2BXZA 2F5VA 1TL8A 5FJ8J 3MKZA 2HDCA 3VB2A 2L4MA 1O3QA 1ONVA 3OWTA 2KIFA 4FQGA 3O2PE 2V4JC 2L9SA 3KP5A 1KU7A 1RRJA 2C6YA 3BCAA 4QIWN 3PIOF 3F21A 2F5EA 1LJ9A 4BE0A 2HYJA 3WG9A 2W48A 1B6AA 2EZKA 5FKOA 5LGNA 4D5FA 5HOOA 2E2IJ 2Y0SN 2PJPA 3QU6A 2LY9A 5HNHA 3BTIA 2JA6J 1SEUA 2DMUA 3V8JA 5HDGA 3OYBA 2DA1A 1YIOA 2M0MA 4A0XA 5EZHA 3NWTA 2R3SA 4MTDA 5EJCA 4RGSA 5ICEA 2FU4A 3M7GA 2WB1A 1F5TA 2LSOA 1VQPI 1O7LA 2AXLA 3GTLJ 1FX7A 3HGYA 4A0YA 4CZZA 5IYBJ 1MIJA 3HRMA 5D5UB 2R7VA 3C7JA 3L00A 5DS9A 1OCTC 2X48A 3U9GA 3CCVI 9ANTA 3FMRA 4GO1A 4RAZA 3SZPA 5E17F 1DP3A 3GF2A 2ZKZA 1BC7C 5L3BA 3QRFF 5EF6A 1T56A 5BQTA 1E17A 3JR9A 4R79A 1BN5A 4DBRA 5TRDA 2LK2A 3PQJA 1DPRA 1XMAA 4LOCA 1E0EA 3W3CA 4WXCA 2Z5UA 4XONA 2HNHA 4GYIA 4I98B 2WC2A 1BI3A 3BG5A 2LKPA 2BY2A 1BR2A 4C2MJ 2OUMA 2L54A 1S8NA 3S2HJ 5EDNA 4JX5A 2X51A 4X0GA 3IRRA 3QOEA 4EM0B 2QF7A 1GXPA 4HF1A 3TL4X 1LDDA 1BW5A 3O8GA 2HQRA 4ZDPA 2BGCA 1UG0A 1I50J 2PMUA 1T33A 1Z7LA 1FSHA 3V8LA 2K7LA 4BGDA 2PI0A 1DGRM 3R0AA 2WAEA 3TW6A 1EV7A 4NC8A 1JJ6C 1MBHA 2DLLA 4HEA2 2IEKA 4CYCA 3E3VA 3JW4A 4NC7A 4CO8A 1O57A 2KZVA 1BI0A 3J7AO 2ECCA 3DP7A 2LR8A 3H9GA 4UUTA 3GZNB 3HOYJ 4P96A 5DV5A 1FYKA 2XV4S 3KYDB 4OU0A 4U7BA 3BG3A 2PQ8A 2DDAA 2RN7A 4XRMA 2RREA 1QRYA 4J01A 4CYCB 2MLGA 2QQAA 2YPRA 1VI0A 2RV8A 4MQ9F 1IN8A 1IV8A 2DCEA 1B8IB 1Z67A 3I58A 1OMIA 4KT6A 4QTRA 5HLIA 1MBGA 3H3UA 1FEXA 2Q2EB 1WPKA 1JHHA 1TQMA 2CO5A 5H6RA 1SFKA 2XB5A 1JE8A 3F9KA 5LHGA 4WK8F 4GRIA 3WU0A 3JRHA 2FOWA 1R4NB 3ZQQA 4IL6C 1CQTA 4UB8C 2AXTC 4Y15A 1FBQA 2ZMEC 3S2WA 3CDLA 2X1EA 1WFXA 1MH4A 1K78A 3G4SI 1B9MA 2E7WA 2KIUA 3CC2I 4XN0A 4HX4A 1IZ1A 5LEJA 1W36C 1DU0A 4KITB 2FE3A 1AA7A 1OCPA 4E4HA 4PGGA 5GTHC 2M7BA 2KIQA 2ZJQF 2W57A 3FHNA 2HQNA 1AOYA 3C2GA 4Z2YA 4ZYAA 2E71A 2GA2A 1VQOI 1BR1A 4XN3A 4XLEA 1K78B 1I6HJ 3OYJA 1IXRC 1O3SA 3ZMVA 1JTYA 1D0ZA 3HTUA 3K4NA 2ZJRF 3T8TA 1M1EB 3IUOA 2HZDA 3V8KA 1R5HA 3H1CA 3PSIA 3MKYB 3F22A 1WCMJ 2BVMA 3B6AA 4A3JJ 4ZJZA 5FD5A 1IF1A 3ZMZA 4QLCU 4XLPF 5BNGA 3LSKA 1SVOA 2Y30A 3GFIA 3E6DA 5EEAA 1YJNI 2CFXA 3GMEA 2DFEA 3E5XA 4IXAA 3R0JA 5E1WA 1ZRDA 4IHTA 2R7XA 2DTZA 1GT0C 3ASNH 2H8WA 2X1DA 2XASA 4JBAA 1LFPA 3DCFA 3TGNA 1K4SA 2MLKA 1S6LA 1XS9A 2ISZA 4BJ6C 3PUFA 3L7WA 3CMMA 1RC9A 1YW8A 3CQZJ 4NDLA 4QWQA 2IP2A 2K9NA 4P9UA 3BQYA 1U8BA 1OFCX 2RNJA 4XKCA 2E5NA 4IF4A 1WH7A 4HX7A 1YS6A 3OSGA 1S7OA 3IH4A 3BJOA 2OC6A 2P5VA 3GO5A 3I3LA 4B44A 4XLCA 4E7JA 2JRMA 2FJ1A 3K70D 1ERDA 1DUXC 4OMYA 2Z9OA 4IOAF 1OYIA 2OA4A 4FTHA 2L0KA 2E34A 5FKLA 2R5YA 5ILUA 4F92B 4ZTJA 1S9HA 2A61A 3WTYC 5HDKA 1NK3P 4DNCA 1U6GA 2DFFA 4RB1A 3HBLA 3LL7A 4A3BJ 5JFRA 2LNBA 1QU3A 1RPWA 4LLGF 1H0MA 3FX3A 2F4IA 3WHBA 3GYHX 1APLC 2ME6A 4D7NA 1J75A 2K3FA 1L0OC 2R5YB 1R7JA 5FRNA 4OIQF 1R23A 4U88A 2HOSA 1TT0A 4B47A 5A2QK 5KK1A 2XGXA 2HDDA 3BJ6A 3ZOBA 3GFLA 3IWFA 4I99C 3N4MA 4YRVA 3LNQA 3KEOA 3OOPA 3AFHA 4HLXA 4F55A 2JQ7A 4XKBA 2ICWG 3A03A 3CP8A 1WJDA 2COBA 3GTPJ 1IAWA 4EGZA 2W85A 1PUEE 2BXYA 3FXQA 4HF2A 2FMLA 2DA2A 5CQEA 3MKWB 3SEZA 1ZG5A 1H89C 4FT8A 4A3KJ 3I9V2 1A6IA 3KLNA 4M3FA 4LK0F 2EFPA 2J5PA 3FMQA 4LMYA 1YYVA 1Y1WJ 3QU3A 1J0RA 5B1BH 1BBYA 3EUAA 2XAJA 4IRHA 1D8JA 1JGSA 3V7CA 5K5RA 2JJ7A 2MGQA 3IC7A 4MGRA 2BY0A 3RYRA 2LDUA 3BR3A 3BZKA 3HC7A 2QZ8A 4KIGA 1V5GA 3LA7A 2K9LA 1X58A 2KL4A 2KQRA 2HYFA 2P8TA 3AG2H 2KJBA 3LMMA 4V19K 3CCLI 5HLHA 1LE8A 4A3MJ 1Z3YA 1X1AA 4BJ5C 2O8KA 4BE1A 2JUGA 5IOYA 3BTLA 4FX4A 4RS8A 5CQGA 3BG7A 5LLQA 2KDOA 4S04A 3FMSA 4BY7J 1KYWA 4OWRB 2JPCA 4MLOA 1BA5A 1LE8B 2JA8J 2ZJ2A 3E6CC 1SVLA 2I8DA 1SAXA 2G9WA 3KPHA 3WODF 2XGDA 4KMFA 2STTA 2ID3A 3IAM2 4H0EA 3H9JA 2CG4A 2XF6A 2IPQX 3FXJA 2DT6A 2EPFA 1J2XA 3GLLA 4CH7A 3ZRGA 3LSIA 4BQNA 2GXAA 1WZ2A 4E7LA 1MNDA 2DPDA 3SYTA 4B1RA 4ZYGA 4HDUA 4M3EA 2QSHX 2E1MC 2L7MP 5DDGA 2XROA 4KDPA 2Y9YA 1YTYA 3RPUD 4DW6A 3K1NA 1IC8A 2CQQA 3EETA 2E36A 4O3MA 3TP0A 2MABA 2QA4I 4BEHA 2M87A 1V4RA 2EA4A 3VYRB 1Z3XA 3FDYA 2XSDC 3AG3H 3I4PA 1EKEA 4A2UA 4E6KG 3R60A 2LY2A 2R7OA 3I4NJ 4LB5A 3OYFA 2VL8A 2KIMA 3SQNA 4BEHB 3L2RA 3OSFA 4A0ZA 5FLXK 1ZREA 4AD9A 2XUBA 4PJNA 3JSOA 1VQ6I 4NBQA 4IEJA 4Q4ZF 2Z33A 1FWZA 4XRSG 3KP6A 1KA8A 3LQRA 3NRVA 4A3EJ 1LNWA 4RGUA 1ZKGA 2NOGA 4V2GA 2ISYA 2CJJA 1VQNI 5J47A 5M5YJ 2CQ7A 1B4AA 1SFXA 1R5ID 2CFOA 2RC4A 2AQEA 1BI1A 3HKZN 3RQIA 2DMQA 3I55I 1PP7U 3D0SA 4L5EA 3IKVA 2DMPA 4CXFA 4KN4X 2H27A 2QVOA 3WE3A 1ETWA 4XSXF 1QHGA 5FFXA 3OIPA 3E97A 3CC4I 1HF0A 4G6QA 5HS7A 3F8BA 1MGTA 3RSNA 2XDVA 4BBRJ 1YFHA 1FTTA 2FEZA 3I71A 3OS2A 4D9JA 3RI4A 3V7SA 3JRCA 2ZXJA 2EV6A 3U21A 2M2EA 4XNFA 3FKIJ 4II3A 4A5NA 2WAQN 2EV0A 2V1UA 2HDWA 2R7QA 1SANA 3LAPA 2ZFUA 4WWCA 3AL0B 3WG7H 3IAS2 2ADUA 2ELHA 5JLWA 3RKWA 1X19A 1W4MA 4CSWA 3CUQA 5DTDA 4PSXA 3GWZA 2JSCA 5JHUA 2CV0A 1O4XA 2BZTA 1LQ1A 4NQWA 1ZR2A 3M4OJ 2IS2A 2EQRA 2EZIA 5HLTA 4UNOA 5L3CA 1FOKA 2BHZA 2D1HA 1W0UA 1ITYA 3HOZJ 2F5CA 3OL3A 1E3HA 1BIBA 3Q0WA 1KU2A 3CUQB 5LGTA 2P7CB 2PBIA 1B72A 1Y0NA 2MSYA 2A6HF 5B66C 4NQWB 3HKZA 3WTSC 5IY5H 4LG0A 2XHKA 4XRSA 1R4MB 1ZLJA 5M3MJ 1VQ8I 1S72I 1XG1A 3GVAA 2JA5J 2XF7A 5CVRA 3ZQIA 1DGWY 2HEOA 3HSRA 2HYGD 1TWFJ 3QQAA 2EV5A 4CHUA 4ZDOA 1IXSB 3WTWC 1LB2A 2A3SA 4IRGA 3I53A 1SMTA 2R7RA 3HYIA 2LTPA 5DUKA 1TBXA 4EJVA 3CCSI 1B72B 2LRDA 2Y69H 3H0DA 4HDVA 2CQNA 2OZ6A 2LP0A 3L2WA 2K27A 2VJJA 5F64A 2W4SA 2FXAA 2L4AA 2VJ4A 1SD4A 3ELKA 1W5SA 3UKGA 2VQHA 1R5GA 4MEYF 5ICGA 5B5EC 3NQOA 3QPSA 3H3VK 3MWMA 3G3ZA 4ZYEA 2K9SA 1ZTRA 2X85A 4UVCA 2JWTA 5BMZA 4HRIA 3IH2A 4EATA 1UFMA 1X1BA 2B7EA 3ZPLA 2M8EA 2FBHA 4BH9A 5HNFA 3WTXC 2FSWA 3KP3A 3BR6A 4XLHA 1YIJI 3BR1A 2KZGA 3O6BB 5E3OA 4I02A 1R49A 2V9VA 2KDZA 1HKTA 3B6CA 2E7XA 3GTKJ 2I10A 3LSTA 5CYVA 3MZHA 1F9NA 3OV8A 4HA8A 4A6DA 1E3PA 2LBFA 1N75A 2OJED 3MFKA 1FMWA 1A31A 1FYLA 2VT2A 2YSRA 3KP2A 4X6AJ 3BZCA 3BZ6A 3V7RA 2XKOA 4H4KC 2HVQA 2Q8KA 1AKHA 1P6RA 4FETA 4UUVA 2LFBA 5FB2A 4P9FA 4AIHA 2LBFB 3F8CA 1XD7A 1EH7A 1R00A 3TO6A 1Z6TA 3JRBA 4AM3A 5GPCA 1V3FA 2MC3A 4ESFA 1MNEA 4HV5A 3HPGA 1R58A 3G73A 2A69F 3MD2A 2DW4A 4BU2A 3RZOJ 2K9MA 1B59A 1FOWA 4XBFA 3K69A 4QSHA 2IGOA 1YO5C 4PFPA 2QUFA 5C4JJ 5LBQA 4CCNA 1VFCA 4W1UA 4IHYA 1A04A 2P5KA 5FO5A 2W82A 4XLNF 1HKQA 1R6RA 3WTTC 4ZYDA 3CDHA 5K5QA 4E7ZA 3H0GJ 3Q9VA 3B73A 1U9OA 3UR3C 4OOIA 3ZP5A 4R8HA 2ZCWA 3K4LA 1FPQA 1TW2A 5D5XB 2W84A 1I1GA 3GTJJ 3MZ8A 2FX0A 1YX3A 4BQOA 5K5OA 2R0QC 2NS0A 3MN2A 4L9TA 3BCBA 5C44J 1UCRA 3CCYA 4LFUA 3W6JB 5CJ9A 1ZYRF 2ACJA 2FNPA 5M5WJ 2LD5A 5IPAA 1R1TA 1TNSA 4IJAA 2VUMJ 5ICFA 3GFMA 1GDTA 2EIJH 5HDNA 4B3XA 2R7TA 2EIMH 5TISC 3J80Z 3G6EI 4GYGA 2M1BA 1SFEA 1H9TA 3KFWX 4OIOF 3Q0VA 4IZZA 2M8GX 4U87A 1VQMI 1IRZA 1MJBA 1IUFA 3ECHA 4BHPA 3DPUA 1YITI 2EFOA 2G7HA 3E1SA 1JT6A 4B09A 2IA2A 3W2VA 4MIMA 4YFNF 2L7FP 1G3TA 1RUNA 4ABZA 1P2FA 2NXNB 1P7JA 4J19A 2PLYA 1IDYA 3A02A 1EF4A 4M3DA 1OCCH 1P4XA 1ZAOA 2YX7A 3ECOA 2CUJA 4ENMA 1ORKA 2VKDA 4MTEA 3CJTB 3S32A 1IRXA 1FNNA 2DN0A 1S5LC 2L5QA 2M4KA 1KQ9A 2L7KA 1YRNA 1RESA 5E1ZB 3CMAI 1B9NA 1ETKA 1WI3A 5FLMJ 5LRSA 4PK4A 3DBLB 4PSWA 3F8NA 5F0HA 3PFYA 4E7IA 3M3YJ 1FT9A 1XX5A 2EB7A 1JKPC 1O7FA 2KJCA 5BS6A 4M9ZA 2IBDA 2YUSA 1BJZA 4XR6A 2WV1A 1ZLKA 1YOVB 4MFDA 3DBRB 4HYEA 1YRNB 4EQQA 4XL9A 3DLAA 5JVGF 4BQAA 1X4OA 3S16J 1G6NA 3PUBA 5IT9K 5KNLA 1HDPA 1ZRFA 1WHUA 3BTJA 2ZNZA 2HQAA 2GWRA 2RQPA 2BYVE 2HKOA 3AAFA 3HRSA 5CVJA 1U78A 4L0ZB 4UXNA 1VQ4I 1S3JA 1X1PA 2VBWA 3CJRB 3QWLA 1Z9CA 3SJMA 2HVRA 1XMKA 2E35A 3S3OA 2CW7A 3RPQA 3K0LA 3VYUB 3OYNA 3V4GA 3TQNA 4JK1X 2HXOA 3NAUA 2ESHA 5HS8A 1O3RA 1MKMA 4E7SA 4WXHA 2DI3A 1ETYA 2EBIA 2WV0A 2OBPA 3HUGB 1BM9A 5E8GA 1Z1DA 2OCCH 3RTRA 4AIJA 2NVTJ 3ABTA 2A07F 2E2HJ 4RM3A 4S05A 4JQFA 2O9LA 3J81Z 4II2A 4UUSA 3OYCA 4ZDLA 1SMYF 1KQ8A 2X9DA 1TWCJ 2OTLI 1TLHB 2OPTA 3IKTA 2V1NA 1X3UA 5HODA 2QM3A 5ED4A 1SD6A 2JPBA 3ERMA 2L9VA 4UY8I 1T0FA 5LEKA 4F93B 2DBBA 3I59A 2KLOA 2E5ZA 3PL8A 4HPQA 1B8IA 4UUSB 1W7PD 1STZA 2IS6A 1OR7A 2Q2EA 1BOAA 2B63J 4OMZA 3SEQA 2LY1A 3EYYA 4RLQA 3RYPA 5GP9A 3I59B 2WAFA 2OQGA 2M3AA 2HOTA 3ZMTA 1N77A 2HQ5A 2H09A 2L9RA 2M45A 2VE8A 1WH5A 4HLYA 3S17J 2VXZA 4N9IA 5IP7J 2DDBA 4BL0B 5FLVA 1G2HA 2YU9J 2ZNYA 2JVGA 1Z21A 2VC1A 1Z91A 4IO9F 1OCRH 3K4JA 1RZ4A 1S29A 2EZLA 3WHCA 4S0HB 1YJWI 1IN7A 1ENHA 3CD6I 5JLXA 3E6BA 3L2VA 5D5WB 2UV1A 1YQAA 4KIBA 4KT5C 4KA4A 1ZH5A 1K4TA 2GBYA 4LD5A 2P6TA 1BW6A 3ABKH 4ITVA 1UB9A 1IN4A 3IV5A 2Z16A 4HG2A 5IYDJ 2XPVA 2R7SA 1PUFA 3DQVC 3PJRA 4I7HA 3SDBA 3R61A 2MFZA 2FQ3A 3GCMA 3CCEI 2DO7A 3KX2A 3DEEA 4P1WA 3P5JA 3RPUA 3E5UA 3KEQA 5DM6F 1JXSA 1JUMA 2XPWA 1LDJA 3DKYA 2N8GA 3GTQJ 2L3DA 4M6VA 4RB0A 4G94A 3OYDA 4L0YB 2IXSA 2VB6A 1PUFB 2ZSIB 4DGWB 2B0LA 2B9SA 4PFOA 2KFDA 1DU6A 3E5QA 2QLZA 1A36A 2X6OA 3BDDA 5ICCA 2KISA 2VPLA 3M8EA 2JK3A 2K86A 2DK8A 1XPXA 5K7HA 1V5FA 2IA1A 3GZ5A 1T38A 2XAUA 4RM2A 3FM5A 2K40A 4M72A 4FISA 5FKKA 2DA4A 1BOBA 4I0AA 3SFZA 1HBXG 4N0BA 2W7NA 1XGOA 1ETXA 3LFUA 2IAIA 4IKFA 2CQXA 4KFCA 1S7EA 2RKHA 3LOCA 4ZC3A 2X1CA 2QBYA 3ZN0A 4DIQA 3DKXA 2CUEA 2ZXWH 4M73A 3TP3A 4G6DA 2NOJB 5FROA 1MBFA 4U0VA 3ZQCA 4GFBA 3S1MJ 2GOXB 4LIVA 2VJIA 4BJTA 3WTVC 3F23A 2QBYB 2DT7B 2P81A 1GXQA 3KIOA 4IHSA 1ZG1A 1WJEA 4MFEA 5D6FA 3ASOH 6PAXA 1WJ5A 4NUBA 2CYYA 2H6CA 2V79A 3ZGKA 4ETSA 2LMDA 5EG0B 1J09A 2L02A 1K6OA 3F8FA 1HOMA 2XC7A 2VKEA 3A1YA 3BROA 5LHIA 3I64A 2DA5A 3LSHA 5D5VB 1SFUA 2IVMA 3Q9SA 3C3WA 4A3DJ 2GAUA 2K5CA 5EGOA 3F0CA 4PDKA 5E8IA 2DQRA 2PJRA 1BJAA 3T1BA 2VOOA 4CGZA 1ZGJA 5DYMA 3VSKA 3A0BC 3H3ZA 5ILVA 4EM1A 2R92J 2VQLA 4I01A 2DMTA 2ECBA 3BPXA 1X2MA 2OF7A 5J1YA 1YI2I 3HHGA 3TDZC 5EGOB 1QNTA 2G0EA 2GM4A 5GAEJ 2PJRB 3GEZA 2FMYA 5AIPA 2O61A 2DYRH 2NRAC 3WGGA 2R93J 2JRTA 1XCVA 2WY8Q 4BACA 1D1BA 1D3YA 4B48A 2DQLA 2F48A 2ZC2A 3GUDA 4BAYA 2V7FA 1FSEA 4V2FA 2X6YA 3QP6A 3U1KA 1U2WA 1TTYA 2VQGA 3H36A 1HSJA 4HSTA 2ID6A 1IXCA 4Q5SF 3PFIA 1RI7A 2H1LA 3DEWA 1BR4A 5CKTA 4M71A 2PMZN 5JR3A 3WE2A 3W6VA 1USSA 1JUPA 5LFAA 2BVLA 2YU3A 3JREA 4MHGA 2FNAA 2COMA 1C0WA 1H8AC 3OOUA 1VQLI 1E2XA 