2FQDA

Crystal structures of e. coli laccase cueo under different copper binding situations
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
487
structure length
464
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of E. coli laccase CueO at different copper concentrations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 130
structure length 464
sequence length 487
ec nomenclature ec 1.-.-.-:
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqdA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqdA03
2CJ3A 1MG2C 2VMJA 3MBWB 4DPCX 1ASOA 1I53A 1XMEB 4DP0X 2BZ7A 1JVLA 3TA4D 1FFTB 3FT0A 1E5ZA 2QDWA 4RH4A 3GDCA 3IN0A 4BDVB 2Y69B 4K9JA 2AZUA 1IKOP 3SBRA 2YXWA 4YSRA 1L9SA 4GY4A 4AKOA 1A4CA 5B1KA 1OCRB 4BK5C 1CYXA 4YSSA 2UXGA 2I7SA 2IH8A 1M9WA 3OD3A 1J9SA 2PPDA 3PAUA 4E9XA 1OF0A 2XXGA 2HRHA 1FWXA 1BYOA 4AI7A 1JVOA 1WS8A 4DP7X 4GP8B 1QHQA 4W9ZA 5D4JA 2CAKA 3UABA 3OMIB 1JZEA 1UATA 3QPKA 2XWZA 4KO5A 4KO9A 3ABMB 3FSWA 1ASPA 1HAUA 3FSAA 4KOBA 4AZUA 3ZDWA 3FU7B 1QLEB 2OCCB 3QJUB 3X1BA 4KNTA 3FU8A 2IDQA 3PXLA 2BO0A 2IDFA 3PLYA 1JOIA 3EH3B 2YAPA 5I6PA 3AW5A 5B1BB 1BXAA 2HXAA 1X9RA 1AZBA 4A2GA 3UGEA 5I6OA 1XB8A 4P5SA 3DIVA 3S3BB 5B7FA 1GY2A 1NPNA 3PCYA 2P80D 1WA1X 3FSZA 2PP8A 1NIFA 1OCZB 1W6WA 3NSCA 1ID2A 2I7OA 1EZLA 2FQGA 2H47C 1L9PA 5B1AB 1PZBA 2IWKA 4E9SA 2XUWA 5IY5B 1W6LA 1TEFA 1JXGA 2DYRB 1BXVA 1J5DA 2FQFA 3TBBA 1NWOA 4G72B 4A66A 1CUOA 2Q5BA 5F7BA 1KDIA 2J56A 1BQRA 1RZPA 2WSDA 1JERA 4QLWA 4M3HA 1NIBA 1V55B 2Q9OA 4MFHA 8PAZA 2QPDB 4BWTA 2GBAA 4Q8BA 3H4FA 2FNWA 2FQDA 5TK2A 1NINA 4G71B 2GSMB 2WO3B 1PZCA 2BP8A 4W1TA 1J5CA 1NDTA 3QJVB 1JZHA 1RZQA 1NIEA 2PPEA 5I5MA 3IBOA 2RACA 3UAEA 5I6MA 3MX0B 4YL4A 2AFNA 3GYRA 2X87A 2J5WA 4HCGA 4G7QB 3CVCA 2FJSA 2GIMA 3GXUB 5E9NA 1AG0A 1J9QA 5D4HA 4YVNA 2GC7C 1MG3C 3X1FA 3T6ZA 2FWLB 4FAAB 3WKQA 3AG1B 2ZXWB 4A67A 4N8UA 1E65A 3OQRA 1KDJA 2DYSB 2YARA 5I28A 2VSKB 2BWDA 1X9UA 2AVFA 5I5JA 2IDTA 4F2FA 4PAZA 1EHKB 1A4BA 2YAOA 1PLBA 1N68A 1F56A 4YSPA 3NSFA 1KGYE 1AZCA 4A2HA 4BWWA 4UANA 3N2JA 3NJFA 1ET7A 1QNIA 4HIPA 3UAAA 3ZIYA 5I6KA 5ANHA 2BP8B 2BWIA 4YSTA 2PPAA 3T71A 3SBQA 1SFHA 4GXFA 3NP4A 1L9QA 3ZX1A 4TXVB 4A2DA 4N4YB 4ZK8A 5B1JC 3ABKB 4AKQA 5I5IA 3ABLB 3SBPA 4DPBX 5AKRA 1FA4A 3NJMA 4A2FA 1GR7A 3NP3A 4KO6A 1ET8A 2W88A 1AS8A 3U25A 3AZUA 1ZIBA 2QT6A 3NJGA 4UAHA 2GB2A 4E9QA 3RYMA 1W8EA 1ZDSA 2UXVA 4AKPA 2EILB 2GI0A 3QQXA 1L9OA 2E86A 2VN3A 1JXFA 1KCBA 1ZDQA 3S8GB 1JZGA 2EINB 3ZBMA 4DP2X 4DP5X 3NJHA 4JKNA 3G5WA 1OOWA 3HB3B 2PLTA 3FSVA 4G70B 2BZCA 2FTAA 2AZAA 3NJLA 3OMAB 4HZ1A 4JHVA 2GHZA 6PCYA 2HX9A 1MZZA 2LLNA 2N0MA 3D12B 4GP5B 4UF7C 3DKHA 4HHGA 2B3IA 3CVDA 1ZPUA 2UX6A 3WIAA 2BP0A 3ERXA 4YSDA 2JKWA 3DTUB 1ET5A 4HCFA 2QDVA 3X1EA 5AZUA 2UX7A 3QJTB 1SDDA 3FYEB 1HFUA 2XYBA 1NIAA 2PCFA 1AZUA 1L9TA 3NYKA 1CYWA 1GSKA 3T6VA 1GS7A 2FQEA 1MDAA 1OCOB 2AANA 1AIZA 1A4AA 3N55A 2ZWNA 4A2EA 4Q89A 3EF4A 2MTAA 3UADA 3HEIB 1RCYA 1TEGA 2DWSA 2R7EA 5F7AA 4BXSV 1SHXA 1VLXA 4DP4X 2FT6A 1T5KA 2TSBA 3EH4B 1DZ0A 2YQBA 3ASOB 1YLBB 4DP8X 4KNUA 1NTDA 3S3DB 2HX8A 5B7EA 2J57A 2PP9A 1GS6X 3FS9A 1PAZA 5B7MA 1KBWA 1KCWA 4NB7A 1TU2A 1SHWA 2BW4A 2XX0A 3H4HA 3TASA 2UXFA 3X2QB 2VW4A 3EHBB 1WS7A 1AZRA 1GW0A 2VM4A 1M57B 1N70A 1PCSA 3CVBA 4HAKA 3CDZA 4L0PB 2XX1A 3PPSA 2XXFA 1BAWA 4HHWA 1ILUA 2P80A 2YAQA 2DV6A 1SNRA 1XB3A 2QPEB 1MZYA 1AANA 1E5YA 4YSAA 1AR1B 2IAAC 3T6WA 1GY1A 2VSMB 4PCYA 2HRGA 4BDVA 3PAVA 5AFAA 1JZFA 3KW8A 3IE9A 2I85A 2YXVA 4DP6X 3FU9A 5EHFA 1WA0X 2OJ1A 3QJQB 1NICA 1PNDA 2NRDA 2OV0A 1ASQA 1E30A 1PZAA 3FQYA 4JHUA 1ILSA 2XLLA 1AACA 2TSAA 2XVBA 3NSYA 4KNSA 2IWEA 1SF3A 3EH5B 3AG4B 1BEXA 1TKWA 2J55A 3C75A 1IBYA 2B08A 4KO7A 4DP1X 1AG6A 1AS6A 1KV7A 1BQKA 3FU7A 3ABGA 4G7RB 4P5RA 1JZIA 1NWPA 4QKTA 2GC4C 3WKPA 5FC9A 1OE2A 3BQVA 2JXMA 1IBZA 2Y1AA 1BYPA 4YSOA 2PPFA 2YAMA 3KW7A 4FA7B 2XV2A 4X4KA 2PCYA 1AAJA 2HX7A 3NJNA 2CBPA 4CSPA 3WG7B 1KBVA 3OMNB 5B1JA 4CSZA 4YSUA 3IEAA 3L45A 2IWFA 2W8CA 2ZOOA 3IN2A 9PCYA 1A3ZA 2DY2A 4NERA 1ZIAA 6PAZA 2ZONA 3S3CB 3WNJA 2EIMB 3NT0A 1URIA 5I26A 4DP9X 1GYCA 4ENZA 4GP4B 1IC0A 1OE3A 2IH9A 1SFDA 3T6XA 4A68A 4DPAX 1BXUA 2BW5A 5PAZA 2A3TA 1B3IA 4HCIA 1JZJA 5TK4A 3X1NA 3ASNB 3H56A 4EF3A 1CURA 3OM3B 1SJMA 1JXDA 2VM3A 1AS7A 1ZV2A 3X1GA 1A65A 4E9VA 4NAJA 1GS8A 1PY0A 2XV3A 2CALA 1PMYA 1ETJA 2CUAA 3BVDB 3QJRB 1HAWA 3WNIA 5I6NA 3TBCA 4E9RA 2YAEA 2MRYA 4YSCA 1WA2X 1WAEA 3FYIB 4YVUA 2JFCA 1V10A 1ADWA 3CZUB 3JT2A 4E9WA 3T9WA 2YAFA 2XV0A 1RKRA 2H5UA 3NJKA 4E9YA 2BHFA 1J9TA 2BP0B 1CC3A 2HLEB 3NJJA 2VW7A 3WI9A 1SDDB 2XU9A 1V54B 4KOCA 3JTBA 4YSQA 2DWTA 1OV8A 1PLCA 3S8FB 1NZRA 3UACA 1IUZA 2PP7A 3SQRA 3V9EA 3PAZA 1R1CA 1OE1A 3AG3B 4WKXA 1PF3A 2EIKB 3NSDA 2PPCA 3TU6A 5A7EA 1PNCA 2R7EB 2HZHA 1E67A 1L9RA 4F2EA 1AZNA 3FPXA 1KYAA 4M4RB 2X88A 3FQ2A 1BQ5A 4G7SB 2UXTA 3CG8A 2YAHA 4BXVA 2EIJB 1OCCB 1M56B 1NPJA 1A8ZA 7PAZA 1DYZA 2H3XC 2WO2B 2IDUA 4AX3A 4HALA 3FPYA 5I6LA 2VW6A 1AOZA 1NIDA 3V9CA 3FQ1A 1XB6A 1AQ8A 3AY2A 1PLAA 7PCYA 3AG2B 1J9RA 1SF5A 5B3SB 5PCYA 4BWUA 4E9TA 4YSEA 4F7KA 3NJIA 5D4IA 2CCWA 4WTQA 2IDSA 3QJSB 2FT8A 4GYBA 5LDUA 2FT7A 3CDZB