2OQRA 2GA1A 4XIDA 3AL0C 2E60A 2HR3A 3CP2A 1X3WB 4D0PA 4DYCA 2XAHA 3JRIA 1ON1A 3CCQI 4ANJA 2A05A 2FF4A 1LEAA 2QYOA 1IGNA 4L5JA 3SZGA 4A5MA 1FIAA 1RUOA 2GXBA 1Y56A 2DMNA 1SC7A 3W2AA 4HBLA 2HOEA 5F27A 3HM5A 1RNLA 4NC6A 4Y3OA 5F08A 1IRFA 3FXLA 5DEQA 2AHQA 3BQZA 1FP2A 5H2FC 2H6BA 1LPQA 1T08B 3K9TA 2LKXA 2CW8A 3CUQC 2P4WA 3U1DA 3NEUA 4I6ZA 3EPZA 1MJAA 4XLFA 1ODDA 3ZXSA 2K4BA 1IJWC 2BHYA 5KCMA 2VE9A 1MMSA 1P4AA 3F6VA 2V6CA 1PDNC 3K4BA 5LRRA 1UHMA 5J8CA 1CF7A 3O8HA 5IP6A 3S14J 3F8MA 3VWBA 2CS3A 2VI6A 3FBIB 2BOLA 4ESBA 3S2DJ 1K6YA 2VJ5A 2E1OA 2PMZA 1HDDC 4Z6YA 4RBOA 1WQ2A 3X2QH 1KQ0A 1TZLA 3ZQHA 1WJCA 1JKQC 2EK5A 2DOAA 3H5AA 1CF7B 3G71I 1MNMC 1AU7A 2RGVA 2CU7A 5E3NA 2BV6A 3HG9A 2O3FA 4IOCF 3LSMA 2HGCA 1MMNA 2W25A 2R7DA 4RGXA 2WY7Q 2EH3A 5E79C 5K1YA 4CZCA 4XSZF 1W5CC 2DT5A 2NS7A 3PSFA 3PNVA 2GIZA 3UNGC 2TDXA 3LWFA 1LKXA 2HWVA 2IGKA 1B1BA 3L1PA 4N4NB 4RAYA 1FJLA 4YELA 1P7IA 1Z7UA 5DCMA 4AC0A 2CQKA 3RQ4A 2V26A 3E7LA 1TNTA 2M30A 4A3IJ 5M3FJ 1K7AA 3CLQA 3TO9A 4G7ZF 2V6EA 5E3LA 4IHXA 1GHCA 2FBIA 1Q1HA 5F1RA 1ZGWA 3K2ZA 2ZO4A 3ESWB 3LSRA 5CVUA 2X6XA 2ESNA 4OAZA 3MEXA 2JA2A 2HVSA 3WTZA 5DCMB 2ZXHA 3S1NJ 2H8RA 1GV5A 3A4CA 2KKOA 3HOSA 3TEDA 4L18B 4G6TB 4HV6A 3TOAA 1A35A 1W36D 1UG2A 4X1EA 2IS4A 3CZ6A 3OIOA 1YHQI 4CUGA 3DTKA 2GZWA 1T95A 1TWAJ 3IH3A 2QSFX 3TO7A 2VBXA 2JMWA 4BUPA 4EVIA 3LSPA 4YG2F 2Z1DA 4FHTA 4E7HA 1MSFC 2BE5F 4XICA 2NS8A 1U5TC 3G1OA 3CC7I 1HXDA 2YS9A 3D5RC 2DYSH 3CCMI 1J9IA 1OYWA 1YW7A 5E20A 1POGA 4YFXF 1QZYA 3IHUA 1VQKI 1NHAA 2FRHA 3ROUA 2LVSA 2XPUA 3BR2A 3JTGA 2Z2SB 1T39A 3DU5A 2VXDA 3E6MA 1KU9A 3J7AY 1XB4A 1PVEA 4P5OA 4DZPA 3M8FA 2KRCA 1RKWA 4XK4A 3CJQB 1FP1D 3FF5A 3ZQ7A 3JAMZ 2A5YB 2O7OA 4KUMA 1S7AA 3KZYA 3TKYA 1MDMA 1XDUA 5J8FA 5IYCJ 5H20A 5DM7F 5F1JA 2F6CA 2GLOA 3TOBA 4R1HA 1IUYA 1H9GA 4Q47A 1LEBA 4M9SA 3P9CA 4IQJA 4WCGA 1GUUA 2UUZA 3CF2A 5B3SH 3RCOA 3D5LA 2Y31A 3FXKA 4HSRA 5C4XJ 2HKXA 3HL2A 2M34A 3QYBA 1MDMB 1QPIA 4G12A 3EQLF 5M5XJ 1Q1VA 3WU1B 1MZBA 3GTGJ 2KRFA 4Y17A 4A69C 3DFGA 4C9YA 2PFBA 1LVKA 2DTRA 5KAFC 5LD2C 1WJBA 2XVCA 3K2AA 2G7UA 2ELJA 3RKXA 3SHFA 2FBKA 4ENKA 1R22A 4HNVA 2DXIA 2VASA 1T2KA 1A6QA 3LAJA 2CUZA 1IO2A 1W7PA 3QPLA 3A0HC 4UVBA 3KP4A 1D1AA 1U5TA 3SXYA 1ACIA 3KLOA 2K85A 3QYEA 3ERED 2UWMA 1FMVA 2E19A 2GOMA 2EILH 4OINF 1W7PB 1OCZH 4AVPA 2HZTA 3DKWA 2JA7J 2DAOA 1U5TB 1P4WA 4AIDA 3K70C 3K7AJ 4L9VA 1BL0A 2Y75A 4FE4A 5FKMA 3DLLF 4XOPA 3I0TA 4YIRX 2A6TA 3K6GA 1ZELA 1Z6RA 3OYIA 5BPDA 2R7FA 1GVJA 4RB3C 4QPOA 3A01A 2ZFWA 4CYDA 4P55A 4I76A 2HU9A 1JGGA 1XMXA 2XAQA 1UMQA 1ETQA 2RQQA 1XDSA 1XTAA 2L2OA 3OS1A 2LH9A 2LG4A 5IOZA 4IX7A 3HXLA 4E70A 2WADA 4BE2A 1FYMA 1Y0UA 5D8KB 1G4DA 1QVTA 3F6OA 5BOXA 4BXXJ 2HFHA 3BPVA 5GAGJ 3A01B 4YEJA 3EUHA 4KN7X 1NG6A 3HOTA 2F5FA 4A3CJ 2VIXA 2QKLB 3FWEA 2AQFA 1QZEA 1QA6A 4UHTA 5BPIA 2XAFA 1MMGA 3TBIA 3M1EA 3OYEA 3LSJA 4XLAA 4KICA 4UV8A 2GQQA 3CO6C 4A3LJ 4EMSA 4M9XA 2P6SA 3I54A 3KE2A 3T0YA 3DEUA 1AHDP 1MSEC 1VF9A 3OY9A 1ETVA 2R7ZJ 2O5RA 4EJOA 1T0FC 3G1MA 4C3HJ 2XGEA 1OYYA 2DOEA 2ELKA 3CCRI 1HCRA 3FXMA 1PP8F 4JX4A 1DQUA 1FC3A 2CH0A 3P9IA 2EIKH 4M74A 1OR7C 3L2QA 2CV2A 5ERIA 1RIOH 1OLTA 3F3XA 5ILSA 3MCZA 1RETA 4QPQA 3Q3SA 3ZCOA 5JHFA 3HOXJ 2QSGX 1ZGAA 3U2RA 4MEXF 2CV1A 1W0TA 4B3AA 2A6EF 3BWGA 1J59A 5B1AH 1FOXA 4A3FJ 1G3SA 3H35A 2MH9A 2FOKA 2Y2ZA 4N9HA 5AIQA 3J80K 1ON2A 3JRGA 4A3GJ 3AG4H 4LIUA 4J00A 3HUGA 2X6WA 2RVCA 3LSGA 5J3LA 1LFUP 3KYLA 4BXFA 1P9QC 2CRGA 5J4YA 5LGUA 3CCUI 4G7OF 3FXOA 3SDGA 2P5LC 4F52A 4DBQA 4LJZF 2BY1A 1K83J 1MBKA 2IW5A 1XGNA 1D1CA 1F43A 2VC0A 5F04A 4BXUA 2NVUB 4Y33A 2JUCA 3K10A 1QQIA 1I39A 5TGTA 1H88C 3IL2A 4WXDA 4KYWA 1VNDA 5E18F 3S3NA 4HOBA 3CCJI 5TJJA 4EEFG 1MH3A 2OAZA 4WF2A 4XMYA 2OD5A 3PIPF 1FLIA 4ENJA 1F4KA 1KU3A 2I5UA 3VDXA 3WTUC 4EM2A 2X4HA 3LA2A 2VLAA 3L09A 4PGHA 1IDZA 3HEFA 1D0YA 2PEXA 1FOYA 2Y0SA 4B8XA 2MC4A 4C3JJ 2WWYA 1JKRC 2D2WA 2PG4A 3ZMSA 1PYVA 4YFKF 4LLNA 2R7UA 1OKRA 3SFIA 1TQPA 3OIQA 2CMPA 3KETA 3RZDJ 4HW0A 4PJJA 4K2EA 2VODA 3M07A 4CCKA 4BNCA 4PJMA 3H9QA 3MMYB 2O6GE 3KZZA 1L3LA 2DA6A 1OQYA 1HW2A 2M7AA 3FZVA 2KT0A 3PO3J 5CPRB 1W5TA 2UZKA 3CF5F 1MBEA 2BEOA 3FK6A 2O8XA 3Q0UA 4RLFA 5J1UA 3ZR8X 5J4VA 1FIPA 3M9AA 3M1CA 2BY3A 1GVDA 3OMYA 3FHZA 2J5OA 3K4MA 3J81K 1XC5A 4MO7A 3MKLA 2MG4A 1J5YA 3GXOA 2PX9A 5E1XA 2STWA 1GLNA 3HOUJ 3TW7A 3O3KA 4D5CA 4TV7A 3VSLA 3S8PA 3K4KA 3CLOA 2CWEA 1WJAA 1ZG3A 1HSTA 2E1NA 1JI8A 2QQ9A 2WTEA
chains in the Genus database with same CATH topology
3T5XA 4U0YA 4A6EA 4ZZDA 1XSDA 5DUIA 4EJWA 3TDUC 1I27A 1IN5A 2XRNA 5D6EA 4DQ2A 4HZFA 1QZZA 5CLSA 5IT3A 5FGMA 1MJ9A 3WGHA 4KNYA 2IA0A 2IRFG 2V1XA 3HRTA 1D8KA 2EWNA 4I0BA 2EFWA 4HX8A 4GXOA 4RB2C 1IN6A 2MBFA 4MNUA 3DV8A 2ZBKA 2AS5F 3RJPA 2MH2A 2YR2A 4XRFA 3RIRA 2QQBA 1R36A 3FXUA 2IT0A 1BIAA 5FD6A 1T6SA 2XAGA 3REOA 5A2QZ 3HTSB 4IRIA 1REPC 2QWWA 4GCVA 1HW5A 1LVAA 5LHHA 2Q0OA 2DU9A 1HW1A 2P7VB 1CGPA 1SD5A 3ML6A 2EA2A 2OU2A 3R4KA 1ULYA 2O0YA 3DXJF 2ZMEA 4ZH4F 1ZARA 3JTHA 3QP5A 2DPUA 1XSXA 3GZ6A 3P7NA 1SD7A 3IRQA 3GLXA 2FA5A 1ZHFA 1USTA 3BY6A 2ZMEB 1JHFA 4CDGA 2VONA 4ESJA 4L9JA 5FFZA 4ENNA 1IW7F 1ZN2A 4L5IA 1FBSA 3C18A 2PN6A 1UHWA 3VODA 3L9FA 5DD4A 2EJRA 1XGSA 2MA3A 1TQIA 4RGRA 4GGGA 3GFJA 1XSVA 2XKPA 4LGWA 3ABUA 4G7HF 4IVNA 4ASNA 1K79A 2RDPA 4BHBA 2EFQA 2XIGA 4LK1F 3ISPA 3QPTA 3HSEA 4WX9A 4O6JA 3BP8A 4G9YA 2HTJA 2OZUA 1QGPA 2VBZA 2EFNA 4M6YA 4BYYA 2H94A 1O3TA 3DPLC 1LDKB 1KGSA 5FLXZ 1U3EM 1DP7P 1EH8A 3K1MA 2NNNA 5DCFA 4IPAA 2UXNA 1XN7A 1I5ZA 2D45A 3VFZA 1KYZA 5L3GA 1AWCA 4HQEA 3W6KB 5L3DA 1J7KA 1TW3A 3T8RA 1FZPB 5H6QA 5D4RA 4I2OA 4AWXB 3ZN1A 3LFKA 1YG2A 3CJNA 2D1VA 3HRUA 1XCBA 2Z3YA 4EV0A 2F2EA 4A12A 1HKSA 1ZRCA 1I1SA 1YW9A 1HQCA 1R1VA 2X0LA 1WKMA 3HSFA 4L9NA 3C1DA 2CSOA 3ULQB 4YIFA 3IWZA 4Y13A 3QPHA 1G3YA 3BOQA 3HHHA 2DFIA 2LF7A 3HIFA 1MD0A 3KP7A 2VOPA 2HTSA 2PMHA 3QOPA 3F72A 4OIPF 4LLLA 3VOEA 3BJAA 4KIFA 1QPMA 4ZZLA 2IJLA 2JZYA 3N97A 4NHJA 1Z05A 4PZJA 1T98A 5HLGA 2VT3A 2O03A 3GW2A 3RKYA 1BI2A 3EYIA 1WRJA 1G3WA 5D8LB 4U0WA 1YS7A 4UVAA 2JTVA 4HF0A 3Q5FA 3CTAA 2V1DA 4UV9A 2YX4A 2NAZA 3SZTA 2CW0F 4EJTA 1VTNC 2DK5A 2LF8A 3MAJA 4CICA 5CVVA 2E1CA 2K02A 4Q48A 2A68F 3FM3A 3I5UA 4O5VA 4FX0A 4KMUX 5EEHA 1D5VA 1U8RA 3COAC 1R1UA 4NB5A 1FBUA 1OPCA 2NYXA 4LG0B 2VN2A 3LA3A 3JSPA 1F1ZA 2K4JA 3GX4X 3ZMDA 4MQVA 1QO0D 3QAHA 4PCQA 4YIIA 3R6SA 3VEPA 3MQ0A 1WSUA 4ZYHA 5CVIA 1XGMA 3RDIA 3DF8A 3L2CA 2Z99A 2QENA 2MD5A 3JAMK 4EJUA 1DPUA 5JI6A 4LB6B 3K1PA 1DDNA 5HS9A 4EGYA 3B02A 3MZYA 5DD8A 5F6FA 3LQQA 3EDPA 3CO7C 2CGPA 2NNYA 4F7ZA 2JT1A 1I6XA 4ON0A 5HVQC 1P92A 4M6XA 5L3EA 4U7DA 4BHCA 5JVTA 3DPTA 2VBYA 1IRGA 2HS5A 2W24A 2BBYA 3H92A 3ZMUA 5L3FA 1QBJA 3FXRA 5J6XA 2L01A 4I09A 4OIRF 2Y0MA 2M5WA 2UXXA 3CUOA 5AONA 1YLFA 1FY7A 5EEGA 2F5DA 2GIVA 3P9KA 4HAMA 2Y48A 1EH6A 1BC8C 2GXGA 1WI9A 4HQMA 4AIKA 5D4SA 4G8XA 3PQKA 3WGIA 1WWXA 5KVRA 3KCCA 5IT9Z 2ETHA 2HDCA 3VB2A 2L4MA 1O3QA 1ONVA 2KIFA 3O2PE 3KP5A 1KU7A 2C6YA 3F21A 2F5EA 1LJ9A 3WG9A 1B6AA 5LGNA 5HOOA 2PJPA 3QU6A 3V8JA 5HDGA 1YIOA 4A0XA 2R3SA 4MTDA 5ICEA 4RGSA 2FU4A 3M7GA 1F5TA 2LSOA 1O7LA 2AXLA 1FX7A 4A0YA 4CZZA 3HRMA 5D5UB 3C7JA 3L00A 3U9GA 3FMRA 4GO1A 4RAZA 3SZPA 5E17F 3GF2A 2ZKZA 1BC7C 5L3BA 3QRFF 5BQTA 1E17A 4R79A 1BN5A 5TRDA 3PQJA 1DPRA 1XMAA 4WXCA 2Z5UA 4GYIA 4I98B 2WC2A 1BI3A 2LKPA 2L54A 1S8NA 3IRRA 4EM0B 1GXPA 4HF1A 1LDDA 2HQRA 2BGCA 2PMUA 1FSHA 3V8LA 2K7LA 2PI0A 3R0AA 1EV7A 2DLLA 3E3VA 3JW4A 4CO8A 1O57A 1BI0A 3J7AO 3DP7A 4P96A 5DV5A 1FYKA 2XV4S 4OU0A 4U7BA 2PQ8A 2RN7A 2MLGA 2QQAA 2YPRA 2RV8A 4MQ9F 1IN8A 3I58A 1OMIA 5HLIA 3H3UA 1JHHA 1TQMA 2CO5A 5H6RA 1JE8A 5LHGA 4WK8F 3WU0A 4Y15A 1FBQA 3S2WA 1K78A 1B9MA 2E7WA 2KIUA 4HX4A 1IZ1A 5LEJA 2FE3A 4PGGA 2W57A 2HQNA 1AOYA 4Z2YA 2GA2A 1K78B 1IXRC 1O3SA 3ZMVA 3HTUA 3T8TA 3V8KA 1R5HA 3F22A 5FD5A 1IF1A 3ZMZA 4QLCU 4XLPF 3GFIA 3E6DA 2CFXA 5E1WA 3E5XA 4IXAA 3R0JA 1ZRDA 4IHTA 2XASA 4JBAA 3TGNA 2MLKA 1S6LA 2ISZA 3L7WA 1YW8A 4QWQA 2IP2A 4P9UA 2RNJA 4IF4A 4HX7A 1YS6A 1S7OA 3BJOA 2P5VA 3GO5A 1DUXC 4OMYA 2Z9OA 1OYIA 2OA4A 5ILUA 2A61A 3WTYC 5HDKA 4DNCA 1U6GA 4RB1A 5JFRA 2LNBA 4LLGF 1H0MA 3FX3A 3GYHX 1J75A 1L0OC 1R7JA 4OIQF 1R23A 4U88A 5A2QK 5KK1A 2XGXA 3BJ6A 3GFLA 3IWFA 3N4MA 3KEOA 3OOPA 4HLXA 1IAWA 4EGZA 2W85A 1PUEE 3FXQA 4HF2A 2FMLA 1ZG5A 4FT8A 3KLNA 4LK0F 2EFPA 2J5PA 3FMQA 4LMYA 1YYVA 3QU3A 1J0RA 1BBYA 2XAJA 4IRHA 1D8JA 1JGSA 3V7CA 5K5RA 3IC7A 4MGRA 3RYRA 2LDUA 2QZ8A 4KIGA 3LA7A 2HYFA 2P8TA 2KJBA 5HLHA 4FX4A 4RS8A 5LLQA 4S04A 3FMSA 1KYWA 2JPCA 2ZJ2A 3E6CC 1SAXA 2G9WA 3WODF 4KMFA 2STTA 4H0EA 2CG4A 2IPQX 1J2XA 2DPDA 4ZYGA 4HDUA 5DDGA 2XROA 4KDPA 1YTYA 4O3MA 3K1NA 3EETA 2M87A 1V4RA 2EA4A 3I4PA 4A2UA 3R60A 4LB5A 2KIMA 3SQNA 4A0ZA 5FLXK 1ZREA 4AD9A 2XUBA 3JSOA 2Z33A 4Q4ZF 1FWZA 3KP6A 1KA8A 3LQRA 3NRVA 1LNWA 4RGUA 2ISYA 1B4AA 1SFXA 2RC4A 1BI1A 1PP7U 3D0SA 3IKVA 4CXFA 4KN4X 2H27A 2QVOA 3WE3A 4XSXF 5FFXA 3E97A 4G6QA 5HS7A 3F8BA 1MGTA 1YFHA 2FEZA 3I71A 3RI4A 3V7SA 2ZXJA 2EV6A 4A5NA 2V1UA 2EV0A 3LAPA 4WWCA 2ADUA 2ELHA 3RKWA 1W4MA 3CUQA 3GWZA 2JSCA 5JHUA 1LQ1A 4NQWA 4UNOA 5L3CA 1FOKA 2D1HA 2F5CA 1BIBA 5LGTA 1KU2A 3CUQB 2P7CB 2PBIA 2A6HF 3WTSC 4LG0A 2XHKA 1ZLJA 3GVAA 5CVRA 2HEOA 3HSRA 2HYGD 2EV5A 4CHUA 1IXSB 3WTWC 1LB2A 2A3SA 4IRGA 3I53A 1SMTA 3HYIA 5DUKA 4EJVA 1TBXA 4HDVA 2OZ6A 2K27A 5F64A 2FXAA 2L4AA 1SD4A 3ELKA 1W5SA 1R5GA 4MEYF 5ICGA 3NQOA 3MWMA 3G3ZA 4ZYEA 4UVCA 5BMZA 1UFMA 3ZPLA 2M8EA 2FBHA 4BH9A 3WTXC 2FSWA 3KP3A 3O6BB 4I02A 2V9VA 1HKTA 2E7XA 3LSTA 5CYVA 3MZHA 1F9NA 3OV8A 4HA8A 4A6DA 3MFKA 1FYLA 2VT2A 2YSRA 3KP2A 3BZ6A 3V7RA 2XKOA 2Q8KA 1P6RA 4UUVA 5FB2A 4P9FA 4AIHA 3F8CA 1XD7A 1EH7A 1R00A 3TO6A 1Z6TA 1V3FA 2MC3A 4ESFA 4HV5A 1R58A 3G73A 2A69F 2DW4A 1B59A 4XBFA 3K69A 1YO5C 2QUFA 5LBQA 1A04A 2P5KA 5FO5A 4XLNF 1HKQA 3WTTC 4ZYDA 3CDHA 5K5QA 3Q9VA 3B73A 4OOIA 3ZP5A 4R8HA 2ZCWA 1FPQA 1TW2A 5D5XB 2W84A 1I1GA 5K5OA 2NS0A 4L9TA 1UCRA 3W6JB 4LFUA 5CJ9A 1ZYRF 2ACJA 2FNPA 1R1TA 1TNSA 4IJAA 5ICFA 3GFMA 5HDNA 3J80Z 4GYGA 2M1BA 1SFEA 1H9TA 3KFWX 4OIOF 1MJBA 3ECHA 4BHPA 2EFOA 2G7HA 4B09A 2IA2A 4YFNF 1G3TA 1RUNA 2PLYA 1P2FA 1P4XA 1ZAOA 2YX7A 3ECOA 4ENMA 4MTEA 1FNNA 1KQ9A 5E1ZB 1B9NA 5LRSA 3F8NA 1FT9A 2EB7A 1O7FA 2KJCA 5BS6A 4M9ZA 1ZLKA 4HYEA 4EQQA 4BQAA 1G6NA 5IT9K 1ZRFA 2ZNZA 2GWRA 2RQPA 2BYVE 2HKOA 3AAFA 3HRSA 5CVJA 1U78A 4L0ZB 4UXNA 1S3JA 2VBWA 1Z9CA 1XMKA 3RPQA 3K0LA 3V4GA 3TQNA 4JK1X 2ESHA 5HS8A 1O3RA 1MKMA 4WXHA 2DI3A 2WV0A 2OBPA 1BM9A 5E8GA 1Z1DA 3RTRA 4AIJA 3ABTA 2A07F 4S05A 4JQFA 3J81Z 1SMYF 1KQ8A 1TLHB 3IKTA 1X3UA 2QM3A 5ED4A 1SD6A 2JPBA 1T0FA 5LEKA 2DBBA 3I59A 1W7PD 1STZA 1OR7A 2Q2EA 1BOAA 4OMZA 3EYYA 3RYPA 3I59B 2OQGA 3ZMTA 2H09A 2VE8A 2M45A 4HLYA 2VXZA 4N9IA 2ZNYA 2VC1A 1Z91A 1RZ4A 1S29A 1IN7A 3E6BA 5D5WB 1YQAA 4KIBA 4KT5C 4KA4A 1ZH5A 4LD5A 2P6TA 1UB9A 1IN4A 3DQVC 4I7HA 3R61A 2FQ3A 2DO7A 3RPUA 3E5UA 3KEQA 1JXSA 1LDJA 2L3DA 4RB0A 4G94A 4L0YB 2B0LA 3E5QA 2QLZA 5ICCA 3BDDA 3M8EA 2K86A 2DK8A 2IA1A 3GZ5A 1T38A 3FM5A 4M72A 4I0AA 3SFZA 1HBXG 4N0BA 1XGOA 4KFCA 2RKHA 2QBYA 3ZN0A 4M73A 4G6DA 4U0VA 3WTVC 3F23A 2QBYB 1GXQA 4IHSA 1ZG1A 5D6FA 6PAXA 2CYYA 2H6CA 2V79A 4ETSA 2L02A 1K6OA 3F8FA 3BROA 5LHIA 3I64A 5D5VB 1SFUA 2IVMA 3Q9SA 3C3WA 2GAUA 4PDKA 5E8IA 2DQRA 1BJAA 3T1BA 2VOOA 4CGZA 1ZGJA 5DYMA 3H3ZA 5ILVA 4EM1A 4I01A 3BPXA 3HHGA 3TDZC 1QNTA 3GEZA 2FMYA 5AIPA 2O61A 2NRAC 3WGGA 2JRTA 1XCVA 1D3YA 2DQLA 3GUDA 4BAYA 1FSEA 3QP6A 1U2WA 1TTYA 1HSJA 1IXCA 4Q5SF 3PFIA 1RI7A 4M71A 5JR3A 3WE2A 1USSA 2YU3A 4MHGA 2FNAA 2COMA 1C0WA 1E2XA 2OQRA 2GA1A 2HR3A 4D0PA 2XAHA 1ON1A 2FF4A 1LEAA 2QYOA 4L5JA 4A5MA 1RUOA 2GXBA 4HBLA 2HOEA 1RNLA 1IRFA 5DEQA 1FP2A 2H6BA 3K9TA 3CUQC 2P4WA 3U1DA 3NEUA 1MJAA 1ODDA 2K4BA 2VE9A 1P4AA 3F6VA 2V6CA 1PDNC 5LRRA 1UHMA 5J8CA 1CF7A 3F8MA 4ESBA 1WQ2A 1KQ0A 2EK5A 1CF7B 2RGVA 2BV6A 2O3FA 2HGCA 2W25A 2R7DA 4RGXA 5K1YA 4XSZF 2DT5A 2TDXA 3LWFA 2HWVA 1B1BA 4RAYA 1Z7UA 5DCMA 2CQKA 1TNTA 2M30A 1K7AA 3TO9A 4G7ZF 1GHCA 2FBIA 1Q1HA 5F1RA 3K2ZA 2ZO4A 5CVUA 2ESNA 3MEXA 3WTZA 5DCMB 2KKOA 3HOSA 4L18B 4HV6A 3TOAA 2GZWA 3TO7A 2VBXA 4EVIA 4YG2F 4FHTA 2BE5F 1U5TC 1HXDA 1J9IA 1OYWA 1YW7A 5E20A 4YFXF 1QZYA 3IHUA 1NHAA 2FRHA 3ROUA 3JTGA 1T39A 3E6MA 1KU9A 1XB4A 4P5OA 3M8FA 3ZQ7A 1FP1D 3FF5A 3JAMZ 2A5YB 4KUMA 1S7AA 3KZYA 3TKYA 1MDMA 1XDUA 5J8FA 5H20A 3TOBA 4R1HA 1IUYA 1H9GA 4Q47A 1LEBA 4M9SA 3P9CA 4WCGA 3D5LA 2HKXA 1MDMB 3EQLF 3WU1B 1MZBA 2KRFA 4Y17A 3DFGA 2PFBA 2DTRA 2XVCA 2G7UA 3RKXA 3SHFA 2FBKA 4ENKA 1R22A 1T2KA 3LAJA 1W7PA 4UVBA 3KP4A 1U5TA 3SXYA 3KLOA 3ERED 2UWMA 4OINF 1W7PB 4AVPA 2HZTA 3DKWA 2DAOA 1U5TB 1P4WA 4L9VA 2Y75A 3I0TA 1Z6RA 5BPDA 2R7FA 1GVJA 4RB3C 2ZFWA 4CYDA 4P55A 2XAQA 1XDSA 4E70A 1FYMA 1Y0UA 5D8KB 1G4DA 3F6OA 5BOXA 2HFHA 3BPVA 3EUHA 4KN7X 3HOTA 2F5FA 3FWEA 4UHTA 5BPIA 2XAFA 3M1EA 4KICA 4UV8A 2GQQA 3CO6C 4EMSA 4M9XA 2P6SA 3I54A 3KE2A 3T0YA 3DEUA 4EJOA 1OYYA 1PP8F 1FC3A 3P9IA 4M74A 5ERIA 1RIOH 3F3XA 5ILSA 3MCZA 1ZGAA 3U2RA 4MEXF 2A6EF 3BWGA 1J59A 1G3SA 2MH9A 2FOKA 4N9HA 5AIQA 3J80K 1ON2A 3HUGA 2RVCA 5LGUA 4G7OF 2P5LC 4LJZF 2IW5A 1XGNA 2VC0A 4BXUA 1QQIA 3IL2A 4WXDA 4KYWA 5E18F 4HOBA 5TJJA 2OAZA 4WF2A 2OD5A 1FLIA 4ENJA 1F4KA 1KU3A 3WTUC 4EM2A 2X4HA 3LA2A 3L09A 4PGHA 2PEXA 4B8XA 2WWYA 2D2WA 2PG4A 3ZMSA 4YFKF 4LLNA 1OKRA 1TQPA 3KETA 4HW0A 4K2EA 2VODA 4BNCA 2O6GE 3KZZA 1L3LA 1HW2A 3FZVA 1W5TA 2UZKA 2BEOA 2O8XA 3M9AA 3FHZA 2J5OA 3J81K 3GXOA 1J5YA 5E1XA 2STWA 3O3KA 4TV7A 2CWEA 3CLOA 1ZG3A 2E1NA 1HSTA 2QQ9A 2WTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T5X A;  4U0Y A;  4A6E A;  4ZZD A;  1XSD A;  5DUI A;  4EJW A;  3TDU C;  1I27 A;  1IN5 A;  2XRN A;  5D6E A;  4DQ2 A;  4HZF A;  1QZZ A;  5CLS A;  5IT3 A;  5FGM A;  1MJ9 A;  3WGH A;  4KNY A;  2IA0 A;  2IRF G;  2V1X A;  3HRT A;  1D8K A;  2EWN A;  4I0B A;  2EFW A;  4HX8 A;  4GXO A;  4RB2 C;  1IN6 A;  2MBF A;  4MNU A;  3DV8 A;  2ZBK A;  2AS5 F;  3RJP A;  2MH2 A;  2YR2 A;  4XRF A;  3RIR A;  2QQB A;  1R36 A;  3FXU A;  2IT0 A;  1BIA A;  5FD6 A;  1T6S A;  2XAG A;  3REO A;  5A2Q Z;  3HTS B;  4IRI A;  1REP C;  2QWW A;  4GCV A;  1HW5 A;  1LVA A;  5LHH A;  2Q0O A;  2DU9 A;  1HW1 A;  2P7V B;  1CGP A;  1SD5 A;  3ML6 A;  2EA2 A;  2OU2 A;  3R4K A;  1ULY A;  2O0Y A;  3DXJ F;  2ZME A;  4ZH4 F;  1ZAR A;  3JTH A;  3QP5 A;  2DPU A;  1XSX A;  3GZ6 A;  3P7N A;  1SD7 A;  3IRQ A;  3GLX A;  2FA5 A;  1ZHF A;  1UST A;  3BY6 A;  2ZME B;  1JHF A;  4CDG A;  2VON A;  4ESJ A;  4L9J A;  5FFZ A;  4ENN A;  1IW7 F;  1ZN2 A;  4L5I A;  1FBS A;  3C18 A;  2PN6 A;  1UHW A;  3VOD A;  3L9F A;  5DD4 A;  2EJR A;  1XGS A;  2MA3 A;  1TQI A;  4RGR A;  4GGG A;  3GFJ A;  1XSV A;  2XKP A;  4LGW A;  3ABU A;  4G7H F;  4IVN A;  4ASN A;  1K79 A;  2RDP A;  4BHB A;  2EFQ A;  2XIG A;  4LK1 F;  3ISP A;  3QPT A;  3HSE A;  4WX9 A;  4O6J A;  3BP8 A;  4G9Y A;  2HTJ A;  2OZU A;  1QGP A;  2VBZ A;  2EFN A;  4M6Y A;  4BYY A;  2H94 A;  1O3T A;  3DPL C;  1LDK B;  1KGS A;  5FLX Z;  1U3E M;  1DP7 P;  1EH8 A;  3K1M A;  2NNN A;  5DCF A;  4IPA A;  2UXN A;  1XN7 A;  1I5Z A;  2D45 A;  3VFZ A;  1KYZ A;  5L3G A;  1AWC A;  4HQE A;  3W6K B;  5L3D A;  1J7K A;  1TW3 A;  3T8R A;  1FZP B;  5H6Q A;  5D4R A;  4I2O A;  4AWX B;  3ZN1 A;  3LFK A;  1YG2 A;  3CJN A;  2D1V A;  3HRU A;  1XCB A;  2Z3Y A;  4EV0 A;  2F2E A;  4A12 A;  1HKS A;  1ZRC A;  1I1S A;  1YW9 A;  1HQC A;  1R1V A;  2X0L A;  1WKM A;  3HSF A;  4L9N A;  3C1D A;  2CSO A;  3ULQ B;  4YIF A;  3IWZ A;  4Y13 A;  3QPH A;  1G3Y A;  3BOQ A;  3HHH A;  2DFI A;  2LF7 A;  3HIF A;  1MD0 A;  3KP7 A;  2VOP A;  2HTS A;  2PMH A;  3QOP A;  3F72 A;  4OIP F;  4LLL A;  3VOE A;  3BJA A;  4KIF A;  1QPM A;  4ZZL A;  2IJL A;  2JZY A;  3N97 A;  4NHJ A;  1Z05 A;  4PZJ A;  1T98 A;  5HLG A;  2VT3 A;  2O03 A;  3GW2 A;  3RKY A;  1BI2 A;  3EYI A;  1WRJ A;  1G3W A;  5D8L B;  4U0W A;  1YS7 A;  4UVA A;  2JTV A;  4HF0 A;  3Q5F A;  3CTA A;  2V1D A;  4UV9 A;  2YX4 A;  2NAZ A;  3SZT A;  2CW0 F;  4EJT A;  1VTN C;  2DK5 A;  2LF8 A;  3MAJ A;  4CIC A;  5CVV A;  2E1C A;  2K02 A;  4Q48 A;  2A68 F;  3FM3 A;  3I5U A;  4O5V A;  4FX0 A;  4KMU X;  5EEH A;  1D5V A;  1U8R A;  3COA C;  1R1U A;  4NB5 A;  1FBU A;  1OPC A;  2NYX A;  4LG0 B;  2VN2 A;  3LA3 A;  3JSP A;  1F1Z A;  2K4J A;  3GX4 X;  3ZMD A;  4MQV A;  1QO0 D;  3QAH A;  4PCQ A;  4YII A;  3R6S A;  3VEP A;  3MQ0 A;  1WSU A;  4ZYH A;  5CVI A;  1XGM A;  3RDI A;  3DF8 A;  3L2C A;  2Z99 A;  2QEN A;  2MD5 A;  3JAM K;  4EJU A;  1DPU A;  5JI6 A;  4LB6 B;  3K1P A;  1DDN A;  5HS9 A;  4EGY A;  3B02 A;  3MZY A;  5DD8 A;  5F6F A;  3LQQ A;  3EDP A;  3CO7 C;  2CGP A;  2NNY A;  4F7Z A;  2JT1 A;  1I6X A;  4ON0 A;  5HVQ C;  1P92 A;  4M6X A;  5L3E A;  4U7D A;  4BHC A;  5JVT A;  3DPT A;  2VBY A;  1IRG A;  2HS5 A;  2W24 A;  2BBY A;  3H92 A;  3ZMU A;  5L3F A;  1QBJ A;  3FXR A;  5J6X A;  2L01 A;  4I09 A;  4OIR F;  2Y0M A;  2M5W A;  2UXX A;  3CUO A;  5AON A;  1YLF A;  1FY7 A;  5EEG A;  2F5D A;  2GIV A;  3P9K A;  4HAM A;  2Y48 A;  1EH6 A;  1BC8 C;  2GXG A;  1WI9 A;  4HQM A;  4AIK A;  5D4S A;  4G8X A;  3PQK A;  3WGI A;  1WWX A;  5KVR A;  3KCC A;  5IT9 Z;  2ETH A;  2HDC A;  3VB2 A;  2L4M A;  1O3Q A;  1ONV A;  2KIF A;  3O2P E;  3KP5 A;  1KU7 A;  2C6Y A;  3F21 A;  2F5E A;  1LJ9 A;  3WG9 A;  1B6A A;  5LGN A;  5HOO A;  2PJP A;  3QU6 A;  3V8J A;  5HDG A;  1YIO A;  4A0X A;  2R3S A;  4MTD A;  5ICE A;  4RGS A;  2FU4 A;  3M7G A;  1F5T A;  2LSO A;  1O7L A;  2AXL A;  1FX7 A;  4A0Y A;  4CZZ A;  3HRM A;  5D5U B;  3C7J A;  3L00 A;  3U9G A;  3FMR A;  4GO1 A;  4RAZ A;  3SZP A;  5E17 F;  3GF2 A;  2ZKZ A;  1BC7 C;  5L3B A;  3QRF F;  5BQT A;  1E17 A;  4R79 A;  1BN5 A;  5TRD A;  3PQJ A;  1DPR A;  1XMA A;  4WXC A;  2Z5U A;  4GYI A;  4I98 B;  2WC2 A;  1BI3 A;  2LKP A;  2L54 A;  1S8N A;  3IRR A;  4EM0 B;  1GXP A;  4HF1 A;  1LDD A;  2HQR A;  2BGC A;  2PMU A;  1FSH A;  3V8L A;  2K7L A;  2PI0 A;  3R0A A;  1EV7 A;  2DLL A;  3E3V A;  3JW4 A;  4CO8 A;  1O57 A;  1BI0 A;  3J7A O;  3DP7 A;  4P96 A;  5DV5 A;  1FYK A;  2XV4 S;  4OU0 A;  4U7B A;  2PQ8 A;  2RN7 A;  2MLG A;  2QQA A;  2YPR A;  2RV8 A;  4MQ9 F;  1IN8 A;  3I58 A;  1OMI A;  5HLI A;  3H3U A;  1JHH A;  1TQM A;  2CO5 A;  5H6R A;  1JE8 A;  5LHG A;  4WK8 F;  3WU0 A;  4Y15 A;  1FBQ A;  3S2W A;  1K78 A;  1B9M A;  2E7W A;  2KIU A;  4HX4 A;  1IZ1 A;  5LEJ A;  2FE3 A;  4PGG A;  2W57 A;  2HQN A;  1AOY A;  4Z2Y A;  2GA2 A;  1K78 B;  1IXR C;  1O3S A;  3ZMV A;  3HTU A;  3T8T A;  3V8K A;  1R5H A;  3F22 A;  5FD5 A;  1IF1 A;  3ZMZ A;  4QLC U;  4XLP F;  3GFI A;  3E6D A;  2CFX A;  5E1W A;  3E5X A;  4IXA A;  3R0J A;  1ZRD A;  4IHT A;  2XAS A;  4JBA A;  3TGN A;  2MLK A;  1S6L A;  2ISZ A;  3L7W A;  1YW8 A;  4QWQ A;  2IP2 A;  4P9U A;  2RNJ A;  4IF4 A;  4HX7 A;  1YS6 A;  1S7O A;  3BJO A;  2P5V A;  3GO5 A;  1DUX C;  4OMY A;  2Z9O A;  1OYI A;  2OA4 A;  5ILU A;  2A61 A;  3WTY C;  5HDK A;  4DNC A;  1U6G A;  4RB1 A;  5JFR A;  2LNB A;  4LLG F;  1H0M A;  3FX3 A;  3GYH X;  1J75 A;  1L0O C;  1R7J A;  4OIQ F;  1R23 A;  4U88 A;  5A2Q K;  5KK1 A;  2XGX A;  3BJ6 A;  3GFL A;  3IWF A;  3N4M A;  3KEO A;  3OOP A;  4HLX A;  1IAW A;  4EGZ A;  2W85 A;  1PUE E;  3FXQ A;  4HF2 A;  2FML A;  1ZG5 A;  4FT8 A;  3KLN A;  4LK0 F;  2EFP A;  2J5P A;  3FMQ A;  4LMY A;  1YYV A;  3QU3 A;  1J0R A;  1BBY A;  2XAJ A;  4IRH A;  1D8J A;  1JGS A;  3V7C A;  5K5R A;  3IC7 A;  4MGR A;  3RYR A;  2LDU A;  2QZ8 A;  4KIG A;  3LA7 A;  2HYF A;  2P8T A;  2KJB A;  5HLH A;  4FX4 A;  4RS8 A;  5LLQ A;  4S04 A;  3FMS A;  1KYW A;  2JPC A;  2ZJ2 A;  3E6C C;  1SAX A;  2G9W A;  3WOD F;  4KMF A;  2STT A;  4H0E A;  2CG4 A;  2IPQ X;  1J2X A;  2DPD A;  4ZYG A;  4HDU A;  5DDG A;  2XRO A;  4KDP A;  1YTY A;  4O3M A;  3K1N A;  3EET A;  2M87 A;  1V4R A;  2EA4 A;  3I4P A;  4A2U A;  3R60 A;  4LB5 A;  2KIM A;  3SQN A;  4A0Z A;  5FLX K;  1ZRE A;  