chains in the Genus database with same CATH superfamily
1EJOH 3DX9B 5A2FA 4P06A 3K4DA 1TQVA 1I53A 2VH5H 1MFNA 5H35B 2H9GA 3VM7A 3WYRA 3Q05A 3DETD 4ZUWA 1UCBH 3SDCB 3L2MA 3GSRB 3II2A 3RTQC 3O4LE 3LEVL 2UZXB 5I8OH 4JO5A 3L8QA 1YMMA 3FQNB 4DUXA 4AT6B 5HDQH 1LLAA 2H3NB 2IBBA 2NSXA 2IADB 4J5VA 1ZV9A 3IPFA 2NZ1A 1NGXB 4AKOA 3MHZA 4OLZL 2WCPA 2NY1C 4BK5C 2Y2WA 4JQVC 4D9RD 5K9QG 2CA3A 3I3DA 1XT5A 2HRHA 4JDEB 3AQYA 2HA1A 4DP7X 1V05A 5EOQL 2H6OA 3UTTD 2ZX6A 1QHOA 5JDSA 1TQSA 4EI0A 1CN4A 2VXQH 1AGDA 1EO8L 1GOGA 3QCTH 3WELA 1O9VA 4YWGL 3VXUB 2XWZA 3DETC 1IAII 4G5ZH 3SGEI 3DRQB 1H0DB 2XTJD 1KEGL 1AGBA 5CJQL 3O3DB 4NQSB 1OIOA 5HDWA 3AB0C 3VFTA 8FABB 3WTXA 1S9KC 2WBXA 2VWEC 1Z5HA 3HS8A 5MP6H 2NOYA 1LEKB 4GUCA 5SX4I 5F70A 1TZHB 1W72B 1AKPA 4HPHA 2NUTA 5IV2A 5IREA 4NUGH 1F2XK 4L9LB 4N2CA 5F2FA 3S0PA 5AVZB 2OAAA 5CM1A 1E4XL 2HJFB 1KJ2L 1OM3L 2EVHA 2WSKA 2E6QA 3QCVL 3B7SA 3DX7B 3ZUCA 1S7RA 2YQGA 1U8LB 2JCWA 4PJDE 1CK0L 1L0XA 4GO9A 5LXVA 2UUDH 2CDGB 1VZGA 5JOFA 3S97C 1H5BC 1EAQA 5HHVH 4YK4B 4FC3E 2AJSH 4TUKL 3EW3B 2EO9A 4A1RA 4PRHE 4X0KA 2ZAIA 4AV5A 4W9GC 1ZLWH 2NY4B 4E9SA 5IY5B 4W70A 5F7KC 5BCAA 4DOHE 2MCMA 5C97A 2X0VA 2IG2L 1WFMA 1D7CA 3UTTA 1IM9D 2N7SA 1S4IA 2VLKE 1KC5L 3HC0B 5FKPA 1BQRA 3WJMA 2R69H 5AOKA 5JUEH 5CJOL 2BVPA 2ID5A 3Q0HA 1FL6B 4YFLF 1M7DB 5DD1H 1YEGL 2DKUA 4WI8A 1XGRA 2D3LA 4YDLC 2FQDA 2XSKA 1TZGH 5EA0L 1SY6A 3TNMB 2WW8A 2BP8A 3WO4B 4F80A 2OTWA 4WK4B 3SO3B 4PJHB 5DJYB 1QTPA 1ZGLB 3HZVA 3QDJD 5IVZB 4KKCD 4G8GE 3GYRA 4QRQB 4FMKA 2ZYHA 4M1DH 4JZJB 3AWGA 2FJSA 4XVSL 1ROCA 1C1EL 5E1IA 5D4HA 4QJ5B 1KTDB 2E0PA 2B16A 2EAEA 1KTLB 1UACH 5K9OA 3ZDZE 2R4RH 3QDHA 4JN2A 3TPKA 3LD8C 4P46D 2PWDA 2QSCH 5ESQB 5JPNB 4ZS6C 1E65A 2VE6A 3LZNA 4LVNB 4HPYL 4MCZB 4FG6D 4GQ9L 1RERA 3PQYA 5J1SC 5ID1B 4GRWB 5A6LA 3VWKA 5IMOB 1EHKB 2MPAL 1VFAA 5K9JH 1AHWA 3O6FA 3IE4A 3MV8A 1ZD6A 4PR5B 1IM9A 4BWWA 4XNQA 3DXAB 4PYHA 3SYOA 2X1WL 4LSSL 1RUPH 4KKCC 3IS1X 1MKFA 3I6SA 4DT2A 1R3HB 3ISYA 1SFHA 2JTYA 2VERA 2WGNB 3MLZL 4NRYA 2FBRA 3M1OA 4AKQA 3K0WA 4K3HA 2WZPD 4DEPB 1O0VA 1R46A 3BEWB 2X4SA 3ABLB 3FRUB 4YDMA 2K6WA 3SBPA 1J5HA 3FQUB 5AKRA 1KPVA 5FUCC 2BXYA 1GR7A 3CWGA 1N2RA 3DGGA 4HKZA 5MEOB 1P0SE 2Y6SD 3A24A 3F62A 4FHBD 4LL1A 3ULVH 4FG6C 5I23A 2Q76A 4E9QA 1KXVC 4YUEH 1CO1A 2EILB 5ISZA 1OGTB 3TBSA 2CU9A 5L0QB 1AYRA 3L5WB 4JQIA 4WU5A 4W81A 5KJRL 3KPRD 5AOIA 3LZPA 2WZAA 4WI4A 5JHDD 2VDPH 4F92B 4B9JA 1DANT 3OAUH 5IUCA 4P46A 3VRIB 4IBZA 3KYNA 4S1SH 4W4OC 3VSVA 4G70B 3TN0D 1JZDC 1M2VB 4JHVA 4LQFH 2QV4A 2A6JA 2ESVA 5JQ6L 2HX9A 1BQHA 1PKQE 1U6AH 3MLUH 3D12B 4HGMA 2OMVB 1VSCA 2XG5B 1HXYB 4RZKA 4APQB 2XI9A 1AQKL 5INDA 3QWOA 2GBVA 4ERSL 1IM3D 4KITB 1ADQL 3LXAA 2VN5A 2Y6SC 3ZYOA 5GGRB 1KBBA 2AW2A 2PUQT 1KJ3H 5GPRA 4PN6A 4FADA 3G3LA 1WJ3A 5FYJE 3QUHA 1P7QD 1AJ7H 5T3XH 1FBIL 5E08H 1DBBH 1K5NB 2KC0A 3AFLA 1O7VA 1GSKA 1GGTA 4JCMA 1JGEA 3I6GB 3TIDB 1HHJA 4Z0BH 3LKNA 3WY3A 3RB7A 1ZY9A 1USQA 1UTDA 2YQ3A 4L3ED 3MYZA 1XCQB 3IF1A 4WJG3 3UADA 5E6SB 3TURA 1T1YB 2DWSA 3AMLA 1A5FL 3R19A 1OTUC 1NUNB 3HI5L 4H2CA 1JP5A 4HIJA 3BP5B 4N2IA 3UTZB 3VD5A 5I1LB 3BDBA 2OSWA 2Z35A 4AH2A 3KE0A 1UXWB 5E8DL 3BZDA 3KPRA 2ZCKL 4HEPG 5A2KH 2JF1A 3L7EA 1CVSC 1KBGH 4R4FH 4WFHE 5AVRB 3C8KB 2XXMB 5DJ0B 1W91A 1Q0YL 3TN0A 4N86A 4IDLA 2X6BA 1NM9A 1JV2B 3DX6B 2XX0A 2PXYD 2CMRL 3O2VH 2V5YA 5DDHA 3H3BC 2GJPA 2UXFA 3QNZB 2VLME 4B0MB 3BEVB 5EBLB 2YPVH 1LTXA 3ZTCC 2D7QA 4PW4A 4HIIB 2CK2A 4MZRA 3VD7A 3NDYE 2AP2A 3GIVB 3GI8L 4WI3A 4JPKH 5KSAC 2V2TA 2J1ZA 2BSTA 2N7BA 3MRMB 4DN4H 2KZ1B 3DTXA 3WJLA 4LSUL 3NTCL 2DM3A 4NFCA 4PQXA 1AR1B 1A3LL 3VGAC 4A2MA 5LVEA 2H1PH 4AEHH 1QSFE 1A1NA 4DAGH 1AP2A 4NKMB 4PJ5B 3QH3B 5E6ZA 1XF2B 4R96B 1UD6A 5L4IA 1HQ4A 4ZAKB 3NCEB 3RQ3A 4RFNB 5KSBB 1E4WH 1M7IB 4ACTA 5HYFA 1HJBC 3IE9A 1Z6JT 1QKZH 4G6AC 2DLGA 5JHBA 3NG5A 5KEZA 2DLIA 2HCZX 3HVDA 4FLQA 1E6JH 1J5IA 2A6KA 1P4IL 3LN4B 2NRDA 5SWZB 1OAJA 1C12B 2AQ1A 2JTDA 1EEQA 2NNFA 2XPZA 2EE9A 2WP3O 5DEGB 1EDHA 4X5XB 3R8QA 2XLLA 3TBYB 1U93B 3H7LA 1ITCA 1TMQA 5E8EA 2CR6A 2PXYA 3O3EB 3C9NA 5IZ7A 4M93C 5I66B 1B0RA 5FC9A 4BH7A 1YYCA 5K5YA 4ZFOB 1QR1B 3LMJL 1JHLH 5DJDA 1SVCP 5F88A 4M29A 2PWFA 2CDFB 4OCWL 3WDHA 3BW9B 4IHOB 5GGSY 