4AD9 A;  2XUB A;  3JSO A;  2Z33 A;  4Q4Z F;  1FWZ A;  3KP6 A;  1KA8 A;  3LQR A;  3NRV A;  1LNW A;  4RGU A;  2ISY A;  1B4A A;  1SFX A;  2RC4 A;  1BI1 A;  1PP7 U;  3D0S A;  3IKV A;  4CXF A;  4KN4 X;  2H27 A;  2QVO A;  3WE3 A;  4XSX F;  5FFX A;  3E97 A;  4G6Q A;  5HS7 A;  3F8B A;  1MGT A;  1YFH A;  2FEZ A;  3I71 A;  3RI4 A;  3V7S A;  2ZXJ A;  2EV6 A;  4A5N A;  2V1U A;  2EV0 A;  3LAP A;  4WWC A;  2ADU A;  2ELH A;  3RKW A;  1W4M A;  3CUQ A;  3GWZ A;  2JSC A;  5JHU A;  1LQ1 A;  4NQW A;  4UNO A;  5L3C A;  1FOK A;  2D1H A;  2F5C A;  1BIB A;  5LGT A;  1KU2 A;  3CUQ B;  2P7C B;  2PBI A;  2A6H F;  3WTS C;  4LG0 A;  2XHK A;  1ZLJ A;  3GVA A;  5CVR A;  2HEO A;  3HSR A;  2HYG D;  2EV5 A;  4CHU A;  1IXS B;  3WTW C;  1LB2 A;  2A3S A;  4IRG A;  3I53 A;  1SMT A;  3HYI A;  5DUK A;  4EJV A;  1TBX A;  4HDV A;  2OZ6 A;  2K27 A;  5F64 A;  2FXA A;  2L4A A;  1SD4 A;  3ELK A;  1W5S A;  1R5G A;  4MEY F;  5ICG A;  3NQO A;  3MWM A;  3G3Z A;  4ZYE A;  4UVC A;  5BMZ A;  1UFM A;  3ZPL A;  2M8E A;  2FBH A;  4BH9 A;  3WTX C;  2FSW A;  3KP3 A;  3O6B B;  4I02 A;  2V9V A;  1HKT A;  2E7X A;  3LST A;  5CYV A;  3MZH A;  1F9N A;  3OV8 A;  4HA8 A;  4A6D A;  3MFK A;  1FYL A;  2VT2 A;  2YSR A;  3KP2 A;  3BZ6 A;  3V7R A;  2XKO A;  2Q8K A;  1P6R A;  4UUV A;  5FB2 A;  4P9F A;  4AIH A;  3F8C A;  1XD7 A;  1EH7 A;  1R00 A;  3TO6 A;  1Z6T A;  1V3F A;  2MC3 A;  4ESF A;  4HV5 A;  1R58 A;  3G73 A;  2A69 F;  2DW4 A;  1B59 A;  4XBF A;  3K69 A;  1YO5 C;  2QUF A;  5LBQ A;  1A04 A;  2P5K A;  5FO5 A;  4XLN F;  1HKQ A;  3WTT C;  4ZYD A;  3CDH A;  5K5Q A;  3Q9V A;  3B73 A;  4OOI A;  3ZP5 A;  4R8H A;  2ZCW A;  1FPQ A;  1TW2 A;  5D5X B;  2W84 A;  1I1G A;  5K5O A;  2NS0 A;  4L9T A;  1UCR A;  3W6J B;  4LFU A;  5CJ9 A;  1ZYR F;  2ACJ A;  2FNP A;  1R1T A;  1TNS A;  4IJA A;  5ICF A;  3GFM A;  5HDN A;  3J80 Z;  4GYG A;  2M1B A;  1SFE A;  1H9T A;  3KFW X;  4OIO F;  1MJB A;  3ECH A;  4BHP A;  2EFO A;  2G7H A;  4B09 A;  2IA2 A;  4YFN F;  1G3T A;  1RUN A;  2PLY A;  1P2F A;  1P4X A;  1ZAO A;  2YX7 A;  3ECO A;  4ENM A;  4MTE A;  1FNN A;  1KQ9 A;  5E1Z B;  1B9N A;  5LRS A;  3F8N A;  1FT9 A;  2EB7 A;  1O7F A;  2KJC A;  5BS6 A;  4M9Z A;  1ZLK A;  4HYE A;  4EQQ A;  4BQA A;  1G6N A;  5IT9 K;  1ZRF A;  2ZNZ A;  2GWR A;  2RQP A;  2BYV E;  2HKO A;  3AAF A;  3HRS A;  5CVJ A;  1U78 A;  4L0Z B;  4UXN A;  1S3J A;  2VBW A;  1Z9C A;  1XMK A;  3RPQ A;  3K0L A;  3V4G A;  3TQN A;  4JK1 X;  2ESH A;  5HS8 A;  1O3R A;  1MKM A;  4WXH A;  2DI3 A;  2WV0 A;  2OBP A;  1BM9 A;  5E8G A;  1Z1D A;  3RTR A;  4AIJ A;  3ABT A;  2A07 F;  4S05 A;  4JQF A;  3J81 Z;  1SMY F;  1KQ8 A;  1TLH B;  3IKT A;  1X3U A;  2QM3 A;  5ED4 A;  1SD6 A;  2JPB A;  1T0F A;  5LEK A;  2DBB A;  3I59 A;  1W7P D;  1STZ A;  1OR7 A;  2Q2E A;  1BOA A;  4OMZ A;  3EYY A;  3RYP A;  3I59 B;  2OQG A;  3ZMT A;  2H09 A;  2VE8 A;  2M45 A;  4HLY A;  2VXZ A;  4N9I A;  2ZNY A;  2VC1 A;  1Z91 A;  1RZ4 A;  1S29 A;  1IN7 A;  3E6B A;  5D5W B;  1YQA A;  4KIB A;  4KT5 C;  4KA4 A;  1ZH5 A;  4LD5 A;  2P6T A;  1UB9 A;  1IN4 A;  3DQV C;  4I7H A;  3R61 A;  2FQ3 A;  2DO7 A;  3RPU A;  3E5U A;  3KEQ A;  1JXS A;  1LDJ A;  2L3D A;  4RB0 A;  4G94 A;  4L0Y B;  2B0L A;  3E5Q A;  2QLZ A;  5ICC A;  3BDD A;  3M8E A;  2K86 A;  2DK8 A;  2IA1 A;  3GZ5 A;  1T38 A;  3FM5 A;  4M72 A;  4I0A A;  3SFZ A;  1HBX G;  4N0B A;  1XGO A;  4KFC A;  2RKH A;  2QBY A;  3ZN0 A;  4M73 A;  4G6D A;  4U0V A;  3WTV C;  3F23 A;  2QBY B;  1GXQ A;  4IHS A;  1ZG1 A;  5D6F A;  6PAX A;  2CYY A;  2H6C A;  2V79 A;  4ETS A;  2L02 A;  1K6O A;  3F8F A;  3BRO A;  5LHI A;  3I64 A;  5D5V B;  1SFU A;  2IVM A;  3Q9S A;  3C3W A;  2GAU A;  4PDK A;  5E8I A;  2DQR A;  1BJA A;  3T1B A;  2VOO A;  4CGZ A;  1ZGJ A;  5DYM A;  3H3Z A;  5ILV A;  4EM1 A;  4I01 A;  3BPX A;  3HHG A;  3TDZ C;  1QNT A;  3GEZ A;  2FMY A;  5AIP A;  2O61 A;  2NRA C;  3WGG A;  2JRT A;  1XCV A;  1D3Y A;  2DQL A;  3GUD A;  4BAY A;  1FSE A;  3QP6 A;  1U2W A;  1TTY A;  1HSJ A;  1IXC A;  4Q5S F;  3PFI A;  1RI7 A;  4M71 A;  5JR3 A;  3WE2 A;  1USS A;  2YU3 A;  4MHG A;  2FNA A;  2COM A;  1C0W A;  1E2X A;  2OQR A;  2GA1 A;  2HR3 A;  4D0P A;  2XAH A;  1ON1 A;  2FF4 A;  1LEA A;  2QYO A;  4L5J A;  4A5M A;  1RUO A;  2GXB A;  4HBL A;  2HOE A;  1RNL A;  1IRF A;  5DEQ A;  1FP2 A;  2H6B A;  3K9T A;  3CUQ C;  2P4W A;  3U1D A;  3NEU A;  1MJA A;  1ODD A;  2K4B A;  2VE9 A;  1P4A A;  3F6V A;  2V6C A;  1PDN C;  5LRR A;  1UHM A;  5J8C A;  1CF7 A;  3F8M A;  4ESB A;  1WQ2 A;  1KQ0 A;  2EK5 A;  1CF7 B;  2RGV A;  2BV6 A;  2O3F A;  2HGC A;  2W25 A;  2R7D A;  4RGX A;  5K1Y A;  4XSZ F;  2DT5 A;  2TDX A;  3LWF A;  2HWV A;  1B1B A;  4RAY A;  1Z7U A;  5DCM A;  2CQK A;  1TNT A;  2M30 A;  1K7A A;  3TO9 A;  4G7Z F;  1GHC A;  2FBI A;  1Q1H A;  5F1R A;  3K2Z A;  2ZO4 A;  5CVU A;  2ESN A;  3MEX A;  3WTZ A;  5DCM B;  2KKO A;  3HOS A;  4L18 B;  4HV6 A;  3TOA A;  2GZW A;  3TO7 A;  2VBX A;  4EVI A;  4YG2 F;  4FHT A;  2BE5 F;  1U5T C;  1HXD A;  1J9I A;  1OYW A;  1YW7 A;  5E20 A;  4YFX F;  1QZY A;  3IHU A;  1NHA A;  2FRH A;  3ROU A;  3JTG A;  1T39 A;  3E6M A;  1KU9 A;  1XB4 A;  4P5O A;  3M8F A;  3ZQ7 A;  1FP1 D;  3FF5 A;  3JAM Z;  2A5Y B;  4KUM A;  1S7A A;  3KZY A;  3TKY A;  1MDM A;  1XDU A;  5J8F A;  5H20 A;  3TOB A;  4R1H A;  1IUY A;  1H9G A;  4Q47 A;  1LEB A;  4M9S A;  3P9C A;  4WCG A;  3D5L A;  2HKX A;  1MDM B;  3EQL F;  3WU1 B;  1MZB A;  2KRF A;  4Y17 A;  3DFG A;  2PFB A;  2DTR A;  2XVC A;  2G7U A;  3RKX A;  3SHF A;  2FBK A;  4ENK A;  1R22 A;  1T2K A;  3LAJ A;  1W7P A;  4UVB A;  3KP4 A;  1U5T A;  3SXY A;  3KLO A;  3ERE D;  2UWM A;  4OIN F;  1W7P B;  4AVP A;  2HZT A;  3DKW A;  2DAO A;  1U5T B;  1P4W A;  4L9V A;  2Y75 A;  3I0T A;  1Z6R A;  5BPD A;  2R7F A;  1GVJ A;  4RB3 C;  2ZFW A;  4CYD A;  4P55 A;  2XAQ A;  1XDS A;  4E70 A;  1FYM A;  1Y0U A;  5D8K B;  1G4D A;  3F6O A;  5BOX A;  2HFH A;  3BPV A;  3EUH A;  4KN7 X;  3HOT A;  2F5F A;  3FWE A;  4UHT A;  5BPI A;  2XAF A;  3M1E A;  4KIC A;  4UV8 A;  2GQQ A;  3CO6 C;  4EMS A;  4M9X A;  2P6S A;  3I54 A;  3KE2 A;  3T0Y A;  3DEU A;  4EJO A;  1OYY A;  1PP8 F;  1FC3 A;  3P9I A;  4M74 A;  5ERI A;  1RIO H;  3F3X A;  5ILS A;  3MCZ A;  1ZGA A;  3U2R A;  4MEX F;  2A6E F;  3BWG A;  1J59 A;  1G3S A;  2MH9 A;  2FOK A;  4N9H A;  5AIQ A;  3J80 K;  1ON2 A;  3HUG A;  2RVC A;  5LGU A;  4G7O F;  2P5L C;  4LJZ F;  2IW5 A;  1XGN A;  2VC0 A;  4BXU A;  1QQI A;  3IL2 A;  4WXD A;  4KYW A;  5E18 F;  4HOB A;  5TJJ A;  2OAZ A;  4WF2 A;  2OD5 A;  1FLI A;  4ENJ A;  1F4K A;  1KU3 A;  3WTU C;  4EM2 A;  2X4H A;  3LA2 A;  3L09 A;  4PGH A;  2PEX A;  4B8X A;  2WWY A;  2D2W A;  2PG4 A;  3ZMS A;  4YFK F;  4LLN A;  1OKR A;  1TQP A;  3KET A;  4HW0 A;  4K2E A;  2VOD A;  4BNC A;  2O6G E;  3KZZ A;  1L3L A;  1HW2 A;  3FZV A;  1W5T A;  2UZK A;  2BEO A;  2O8X A;  3M9A A;  3FHZ A;  2J5O A;  3J81 K;  3GXO A;  1J5Y A;  5E1X A;  2STW A;  3O3K A;  4TV7 A;  2CWE A;  3CLO A;  1ZG3 A;  2E1N A;  1HST A;  2QQ9 A;  2WTE A; 
#chains in the Genus database with same CATH topology
 3CMY A;  3T5X A;  4A93 J;  2QGU A;  1YJ9 I;  4U0Y A;  1QHH D;  4OAY A;  4RDU A;  1IV6 A;  3FIS A;  3J7Y J;  3BR0 A;  2MYS A;  4IQ4 A;  4A6E A;  4ZZD A;  1XSD A;  3A2K A;  2W1O A;  1VZ0 A;  4M3B A;  5DUI A;  1RR8 C;  4EJW A;  3TDU C;  1G59 A;  2NVX J;  1I27 A;  1IN5 A;  5F0C A;  2DFH A;  2XRN A;  3ZQL A;  5D6E A;  4DQ2 A;  1UHS A;  4HZF A;  1QZZ A;  1SFO J;  2L9N A;  2H1K A;  3G2B A;  5CLS A;  4JOM A;  1U9N A;  4C3I J;  3CDI A;  5IT3 A;  3G1L A;  3BLY A;  5FGM A;  1MJ9 A;  3WGH A;  1JJ8 C;  4KNY A;  1F36 A;  2IA0 A;  4JX6 A;  1KON A;  2IRF G;  2V1X A;  3KYC B;  4N4O B;  3HRT A;  5FRM A;  1D8K A;  2EWN A;  4I0B A;  1ETO A;  2DA7 A;  3FBN B;  5GPA A;  2MD0 A;  2EFW A;  4HX8 A;  3HDD A;  4GXO A;  4RB2 C;  1IN6 A;  2MBF A;  4MNU A;  4KJZ A;  4FAS D;  2IS1 A;  3DV8 A;  2ZBK A;  3TMO A;  3PM1 A;  3C2H A;  2AS5 F;  2HPM A;  2QKM B;  4RAG A;  3RJP A;  1KZH A;  2MH2 A;  3KEY A;  2YR2 A;  4XRF A;  3RIR A;  4AVZ A;  3V42 A;  2W00 A;  2LRE A;  1G8X A;  2QQB A;  2XF5 A;  4DOZ A;  1R36 A;  3CME I;  3FXU A;  2IT0 A;  1BIA A;  5FD6 A;  1T6S A;  3D1N I;  2XAG A;  3REO A;  5A2Q Z;  3MVP A;  4PJ0 C;  3HTS B;  4IRI A;  5EG0 A;  2HPI A;  1ZK8 A;  1REP C;  2QWW A;  2D5V A;  1WGX A;  4GCV A;  2ZSH B;  1HW5 A;  5EYR A;  1OIS A;  1LVA A;  5LHH A;  2Q0O A;  2DU9 A;  1HW1 A;  3I4M J;  1TWG J;  5GAD J;  4B4C A;  2P7V B;  1CGP A;  1SD5 A;  3ML6 A;  2R4G A;  2R7W A;  1Y8Q B;  2EA2 A;  3PO2 J;  2OU2 A;  1WJF A;  2TCT A;  3R4K A;  1MMD A;  1ULY A;  2O0Y A;  3DXJ F;  2ZME A;  4ZH4 F;  1ZAR A;  2IGN A;  3AG1 H;  3JTH A;  3QP5 A;  3OS0 A;  3M8J A;  2DPU A;  4M3G A;  4RMN A;  1XSX A;  1RR7 A;  3GZ6 A;  3P7N A;  1SD7 A;  3IRQ A;  1VQ5 I;  3GLX A;  2FUG 2;  2LYC A;  3S3M A;  2FA5 A;  1ZHF A;  1UST A;  3BY6 A;  1UEL B;  2ZME B;  1ZQ3 P;  1JHF A;  2OV7 A;  4CDG A;  3HOW J;  2VON A;  4ESJ A;  1Y8R B;  4L9J A;  3ZQF A;  2KPM A;  5FFZ A;  4ENN A;  1IW7 F;  1ZN2 A;  4L5I A;  2CUF A;  5FKN A;  1FBS A;  2XGC A;  1E3O C;  3C18 A;  2V9K A;  1PJR A;  2A5W A;  3BT9 A;  2PN6 A;  1UHW A;  3VOD A;  3L9F A;  4CCJ A;  2QCO A;  5DD4 A;  5J1R A;  2EJR A;  1XGS A;  2MA3 A;  4DYR A;  4IHV A;  1TQI A;  4RGR A;  2ZB9 A;  2JN6 A;  4GGG A;  3GFJ A;  1T8I A;  3VYS B;  2HOA A;  1XSV A;  2XKP A;  4LGW A;  1D5Y A;  1Y6I A;  3ABU A;  4C30 A;  4G7H F;  4IVN A;  4ASN A;  1K79 A;  2RDP A;  2VQC A;  4BHB A;  2EFQ A;  2XIG A;  4LK1 F;  1FTZ A;  3KZI C;  1RKT A;  2TRT A;  3ISP A;  3QPT A;  1D0X A;  2Q1Z B;  3HSE A;  3OYH A;  4WX9 A;  2JVH A;  4O6J A;  2Y9Z A;  3BP8 A;  4PJL A;  4G9Y A;  2HTJ A;  1MMA A;  4BS9 A;  2KMU A;  3NAR A;  1V55 H;  2OZU A;  2DA3 A;  1QGP A;  2VBZ A;  2EFN A;  4M6Y A;  4DZJ A;  5E3M A;  2DOF A;  4XKW A;  3H5N A;  4BYY A;  3GBG A;  4C2U A;  2H94 A;  2DOD A;  1YE9 A;  1O3T A;  3DPL C;  1LDK B;  2F4M B;  2XB0 X;  3CES A;  3OYK A;  3S1Q J;  1KGS A;  2HXI A;  5FLX Z;  1U3E M;  3OYL A;  2K3P A;  1DP7 P;  1EH8 A;  3K1M A;  2NNN A;  5DCF A;  4IPA A;  2XRL A;  3I56 I;  2UXN A;  1XN7 A;  1I5Z A;  4XKV A;  1I3A A;  3VFZ A;  1KYZ A;  2D45 A;  3BG6 A;  5L3G A;  4LIT A;  1HLV A;  1JKO C;  1AWC A;  2K9Q A;  2OCE A;  4HQE A;  5K7Z A;  3DTI A;  3W6K B;  3VPR A;  5L3D A;  1J7K A;  1TW3 A;  1OCO H;  1UAA A;  2QQ8 A;  1R71 A;  3T8R A;  1FZP B;  5H6Q A;  1HC8 A;  5D4R A;  4I2O A;  4AWX B;  3ZN1 A;  3LFK A;  1YG2 A;  1ZR4 A;  3CJN A;  4D1Q A;  2D1V A;  4IHW A;  3AKZ A;  3S15 J;  4LG3 A;  1I3Q J;  3HRU A;  4AUX A;  1XCB A;  2Z3Y A;  4EV0 A;  2F2E A;  4A12 A;  1HKS A;  1ZRC A;  1Z77 A;  3HGG A;  4DJA A;  3OR1 C;  1YW9 A;  1I1S A;  3HB9 A;  4RAF A;  1HQC A;  1R1V A;  2X0L A;  3JCU C;  1WKM A;  3HSF A;  1SVM A;  2F4O B;  3N05 A;  5J40 A;  4L9N A;  1JUS A;  5C3E J;  3C1D A;  4CCM A;  2CSO A;  3ULQ B;  4YIF A;  3IWZ A;  3PNY A;  4HNT A;  4Y13 A;  3C2B A;  3QPH A;  1G3Y A;  3BOQ A;  3HHH A;  4F3Q A;  2NVY J;  2DFI A;  2OTJ I;  3ABL H;  2EZH A;  2LF7 A;  3HIF A;  3ABM H;  1MD0 A;  4CCL A;  3KP7 A;  2AO9 A;  3QYF A;  1X1D A;  1EJ9 A;  4BDY A;  1TC3 C;  5GTI C;  2VOP A;  2LOO A;  3OR2 C;  2HTS A;  2PMH A;  3QOP A;  3F72 A;  4OIP F;  4LLL A;  3VOE A;  3BJA A;  4KIF A;  1MBJ A;  2JSP A;  1JTX A;  3EUK L;  2FD5 A;  1UZC A;  1QPM A;  4BQQ A;  1TWH J;  3OL4 A;  4ZZL A;  2BW3 A;  2IJL A;  2JZY A;  3N97 A;  4NHJ A;  1Y1V J;  4JYK A;  1Z05 A;  4PZJ A;  1T98 A;  5HLG A;  3QOD A;  3DBH B;  2VT3 A;  4FCY A;  2O03 A;  2M9H A;  1UJ8 A;  2VKH A;  4F91 B;  3GW2 A;  3RKY A;  1BI2 A;  3EYI A;  1WRJ A;  1G3W A;  5D8L B;  4U0W A;  1YS7 A;  4UVA A;  1TT5 B;  2JTV A;  2V9P A;  3JRA A;  4HF0 A;  3Q5F A;  3CTA A;  1X2N A;  2V1D A;  3DU6 A;  2BW3 B;  4XOT A;  4UV9 A;  4Y52 J;  2YX4 A;  4C2T A;  2NAZ A;  2NVQ J;  2XSJ C;  3SZT A;  3ONQ A;  2CW0 F;  4EJT A;  4W97 A;  1VTN C;  2KHM A;  2WBM A;  2DK5 A;  5K7F A;  1N25 A;  1NH3 A;  2LF8 A;  3MAJ A;  2E1M B;  3PNT A;  4CIC A;  1X4P A;  2M4G A;  5CVV A;  2E1C A;  4JP0 A;  1K61 A;  2E2J J;  2K02 A;  4Q48 A;  2A68 F;  3FK7 A;  3J7Z I;  4ZTF A;  4CCO A;  1JT0 A;  1QVU A;  3FM3 A;  3I5U A;  3HPH A;  4O5V A;  3OYM A;  4NNJ A;  3BG9 A;  3GTO J;  4FX0 A;  2R5Z A;  5IP9 J;  2FQ4 A;  4KMU X;  5EEH A;  1D5V A;  1U8R A;  3COA C;  2VPR A;  1R1U A;  1U0J A;  2EIN H;  2HI3 A;  4NB5 A;  1TP4 A;  1VQ9 I;  1FBU A;  1OPC A;  4BBS J;  2NYX A;  4Y4R A;  4LG0 B;  2VN2 A;  3OYG A;  2VKV A;  3LA3 A;  3JSP A;  1F1Z A;  2K4J A;  2R5Z B;  3L2U A;  3GX4 X;  2ZJP F;  4FE7 A;  3ZMD A;  4MQV A;  1LUJ B;  2WAQ A;  3EUH C;  1QO0 D;  3QAH A;  1X3Z B;  3S93 A;  2M0C A;  5KAI C;  2DJI A;  4PCQ A;  4YII A;  3R6S A;  3VEP A;  4UB6 C;  3MQ0 A;  1WSU A;  4ZYH A;  3D5S C;  4B43 A;  5CVI A;  1XGM A;  3RDI A;  1VQ7 I;  3DF8 A;  1YX5 A;  3L2C A;  2Z99 A;  2QEN A;  2MD5 A;  1MW7 A;  3GTM J;  3JAM K;  4AYB N;  4EJU A;  1DPU A;  5JI6 A;  4LB6 B;  4Y7N J;  3K1P A;  3OYA A;  1DDN A;  5GAH J;  1OJL A;  1IG7 A;  5HS9 A;  4EGY A;  3HJE A;  3B02 A;  3MZY A;  5KHD A;  5DD8 A;  3WU2 C;  3JRF A;  3JRD A;  2RAE A;  2ME0 A;  5F6F A;  3LQQ A;  3EDP A;  3CO7 C;  1NG7 A;  3ZQG A;  4D7M A;  2CGP A;  2NNY A;  4GDF A;  4F7Z A;  3IP4 B;  2JT1 A;  4DYQ A;  4CA0 A;  1I6X A;  4ON0 A;  3RKQ A;  5HVQ C;  1P92 A;  4M6X A;  3HZJ A;  5L3E A;  3VYT B;  2QEX I;  3DWL E;  3FIW A;  5F0F A;  1NTC A;  4BHC A;  2MW8 A;  2L7Z A;  5JVT A;  4U7D A;  3DPT A;  2VBY A;  4XQF A;  1AKH B;  4BDZ A;  1IRG A;  2RNG A;  2HS5 A;  2W24 A;  1EA3 A;  2BBY A;  1W1W E;  3BC8 A;  3H92 A;  1N78 A;  1V54 H;  1WVR A;  3BTC A;  2IGM A;  3NWS A;  3H5R A;  3ZMU A;  5L3F A;  1X1C A;  1V5E A;  4RA2 A;  1QBJ A;  1R9T J;  4KIS A;  3FXR A;  5J6X A;  2L01 A;  4I09 A;  2WB1 N;  4OIR F;  3S1R J;  3K4C A;  3BR5 A;  3FKJ A;  1LFB A;  2P0W A;  2Y0M A;  1HA8 A;  2M5W A;  2UXX A;  3CUO A;  4AYB A;  5AON A;  3DTE A;  2DJN A;  1YLF A;  4AU7 A;  1FY7 A;  2KP6 A;  2KRH A;  5EEG A;  2F5D A;  2LKS A;  1A5J A;  2GIV A;  1NK2 P;  1GV2 A;  4BY1 J;  3P9K A;  3W2W A;  3E0J B;  1Z0X A;  4HAM A;  2LLK A;  4XM3 A;  2LC2 A;  5EZG A;  4BKX A;  2Y48 A;  1EH6 A;  4PUS A;  4XOR A;  3HOV J;  1Y39 A;  1BC8 C;  2GXG A;  1WI9 A;  1SAU A;  4HQM A;  4AIK A;  5D4S A;  4G8X A;  2ZXI A;  4E7K A;  2WA0 A;  3PQK A;  4HNU A;  1WWX A;  5KVR A;  3KCC A;  3WGI A;  5IT9 Z;  2ETH A;  2BXZ A;  2F5V A;  1TL8 A;  5FJ8 J;  3MKZ A;  2HDC A;  3VB2 A;  2L4M A;  1O3Q A;  1ONV A;  3OWT A;  2KIF A;  4FQG A;  3O2P E;  2V4J C;  2L9S A;  3KP5 A;  1KU7 A;  1RRJ A;  2C6Y A;  3BCA A;  4QIW N;  3PIO F;  3F21 A;  2F5E A;  1LJ9 A;  4BE0 A;  2HYJ A;  3WG9 A;  2W48 A;  1B6A A;  2EZK A;  5FKO A;  5LGN A;  4D5F A;  5HOO A;  2E2I J;  2Y0S N;  2PJP A;  3QU6 A;  2LY9 A;  5HNH A;  3BTI A;  2JA6 J;  1SEU A;  2DMU A;  3V8J A;  5HDG A;  3OYB A;  2DA1 A;  1YIO A;  2M0M A;  4A0X A;  5EZH A;  3NWT A;  2R3S A;  4MTD A;  5EJC A;  4RGS A;  5ICE A;  2FU4 A;  3M7G A;  2WB1 A;  1F5T A;  2LSO A;  1VQP I;  1O7L A;  2AXL A;  3GTL J;  1FX7 A;  3HGY A;  4A0Y A;  4CZZ A;  5IYB J;  1MIJ A;  3HRM A;  5D5U B;  2R7V A;  3C7J A;  3L00 A;  5DS9 A;  1OCT C;  2X48 A;  3U9G A;  3CCV I;  9ANT A;  3FMR A;  4GO1 A;  4RAZ A;  3SZP A;  5E17 F;  1DP3 A;  3GF2 A;  2ZKZ A;  1BC7 C;  5L3B A;  3QRF F;  5EF6 A;  1T56 A;  5BQT A;  1E17 A;  3JR9 A;  4R79 A;  1BN5 A;  4DBR A;  5TRD A;  2LK2 A;  3PQJ A;  1DPR A;  1XMA A;  4LOC A;  1E0E A;  3W3C A;  4WXC A;  2Z5U A;  4XON A;  2HNH A;  4GYI A;  4I98 B;  2WC2 A;  1BI3 A;  3BG5 A;  2LKP A;  2BY2 A;  1BR2 A;  4C2M J;  2OUM A;  2L54 A;  1S8N A;  3S2H J;  5EDN A;  4JX5 A;  2X51 A;  4X0G A;  3IRR A;  3QOE A;  4EM0 B;  2QF7 A;  1GXP A;  4HF1 A;  3TL4 X;  1LDD A;  1BW5 A;  3O8G A;  2HQR A;  4ZDP A;  2BGC A;  1UG0 A;  1I50 J;  2PMU A;  1T33 A;  1Z7L A;  1FSH A;  3V8L A;  2K7L A;  4BGD A;  2PI0 A;  1DGR M;  3R0A A;  2WAE A;  3TW6 A;  1EV7 A;  4NC8 A;  1JJ6 C;  1MBH A;  2DLL A;  4HEA 2;  2IEK A;  4CYC A;  3E3V A;  3JW4 A;  4NC7 A;  4CO8 A;  1O57 A;  2KZV A;  1BI0 A;  3J7A O;  2ECC A;  3DP7 A;  2LR8 A;  3H9G A;  4UUT A;  3GZN B;  3HOY J;  4P96 A;  5DV5 A;  1FYK A;  2XV4 S;  3KYD B;  4OU0 A;  4U7B A;  3BG3 A;  2PQ8 A;  2DDA A;  2RN7 A;  4XRM A;  2RRE A;  1QRY A;  4J01 A;  4CYC B;  2MLG A;  2QQA A;  2YPR A;  1VI0 A;  2RV8 A;  4MQ9 F;  1IN8 A;  1IV8 A;  2DCE A;  1B8I B;  1Z67 A;  3I58 A;  1OMI A;  4KT6 A;  4QTR A;  5HLI A;  1MBG A;  3H3U A;  1FEX A;  2Q2E B;  1WPK A;  1JHH A;  1TQM A;  2CO5 A;  5H6R A;  1SFK A;  2XB5 A;  1JE8 A;  3F9K A;  5LHG A;  4WK8 F;  4GRI A;  3WU0 A;  3JRH A;  2FOW A;  1R4N B;  3ZQQ A;  4IL6 C;  1CQT A;  4UB8 C;  2AXT C;  4Y15 A;  1FBQ A;  2ZME C;  3S2W A;  3CDL A;  2X1E A;  1WFX A;  1MH4 A;  1K78 A;  3G4S I;  1B9M A;  2E7W A;  2KIU A;  3CC2 I;  4XN0 A;  4HX4 A;  1IZ1 A;  5LEJ A;  1W36 C;  1DU0 A;  4KIT B;  2FE3 A;  1AA7 A;  1OCP A;  4E4H A;  4PGG A;  5GTH C;  2M7B A;  2KIQ A;  2ZJQ F;  2W57 A;  3FHN A;  2HQN A;  1AOY A;  3C2G A;  4Z2Y A;  4ZYA A;  2E71 A;  2GA2 A;  1VQO I;  1BR1 A;  4XN3 A;  4XLE A;  1K78 B;  1I6H J;  3OYJ A;  1IXR C;  1O3S A;  3ZMV A;  1JTY A;  1D0Z A;  3HTU A;  3K4N A;  2ZJR F;  3T8T A;  1M1E B;  3IUO A;  2HZD A;  3V8K A;  1R5H A;  3H1C A;  3PSI A;  3MKY B;  3F22 A;  1WCM J;  2BVM A;  3B6A A;  4A3J J;  4ZJZ A;  5FD5 A;  1IF1 A;  3ZMZ A;  4QLC U;  4XLP F;  5BNG A;  3LSK A;  1SVO A;  2Y30 A;  3GFI A;  3E6D A;  5EEA A;  1YJN I;  2CFX A;  3GME A;  2DFE A;  3E5X A;  4IXA A;  3R0J A;  5E1W A;  1ZRD A;  4IHT A;  2R7X A;  2DTZ A;  1GT0 C;  3ASN H;  2H8W A;  2X1D A;  2XAS A;  4JBA A;  1LFP A;  3DCF A;  3TGN A;  1K4S A;  2MLK A;  1S6L A;  1XS9 A;  2ISZ A;  4BJ6 C;  3PUF A;  3L7W A;  3CMM A;  1RC9 A;  1YW8 A;  3CQZ J;  4NDL A;  4QWQ A;  2IP2 A;  2K9N A;  4P9U A;  3BQY A;  1U8B A;  1OFC X;  2RNJ A;  4XKC A;  2E5N A;  4IF4 A;  1WH7 A;  4HX7 A;  1YS6 A;  3OSG A;  1S7O A;  3IH4 A;  3BJO A;  2OC6 A;  2P5V A;  3GO5 A;  3I3L A;  4B44 A;  4XLC A;  4E7J A;  2JRM A;  2FJ1 A;  3K70 D;  1ERD A;  1DUX C;  4OMY A;  2Z9O A;  4IOA F;  1OYI A;  2OA4 A;  4FTH A;  2L0K A;  2E34 A;  5FKL A;  2R5Y A;  5ILU A;  4F92 B;  4ZTJ A;  1S9H A;  2A61 A;  3WTY C;  5HDK A;  1NK3 P;  4DNC A;  1U6G A;  2DFF A;  4RB1 A;  3HBL A;  3LL7 A;  4A3B J;  5JFR A;  2LNB A;  1QU3 A;  1RPW A;  4LLG F;  1H0M A;  3FX3 A;  2F4I A;  3WHB A;  3GYH X;  1APL C;  2ME6 A;  4D7N A;  1J75 A;  2K3F A;  1L0O C;  2R5Y B;  1R7J A;  5FRN A;  4OIQ F;  1R23 A;  4U88 A;  2HOS A;  1TT0 A;  4B47 A;  5A2Q K;  5KK1 A;  2XGX A;  2HDD A;  3BJ6 A;  3ZOB A;  3GFL A;  3IWF A;  4I99 C;  3N4M A;  4YRV A;  3LNQ A;  3KEO A;  3OOP A;  3AFH A;  4HLX A;  4F55 A;  2JQ7 A;  4XKB A;  2ICW G;  3A03 A;  3CP8 A;  1WJD A;  2COB A;  3GTP J;  1IAW A;  4EGZ A;  2W85 A;  1PUE E;  2BXY A;  3FXQ A;  4HF2 A;  2FML A;  2DA2 A;  5CQE A;  3MKW B;  3SEZ A;  1ZG5 A;  1H89 C;  4FT8 A;  4A3K J;  3I9V 2;  1A6I A;  3KLN A;  4M3F A;  4LK0 F;  2EFP A;  2J5P A;  3FMQ A;  4LMY A;  1YYV A;  1Y1W J;  3QU3 A;  1J0R A;  5B1B H;  1BBY A;  3EUA A;  2XAJ A;  4IRH A;  1D8J A;  1JGS A;  3V7C A;  5K5R A;  2JJ7 A;  2MGQ A;  3IC7 A;  4MGR A;  2BY0 A;  3RYR A;  2LDU A;  3BR3 A;  3BZK A;  3HC7 A;  2QZ8 A;  4KIG A;  1V5G A;  3LA7 A;  2K9L A;  1X58 A;  2KL4 A;  2KQR A;  2HYF A;  2P8T A;  3AG2 H;  2KJB A;  3LMM A;  4V19 K;  3CCL I;  5HLH A;  1LE8 A;  4A3M J;  1Z3Y A;  1X1A A;  4BJ5 C;  2O8K A;  4BE1 A;  2JUG A;  5IOY A;  3BTL A;  4FX4 A;  4RS8 A;  5CQG A;  3BG7 A;  5LLQ A;  2KDO A;  4S04 A;  3FMS A;  4BY7 J;  1KYW A;  4OWR B;  2JPC A;  4MLO A;  1BA5 A;  1LE8 B;  2JA8 J;  2ZJ2 A;  3E6C C;  1SVL A;  