4XN7A 4UM9A 3E6FA 2KDGA 3P3RA 1NLDL 3I50L 3HNTH 3AS1A 3X14A 1FAKT 4WENB 2W9EL 4JO3H 1LP9B 4DGIL 3LKRA 4TPRH 4GAAA 4HQQL 1EHXA 3SPVB 3T8MA 3DK2A 4MQXD 4FQXB 1ZHBA 4WQOA 3NFSH 3W0WE 1QA9B 2EC9U 3BDYL 2R1WB 4PREA 5DYOB 3SGKA 4DPAX 1KN2H 2GTWB 4XBMA 3FQRB 1MLCB 2VXTH 3CSGA 1HYSC 4EDXB 2CKNA 4XCYB 3BZEB 4X6CF 2QZQA 1FC2D 1HEZA 3QDGD 1F58H 2X38A 3D4ZA 4JRXA 1SXNA 3DNKA 1A65A 1BFVH 1E5UI 3KBEA 4EPSA 3VO0A 3SJVE 2W94A 3FBKA 4NQDE 1BYNA 1HAWA 1F8TH 1PAMA 2Y5EA 3NJXA 1EQWA 5EBGA 4E9RA 1VFBA 3FT2A 1H9DA 3GNML 4YVUA 1V10A 4XMVA 4HS8L 4OJFL 1SYVA 3D8MA 2VR5A 1J1OH 5EU7E 3WL9A 5E6IB 1K2DA 1SPDA 4YHML 5JHAA 3B2VL 1MIML 4UNTA 2ERJC 3MRGB 4OJAA 1YYML 1V3JA 3D2UB 1CLOH 4Z3EA 4IU3B 2FO4A 1D5BA 3DPBB 4O4YL 2JLPA 4HJJH 1EJ6A 3EOAA 3WS3B 4OY9A 3UACA 1U91A 3MRBB 3VU2A 3WFDH 1TTUA 4B53A 5IIEA 2BSED 3GMNA 1F97A 3PAZA 4F3FA 4NM8L 4BCZA 1XFPA 2BNQE 3D51A 5CILL 1UQSB 2NR6A 2J1KA 3BVUA 2KZWA 2VDOL 2PPCA 3P4LA 3LQAH 3X3FL 2EDYA 1E67A 2XRAH 3BVWA 3OAZK 4IIQB 3SCMA 1NLBL 1CFBA 4BINA 3FPXA 2VDOB 3NSJA 1JPFA 3VD0A 2ZQKA 3QHFH 2AXFB 2X88A 4LEXL 5IESL 2DBLL 5DK3A 2C9XA 4MTMA 1I1RA 4JHZA 2WXNA 4KPHL 4OFYD 3V0VA 2D7TL 4BXVA 5JDJA 3AT0A 3GSNA 3I2CL 3MV9B 1ED3B 4BV1A 4Y89A 1SEQL 3TO2A 1EAJA 1X5AA 5TDPA 3BGFB 1OAQL 1FL5A 2PYFA 2Z31B 5IKCB 4LHUB 3KJ4B 4JZOA 4XMKH 4KV5F 3H3PH 5T5NG 3QCUH 5AENA 2HWZL 3CLFH 4K3DL 4AL8C 3AG2B 4GW5A 3N44B 2X4PA 3L2LA 3UEZA 4N8CH 1KIUB 1FVEB 3GPEA 3VU1A 1I1FA 3APMA 5C2UB 2BY3A 4M7JH 1WD9A 5T1MA 3PHOB 3BZFA 1YAZA 4JFFA 4WKZA 2UZIH 3RL1A 4UTBA 5L2JB 4DVBB 5I1KL 3QUMH 4X9GA 2BSEA 3SKOA 3VJ6B 3PJSB 1XD0A 2VZSA 5HGAA 4URKA 1I1YA 3FSOA 3ARDB 1RPUA 2K7QA 4RWYH 1NSNL 4IKNA 3EHBD 2Q8BL 2Y69B 4K9JA 5G5DB 3RB5A 1R5IA 1NFDE 5JLZA 1R17A 3WY2A 3P9LA 5EUOE 5TE4H 2OZ4A 3WE6A 4B95C 2JCCB 3LIZL 4HLZG 2FBJH 4P9MH 4KJYA 4TQHA 3H53A 4EAEA 1HZKA 4TUOA 1DBJH 3NIGB 3QEUB 3C09B 3QXTA 2NXYB 2VDKL 4NFBA 1J10A 1J9SA 3BGMA 4N1CA 4NC1E 5IJKC 1AQHA 1C5BL 1BYOA 7TAAA 2CKBB 4EDWL 3ZDXB 5T33L 3QAQA 3UABA 2VMEA 1I4FA 4PTTB 4M56A 2P24B 2YHGA 1X5KA 4JFDB 5AL0A 4Z7WA 1CGWA 4PW3A 5D7LD 5DGRA 5ELIA 1CFSA 1MFEH 3BPLC 4XO4A 5C0AB 4IOSA 1BFOB 4ALAL 5BW7C 5IWLA 4ZMPA 4FFYA 4NRZB 2Y1YA 1QLEB 3JV0A 3E8UL 5F1IA 3O6LL 4G6FB 1WWAX 3T0ED 1U8MB 3WIFB 4Z7OB 4TUUA 2B1AH 3WIIL 2GT9A 2A77H 3O2DL 4WTZG 3WAKA 5KYXA 4PRDA 1DBMH 3K80A 1AXTH 1TITA 5CSZB 3ORJA 4M61A 3TT3L 1S3KH 1ACYH 2GJZB 5DQDH 3VFPB 2FX7H 1O9ZA 1N59A 3U36B 3LN9A 4N5UA 4OF3A 3L1OH 3MR9A 3ZR6A 2Q3ZA 2DLHA 5CLWA 5HVHB 2OK0L 3VFGL 4CN6A 1E9PA 3BAEL 1AFVL 1MQKH 1IT9H 1WA1X 3T2OA 1BLNB 4XP1L 5DSCB 3ZTJG 4IMLA 3MLSL 3MYJA 9CGTA 3DO3A 3CK0H 3U4BH 3L3OA 4D0DB 3Q5YA 2ADGA 2OMBA 3P0VH 4ZQKA 4P23A 3T0EC 3GBLA 1RPQA 4X7SL 5MI0C 1DQIA 4OIIL 3FO9A 4DKFH 1AQDB 2F1AA 2LFGA 2BCKB 2EDRA 4ACPA 2UWEB 3C5SA 5I71B 4UM8A 4HFWA 2WSDA 1JERA 3BD3A 4HD5A 5HHMB 3DX8B 4O2FA 5ALBL 3UPCA 1OGSA 3MOQA 5C7ZA 5C9KA 1BZ8A 1CTMA 3FUFA 3K46A 4BWTA 3U4EA 4PJAF 1X7SA 3GLZA 3F65A 3IU4L 4OGAD 5KS9F 2W9DH 4WUUD 4MXWH 3ET9F 3KWUA 2GJ6D 4AQAA 5E99L 2QKIC 4LASL 4G6JL 5CGTA 4H44C 5JHLA 2GTQA 4N26A 4G42A 5JQIB 2FLRT 5I5RA 3IGAA 2XQBH 3CNKA 3B5HA 1IJ9A 3QNXB 1TNNA 1IGJA 5DD6A 4BKLB 2KUTA 4IJ3C 1YUHA 2D0GA 1UKTA 2J5WA 3QUXC 3DSNB 1MFDL 2Q20A 3NZHH 3O3AB 5JXED 1P5VA 1Y7VA 3MGAA 5EOCJ 4YVNA 1MG3C 1SDYA 3WGUB 3H54A 2AV7A 4EVNB 4A67A 5TDOB 2HRLA 3QEGL 3MFFA 1PZDA 5I9QB 4QRTA 1PCXA 4LLYA 3D1MC 3RVXD 2RCSL 4OGAC 4NHCL 2A38A 4PD4J 4QRSB 4PLKD 1C9SA 3PABA 3V0JA 2R1YA 1MHPL 3GMMB 2YFNA 5FOBA 2BVQB 1QUNB 1Z5YD 2Q0ZX 5DWUL 4YR6A 3EO1A 2RQEA 4ZFFA 5BUGA 1TZIB 4O5LH 4UQ2B 4ZZKA 1ET7A 1QNIA 1XL4A 2XT1B 4LIQH 3UFIA 1AO7B 4Z95H 1NMBL 3GBDA 1UZ8A 2EYSB 5JXEC 3L3KB 3KXFE 5EZLA 4ZW8A 3DURB 5IEKA 4BYHA 3IAGC 4WUUA 3JWDH 2F54E 5B1JC 3FT1A 5FYLL 2PCPB 2FJGA 1RIUH 1WTGT 4OCXL 4F8QA 4D9QD 3BH9A 7FABL 3QIWD 2B59A 2X6CA 2NPLX 4WW2A 1XZ0A 5IVXF 4PLKC 1U8CA 5IHUL 1SOKA 2XVKA 3G04A 1P7BA 3QQXA 4WU7A 2IANA 1RZJL 5EF1A 1II4E 4P57A 1ZTXH 1OOWA 1HNYA 1L5GB 5D6CB 1PKOA 2CSPA 4HAFA 1Q0XH 5BUAA 4H40A 2XN1A 4MA8L 1OGAD 2WQSA 3RI5F 1BPLB 1Z5LB 1XGQB 2WB1A 3EADA 5EU4B 3TX4A 1D5IH 3DKHA 5JR1L 4FZEH 4AY0A 3HJ0A 1N0XH 3CVDA 4KHTH 2YC1A 2L7EA 2KH2B 3QIWC 3AU1B 1FJ1B 4Y4FB 4YSDA 3DTUB 2DJ4A 2N3JA 3KLLA 2AGJH 4HLZH 2FE0A 1DCLA 1K4DA 3FHEA 2QGCA 1BQHG 1M3IA 2P8LA 1ZEAH 2XWTB 3HFFA 4FKHA 4XC1H 5KSVA 4M6NL 3CC1A 1OCOB 2CLVB 4G8EB 5IFJA 2AANA 3B8SA 4OKVA 2AK4D 4JFYA 3U83A 1XF1A 4JHWH 4BCYA 3A4FA 3OWRA 3OXRA 1ZT1B 2FR4A 3CUPA 1FIEA 4D9LL 3P11H 3GKWL 5F71A 2IPTL 5HYEA 1LO2H 2Y5TB 4D7PA 1GZQA 3PL6B 4H8QA 5DO2D 3UPRB 3QZBA 4R90H 1MCWW 4PJ8D 3T2NH 4XP5L 1NCWH 5BJTB 2HTLC 3LEYL 5F9JA 3ZE1E 4BZ2H 2ITCA 4DP8X 2XN2A 5CUSH 