2I8D A;  1SAX A;  2G9W A;  3KPH A;  3WOD F;  2XGD A;  4KMF A;  2STT A;  2ID3 A;  3IAM 2;  4H0E A;  3H9J A;  2CG4 A;  2XF6 A;  2IPQ X;  3FXJ A;  2DT6 A;  2EPF A;  1J2X A;  3GLL A;  4CH7 A;  3ZRG A;  3LSI A;  4BQN A;  2GXA A;  1WZ2 A;  4E7L A;  1MND A;  2DPD A;  3SYT A;  4B1R A;  4ZYG A;  4HDU A;  4M3E A;  2QSH X;  2E1M C;  2L7M P;  5DDG A;  2XRO A;  4KDP A;  2Y9Y A;  1YTY A;  3RPU D;  4DW6 A;  3K1N A;  1IC8 A;  2CQQ A;  3EET A;  2E36 A;  4O3M A;  3TP0 A;  2MAB A;  2QA4 I;  4BEH A;  2M87 A;  1V4R A;  2EA4 A;  3VYR B;  1Z3X A;  3FDY A;  2XSD C;  3AG3 H;  3I4P A;  1EKE A;  4A2U A;  4E6K G;  3R60 A;  2LY2 A;  2R7O A;  3I4N J;  4LB5 A;  3OYF A;  2VL8 A;  2KIM A;  3SQN A;  4BEH B;  3L2R A;  3OSF A;  4A0Z A;  5FLX K;  1ZRE A;  4AD9 A;  2XUB A;  4PJN A;  3JSO A;  1VQ6 I;  4NBQ A;  4IEJ A;  4Q4Z F;  2Z33 A;  1FWZ A;  4XRS G;  3KP6 A;  1KA8 A;  3LQR A;  3NRV A;  4A3E J;  1LNW A;  4RGU A;  1ZKG A;  2NOG A;  4V2G A;  2ISY A;  2CJJ A;  1VQN I;  5J47 A;  5M5Y J;  2CQ7 A;  1B4A A;  1SFX A;  1R5I D;  2CFO A;  2RC4 A;  2AQE A;  1BI1 A;  3HKZ N;  3RQI A;  2DMQ A;  3I55 I;  1PP7 U;  3D0S A;  4L5E A;  3IKV A;  2DMP A;  4CXF A;  4KN4 X;  2H27 A;  2QVO A;  3WE3 A;  1ETW A;  4XSX F;  1QHG A;  5FFX A;  3OIP A;  3E97 A;  3CC4 I;  1HF0 A;  4G6Q A;  5HS7 A;  3F8B A;  1MGT A;  3RSN A;  2XDV A;  4BBR J;  1YFH A;  1FTT A;  2FEZ A;  3I71 A;  3OS2 A;  4D9J A;  3RI4 A;  3V7S A;  3JRC A;  2ZXJ A;  2EV6 A;  3U21 A;  2M2E A;  4XNF A;  3FKI J;  4II3 A;  4A5N A;  2WAQ N;  2EV0 A;  2V1U A;  2HDW A;  2R7Q A;  1SAN A;  3LAP A;  2ZFU A;  4WWC A;  3AL0 B;  3WG7 H;  3IAS 2;  2ADU A;  2ELH A;  5JLW A;  3RKW A;  1X19 A;  1W4M A;  4CSW A;  3CUQ A;  5DTD A;  4PSX A;  3GWZ A;  2JSC A;  5JHU A;  2CV0 A;  1O4X A;  2BZT A;  1LQ1 A;  4NQW A;  1ZR2 A;  3M4O J;  2IS2 A;  2EQR A;  2EZI A;  5HLT A;  4UNO A;  5L3C A;  1FOK A;  2BHZ A;  2D1H A;  1W0U A;  1ITY A;  3HOZ J;  2F5C A;  3OL3 A;  1E3H A;  1BIB A;  3Q0W A;  1KU2 A;  3CUQ B;  5LGT A;  2P7C B;  2PBI A;  1B72 A;  1Y0N A;  2MSY A;  2A6H F;  5B66 C;  4NQW B;  3HKZ A;  3WTS C;  5IY5 H;  4LG0 A;  2XHK A;  4XRS A;  1R4M B;  1ZLJ A;  5M3M J;  1VQ8 I;  1S72 I;  1XG1 A;  3GVA A;  2JA5 J;  2XF7 A;  5CVR A;  3ZQI A;  1DGW Y;  2HEO A;  3HSR A;  2HYG D;  1TWF J;  3QQA A;  2EV5 A;  4CHU A;  4ZDO A;  1IXS B;  3WTW C;  1LB2 A;  2A3S A;  4IRG A;  3I53 A;  1SMT A;  2R7R A;  3HYI A;  2LTP A;  5DUK A;  1TBX A;  4EJV A;  3CCS I;  1B72 B;  2LRD A;  2Y69 H;  3H0D A;  4HDV A;  2CQN A;  2OZ6 A;  2LP0 A;  3L2W A;  2K27 A;  2VJJ A;  5F64 A;  2W4S A;  2FXA A;  2L4A A;  2VJ4 A;  1SD4 A;  3ELK A;  1W5S A;  3UKG A;  2VQH A;  1R5G A;  4MEY F;  5ICG A;  5B5E C;  3NQO A;  3QPS A;  3H3V K;  3MWM A;  3G3Z A;  4ZYE A;  2K9S A;  1ZTR A;  2X85 A;  4UVC A;  2JWT A;  5BMZ A;  4HRI A;  3IH2 A;  4EAT A;  1UFM A;  1X1B A;  2B7E A;  3ZPL A;  2M8E A;  2FBH A;  4BH9 A;  5HNF A;  3WTX C;  2FSW A;  3KP3 A;  3BR6 A;  4XLH A;  1YIJ I;  3BR1 A;  2KZG A;  3O6B B;  5E3O A;  4I02 A;  1R49 A;  2V9V A;  2KDZ A;  1HKT A;  3B6C A;  2E7X A;  3GTK J;  2I10 A;  3LST A;  5CYV A;  3MZH A;  1F9N A;  3OV8 A;  4HA8 A;  4A6D A;  1E3P A;  2LBF A;  1N75 A;  2OJE D;  3MFK A;  1FMW A;  1A31 A;  1FYL A;  2VT2 A;  2YSR A;  3KP2 A;  4X6A J;  3BZC A;  3BZ6 A;  3V7R A;  2XKO A;  4H4K C;  2HVQ A;  2Q8K A;  1AKH A;  1P6R A;  4FET A;  4UUV A;  2LFB A;  5FB2 A;  4P9F A;  4AIH A;  2LBF B;  3F8C A;  1XD7 A;  1EH7 A;  1R00 A;  3TO6 A;  1Z6T A;  3JRB A;  4AM3 A;  5GPC A;  1V3F A;  2MC3 A;  4ESF A;  1MNE A;  4HV5 A;  3HPG A;  1R58 A;  3G73 A;  2A69 F;  3MD2 A;  2DW4 A;  4BU2 A;  3RZO J;  2K9M A;  1B59 A;  1FOW A;  4XBF A;  3K69 A;  4QSH A;  2IGO A;  1YO5 C;  4PFP A;  2QUF A;  5C4J J;  5LBQ A;  4CCN A;  1VFC A;  4W1U A;  4IHY A;  1A04 A;  2P5K A;  5FO5 A;  2W82 A;  4XLN F;  1HKQ A;  1R6R A;  3WTT C;  4ZYD A;  3CDH A;  5K5Q A;  4E7Z A;  3H0G J;  3Q9V A;  3B73 A;  1U9O A;  3UR3 C;  4OOI A;  3ZP5 A;  4R8H A;  2ZCW A;  3K4L A;  1FPQ A;  1TW2 A;  5D5X B;  2W84 A;  1I1G A;  3GTJ J;  3MZ8 A;  2FX0 A;  1YX3 A;  4BQO A;  5K5O A;  2R0Q C;  2NS0 A;  3MN2 A;  4L9T A;  3BCB A;  5C44 J;  1UCR A;  3CCY A;  4LFU A;  3W6J B;  5CJ9 A;  1ZYR F;  2ACJ A;  2FNP A;  5M5W J;  2LD5 A;  5IPA A;  1R1T A;  1TNS A;  4IJA A;  2VUM J;  5ICF A;  3GFM A;  1GDT A;  2EIJ H;  5HDN A;  4B3X A;  2R7T A;  2EIM H;  5TIS C;  3J80 Z;  3G6E I;  4GYG A;  2M1B A;  1SFE A;  1H9T A;  3KFW X;  4OIO F;  3Q0V A;  4IZZ A;  2M8G X;  4U87 A;  1VQM I;  1IRZ A;  1MJB A;  1IUF A;  3ECH A;  4BHP A;  3DPU A;  1YIT I;  2EFO A;  2G7H A;  3E1S A;  1JT6 A;  4B09 A;  2IA2 A;  3W2V A;  4MIM A;  4YFN F;  2L7F P;  1G3T A;  1RUN A;  4ABZ A;  1P2F A;  2NXN B;  1P7J A;  4J19 A;  2PLY A;  1IDY A;  3A02 A;  1EF4 A;  4M3D A;  1OCC H;  1P4X A;  1ZAO A;  2YX7 A;  3ECO A;  2CUJ A;  4ENM A;  1ORK A;  2VKD A;  4MTE A;  3CJT B;  3S32 A;  1IRX A;  1FNN A;  2DN0 A;  1S5L C;  2L5Q A;  2M4K A;  1KQ9 A;  2L7K A;  1YRN A;  1RES A;  5E1Z B;  3CMA I;  1B9N A;  1ETK A;  1WI3 A;  5FLM J;  5LRS A;  4PK4 A;  3DBL B;  4PSW A;  3F8N A;  5F0H A;  3PFY A;  4E7I A;  3M3Y J;  1FT9 A;  1XX5 A;  2EB7 A;  1JKP C;  1O7F A;  2KJC A;  5BS6 A;  4M9Z A;  2IBD A;  2YUS A;  1BJZ A;  4XR6 A;  2WV1 A;  1ZLK A;  1YOV B;  4MFD A;  3DBR B;  4HYE A;  1YRN B;  4EQQ A;  4XL9 A;  3DLA A;  5JVG F;  4BQA A;  1X4O A;  3S16 J;  1G6N A;  3PUB A;  5IT9 K;  5KNL A;  1HDP A;  1ZRF A;  1WHU A;  3BTJ A;  2ZNZ A;  2HQA A;  2GWR A;  2RQP A;  2BYV E;  2HKO A;  3AAF A;  3HRS A;  5CVJ A;  1U78 A;  4L0Z B;  4UXN A;  1VQ4 I;  1S3J A;  1X1P A;  2VBW A;  3CJR B;  3QWL A;  1Z9C A;  3SJM A;  2HVR A;  1XMK A;  2E35 A;  3S3O A;  2CW7 A;  3RPQ A;  3K0L A;  3VYU B;  3OYN A;  3V4G A;  3TQN A;  4JK1 X;  2HXO A;  3NAU A;  2ESH A;  5HS8 A;  1O3R A;  1MKM A;  4E7S A;  4WXH A;  2DI3 A;  1ETY A;  2EBI A;  2WV0 A;  2OBP A;  3HUG B;  1BM9 A;  5E8G A;  1Z1D A;  2OCC H;  3RTR A;  4AIJ A;  2NVT J;  3ABT A;  2A07 F;  2E2H J;  4RM3 A;  4S05 A;  4JQF A;  2O9L A;  3J81 Z;  4II2 A;  4UUS A;  3OYC A;  4ZDL A;  1SMY F;  1KQ8 A;  2X9D A;  1TWC J;  2OTL I;  1TLH B;  2OPT A;  3IKT A;  2V1N A;  1X3U A;  5HOD A;  2QM3 A;  5ED4 A;  1SD6 A;  2JPB A;  3ERM A;  2L9V A;  4UY8 I;  1T0F A;  5LEK A;  4F93 B;  2DBB A;  3I59 A;  2KLO A;  2E5Z A;  3PL8 A;  4HPQ A;  1B8I A;  4UUS B;  1W7P D;  1STZ A;  2IS6 A;  1OR7 A;  2Q2E A;  1BOA A;  2B63 J;  4OMZ A;  3SEQ A;  2LY1 A;  3EYY A;  4RLQ A;  3RYP A;  5GP9 A;  3I59 B;  2WAF A;  2OQG A;  2M3A A;  2HOT A;  3ZMT A;  1N77 A;  2HQ5 A;  2H09 A;  2L9R A;  2M45 A;  2VE8 A;  1WH5 A;  4HLY A;  3S17 J;  2VXZ A;  4N9I A;  5IP7 J;  2DDB A;  4BL0 B;  5FLV A;  1G2H A;  2YU9 J;  2ZNY A;  2JVG A;  1Z21 A;  2VC1 A;  1Z91 A;  4IO9 F;  1OCR H;  3K4J A;  1RZ4 A;  1S29 A;  2EZL A;  3WHC A;  4S0H B;  1YJW I;  1IN7 A;  1ENH A;  3CD6 I;  5JLX A;  3E6B A;  3L2V A;  5D5W B;  2UV1 A;  1YQA A;  4KIB A;  4KT5 C;  4KA4 A;  1ZH5 A;  1K4T A;  2GBY A;  4LD5 A;  2P6T A;  1BW6 A;  3ABK H;  4ITV A;  1UB9 A;  1IN4 A;  3IV5 A;  2Z16 A;  4HG2 A;  5IYD J;  2XPV A;  2R7S A;  1PUF A;  3DQV C;  3PJR A;  4I7H A;  3SDB A;  3R61 A;  2MFZ A;  2FQ3 A;  3GCM A;  3CCE I;  2DO7 A;  3KX2 A;  3DEE A;  4P1W A;  3P5J A;  3RPU A;  3E5U A;  3KEQ A;  5DM6 F;  1JXS A;  1JUM A;  2XPW A;  1LDJ A;  3DKY A;  2N8G A;  3GTQ J;  2L3D A;  4M6V A;  4RB0 A;  4G94 A;  3OYD A;  4L0Y B;  2IXS A;  2VB6 A;  1PUF B;  2ZSI B;  4DGW B;  2B0L A;  2B9S A;  4PFO A;  2KFD A;  1DU6 A;  3E5Q A;  2QLZ A;  1A36 A;  2X6O A;  3BDD A;  5ICC A;  2KIS A;  2VPL A;  3M8E A;  2JK3 A;  2K86 A;  2DK8 A;  1XPX A;  5K7H A;  1V5F A;  2IA1 A;  3GZ5 A;  1T38 A;  2XAU A;  4RM2 A;  3FM5 A;  2K40 A;  4M72 A;  4FIS A;  5FKK A;  2DA4 A;  1BOB A;  4I0A A;  3SFZ A;  1HBX G;  4N0B A;  2W7N A;  1XGO A;  1ETX A;  3LFU A;  2IAI A;  4IKF A;  2CQX A;  4KFC A;  1S7E A;  2RKH A;  3LOC A;  4ZC3 A;  2X1C A;  2QBY A;  3ZN0 A;  4DIQ A;  3DKX A;  2CUE A;  2ZXW H;  4M73 A;  3TP3 A;  4G6D A;  2NOJ B;  5FRO A;  1MBF A;  4U0V A;  3ZQC A;  4GFB A;  3S1M J;  2GOX B;  4LIV A;  2VJI A;  4BJT A;  3WTV C;  3F23 A;  2QBY B;  2DT7 B;  2P81 A;  1GXQ A;  3KIO A;  4IHS A;  1ZG1 A;  1WJE A;  4MFE A;  5D6F A;  3ASO H;  6PAX A;  1WJ5 A;  4NUB A;  2CYY A;  2H6C A;  2V79 A;  3ZGK A;  4ETS A;  2LMD A;  5EG0 B;  1J09 A;  2L02 A;  1K6O A;  3F8F A;  1HOM A;  2XC7 A;  2VKE A;  3A1Y A;  3BRO A;  5LHI A;  3I64 A;  2DA5 A;  3LSH A;  5D5V B;  1SFU A;  2IVM A;  3Q9S A;  3C3W A;  4A3D J;  2GAU A;  2K5C A;  5EGO A;  3F0C A;  4PDK A;  5E8I A;  2DQR A;  2PJR A;  1BJA A;  3T1B A;  2VOO A;  4CGZ A;  1ZGJ A;  5DYM A;  3VSK A;  3A0B C;  3H3Z A;  5ILV A;  4EM1 A;  2R92 J;  2VQL A;  4I01 A;  2DMT A;  2ECB A;  3BPX A;  1X2M A;  2OF7 A;  5J1Y A;  1YI2 I;  3HHG A;  3TDZ C;  5EGO B;  1QNT A;  2G0E A;  2GM4 A;  5GAE J;  2PJR B;  3GEZ A;  2FMY A;  5AIP A;  2O61 A;  2DYR H;  2NRA C;  3WGG A;  2R93 J;  2JRT A;  1XCV A;  2WY8 Q;  4BAC A;  1D1B A;  1D3Y A;  4B48 A;  2DQL A;  2F48 A;  2ZC2 A;  3GUD A;  4BAY A;  2V7F A;  1FSE A;  4V2F A;  2X6Y A;  3QP6 A;  3U1K A;  1U2W A;  1TTY A;  2VQG A;  3H36 A;  1HSJ A;  4HST A;  2ID6 A;  1IXC A;  4Q5S F;  3PFI A;  1RI7 A;  2H1L A;  3DEW A;  1BR4 A;  5CKT A;  4M71 A;  2PMZ N;  5JR3 A;  3WE2 A;  3W6V A;  1USS A;  1JUP A;  5LFA A;  2BVL A;  2YU3 A;  3JRE A;  4MHG A;  2FNA A;  2COM A;  1C0W A;  1H8A C;  3OOU A;  1VQL I;  1E2X A;  2OQR A;  2GA1 A;  4XID A;  3AL0 C;  2E60 A;  2HR3 A;  3CP2 A;  1X3W B;  4D0P A;  4DYC A;  2XAH A;  3JRI A;  1ON1 A;  3CCQ I;  4ANJ A;  2A05 A;  2FF4 A;  1LEA A;  2QYO A;  1IGN A;  4L5J A;  3SZG A;  4A5M A;  1FIA A;  1RUO A;  2GXB A;  1Y56 A;  2DMN A;  1SC7 A;  3W2A A;  4HBL A;  2HOE A;  5F27 A;  3HM5 A;  1RNL A;  4NC6 A;  4Y3O A;  5F08 A;  1IRF A;  3FXL A;  5DEQ A;  2AHQ A;  3BQZ A;  1FP2 A;  5H2F C;  2H6B A;  1LPQ A;  1T08 B;  3K9T A;  2LKX A;  2CW8 A;  3CUQ C;  2P4W A;  3U1D A;  3NEU A;  4I6Z A;  3EPZ A;  1MJA A;  4XLF A;  1ODD A;  3ZXS A;  2K4B A;  1IJW C;  2BHY A;  5KCM A;  2VE9 A;  1MMS A;  1P4A A;  3F6V A;  2V6C A;  1PDN C;  3K4B A;  5LRR A;  1UHM A;  5J8C A;  1CF7 A;  3O8H A;  5IP6 A;  3S14 J;  3F8M A;  3VWB A;  2CS3 A;  2VI6 A;  3FBI B;  2BOL A;  4ESB A;  3S2D J;  1K6Y A;  2VJ5 A;  2E1O A;  2PMZ A;  1HDD C;  4Z6Y A;  4RBO A;  1WQ2 A;  3X2Q H;  1KQ0 A;  1TZL A;  3ZQH A;  1WJC A;  1JKQ C;  2EK5 A;  2DOA A;  3H5A A;  1CF7 B;  3G71 I;  1MNM C;  1AU7 A;  2RGV A;  2CU7 A;  5E3N A;  2BV6 A;  3HG9 A;  2O3F A;  4IOC F;  3LSM A;  2HGC A;  1MMN A;  2W25 A;  2R7D A;  4RGX A;  2WY7 Q;  2EH3 A;  5E79 C;  5K1Y A;  4CZC A;  4XSZ F;  1W5C C;  2DT5 A;  2NS7 A;  3PSF A;  3PNV A;  2GIZ A;  3UNG C;  2TDX A;  3LWF A;  1LKX A;  2HWV A;  2IGK A;  1B1B A;  3L1P A;  4N4N B;  4RAY A;  1FJL A;  4YEL A;  1P7I A;  1Z7U A;  5DCM A;  4AC0 A;  2CQK A;  3RQ4 A;  2V26 A;  3E7L A;  1TNT A;  2M30 A;  4A3I J;  5M3F J;  1K7A A;  3CLQ A;  3TO9 A;  4G7Z F;  2V6E A;  5E3L A;  4IHX A;  1GHC A;  2FBI A;  1Q1H A;  5F1R A;  1ZGW A;  3K2Z A;  2ZO4 A;  3ESW B;  3LSR A;  5CVU A;  2X6X A;  2ESN A;  4OAZ A;  3MEX A;  2JA2 A;  2HVS A;  3WTZ A;  5DCM B;  2ZXH A;  3S1N J;  2H8R A;  1GV5 A;  3A4C A;  2KKO A;  3HOS A;  3TED A;  4L18 B;  4G6T B;  4HV6 A;  3TOA A;  1A35 A;  1W36 D;  1UG2 A;  4X1E A;  2IS4 A;  3CZ6 A;  3OIO A;  1YHQ I;  4CUG A;  3DTK A;  2GZW A;  1T95 A;  1TWA J;  3IH3 A;  2QSF X;  3TO7 A;  2VBX A;  2JMW A;  4BUP A;  4EVI A;  3LSP A;  4YG2 F;  2Z1D A;  4FHT A;  4E7H A;  1MSF C;  2BE5 F;  4XIC A;  2NS8 A;  1U5T C;  3G1O A;  3CC7 I;  1HXD A;  2YS9 A;  3D5R C;  2DYS H;  3CCM I;  1J9I A;  1OYW A;  1YW7 A;  5E20 A;  1POG A;  4YFX F;  1QZY A;  3IHU A;  1VQK I;  1NHA A;  2FRH A;  3ROU A;  2LVS A;  2XPU A;  3BR2 A;  3JTG A;  2Z2S B;  1T39 A;  3DU5 A;  2VXD A;  3E6M A;  1KU9 A;  3J7A Y;  1XB4 A;  1PVE A;  4P5O A;  4DZP A;  3M8F A;  2KRC A;  1RKW A;  4XK4 A;  3CJQ B;  1FP1 D;  3FF5 A;  3ZQ7 A;  3JAM Z;  2A5Y B;  2O7O A;  4KUM A;  1S7A A;  3KZY A;  3TKY A;  1MDM A;  1XDU A;  5J8F A;  5IYC J;  5H20 A;  5DM7 F;  5F1J A;  2F6C A;  2GLO A;  3TOB A;  4R1H A;  1IUY A;  1H9G A;  4Q47 A;  1LEB A;  4M9S A;  3P9C A;  4IQJ A;  4WCG A;  1GUU A;  2UUZ A;  3CF2 A;  5B3S H;  3RCO A;  3D5L A;  2Y31 A;  3FXK A;  4HSR A;  5C4X J;  2HKX A;  3HL2 A;  2M34 A;  3QYB A;  1MDM B;  1QPI A;  4G12 A;  3EQL F;  5M5X J;  1Q1V A;  3WU1 B;  1MZB A;  3GTG J;  2KRF A;  4Y17 A;  4A69 C;  3DFG A;  4C9Y A;  2PFB A;  1LVK A;  2DTR A;  5KAF C;  5LD2 C;  1WJB A;  2XVC A;  3K2A A;  2G7U A;  2ELJ A;  3RKX A;  3SHF A;  2FBK A;  4ENK A;  1R22 A;  4HNV A;  2DXI A;  2VAS A;  1T2K A;  1A6Q A;  3LAJ A;  2CUZ A;  1IO2 A;  1W7P A;  3QPL A;  3A0H C;  4UVB A;  3KP4 A;  1D1A A;  1U5T A;  3SXY A;  1ACI A;  3KLO A;  2K85 A;  3QYE A;  3ERE D;  2UWM A;  1FMV A;  2E19 A;  2GOM A;  2EIL H;  4OIN F;  1W7P B;  1OCZ H;  4AVP A;  2HZT A;  3DKW A;  2JA7 J;  2DAO A;  1U5T B;  1P4W A;  4AID A;  3K70 C;  3K7A J;  4L9V A;  1BL0 A;  2Y75 A;  4FE4 A;  5FKM A;  3DLL F;  4XOP A;  3I0T A;  4YIR X;  2A6T A;  3K6G A;  1ZEL A;  1Z6R A;  3OYI A;  5BPD A;  2R7F A;  1GVJ A;  4RB3 C;  4QPO A;  3A01 A;  2ZFW A;  4CYD A;  4P55 A;  4I76 A;  2HU9 A;  1JGG A;  1XMX A;  2XAQ A;  1UMQ A;  1ETQ A;  2RQQ A;  1XDS A;  1XTA A;  2L2O A;  3OS1 A;  2LH9 A;  2LG4 A;  5IOZ A;  4IX7 A;  3HXL A;  4E70 A;  2WAD A;  4BE2 A;  1FYM A;  1Y0U A;  5D8K B;  1G4D A;  1QVT A;  3F6O A;  5BOX A;  4BXX J;  2HFH A;  3BPV A;  5GAG J;  3A01 B;  4YEJ A;  3EUH A;  4KN7 X;  1NG6 A;  3HOT A;  2F5F A;  4A3C J;  2VIX A;  2QKL B;  3FWE A;  2AQF A;  1QZE A;  1QA6 A;  4UHT A;  5BPI A;  2XAF A;  1MMG A;  3TBI A;  3M1E A;  3OYE A;  3LSJ A;  4XLA A;  4KIC A;  4UV8 A;  2GQQ A;  3CO6 C;  4A3L J;  4EMS A;  4M9X A;  2P6S A;  3I54 A;  3KE2 A;  3T0Y A;  3DEU A;  1AHD P;  1MSE C;  1VF9 A;  3OY9 A;  1ETV A;  2R7Z J;  2O5R A;  4EJO A;  1T0F C;  3G1M A;  4C3H J;  2XGE A;  1OYY A;  2DOE A;  2ELK A;  3CCR I;  1HCR A;  3FXM A;  1PP8 F;  4JX4 A;  1DQU A;  1FC3 A;  2CH0 A;  3P9I A;  2EIK H;  4M74 A;  1OR7 C;  3L2Q A;  2CV2 A;  5ERI A;  1RIO H;  1OLT A;  3F3X A;  5ILS A;  3MCZ A;  1RET A;  4QPQ A;  3Q3S A;  3ZCO A;  5JHF A;  3HOX J;  2QSG X;  1ZGA A;  3U2R A;  4MEX F;  2CV1 A;  1W0T A;  4B3A A;  2A6E F;  3BWG A;  1J59 A;  5B1A H;  1FOX A;  4A3F J;  1G3S A;  3H35 A;  2MH9 A;  2FOK A;  2Y2Z A;  4N9H A;  5AIQ A;  3J80 K;  1ON2 A;  3JRG A;  4A3G J;  3AG4 H;  4LIU A;  4J00 A;  3HUG A;  2X6W A;  2RVC A;  3LSG A;  5J3L A;  1LFU P;  3KYL A;  4BXF A;  1P9Q C;  2CRG A;  5J4Y A;  5LGU A;  3CCU I;  4G7O F;  3FXO A;  3SDG A;  2P5L C;  4F52 A;  4DBQ A;  4LJZ F;  2BY1 A;  1K83 J;  1MBK A;  2IW5 A;  1XGN A;  1D1C A;  1F43 A;  2VC0 A;  5F04 A;  4BXU A;  2NVU B;  4Y33 A;  2JUC A;  3K10 A;  1QQI A;  1I39 A;  5TGT A;  1H88 C;  3IL2 A;  4WXD A;  4KYW A;  1VND A;  5E18 F;  3S3N A;  4HOB A;  3CCJ I;  5TJJ A;  4EEF G;  1MH3 A;  2OAZ A;  4WF2 A;  4XMY A;  2OD5 A;  3PIP F;  1FLI A;  4ENJ A;  1F4K A;  1KU3 A;  2I5U A;  3VDX A;  3WTU C;  4EM2 A;  2X4H A;  3LA2 A;  2VLA A;  3L09 A;  4PGH A;  1IDZ A;  3HEF A;  1D0Y A;  2PEX A;  1FOY A;  2Y0S A;  4B8X A;  2MC4 A;  4C3J J;  2WWY A;  1JKR C;  2D2W A;  2PG4 A;  3ZMS A;  1PYV A;  4YFK F;  4LLN A;  2R7U A;  1OKR A;  3SFI A;  1TQP A;  3OIQ A;  2CMP A;  3KET A;  3RZD J;  4HW0 A;  4PJJ A;  4K2E A;  2VOD A;  3M07 A;  4CCK A;  4BNC A;  4PJM A;  3H9Q A;  3MMY B;  2O6G E;  3KZZ A;  1L3L A;  2DA6 A;  1OQY A;  1HW2 A;  2M7A A;  3FZV A;  2KT0 A;  3PO3 J;  5CPR B;  1W5T A;  2UZK A;  3CF5 F;  1MBE A;  2BEO A;  3FK6 A;  2O8X A;  3Q0U A;  4RLF A;  5J1U A;  3ZR8 X;  5J4V A;  1FIP A;  3M9A A;  3M1C A;  2BY3 A;  1GVD A;  3OMY A;  3FHZ A;  2J5O A;  3K4M A;  3J81 K;  1XC5 A;  4MO7 A;  3MKL A;  2MG4 A;  1J5Y A;  3GXO A;  2PX9 A;  5E1X A;  2STW A;  1GLN A;  3HOU J;  3TW7 A;  3O3K A;  4D5C A;  4TV7 A;  3VSL A;  3S8P A;  3K4K A;  3CLO A;  2CWE A;  1WJA A;  1ZG3 A;  1HST A;  2E1N A;  1JI8 A;  2QQ9 A;  2WTE A; 
#chains in the Genus database with same CATH homology
 3T5X A;  4U0Y A;  4A6E A;  4ZZD A;  1XSD A;  5DUI A;  4EJW A;  3TDU C;  1I27 A;  1IN5 A;  2XRN A;  5D6E A;  4DQ2 A;  4HZF A;  1QZZ A;  5CLS A;  5IT3 A;  5FGM A;  1MJ9 A;  3WGH A;  4KNY A;  2IA0 A;  2IRF G;  2V1X A;  3HRT A;  1D8K A;  2EWN A;  4I0B A;  2EFW A;  4HX8 A;  4GXO A;  4RB2 C;  1IN6 A;  2MBF A;  4MNU A;  3DV8 A;  2ZBK A;  2AS5 F;  3RJP A;  2MH2 A;  2YR2 A;  4XRF A;  3RIR A;  2QQB A;  1R36 A;  3FXU A;  2IT0 A;  1BIA A;  5FD6 A;  1T6S A;  2XAG A;  3REO A;  5A2Q Z;  3HTS B;  4IRI A;  1REP C;  2QWW A;  4GCV A;  1HW5 A;  1LVA A;  5LHH A;  2Q0O A;  2DU9 A;  1HW1 A;  2P7V B;  1CGP A;  1SD5 A;  3ML6 A;  2EA2 A;  2OU2 A;  3R4K A;  1ULY A;  2O0Y A;  3DXJ F;  2ZME A;  4ZH4 F;  1ZAR A;  3JTH A;  3QP5 A;  2DPU A;  1XSX A;  3GZ6 A;  3P7N A;  1SD7 A;  3IRQ A;  3GLX A;  2FA5 A;  1ZHF A;  1UST A;  3BY6 A;  2ZME B;  1JHF A;  4CDG A;  2VON A;  4ESJ A;  4L9J A;  5FFZ A;  4ENN A;  1IW7 F;  1ZN2 A;  4L5I A;  1FBS A;  3C18 A;  2PN6 A;  1UHW A;  3VOD A;  3L9F A;  5DD4 A;  2EJR A;  1XGS A;  2MA3 A;  1TQI A;  4RGR A;  4GGG A;  3GFJ A;  1XSV A;  2XKP A;  4LGW A;  3ABU A;  4G7H F;  4IVN A;  4ASN A;  1K79 A;  2RDP A;  4BHB A;  2EFQ A;  2XIG A;  4LK1 F;  3ISP A;  3QPT A;  3HSE A;  4WX9 A;  4O6J A;  3BP8 A;  4G9Y A;  2HTJ A;  2OZU A;  1QGP A;  2VBZ A;  2EFN A;  4M6Y A;  4BYY A;  2H94 A;  1O3T A;  3DPL C;  1LDK B;  1KGS A;  5FLX Z;  1U3E M;  1DP7 P;  1EH8 A;  3K1M A;  2NNN A;  5DCF A;  4IPA A;  2UXN A;  1XN7 A;  1I5Z A;  2D45 A;  3VFZ A;  1KYZ A;  5L3G A;  1AWC A;  4HQE A;  3W6K B;  5L3D A;  1J7K A;  1TW3 A;  3T8R A;  1FZP B;  5H6Q A;  5D4R A;  4I2O A;  4AWX B;  3ZN1 A;  3LFK A;  1YG2 A;  3CJN A;  2D1V A;  3HRU A;  1XCB A;  2Z3Y A;  4EV0 A;  2F2E A;  4A12 A;  1HKS A;  1ZRC A;  1I1S A;  1YW9 A;  1HQC A;  1R1V A;  2X0L A;  1WKM A;  3HSF A;  4L9N A;  3C1D A;  2CSO A;  3ULQ B;  4YIF A;  3IWZ A;  4Y13 A;  3QPH A;  1G3Y A;  3BOQ A;  3HHH A;  2DFI A;  2LF7 A;  3HIF A;  1MD0 A;  3KP7 A;  2VOP A;  2HTS A;  2PMH A;  3QOP A;  3F72 A;  4OIP F;  4LLL A;  3VOE A;  3BJA A;  4KIF A;  1QPM A;  4ZZL A;  2IJL A;  2JZY A;  3N97 A;  4NHJ A;  1Z05 A;  4PZJ A;  1T98 A;  5HLG A;  2VT3 A;  2O03 A;  3GW2 A;  3RKY A;  1BI2 A;  3EYI A;  1WRJ A;  1G3W A;  5D8L B;  4U0W A;  1YS7 A;  4UVA A;  2JTV A;  4HF0 A;  3Q5F A;  3CTA A;  2V1D A;  4UV9 A;  2YX4 A;  2NAZ A;  3SZT A;  2CW0 F;  4EJT A;  1VTN C;  2DK5 A;  2LF8 A;  3MAJ A;  4CIC A;  5CVV A;  2E1C A;  2K02 A;  4Q48 A;  2A68 F;  3FM3 A;  3I5U A;  4O5V A;  4FX0 A;  4KMU X;  5EEH A;  1D5V A;  1U8R A;  3COA C;  1R1U A;  4NB5 A;  1FBU A;  1OPC A;  2NYX A;  4LG0 B;  2VN2 A;  3LA3 A;  3JSP A;  1F1Z A;  2K4J A;  3GX4 X;  3ZMD A;  4MQV A;  1QO0 D;  3QAH A;  4PCQ A;  4YII A;  3R6S A;  3VEP A;  3MQ0 A;  1WSU A;  4ZYH A;  5CVI A;  1XGM A;  3RDI A;  3DF8 A;  3L2C A;  2Z99 A;  2QEN A;  2MD5 A;  3JAM K;  4EJU A;  1DPU A;  5JI6 A;  4LB6 B;  3K1P A;  1DDN A;  5HS9 A;  4EGY A;  3B02 A;  3MZY A;  5DD8 A;  5F6F A;  3LQQ A;  3EDP A;  3CO7 C;  2CGP A;  2NNY A;  4F7Z A;  2JT1 A;  1I6X A;  4ON0 A;  5HVQ C;  1P92 A;  4M6X A;  5L3E A;  4U7D A;  4BHC A;  5JVT A;  3DPT A;  2VBY A;  1IRG A;  2HS5 A;  2W24 A;  2BBY A;  3H92 A;  3ZMU A;  5L3F A;  1QBJ A;  3FXR A;  5J6X A;  2L01 A;  4I09 A;  4OIR F;  2Y0M A;  2M5W A;  2UXX A;  3CUO A;  5AON A;  1YLF A;  1FY7 A;  5EEG A;  2F5D A;  2GIV A;  3P9K A;  4HAM A;  2Y48 A;  1EH6 A;  1BC8 C;  2GXG A;  1WI9 A;  4HQM A;  4AIK A;  5D4S A;  4G8X A;  3PQK A;  3WGI A;  1WWX A;  5KVR