4XPHH 4QJ4B 4NWTL 1SM3H 5LCVA 4ZMAT 3ARZA 1TDQA 4JM4L 4PJ7B 4U6TA 3VXUD 3S5LG 4B27A 4HFUL 2GUOA 2R2BB 3MJ9H 3P4NB 3EYFB 3AABA 4H25A 3FQXA 2E7HA 1T5WA 4O51A 4I8DA 2LFEA 4HCRH 4AYFA 2NZ9D 5TF1L 4I1RA 1GW0A 1M53A 3BUTA 3OV6A 2VM4A 4AW4A 2NY3B 4Y1AA 4XBGB 4LDEB 5E03A 4DVRH 1PCSA 3B4NA 3CN3A 3CDZA 5F1NB 5DO2C 3DX9A 1RY7B 3PPSA 4C4KT 2IV8A 1ILUA 2VL5B 4PJ8C 5DZNA 5H35A 3V4UH 2DV6A 4C55A 4HF5H 4DUVA 3SDCA 2FL5B 4ONFH 5ACZB 3GSRA 3LXUX 3GEWB 1AANA 2KLSA 2UZXA 3LKSB 3QG7L 1GY1A 4Y19E 3FQNA 4AT6A 5C3IA 4MVBD 5EWIH 2H3NA 3QHTC 4HJGA 3WKNA 2IADA 3L08A 4FQCH 4K55A 4JDTH 5D2NB 1NGXA 5FW7A 3F7RA 3H1ZA 1JZFA 4GQRA 3LQMA 4PHXA 1IFHH 2NY4D 2V9TA 3RZCB 3BVNB 3S3SA 4JDEA 1MXDA 3IRCA 5SV3A 4ORGB 1U8JB 2H32B 3UZQB 4MD0B 1ILSA 5B8CA 3UG4A 3VXUA 3N9GH 3DRQA 1H0DA 2HG0A 2CK0L 2B08A 3OKYA 5C0JB 8FABA 4NN7C 3O3DA 4NQSA 4OB5H 5LUMA 1NAKH 1QLRB 5HHNB 4Z18A 3HOGA 4MVBC 5D1XE 2F8XC 5J7CC 5ICUA 1WCBB 1YEEH 2AEQL 1LEKA 5F44A 1YY9D 1TZHA 1W72A 4ONGL 3QGVA 5ABDE 4LSRL 2PPFA 2MOQA 4L9LA 4W93A 3T8XB 2Y7SA 4Q6KA 3GT6A 2HJFA 1S7VB 2ZCLH 1JXJA 2APSA 5EOCH 5CZRA 4DKTA 3DX7A 3L45A 3V5HB 1U8LA 2WIIB 3RUGF 1SJXA 4FNRA 3ULUE 3KPSE 1OAYL 2FWUA 4BK4A 2CDGA 2FEEL 4ETYA 3L9RB 4K3EH 2JWYA 1J11A 3FU0A 4M7ZC 5H37A 4R8WH 3K72B 5DT1L 2F58L 1AKJD 3G5ZB 4DK5A 2DKMA 2BFGA 3K2UL 1YY9C 2CHWA 2DMHA 3HC0A 2C4FT 2WBJC 4X4ME 3ESVF 4AJ0A 2X4RB 1OWWA 3U6RB 2VZ1A 2VUKA 3X3GL 2FD6H 4CJ1A 4P04A 1FL6A 3S34H 1M7DA 1E43A 3MQIA 2ISDA 3BVDB 5E1AB 4AGPA 3PWPB 4F7PB 4XO3A 3RY6C 5DRXB 4X8CA 5AW6B 3BUIA 1HZHL 3TNMA 3EYUH 1CCZA 2EDLA 2O5ZH 3FTZA 4J1UB 3RURA 4NIYE 1CR9H 3BKCH 4PJHA 3WFBL 2A9NH 2ZX8A 3FUDA 4N6QA 5DJYA 4BKTC 1ZGLA 5IQ7H 5J3HD 1OEZW 3CJJA 5IVZA 1A14H 2A73B 4QRQA 1SXBA 4E9YA 1J9TA 3O2WH 4JZJA 2VW7A 2QFRA 1JD7A 1KTDA 3HJEA 4WW1B 2ICEB 3ZY7A 4CMHC 1KTLA 1V54B 2XU9A 1A7QH 1H8LA 1COBA 4X0NA 3CVHB 5ESQA 5JPNA 2YPLE 5EBWB 5J13C 1E3FA 2DM2A 1HHHB 1BREA 2EDFA 5DUMH 4GPVA 1WAAE 4MCZA 5IFHL 4CRPA 1GGBL 1BZ7B 2ROXA 5ID1A 4WSJA 3TV8A 5IMOA 3U4KA 3RY4A 3T3PB 3RPBA 1Y0LB 4CW1B 3EDDA 4PR5A 4UAOC 1I7TB 3DXAA 3WFEH 5E6YA 3BWUC 5J3HC 1YAIA 1RJZB 2VDML 5JIKA 1BQ5A 2OQJB 1R3HA 5AOLA 1EGJH 3QULB 4AGMA 3I3BA 2A1WL 5FW6A 1A8ZA 4M6MH 1Y6MR 3FRUA 4AGOA 3BEWA 3WBDA 4HA1A 4F2ME 3FQUA 3L1EA 4K7PL 3VACA 3D06A 4HALA 3Q3GB 3IGLA 5I1HH 5MEOA 1AOZA 4DH2A 4R84A 4K8RD 2L8AA 1NBVL 3AY2A 3A4DA 4OH2A 1OGTA 1SF5A 4N0RA 5TH2B 3L5WA 3O4LB 3OKOB 2KPWA 3TO4B 1UWEL 3CFMA 1S9YB 2FT8A 2FT7A 3UMNA 3HKZA 4G80B 2VMJA 4QKXB 1G4MA 1CDUA 3L48A 2H2SD 1IMHC 3IDXL 3VRIA 5DTFB 1R6VA 2APVA 1MWAH 2BZ7A 4KY1L 1UWGH 2JJVA 1ROWA 1M2VA 4RQQB 3CFJA 3H2WA 3IDGB 1IBHA 3GHBL 4OFQA 4XP6H 2D2OA 1BAGA 5CNHA 2OMVA 4BSWB 2XG5A 1DQML 1HXYA 3GDCA 4ODXB 3RJDA 4APQA 3GBEA 3BUBA 1YNTF 3EOTL 3MRLB 1ITBB 5GGRA 4K8RC 2YIHA 4OKDA 4QAWA 1KN4L 1K5NA 1HEJC 4QWWD 2Y22A 4X6DF 5GZND 4G83A 5I1GL 3I6GA 3TIDA 1DJYA 5IEHB 2AEIT 4GP8B 2BOCB 1CQYA 1GAFH 3OMIB 2H2SC 5F1KC 4LLUB 3GXTA 4YBHA 1QYGL 2P28B 5F7EH 4GMTH 5KVFH 2B9AA 1XCQA 1GC1C 1ZLSL 4RLDA 4GRMB 1T1YA 5A40E 4XVUD 4OZGF 3UTZA 5I1LA 3BP5A 4ZAKD 5F72S 5L2KE 1IKFL 1FYTD 1SHSA 2WAHA 4PJDB 4IOFD 1UXWA 5AYTA 4AGQA 2D0FA 3GIZH 2C1OB 1RIHL 5FYKE 5LQBH 3SDDB 1TFHA 5SWZD 5KAQG 4Y88A 2WQRA 3RA7L 1A4JB 2GAZB 2F5AH 3PLYA 5J6GB 4EBQL 3C8KA 4O02B 5D8JH 1NPUA 5DJ0A 4KUZL 5CD3B 3CZGA 4IRZL 4QWWC 2HXAA 5GZNC 1X9RA 3PWUB 4RISL 1SLXA 3D07A 3JTTA 5F9DC 5I6OA 1JV2A 3ALXA 3DX6A 3GXPA 2ZUSA 4R83A 4U1MB 2JB5H 2XY1A 5E5LA 1XQ4A 4DOHB 4PJFF 1EX0A 1Z3GL 3QNZA 4OCLC 4U3XA 1N5YL 3BEVA 5EBLA 1PQZB 4EI6B 2AJYL 4DF9A 5MHSE 4HIIA 5J57B 2E27L 2VLKB 3OGOE 1KPUB 4L0YA 4WZ9A 2VR6A 3DV4B 3GIVA 2DH3A 1FNAA 1NAMH 3O4OB 3MRMA 2LTQB 3NZ8B 5IJVB 1JXGA 3NRFA 5TFSH 3DX2A 2JKIS 3KLSA 4PJIE 1NEPA 4WI0B 5JNYA 5E70A 3DRTB 3EYSL 5KBPA 3P3SA 5KJ7E 1NBYB 1TVBB 5J12B 1Q9LA 5F0PB 2F53E 1F90L 2BP3A 4NKMA 1A7PH 3QH3A 2Q9OA 4M4PA 4PJ5A 4R96A 5C0GB 8PAZA 1XF2A 5C2BH 1KENL 2NDGA 5KSBA 1F2QA 4G8GB 1M7IA 1NGQH 3QUYB 1RULH 2V0AA 5GS2H 4U1IB 2WN2A 2J73A 3ROLB 1L7IL 4PJEE 1PZCA 3LN4A 2DEYX 4GKZB 2W5PA 5DEGA 5IJCC 4X5XA 2ZOWA 3GSQB 1U93A 4XCNB 3KNBB 4WI2A 5DR5H 2NUPB 3TM6A 2CJUL 3PGFH 3ETSA 4P2OD 3O3EA 2FLBT 3CN2A 3OB0K 5I66A 4I4WB 3EDEA 5HDOA 4D94A 1THAA 2AABL 5H2BB 3K8MA 5AW9B 5CJXC 4ZFOA 1GKOA 1MFCH 1PZ3A 4PLOB 4N24A 1QR1A 3MLVL 1Y1UA 2I07B 2YD2A 2CDFA 4Y2NA 5JOEA 3BW9A 4IHOA 3OGCB 3SDXF 4YSPA 5SWSE 1IAOB 3SOBH 4AGLA 3BFWA 3HHMA 5CD5D 3V9FA 5L88H 3SYAA 5ENWB 3S35H 5KZCB 1X5JA 1DQLL 5DHVB 4GAJL 4MD5B 5I8KL 5AVWB 3ZU8A 1LP9A 3D2UD 3ELQA 2CJSA 2H1XA 3NAAL 3WNMA 1HK6A 4XHQA 4XOCA 1QBBA 2V5TA 3SPVA 2MH4A 2BHZA 3T8VA 4FQXA 4P2OC 1QA9A 2IF7A 5DYOA 2R1WA 3ABKB 4IMKA 3W2DH 4KRPC 2GTWA 2G2RB 3FQRA 1MLCA 4TLUA 4OIAA 3FK3A 4WWID 3WNLA 1FNHA 5HXMA 2W88A 4XNDA 4EDXA 3QUKB 4XCYA 3BZEA 3DIFB 1AC0A 2WTPA 4HT1L 2V2WB 4ZSOE 1TLKA 1MW3A 5DD5H 2Q7YB 3N42B 4JGJA 4RMQA 3VXRE 1VCAA 3WLWD 4BZ1L 4PY8J 2KLTA 2QQQA 2YKLH 1WEJL 5H8DA 1RUQH 3KWVA 2EDXA 5FYJL 3AT8A 1G6RL 3HB3B 1ORSB 1MCBA 3K8LA 2Z31D 5AG9A 4JFPB 4MZ2A 5I19H 4F57H 1G6RB 1KB5L 4M00A 1LM8V 3KVQA 1B4TA 4UF7C 5E6IA 1VESA 1JNHB 1KB5B 4WFEE 4M3KB 3CV5A 3E3QC 2JIXB 5BMFL 1KY6A 5KVGE 4Z7NF 3QFJB 3MRGA 4UIKL 1JGLL 3D2UA 4Q58C 3C8DA 4IU3A 4CVWA 3DPBA 4FKKA 1KTRL 4XT1C 3VMPA 3WLWC 4JJ5B 2ENSA 3MRBA 3CFEB 1JG9A 5ECGA 3UTPE 4AL8H 2XIDA 4Y5VC 2J44A 3LNHA 2ZWNA 3ARDD 3TZVD 1UQSA 2D0HA 4OCRL 4DQOL 2G60L 2YA0A 1MELA 3IDMB 4KI1A 1FE8L 3M86A 4IIQA 4LK4A 1SEBB 2KYIA 2AXFA 3PHQB 4C56E 2NXYD 5JQHC 5JA8B 2XZAL 4IM8A 3QAZC 4H8HA 4NZJA 4JM2A 2E4FA 1H8SA 4KFMA 3EJQA 1YLBB 3MV9A 3EGXB 1IGIH 3OAWA 3EFOB 1ED3A 3KJ6H 5GISH 4KKZA 1P9MC 1XSOA 1VPOH 3FS9A 4WY7H 1P6WA 4LOVA 2Z31A 5DJ2B 2GIYA 4LHUA 5IKCA 4J3WA 2BLFA 4RMUA 5DS2A 5GRZA 5C0AD 1DO5A 4RAUB 5ABZA 1LO4H 3TZVC 4OGQC 1LEGB 4NNPL 2NY5L 1HS6A 1KIUA 1FVEA 3F5WB 4P5KB 4PV8B 4I89A 5L4MA 4HAKA 1OAUL 3PHOA 4KROB 2I5YH 3DUUB 4HHWA 2AI0H 1YCSA 2BOBB 5L2JA 3L2NA 4DVBA 2Y07L 2ZKXA 3E6HB 4POUB 3VJ6A 1NFDF 1C7SA 3PJSA 4QHNB 4NZ8A 3B3BA 2IAAC 3ARDA 4LVHB 4PCYA 3P3TA 4RDQG 4UV7H 1E7UA 2P5WE 5G5DA 3ZT6A 4MNQD 4ELME 2JCCA 2XN0A 5C6TH 4RA3A 1NGZB 1X6NA 3QEUA 1TJGH 1CZ8L 2NW3B 5AWNL 5AZ2H 4DP6X 5E8NB 1U42A 1MPAH 2VM9A 3LKOB 1VRSA 5I0VA 4GUOA 1KACB 3HFMH 4ALAC 2CKBA 4I18B 2V3EA 4WV1C 4LARL 4PTTA 4DTGL 2P24A 5EIIB 1AZZC 5F7FA 5HJBA 4JFDA 1BGXL 3LN5B 1GL4B 4JHAH 4KO7A 4TUJB 1JFQH 4JR9H 5GRVK 5GIRB 1BFOA 5FV2A 3VX0A 4NRZA 3WIFA 3ABGA 2P5PA 1ICTA 1U8MA 1NWPA 2H6UA 3HMXL 4ELDA 4R97B 1KFAL 3LX9A 1FORH 5D4QA 1IBZA 3OR7B 4Q9RL 2OL3L 1HCZA 5CSZA 3LQZB 3HBZA 3O2DA 3A3YB 2MQGA 3DTDA 2GJZA 5F7WC 2ZYRA 5LGHH 4N28A 3VFPA 4I0PD 4J6RL 3U36A 4X50A 1DQVA 3L3JB 4Y9GA 2W0PA 1ZIAA 2OMYB 4XH2B 1YEFL 1HHIB 1BLNA 1IIKA 5DSCA 3INUL 1YEHL 4PWGA 3ML9A 2VQ4A 4QOKD 4PWEA 1FNFA 3HAEH 4WVRA 3DWTA 1PTZA 4LSPH 4PRPB 4D0DA 4BFEA 1CI3M 2NNCA 4PJGE 1DVYA 4GINA 4NQDB 1F6FB 4YHYC 3LKPB 3LAFA 4Y5YC 4ZFZB 1F6LL 1NDMB 2BCKA 5J1TC 4YDVB 1VERA 2UWEA 3JV4B 3R06B 2DYPD 5E6RB 5H37G 3TVMC 3FB6B 3BE1L 1RUKH 1S7TA 4I0PC 3CN1A 1WWWX 2DTMH 3AM8A 3MRNB 4PG2A 5TE7H 3MBXL 5AVSB 1A1OB 1DHKA 3OB8A 2DWDB 4QRPD 4ZMYA 2YAEA 2AV1B 1DCEA 1A7RH 3ARGD 3B5TA 1J8HD 3JT2A 3EYVB 4GQPH 2VJ8A 4DEWA 1BQSA 3QNXA 5DMIH 4K94C 1QSEE 4BKLA 2OMWB 1CYGA 1WH0A 3CSFA 2C5DC 2QMJA 1V7NL 1GH7A 2K6ZA 3DSNA 5F97E 4IBUA 3O3AA 3PAYA 5FO9B 3C08L 2XKUA 3KBFA 4TS6A 1ZK9A 5E56A 4Q9QH 3IMTA 4EVNA 3HC3H 4YSQA 4IQHA 5TDOA 2NY6B 1Q72L 1NZRA 4JFHE 35C8L 3FCBA 4CBPA 4LOEA 4RSYA 3V9EA 4QRSA 1BMGA 4J2XA 2YD5A 3GMMA 4U4IA 2BVQA 4P2QD 4QRAA 4PJCB 1QUNA 3ARGC 4NZUH 3CGTA 1OAXL 5HVFB 1TZIA 4UQ2A 2HZHA 5HHOD 3TV3H 5IQMA 1T0NB 2Z93B 3KEHA 1CPUA 2DLFH 1OK8A 4HH8A 1OP4A 3BMVA 1AO7A 3SODB 1FG2B 4Y5XC 1U2YA 3LIUA 2EYSA 2YAHA 3B7TA 3L3KA 1U3HD 4XOEA 5C07B 3DURA 1GZHC 3BYYA 3UO1L 1NPJA 1Q4NX 4Z8FL 1ZVSB 4P3DA 1DSYA 1DVXA 2PCPA 2NYZA 2QSTA 4AYDC 3FPYA 2WYHA 1UA6H 4UT9H 4H1LB 4K7FB 1QEWB 2B2XH 3MVSA 2QVTA 4M6AA 3S7GA 2AEWA 3VXSA 3U9PH 1N12A 4XWGH 1F1GA 4UT6L 2XN9D 3U7WH 4KDTC 2O4EA 3SZKC 1OSYA 2OW7A 3ESOA 4PJBE 1HL5A 3MUY1 3H6JA 3VD2A 1L5GA 3SDYL 1CLZL 5TDNB 5D6CA 4N0FB 4LSTL 3AU0A 3IRPX 3VFVB 2F19H 1Z5LA 1XGQA 3EO0B 1U3HC 2A4ZA 4IBSA 1MRDH 1RMFL 5EU4A 3VFUB 5KUKA 3RDTB 1MN4A 2FNBA 4ZUUB 3HG2A 3W5MA 5E6UB 4J3UA 4DUWA 1SUHA 3AU1A 1FJ1A 4Y4FA 1CGTA 1L9SA 3FZUD 3LNGA 4H20H 4AE1A 2HT2D 5CCKL 2WJ7A 1G0DA 3CZEA 3VI3E 5AL8A 4Q14A 2XWTA 3PAUA 1OF0A 3KL0A 4G8EA 4HG4J 4U3SB 1QI5A 5D4JA 3MUZ1 3FXIC 1YPZF 1CLVA 3LEVH 1ZT1A 5MENE 3UJJL 2B1HL 3KS0H 4UQ3B 4HUXB 4IBWA 2D7MA 2J5LC 4KQ4L 1I1AB 2Z3FA 2Y5TA 1GYAA 4FI7A 3EBIA 4N2KA 3PL6A 3BKYL 4OLZH 3UPRA 4GJTB 4HMCA 3WTWA 5BJTA 1MRFH 1OOAA 2IDQA 2JXMB 3CQQA 4LSQH 3FZUC 3DOSB 4WRLA 3RX5A 2HT2C 1EFQA 3TBWB 3KWXA 1HCFX 3R7QA 5B1BB 2X10A 2GK0A 4PJ7A 3UL4A 3ZL4L 1EO8H 5F96H 1UEYA 1UH3A 4YWGH 1H3PL 3CZSA 4GMSL 4HETA 5EEXA 2FEJA 2R2BA 3P4NA 1ZSDB 3EYFA 1G84A 4U0RB 2PWHA 5IMMB 1KEGH 1J9CT 1KGCE 5CWSB 5DHEA 2DS4A 1W6WA 2NX5D 1XCWA 4XBGA 4OLEA 4TVUA 4ZMXA 3VWJB 4AUJA 4MGXA 1D2PA 5EEZA 1LD9B 1DVUA 1G6VK 5F1NA 1L9PA 4PS8A 2D73A 4ZFGL 5BS0E 2W81C 5AKTA 2VL5A 3ZN6A 2OSYA 1E4XH 1KJ2H 2V9QA 3DVNB 2FL5A 5ACZA 1EHLH 3QCVH 2HT4C 2GW5A 3B9KB 4UDUB 2QVKA 3EO9L 3LKSA 5DXWA 5C86A 5DRWA 3HG1D 1DN2A 2ATPB 1V55B 3M45A 3DV6B 1UCTA 4MKMA 1IE5A 5LWYL 4PBVC 4KXAA 5D2NA 3MNVB 3TA3B 1EFXB 2GBAA 4TUKH 2F15A 2YLKA 5T5FA 5IB5A 2O5NA 3BVNA 3RZCA 3D4GA 