A;  3KCC A;  5IT9 Z;  2ETH A;  2HDC A;  3VB2 A;  2L4M A;  1O3Q A;  1ONV A;  2KIF A;  3O2P E;  3KP5 A;  1KU7 A;  2C6Y A;  3F21 A;  2F5E A;  1LJ9 A;  3WG9 A;  1B6A A;  5LGN A;  5HOO A;  2PJP A;  3QU6 A;  3V8J A;  5HDG A;  1YIO A;  4A0X A;  2R3S A;  4MTD A;  5ICE A;  4RGS A;  2FU4 A;  3M7G A;  1F5T A;  2LSO A;  1O7L A;  2AXL A;  1FX7 A;  4A0Y A;  4CZZ A;  3HRM A;  5D5U B;  3C7J A;  3L00 A;  3U9G A;  3FMR A;  4GO1 A;  4RAZ A;  3SZP A;  5E17 F;  3GF2 A;  2ZKZ A;  1BC7 C;  5L3B A;  3QRF F;  5BQT A;  1E17 A;  4R79 A;  1BN5 A;  5TRD A;  3PQJ A;  1DPR A;  1XMA A;  4WXC A;  2Z5U A;  4GYI A;  4I98 B;  2WC2 A;  1BI3 A;  2LKP A;  2L54 A;  1S8N A;  3IRR A;  4EM0 B;  1GXP A;  4HF1 A;  1LDD A;  2HQR A;  2BGC A;  2PMU A;  1FSH A;  3V8L A;  2K7L A;  2PI0 A;  3R0A A;  1EV7 A;  2DLL A;  3E3V A;  3JW4 A;  4CO8 A;  1O57 A;  1BI0 A;  3J7A O;  3DP7 A;  4P96 A;  5DV5 A;  1FYK A;  2XV4 S;  4OU0 A;  4U7B A;  2PQ8 A;  2RN7 A;  2MLG A;  2QQA A;  2YPR A;  2RV8 A;  4MQ9 F;  1IN8 A;  3I58 A;  1OMI A;  5HLI A;  3H3U A;  1JHH A;  1TQM A;  2CO5 A;  5H6R A;  1JE8 A;  5LHG A;  4WK8 F;  3WU0 A;  4Y15 A;  1FBQ A;  3S2W A;  1K78 A;  1B9M A;  2E7W A;  2KIU A;  4HX4 A;  1IZ1 A;  5LEJ A;  2FE3 A;  4PGG A;  2W57 A;  2HQN A;  1AOY A;  4Z2Y A;  2GA2 A;  1K78 B;  1IXR C;  1O3S A;  3ZMV A;  3HTU A;  3T8T A;  3V8K A;  1R5H A;  3F22 A;  5FD5 A;  1IF1 A;  3ZMZ A;  4QLC U;  4XLP F;  3GFI A;  3E6D A;  2CFX A;  5E1W A;  3E5X A;  4IXA A;  3R0J A;  1ZRD A;  4IHT A;  2XAS A;  4JBA A;  3TGN A;  2MLK A;  1S6L A;  2ISZ A;  3L7W A;  1YW8 A;  4QWQ A;  2IP2 A;  4P9U A;  2RNJ A;  4IF4 A;  4HX7 A;  1YS6 A;  1S7O A;  3BJO A;  2P5V A;  3GO5 A;  1DUX C;  4OMY A;  2Z9O A;  1OYI A;  2OA4 A;  5ILU A;  2A61 A;  3WTY C;  5HDK A;  4DNC A;  1U6G A;  4RB1 A;  5JFR A;  2LNB A;  4LLG F;  1H0M A;  3FX3 A;  3GYH X;  1J75 A;  1L0O C;  1R7J A;  4OIQ F;  1R23 A;  4U88 A;  5A2Q K;  5KK1 A;  2XGX A;  3BJ6 A;  3GFL A;  3IWF A;  3N4M A;  3KEO A;  3OOP A;  4HLX A;  1IAW A;  4EGZ A;  2W85 A;  1PUE E;  3FXQ A;  4HF2 A;  2FML A;  1ZG5 A;  4FT8 A;  3KLN A;  4LK0 F;  2EFP A;  2J5P A;  3FMQ A;  4LMY A;  1YYV A;  3QU3 A;  1J0R A;  1BBY A;  2XAJ A;  4IRH A;  1D8J A;  1JGS A;  3V7C A;  5K5R A;  3IC7 A;  4MGR A;  3RYR A;  2LDU A;  2QZ8 A;  4KIG A;  3LA7 A;  2HYF A;  2P8T A;  2KJB A;  5HLH A;  4FX4 A;  4RS8 A;  5LLQ A;  4S04 A;  3FMS A;  1KYW A;  2JPC A;  2ZJ2 A;  3E6C C;  1SAX A;  2G9W A;  3WOD F;  4KMF A;  2STT A;  4H0E A;  2CG4 A;  2IPQ X;  1J2X A;  2DPD A;  4ZYG A;  4HDU A;  5DDG A;  2XRO A;  4KDP A;  1YTY A;  4O3M A;  3K1N A;  3EET A;  2M87 A;  1V4R A;  2EA4 A;  3I4P A;  4A2U A;  3R60 A;  4LB5 A;  2KIM A;  3SQN A;  4A0Z A;  5FLX K;  1ZRE A;  4AD9 A;  2XUB A;  3JSO A;  2Z33 A;  4Q4Z F;  1FWZ A;  3KP6 A;  1KA8 A;  3LQR A;  3NRV A;  1LNW A;  4RGU A;  2ISY A;  1B4A A;  1SFX A;  2RC4 A;  1BI1 A;  1PP7 U;  3D0S A;  3IKV A;  4CXF A;  4KN4 X;  2H27 A;  2QVO A;  3WE3 A;  4XSX F;  5FFX A;  3E97 A;  4G6Q A;  5HS7 A;  3F8B A;  1MGT A;  1YFH A;  2FEZ A;  3I71 A;  3RI4 A;  3V7S A;  2ZXJ A;  2EV6 A;  4A5N A;  2V1U A;  2EV0 A;  3LAP A;  4WWC A;  2ADU A;  2ELH A;  3RKW A;  1W4M A;  3CUQ A;  3GWZ A;  2JSC A;  5JHU A;  1LQ1 A;  4NQW A;  4UNO A;  5L3C A;  1FOK A;  2D1H A;  2F5C A;  1BIB A;  5LGT A;  1KU2 A;  3CUQ B;  2P7C B;  2PBI A;  2A6H F;  3WTS C;  4LG0 A;  2XHK A;  1ZLJ A;  3GVA A;  5CVR A;  2HEO A;  3HSR A;  2HYG D;  2EV5 A;  4CHU A;  1IXS B;  3WTW C;  1LB2 A;  2A3S A;  4IRG A;  3I53 A;  1SMT A;  3HYI A;  5DUK A;  4EJV A;  1TBX A;  4HDV A;  2OZ6 A;  2K27 A;  5F64 A;  2FXA A;  2L4A A;  1SD4 A;  3ELK A;  1W5S A;  1R5G A;  4MEY F;  5ICG A;  3NQO A;  3MWM A;  3G3Z A;  4ZYE A;  4UVC A;  5BMZ A;  1UFM A;  3ZPL A;  2M8E A;  2FBH A;  4BH9 A;  3WTX C;  2FSW A;  3KP3 A;  3O6B B;  4I02 A;  2V9V A;  1HKT A;  2E7X A;  3LST A;  5CYV A;  3MZH A;  1F9N A;  3OV8 A;  4HA8 A;  4A6D A;  3MFK A;  1FYL A;  2VT2 A;  2YSR A;  3KP2 A;  3BZ6 A;  3V7R A;  2XKO A;  2Q8K A;  1P6R A;  4UUV A;  5FB2 A;  4P9F A;  4AIH A;  3F8C A;  1XD7 A;  1EH7 A;  1R00 A;  3TO6 A;  1Z6T A;  1V3F A;  2MC3 A;  4ESF A;  4HV5 A;  1R58 A;  3G73 A;  2A69 F;  2DW4 A;  1B59 A;  4XBF A;  3K69 A;  1YO5 C;  2QUF A;  5LBQ A;  1A04 A;  2P5K A;  5FO5 A;  4XLN F;  1HKQ A;  3WTT C;  4ZYD A;  3CDH A;  5K5Q A;  3Q9V A;  3B73 A;  4OOI A;  3ZP5 A;  4R8H A;  2ZCW A;  1FPQ A;  1TW2 A;  5D5X B;  2W84 A;  1I1G A;  5K5O A;  2NS0 A;  4L9T A;  1UCR A;  3W6J B;  4LFU A;  5CJ9 A;  1ZYR F;  2ACJ A;  2FNP A;  1R1T A;  1TNS A;  4IJA A;  5ICF A;  3GFM A;  5HDN A;  3J80 Z;  4GYG A;  2M1B A;  1SFE A;  1H9T A;  3KFW X;  4OIO F;  1MJB A;  3ECH A;  4BHP A;  2EFO A;  2G7H A;  4B09 A;  2IA2 A;  4YFN F;  1G3T A;  1RUN A;  2PLY A;  1P2F A;  1P4X A;  1ZAO A;  2YX7 A;  3ECO A;  4ENM A;  4MTE A;  1FNN A;  1KQ9 A;  5E1Z B;  1B9N A;  5LRS A;  3F8N A;  1FT9 A;  2EB7 A;  1O7F A;  2KJC A;  5BS6 A;  4M9Z A;  1ZLK A;  4HYE A;  4EQQ A;  4BQA A;  1G6N A;  5IT9 K;  1ZRF A;  2ZNZ A;  2GWR A;  2RQP A;  2BYV E;  2HKO A;  3AAF A;  3HRS A;  5CVJ A;  1U78 A;  4L0Z B;  4UXN A;  1S3J A;  2VBW A;  1Z9C A;  1XMK A;  3RPQ A;  3K0L A;  3V4G A;  3TQN A;  4JK1 X;  2ESH A;  5HS8 A;  1O3R A;  1MKM A;  4WXH A;  2DI3 A;  2WV0 A;  2OBP A;  1BM9 A;  5E8G A;  1Z1D A;  3RTR A;  4AIJ A;  3ABT A;  2A07 F;  4S05 A;  4JQF A;  3J81 Z;  1SMY F;  1KQ8 A;  1TLH B;  3IKT A;  1X3U A;  2QM3 A;  5ED4 A;  1SD6 A;  2JPB A;  1T0F A;  5LEK A;  2DBB A;  3I59 A;  1W7P D;  1STZ A;  1OR7 A;  2Q2E A;  1BOA A;  4OMZ A;  3EYY A;  3RYP A;  3I59 B;  2OQG A;  3ZMT A;  2H09 A;  2VE8 A;  2M45 A;  4HLY A;  2VXZ A;  4N9I A;  2ZNY A;  2VC1 A;  1Z91 A;  1RZ4 A;  1S29 A;  1IN7 A;  3E6B A;  5D5W B;  1YQA A;  4KIB A;  4KT5 C;  4KA4 A;  1ZH5 A;  4LD5 A;  2P6T A;  1UB9 A;  1IN4 A;  3DQV C;  4I7H A;  3R61 A;  2FQ3 A;  2DO7 A;  3RPU A;  3E5U A;  3KEQ A;  1JXS A;  1LDJ A;  2L3D A;  4RB0 A;  4G94 A;  4L0Y B;  2B0L A;  3E5Q A;  2QLZ A;  5ICC A;  3BDD A;  3M8E A;  2K86 A;  2DK8 A;  2IA1 A;  3GZ5 A;  1T38 A;  3FM5 A;  4M72 A;  4I0A A;  3SFZ A;  1HBX G;  4N0B A;  1XGO A;  4KFC A;  2RKH A;  2QBY A;  3ZN0 A;  4M73 A;  4G6D A;  4U0V A;  3WTV C;  3F23 A;  2QBY B;  1GXQ A;  4IHS A;  1ZG1 A;  5D6F A;  6PAX A;  2CYY A;  2H6C A;  2V79 A;  4ETS A;  2L02 A;  1K6O A;  3F8F A;  3BRO A;  5LHI A;  3I64 A;  5D5V B;  1SFU A;  2IVM A;  3Q9S A;  3C3W A;  2GAU A;  4PDK A;  5E8I A;  2DQR A;  1BJA A;  3T1B A;  2VOO A;  4CGZ A;  1ZGJ A;  5DYM A;  3H3Z A;  5ILV A;  4EM1 A;  4I01 A;  3BPX A;  3HHG A;  3TDZ C;  1QNT A;  3GEZ A;  2FMY A;  5AIP A;  2O61 A;  2NRA C;  3WGG A;  2JRT A;  1XCV A;  1D3Y A;  2DQL A;  3GUD A;  4BAY A;  1FSE A;  3QP6 A;  1U2W A;  1TTY A;  1HSJ A;  1IXC A;  4Q5S F;  3PFI A;  1RI7 A;  4M71 A;  5JR3 A;  3WE2 A;  1USS A;  2YU3 A;  4MHG A;  2FNA A;  2COM A;  1C0W A;  1E2X A;  2OQR A;  2GA1 A;  2HR3 A;  4D0P A;  2XAH A;  1ON1 A;  2FF4 A;  1LEA A;  2QYO A;  4L5J A;  4A5M A;  1RUO A;  2GXB A;  4HBL A;  2HOE A;  1RNL A;  1IRF A;  5DEQ A;  1FP2 A;  2H6B A;  3K9T A;  3CUQ C;  2P4W A;  3U1D A;  3NEU A;  1MJA A;  1ODD A;  2K4B A;  2VE9 A;  1P4A A;  3F6V A;  2V6C A;  1PDN C;  5LRR A;  1UHM A;  5J8C A;  1CF7 A;  3F8M A;  4ESB A;  1WQ2 A;  1KQ0 A;  2EK5 A;  1CF7 B;  2RGV A;  2BV6 A;  2O3F A;  2HGC A;  2W25 A;  2R7D A;  4RGX A;  5K1Y A;  4XSZ F;  2DT5 A;  2TDX A;  3LWF A;  2HWV A;  1B1B A;  4RAY A;  1Z7U A;  5DCM A;  2CQK A;  1TNT A;  2M30 A;  1K7A A;  3TO9 A;  4G7Z F;  1GHC A;  2FBI A;  1Q1H A;  5F1R A;  3K2Z A;  2ZO4 A;  5CVU A;  2ESN A;  3MEX A;  3WTZ A;  5DCM B;  2KKO A;  3HOS A;  4L18 B;  4HV6 A;  3TOA A;  2GZW A;  3TO7 A;  2VBX A;  4EVI A;  4YG2 F;  4FHT A;  2BE5 F;  1U5T C;  1HXD A;  1J9I A;  1OYW A;  1YW7 A;  5E20 A;  4YFX F;  1QZY A;  3IHU A;  1NHA A;  2FRH A;  3ROU A;  3JTG A;  1T39 A;  3E6M A;  1KU9 A;  1XB4 A;  4P5O A;  3M8F A;  3ZQ7 A;  1FP1 D;  3FF5 A;  3JAM Z;  2A5Y B;  4KUM A;  1S7A A;  3KZY A;  3TKY A;  1MDM A;  1XDU A;  5J8F A;  5H20 A;  3TOB A;  4R1H A;  1IUY A;  1H9G A;  4Q47 A;  1LEB A;  4M9S A;  3P9C A;  4WCG A;  3D5L A;  2HKX A;  1MDM B;  3EQL F;  3WU1 B;  1MZB A;  2KRF A;  4Y17 A;  3DFG A;  2PFB A;  2DTR A;  2XVC A;  2G7U A;  3RKX A;  3SHF A;  2FBK A;  4ENK A;  1R22 A;  1T2K A;  3LAJ A;  1W7P A;  4UVB A;  3KP4 A;  1U5T A;  3SXY A;  3KLO A;  3ERE D;  2UWM A;  4OIN F;  1W7P B;  4AVP A;  2HZT A;  3DKW A;  2DAO A;  1U5T B;  1P4W A;  4L9V A;  2Y75 A;  3I0T A;  1Z6R A;  5BPD A;  2R7F A;  1GVJ A;  4RB3 C;  2ZFW A;  4CYD A;  4P55 A;  2XAQ A;  1XDS A;  4E70 A;  1FYM A;  1Y0U A;  5D8K B;  1G4D A;  3F6O A;  5BOX A;  2HFH A;  3BPV A;  3EUH A;  4KN7 X;  3HOT A;  2F5F A;  3FWE A;  4UHT A;  5BPI A;  2XAF A;  3M1E A;  4KIC A;  4UV8 A;  2GQQ A;  3CO6 C;  4EMS A;  4M9X A;  2P6S A;  3I54 A;  3KE2 A;  3T0Y A;  3DEU A;  4EJO A;  1OYY A;  1PP8 F;  1FC3 A;  3P9I A;  4M74 A;  5ERI A;  1RIO H;  3F3X A;  5ILS A;  3MCZ A;  1ZGA A;  3U2R A;  4MEX F;  2A6E F;  3BWG A;  1J59 A;  1G3S A;  2MH9 A;  2FOK A;  4N9H A;  5AIQ A;  3J80 K;  1ON2 A;  3HUG A;  2RVC A;  5LGU A;  4G7O F;  2P5L C;  4LJZ F;  2IW5 A;  1XGN A;  2VC0 A;  4BXU A;  1QQI A;  3IL2 A;  4WXD A;  4KYW A;  5E18 F;  4HOB A;  5TJJ A;  2OAZ A;  4WF2 A;  2OD5 A;  1FLI A;  4ENJ A;  1F4K A;  1KU3 A;  3WTU C;  4EM2 A;  2X4H A;  3LA2 A;  3L09 A;  4PGH A;  2PEX A;  4B8X A;  2WWY A;  2D2W A;  2PG4 A;  3ZMS A;  4YFK F;  4LLN A;  1OKR A;  1TQP A;  3KET A;  4HW0 A;  4K2E A;  2VOD A;  4BNC A;  2O6G E;  3KZZ A;  1L3L A;  1HW2 A;  3FZV A;  1W5T A;  2UZK A;  2BEO A;  2O8X A;  3M9A A;  3FHZ A;  2J5O A;  3J81 K;  3GXO A;  1J5Y A;  5E1X A;  2STW A;  3O3K A;  4TV7 A;  2CWE A;  3CLO A;  1ZG3 A;  2E1N A;  1HST A;  2QQ9 A;  2WTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...