3DROA 3APCA 3EH2A 4GSRA 2XXCB 4ORGA 1U8JA 4JKLA 5EN3A 1MJ8H 2H32A 2IG2H 4MD0A 3UZQA 5I5MA 2RACA 4OCNC 3UAEA 4FFTA 1KC5H 2X87A 2VN4A 3QJZA 5C8JB 4ISVB 1MNNA 4K71B 4XR8C 5CJOH 5EZOL 5GGUB 1CT8B 3IKCB 1SLVA 5C0JA 1NKGA 1QLRA 3QEQD 3UAJA 1NC4D 2AJ3B 4FLSA 4DFIA 1LGVA 1MCFA 5CU5A 1WCBA 4EIGB 1SDAB 1S6NA 1D5MB 4YL9A 4XP9L 1ACCA 4TVSa 2VSKB 3T8XA 4L4JA 5I5JA 3WNNA 4RGMC 5EULV 4UQBA 1S7VA 4LLAA 3KXFB 4OF0A 4JW3A 3SDAB 4B96A 1KV3A 2YAOA 1N68A 1CQKA 2F54B 1AZCA 4M43L 2CO2A 2WIIA 1OHQA 5HYJB 3GXNA 3N1QC 2X6AA 5FUZL 3ZIYA 4XVSH 4WTWA 1OAZL 3T71A 3L9RA 3MMEB 1UOWA 2A9MH 2V3DA 2NQDA 1UWYA 3C5XA 2FO1A 3K72A 3BWSA 4GRWH 1J87A 3UDWA 3G5ZA 1JV5B 3DVFA 1E50A 3F6LA 4LU5H 3WD5H 4A7UA 2TAAA 1FA4A 4OM1L 2Y2YA 2EDWA 2ZP9A 5D7KE 3CX5J 4KO6A 5CBEB 2MPAH 1VZIA 5DFWH 4I7ZC 2EICA 3V52H 3IJHB 3SKNB 2E9GA 4GXVL 1L9NA 2X4RA 5LN8A 2ZCHL 3RVUD 3U6RA 4LSSH 4BGLA 5AW2B 3S2AA 1JDCA 3FUHA 5GRXG 3QJFB 4TNEA 5E1AA 4F7PA 3PWPA 1UJ3B 5DRXA 2V8MA 2EXSA 3APNA 3F7KA 1QW8A 3KR3L 4FNLL 4PRID 3TL5A 3QIUC 2C4XA 4J1UA 3B2UD 4P4KB 2GHZA 3IDYC 6PCYA 4N90D 2CXKA 4KGLA 3UC2A 3RWEB 3FMGL 2A73A 1OCWH 5HDBE 3TO4D 3V4PL 4HZLB 3ZO9A 1PX4A 3OJDB 5KJRH 6TAAA 2QDVA 3X1EA 3ZKNC 4WW1A 3WEXB 2ICEA 1J8SA 2WBKA 3RVUC 3V4PB 2JQAA 3CVHA 4I3RH 5EBWA 2G5RA 1CF8H 2X9YA 4MWFB 3T0WA 3ZRSA 4Y4KB 1HHHA 1QO3B 4Z7UF 1BZ7A 4J8QA 5JQ6H 3FU6A 4A2EA 1E4KC 4Q89A 3ZE1B 1FZMB 1CF1A 3VGEA 1Y0LA 2Q8AH 3B2UC 4DETA 3HEIB 1CVRA 1RCYA 3O6KL 4N8PA 1I7TA 4CW1A 5C3LD 1CICB 1ADQH 2NQ3A 3UTSD 2B4CL 3OKMB 5E24E 5LXGL 3EGSB 5EU3B 3LYRA 1FBIH 1QSVA 1GKEA 4ZUTB 3QULA 4WK2B 3TJPA 5LKNA 1CTNA 3HC4L 5JA9A 4DW2H 3EJUA 2D7NA 2ZX5A 1UM4H 2QGDA 2J8UF 2GKIA 2B5IB 5I74C 4G5AA 3RWGB 3TP4A 4K8RH 2CCLA 4X9FA 5HHXL 4FXGB 1FN4B 3DGCR 1NFIB 3DDFA 4N2DA 4PRAB 2ESVE 3BVVA 3ETTA 2IMMA 4LO9A 4FNPA 1R5WB 1WITA 4RGOH 5TH2A 3O4LA 3OKOA 3TO4A 4HWBH 3FCSB 5GGTA 5FKAB 1S9YA 4YPJA 4JMXA 5E1QA 3D3VB 4NN6C 4G80A 4LHUG 1GC1H 3KH3A 2QGEA 4LPTA 5KANG 1RVFL 2YWZA 2P80A 3IFPB 5DTFA 5B1CA 2R8SH 4PRHD 1I85A 4RQQA 3B5GA 3VGFA 3IDGA 4ZOAA 1GSMA 2Q6WB 1Q0EA 1U4EA 4YSAA 3CD4A 2X9XA 4BSWA 4W9LC 4ODXA 4EN3B 4QHPA 4O9HL 3MRLA 3BOVA 1Q90A 3GI9L 1JWUB 4GBXC 5KVEE 2VGLM 1S2EA 3GI8H 5LBSA 4LQ1A 4NS0A 3FU9A 3JWNE 1T21B 2VMFA 3JQOB 4AG4L 5D7JB 4JCLA 1D9KB 5E51A 1KB9J 5IEHA 5D1XB 2BOCA 3GTNA 3NTCH 4LSUH 3VQMA 4TNWK 4LLUA 4XVJL 1A3LH 2CD0A 1ZHLB 2D3NA 4LOUD 3ARWA 2OR7A 4GRMA 3OKKB 3ULUL 3L4VA 3U9UB 1A1MB 3TH2T 3QUYD 3V4VL 4P5RA 4PJDA 4YC2C 1U9KA 4AQEB 1IQDB 2G5UA 4QKTA 2C1OA 3EDFA 1I7UB 4N0CD 3SDDA 1NOFA 4GUPA 1HCVA 1BAFH 4Z78B 1A4JA 2GAZA 3GUFA 4NN5C 3MJ8B 5GHWL 4HUWB 5J6GA 1KBVA 4O02A 5AB9A 3HR5B 1XWVA 5FM8A 5CD3A 4OZHE 5F89B 1RU9H 3PWUA 1WUZA 3G5YB 1A3ZA 4U1MA 1MCCA 2OYPA 4IRZA 4LLWB 3N41F 5FF6B 3HNVL 1PQZA 1B0GA 2H41A 3NT0A 4LOUC 4EI6A 3T3ME 4XN2A 4MRCA 2VLKA 2QBWA 4Y2OB 1IBGL 1AY1H 1KPUA 2QR0B 3DV4A 2NT0A 2RAMA 2IH9A 1SFDA 3E80A 2ZUUA 2ZOKB 1NCGA 3LMJH 3OPUA 1BXUA 2BW5A 2J8OA 3H9SE 1QFWI 2COQA 3NZ8A 5TJWK 5IJVA 4E5XG 4N0CC 1VAHA 2E74C 4HKJB 4WI0A 4B3VA 3FTVA 3DRTA 1CURA 5D7IE 5KZCD 3I50H 4JE0A 1KYOK 1LO3H 1NBYA 1TVBA 3MRKB 1EK3A 4XPGL 1ZV2A 1KNOB 2KQNA 4QY8B 2W9EH 5C0GA 2XV3A 2WLHA 3V10A 4DGIH 4HKXB 5FOJA 4ANWA 4LCCB 4G8GA 5CFAA 3QUYA 1NJ9B 4XPAL 4ZTPL 4U1IA 1HZLA 2MRYA 3MLYL 4R4ND 3ROLA 1J0IA 4RVBA 1WA2X 5DMYA 3BIAX 4MYWB 2ZWYA 3Q06A 1G9HA 3LXBA 1GYWA 3RJOA 4GKZA 1DJXA 2GABA 2APWA 3GSQA 5KG9B 4XCNA 3SPIA 2BHFA 3KNBA 3ECBB 2OI9B 2J88H 3PP3H 2NUPA 1A3RH 2C9PA 1FL3B 3W37A 2DF3A 4L5FH 1TJMA 3RWIB 3VRJB 4DGYL 1XH3B 4I4WA 5E2WL 5H2BA 1KCSL 4LDOB 3KYKH 5FYJD 2Z91B 5IHZB 3GNMH 4NBZB 1BQLL 2I07A 3ZQXA 4KX9A 3T77B 3VGGA 3ZTNL 5A2JH 4H26B 2ZJSL 1Q1PA 3OGCA 4R4NC 3W9DB 1UKSA 3AGVA 3II3A 5TGBB 1IAOA 2B1OA 2EIKB 4JRYE 4QD2E 2K70A 5ENWA 3GJEB 3ZRCC 2DQ6A 1ESOA 5DHVA 4KTGA 2LAGB 4YHMH 4F2MB 3B2VH 4MD5A 5SWQB 2Z4TA 1MIMH 3BAXA 1RZKC 3IGUA 1YYMH 5T1LD 1G5AA 4O4YH 4ZMQA 2YEQA 2PF6A 5DQ9B 4I1NB 4DFHA 3WHXB 1FHNA 4ANKA 3R0MA 2G2RA 1K4CB 2WO2B 4XOAA 4M7LT 4HX1B 5I1JL 4P9HC 5CILH 1IC4H 2WK2A 3FAWA 2DMCA 3QUKA 4WFHD 2VJXA 3DIFA 4V1DE 4JL1A 3OX8B 5DMGD 2ZUXA 4H2AA 1AQ8A 2CRMA 2V2WA 3D18B 2Q7YA 4ODBD 4C54A 1XH1A 2XTLA 5D4IA 4LEXH 2DBLH 2R2CA 3ILQC 2QKSA 3Q8FA 3QWQB 4KPHH 3RFZC 5KVMC 2D7TH 1ZSHA 4GB9A 5HYSB 1N4XL 4RSVA 4BZ1A 3S6CA 1ORSA 4LRNL 5ADOL 4HU2A 2Z7ZA 3BSGA 4FRWA 4JFPA 1OAQH 1G6RA 4ABVA 3V0HA 4M8VA 4WEMB 2DZEA 5IFAL 1FV1B 3B2XA 4BDVB 4GIPD 4MASA 5BOPA 2HWZH 1KB5A 2AZUA 3GXFA 1JPSL 2G3NA 2JIXA 2YXWA 2OTPA 3QFGA 1AE6L 1YVLA 5DFTA 3BPOB 1A4CA 3QFJA 5DMGC 1QSFD 3F8UB 4QYAA 5AKSA 1T2QL 5B1KA 1KCVL 4KROD 1E2VA 2WZ0A 5L2KB 2X42A 1FFRA 4JJ5A 5FYKL 3ZYJA 3WU1A 1AI1L 1WS8A 3CFEA 2EDKA 5I1KH 3D39B 5F3HB 1YEIH 4JMNA 4HWEH 3X12B 2QPFA 1UATA 3DA0A 4FCHA 4N2OA 4BE5A 2WWMD 3PDOB 2ZUYA 4L4VB 4OIBA 3I75B 3IDMA 4LBEB 2BNUB 5EDSA 3BXNB 5J11B 1TJHL 1SEBA 2F2HA 4YXKL 3ZDWA 3LIZH 2WXJA 4D7BA 4FXLA 3RPIB 1PZUB 3PHQA 1XF5B 3QJUB 5B4MD 2VDKH 4QTIL 5CFHA 1C5BH 1OQXA 2CXGA 3EGXA 1JZ8A 2BRRL 3EFOA 4G8AC 4EDWH 1ZLUH 3GQFA 4JFFE 4HJIA 5T33H 5BV7C 2QVFB 1FLTX 3QIBC 4ZNCD 3KBPA 4U1GC 5DJ2A 2X2UA 3DIVA 3CXHJ 5B7FA 2D4FA 3NRPA 4RAUA 1GY2A 3KPOB 4XO8A 4PJIB 4XPFH 5CXPA 2FUQA 3MUGB 1LEGA 2PP8A 4ALAH 2WWMC 2DRUA 3F5WA 3TFBA 4P5KA 3O6LH 4PV8A 1ID2A 1EZLA 3BKJL 1QBAA 3EJCA 2F53B 3ESPA 1TTCA 4OF5A 3DUUA 2OXGB 4G9FD 4FOMA 4GSXA 2BOBA 2CRIA 3GS7A 3TEZA 4WWKD 1J5DA 1W0YT 3E6HA 1QRKA 3W0WD 43CAB 4PS4L 4QHNA 4PJEB 4FG4A 1BVZA 2OK0H 5D1QE 3K1KC 3RKDC 4X4ZA 3S4SB 3SYCA 1X7QB 3MGOB 5D7SL 3EGDB 4Z7WE 3FO2B 1DL7H 1NMCB 5G4NA 5ADPH 1FO0L 4HW6A 1NGZA 4MDRA 2IBZY 1CFMA 3ETBJ 1PSKH 2NW3A 3BLBA 5E8NA 1CDJA 3TCXA 1T80A 1FO0B 1RUAL 1UT9A 3LKOA 1CDYA 3SJVD 1NCOA 4NQDD 2Z8WC 1JZHA 4X7SH 1ETA1 4OIIH 4I18A 1CD1B 2FX8H 1SLUA 5KS9B 4HKBB 4B9FA 2F7QA 2VDQB 1N18A 4U6XB 3MX0B 5E2UL 5EIIA 1IU1A 4WUKL 5F7DB 2E7LA 3LN5A 4WWKC 5CCHE 4PU2A 3WN5C 4TUJA 5ALBH 3GJFK 3PHAA 5GIRA 3RTLA 4QGYA 2OTUB 1H3VA 4J3TA 4FAAB 1RSYA 3IU4H 1PG7X 3ARBB 2V33A 4OD1L 4I1PA 2VN7A 3E2HC 3HPLB 4LASH 3DSFL 3OR7A 4N1HB 1JUFB 3HMXA 1PG7H 3B6SB 4NZTH 3LQZA 3A6BL 2XC8A 1L7TH 4PM1A 2BVTA 3R1GL 2V2XB 4PLJD 3B56A 2WQAA 5B3JE 3NIDE 1P4UA 1IKNA 2TRHA 3L3JA 2AQQA 4R2GB 1K8DA 1MFDH 2BNQD 1DVFB 3ZHDA 4AIZA 12E8L 3Q9QA 2OMYA 2XTSA 4XH2A 3ZO0A 1HHIA 3ZGIA 2AJXL 3OC5A 2ENYA 4G8IB 1OP3H 5JHMA 1F42A 3B34A 2OULB 1L9QA 1UKQA 2VRQA 4ZSOB 3ZX1A 2CG9X 4K94H 4PRPA 5EU7C 2ZUTA 1M3JA 1NL0L 3CVIH 1R0AL 3VXRB 1UC6A 2J21A 2RCSH 1HNFA 1X9LA 1XGYH 2A6DB 3NJMA 1N64L 3MJ6A 4MDIB 4NQDA 1D5ZB 1BM3L 4WEBL 3U9WA 4G3YL 3LKPA 4I88A 4ZFZA 3KWTA 1NDMA 1XSIA 3AZUA 2Z8RA 1ZIBA 2G3XA 4YDVA 3JV4A 2DQJH 4RCAA 3R06A 3FB6A 4PVNA 4AKPA 2BJMH 2J43A 4PLJC 2X7LB 1JZGA 2EINB 1NMBH 4GG6F 2DQGL 1GJWA 5KVGL 3MRNA 3PV7A 1A1OA 3C60D 5LNGA 2DWDA 4PLNC 3S9DB 5HY9A 1T89A 3P9WB 5GSRB 2JKTM 2AV1A 4G82A 3WDJA 2BZCA 2FTAA 4OCXH 2G4GA 2GVYA 2WLMA 3TEWA 7FABH 3EYVA 2R29L 4J12A 4ZYKB 1ES0B 3VA6A 4K73A 1O6VA 2OMWA 1I9JL 1N19A 2HT3D 4JG5A 1HOEA 2JKWA 4D3CL 5FO9A 2ARJB 2O61B 3UJIH 3QJTB 4JFZH 4PS7A 1I8KB 5CP3A 1HFUA 3P02A 1WT5C 4DO5A 1MCWM 2DIJA 4KXZI 3GJFA 3CFTA 2A4EA 1FF5A 4C56B 2ZAGA 3C60C 4M9OA 4YGAB 3PU7A 4FL4C 5D71L 4HWUA 1HQRB 2QL1A 3BVXA 4NJAL 4P49A 4PJCA 2VUYA 4L2LA 5JR1H 2W65B 2MKLC 4NKOB 1I82A 1EZVY 1OARH 1PL3A 1T0NA 2Z93A 4LCVA 3FCUB 5F8QC 1IL1B 2WC7A 4U6YB 4KQ0A 1FG2A 2WV3A 2A6IB 2IANE 2HT3C 3ASOB 4OZIF 3P69A 3PJLA 3A6OA 2R0LL 3LVTA 1ZVSA 4YBLB 3T0BA 2GTZB 4G8FB 2BFVH 2K9UA 3GXDA 4GRLB 3HS0B 4OQTA 3ARFB 4H1LA 4K7FA 4NCC2 2O26U 5E4EB 5KVDE 1QEWA 4PJBF 4FS0A 4NC1C 1MFMA 1T66D 4Y16D 1KXQE 4IBQA 4XP5H 1YEDB 3UG3A 4UT6A 1XCXA 3LEYH 2P5WB 4S10A 3UYPB 4F58H 5TDNA 4E41D 2FB4L 5IK3B 1QBML 4ELMB 5I6XB 4N0FA 4YE4H 2EABA 1JIBA 3VFVA 2L3BA 5AW3B 3EO0A 4ZX6A 1GZPB 1ZS8B 2OX5B 3HN8A 4GT0A 4JM4H 3GBNL 3MRPB 4I0KA 4UZSA 3RDTA 4M62L 4ZUUA 3SGDI 3K71B 3MA9L 5C0FB 5FO8B 1DLFL 5TF1H 1J05B 4AZ8B 4PJXF 2FRGP 3VG0L 5DD0L 2IFGA 5T5NF 2P44B 1G0YR 4IRJC 2BSCA 1U95B 1T83C 4FYRA 1I8LA 4H8WL 3CFUA 1DJWA 1U92B 1T66C 4TVPH 4Y16C 2VC2B 1A6WL 1OSEA 1CLYL 1E30A 3JWOL 1UM5L 4CVXA 3BZ5A 4XCEB 1WFOA 4U3SA 4XXWA 5G55A 3S2CA 3AUWB 2XQ0A 3ENEA 4UINH 2HLAB 4C58B 1TTGA 4AMXA 2XVBA 4UTAL 4BH8B 5D6DA 1WGOA 4HUXA 2GSIB 5A1AA 4ZMZA 1YNLL 1I1AA 3D6GA 3R7RA 3ULVE 1LWHA 1FYHB 4N0YL 2EEAA 3VTMA 2XHNA 2XA8L 4F20A 4FQJH 3ZDYF 2JXMA 1ND0B 3G6JE 4Y1AE 5DVMA 4HIEB 3DOSA 1KOAA 1NBCA 2FGWH 3L7FB 2IAMD 1GHFH 2CJTA 2JJSC 1T22A 3TBWA 3OMNB 4B3EA 4IOIB 5DVPA 2ALAA 4WI5A 4PJGB 3N91A 1ZSDA 3WOVA 2CPCA 2CK0H 4NERA 5DVKA 1N8ZB 5IMMA 2XBZA 5TQ0L 5CWSA 3WNJA 2AK1H 3ESUF 1URIA 3KLDA 2WOBA 5LNDA 1T6BX 3D34A 3A47A 2NNAB 3T2QA 3TEYA 3RUGB 1BSIA 2KS0A 3VWJA 2AEQH 4OVVA 4GP4B 5IQNA 1LD9A 2PO6B 4NLAA 4KRMB 3TEXA 4ONGH 4KC3B 3U7AA 5AVQB 1HINL 3MCKB 1RXLA 4JKKA 5C7XL 3KXFD 3PXJA 3VI4F 3WJJC 3X1NA 3DVNA 3PUCA 1LVEA 2F54D 5DC0A 3B9KA 4ENED 4UDUA 2IAMC 4JO1L 1HKLL 1E8WA 4CBZA 2JKRM 4V2BA 2EKJA 1OAYH 3KLHD 2ATPA 5F0LB 2FUTA 3DV6A 4YHKH 4OGXL 3CHQA 4Y7OC 2AAAA 1UOVA 1FNEB 3SQOL 5FLVA 5I30L 3TA3A 4F27A 1EFXA 1QSEB 4ZDHB 4NNYB 1X44A 3W39B 5DT1H 1RJLB 2F58H 2UZYB 2ZG1A 5ICXB 1MY7A 2HRPH 4JPIB 4OSUH 5L8KB 3F7PC 2ZE0A 3LRSB 1N3NB 3CZUB 3UYRL 3PP3K 3O8XD 1K8IB 3K2UH 4OTXH 2XJKA 3NA4A 5C8JA 4ISVA 3Q8AA 1JVKA 2HLEB 2MQ0A 1CT8A 3IKCA 2QADB 1BJ8A 3OKDB 4NFDA 5GGUA 2VMCA 1NCAL 2L4OA 2Z0UA 4PMFA 4MD4B 2CGZA 4XZ4A 2AJ3A 4PB9L 5C6WH 4CN4A 5FCUH 3KLHC 3L16A 1Z66A 3KGRA 1A7OL 4JGNA 4Y2DD 4KY2A 1D5MA 1HZHH 1T0MB 5DZ9A 5D93C 1F11B 4NQCD 3WFBH 2VO5A 4HMDA 1MF2L 4HV8B 3SDAA 3AQZA 4MAYB 4G6MH 1N6UA 2F54A 5GGRY 1QTSA 1GJIA 4KZDH 3O8XC 5D2LE 5HYJA 1H3WM 3WS6A 2W95A 3LS5L 4PH8A 2Q7NA 3VYPA 4LLQB 4KVNL 3PWJB 1BJ1J 1NEUA 3FU5A 3MMEA 4QRRB 3BWZA 5LO7A 3T0AA 3UBGA 1TCMA 4XVTL 4M5TA 1M56B 1QPXA 4Y4KD 4U6HB 3BCFA 4WO4D 3JBG7 2AMGA 2GHWB 1JV5A 3JUZA 4Z3IA 4Y2DC 4P5TD 5E7BA 4TOYL 4UQ9A 5CCGE 5CBEA 3S8WA 5F0MB 1MVYA 5HJGA 4R4BB 4PJHE 1CGYA 3BP4B 3IJHA 3SKNA 3F64A 1JWMB 4YFEA 1JDDA 3ARTA 1N67A 4KAQH 2EEDA 4U1LB 4LRIA 1IEAB 3VD1A 4G9DB 5D9SB 1IJNA 1XH0A 2EE2A 4AQ1C 5IB3B 2VDMH 1DQTA 1IAIL 4RBPH 1I9EA 3QJFA 2HAZA 3QS3A 1UJ3A 4K07A 1LDSA 2VCOA 2Z65C 3KH4A 1UXSB 5DLML 1G1KA 4K7PH 4P4KA 2JKNA 4OCYH 4RX4D 4ZO9A 5LB1A 3VI3B 3AREB 4WO4C 4JK0D 1JYWA 4RH4A 3RWEA 1ZK5A 1NBVH 1G9NC 4P5TC 3D85B 3CSBA 4HZLA 3OJDA 4Y19D 3IYLW 5IGXH 1BD2B 3DXAE 3WEXA 4E9LA 4CSTA 3HCVB 3WMPA 3V4PA 4Z5RB 1GGCL 3LXCA 2BINA 3TT1H 3IDXH 3VSQA 1E40A 4MWFA 4Y4KA 4WHCA 5AAWA 1QO3A 1ZKAA 2B4CC 3GSVB 2DEWX 4W9JC 3LOWA 5JTWA 2L7QA 3BD4A 3GS0A 4QHKI 4Y7MA 4AOFA 1S8DB 2X2YA 3GHBH 4HEME 3QPKA 1FGNL 3NPSC 3ZZQA 2ADYA 1DDTA 1FZMA 3ABMB 2OW6A 4PIBA 3AJ7A 1MCOH 2DD8L 2I9LB 2GPZA 1CICA 4H13C 3DECA 3N43B 3EOTH 1MH5B 3O6MH 4LL9A 4QTFA 3GB7B 3OKMA 3IFNL 4JAMB 3EGSA 5EU3A 4LLMB 1YSOA 2J6WA 3K7UA 4ZUTA 1YC8A 3F7QA 4FQ1L 3U46B 2CBMA 3M1CA 3ZE0E 4PV9B 3QI9B 1UZ6F 5I1GH 2A74B 1JJUA 5D1XD 5AAMC 3RWGA 1V7ML 4UV4L 2CNYA 4FE9A 3VTTA 3O9WB 2ZKHL 1OGPA 1QYGH 1FN4A 3GMQB 4FXGA 4KKRA 5BS0B 1NFIA 1XB8A 2XVLA 1T7ZA 4PRAA 2CIKB 1UFGA 1ZLSH 2DI9A 5E2TL 4PGCB 1JRHL 2C9VA 4TL5A 1AGCB 1IKFH 1R5WA 3DARA 1NIFA 1OCZB 2X9ZA 1IGFL 4MLSA 3ULUD 4OU3A 3KPSD 5FKAA 4ZXBB 5JIDA 1NH6A 3D3VA 4XMLL 3RNQB 3RG1C 1PZBA 5HHPB 2XUWA 3RA7H 3IFPA 3S36L 2QTVA 1TJIL 4EBQH 4UTCA 1U3YA 3TBBA 3MNWB 3LDBB 4QNPE 2Q6WA 1CUOA 5D1XC 1KBPA 3O41B 4L3AA 3D0AA 1SXZA 4IGBD 5IBUB 4QLWA 4ZTOL 4EN3A 5F9AC 1Z3GH 1A6VH 5GRJL 1N5YH 3JZ7A 3ZIMA 2P7TB 2BVYA 1JWUA 2E27H 2ZKWA 4JO2L 3LPFA 3VXQB 1P4BL 4B9KC 1MVUB 3NBNA 1E2ZA 1T21A 5JO5B 1AHKA 1XMWA 5D7JA 5LGYA 4JS7A 1H6TA 1D9KA 3C2SA 3CQFA 2W9LA 3EJSA 3I6KB 1BA9A 4ZODA 1Y6NR 1ZHLA 3LH2L 4AMKL 1GXEA 1F90H 3OKKA 2DDQL 3U9UA 1ZLEA 4V11A 5IBTL 1CFVL 4HC1H 1NANI 1KENH 2M2DA 4H8UA 1PU0A 4IGBC 5IB4B 4ZX4A 3V0IA 1QABA 4APXB 1IQDA 2ZSVB 4AQEA 3WTSA 4N8UA 1I7UA 3C5JB 4NWUL 2WBWB 1REIA 2RB8A 3LPOA 1L7IH 2YGPA 4OZFG 1YJDL 2ZUQC 4Z78A 4ABQA 1X9UA 4JN1H 3LB6D 2VZVA 3N06B 3E38A 3ARSA 4OJYA 5J1AB 2YPLD 3MJ8A 4HUWA 3HR5A 4HWZB 5F89A 4JKWA 5BQDA 5I0DA 5AW5B 1IAMA 3P1VA 3G5YA 4FLRA 3BVTA 2HVKB 4LLWA 2A9CA 2CJUH 2BP8B 5FF6A 4YSTA 1ERNA 1OAKL 5DMJB 1Q1JL 1PIFA 4GXFA 4Y2OA 3MOAL 4X4MA 2QR0A 1TPXB 4TXVB 4JPVL 1U8NB 5KSBE 4OD2B 2ZG2A 4DKEL 1ZHNB 2ZOKA 3MLVH 5CLZA 2RBLA 2WTRB 5AQ0A 4G59C 1ET8A 1WWCA 2IPUK 4HKJA 5D96C 2YOAA 4XX5A 3LB6C 3ZE2F 2GB2A 3MRKA 4Q74A 4GAJH 3INOA 1KNOA 1X6LA 3GSUB 4FI6A 5ECJE 4KTDH 4QY8A 4YDKL 3RX7A 5I8KH 5KBKA 1E9QB 2VSCA 2DN7A 4HKXA 3NAAH 2V17L 3Q2LA 4LCCA 4JKNA 4HGWB 3UERA 1NJ9A 4C47A 4A7TA 3SPJA 3IM1A 4F24A 2HVBA 2HSIA 1HL8A 2P47B 2V3FA 4JQXA 5CEXA 4J27A 1MCRA 2F7IA 1RZKH 3NCFB 1KLGB 3ZKMD 2X3AA 4HT1H 4F5CA 5KG9A 1WAAA 1X5ZA 2AQNA 4DGUA 4PCKA 3UGXA 4NENB 2HFGL 2YKKA 3FH7A 3CSPA 3U0PB 2PNDA 1DANU 4N2AA 1JNNL 1XIWB 1FL3A 1YO4A 1MY5A 4BZ1H 1WEJH 3VRLF 4P9HH 3RWIA 2VNCA 1NIAA 4GT7A 2J6EA 3VRJA 1A9EB 1LP9E 1XH3A 2FJHB 4JQIL 5F21B 3QZWA 4PB0L 4BQ6A 1FCCA 1MDAA 2Z91A 2P5ED 4UMSA 5IHZA 4Z7NB 2CRYA 4N87A 1UYWL 4ZUSB 4UMGA 3T77A 5T1KB 4H26A 3THML 1MW0A 3W9DA 5TGBA 3OPZH 3VXMD 3CDGB 4CC0A 1O7DE 1TEGA 3BQUB 2FATH 3GJEA 1XSKA 4XCCL 4XVOA 4ZO7A 3ZKMC 4I2XB 1D6VL 5F7YC 5SWQA 5BMFH 3V6OE 1HWWA 4YHLH 1JGLH 2ESVB 3F7LA 3FH5A 4DQAA 4IS6B 5DQ9A 1EJFA 3KVPA 3NZUA 4JFQB 4KDVA 4KNUA 4QHMB 1TQBC 1KEML 3WHXA 3RDJA 3AQDA 5FYKD 3F3HA 1K4CA 4EI5D 3HI1B 4HX1A 4OCRH 3I02B 3PYCA 4DQOH 2XWEA 2PN5A 3TASA 2HPOA 3OX8A 2ILLA 2VW4A 3D18A 4L1BA 1YDPB 4NOBA 3HE7B 3U1PA 1VIWA 2W0FB 4YDZA 1U8HB 5KVEL 4OIFA 4OD3L 2YMXL 1OP5H 3MCLL 1PY9A 5HYSA 2R0WL 4H1LG 3WIHL 5DUPL 5BRZB 1NMAL 5HP5A 4J4PD 3UTOA 4HIJB 1XB3A 25C8L 2MJWA 4GS7B 4CN1A 2I25N 1KBKA 2OJZH 3CDYA 1FV1A 4BDVA 4EI5C 5FW8A 4JDVB 3A6CL 4NNPH 5FEBA 3BESR 3B37A 5EEUA 5BV7H 3MO1B 1F86A 1OAUH 4LVOB 5L2KA 3I74A 1MJ7L 1YEKH 2V6HA 4FZ8L 4NQEB 3NFNB 3CH1B 3QUZB 2Y07H 3MV9E 4JHUA 1RURL 3D39A 5F3HA 1G7JB 3MV7D 5D5MF 1N7ML 3X12A 3ZQWA 2CUMA 5GQBA 2VIRB 4J4PC 2XV6B 2Z7WA 5GGVL 1BOGB 1BWWA 3PDOA 4L4VA 5DJXB 3W81A 5JW4Q 2W91A 3I75A 2IEPA 4LBEA 2BNUA 1W8OA 3BXNA 4TULL 4PPTA 1KV7A 4OZHB 5DURB 4BA0A 3FCGA 3DTXB 2BSBA 4OGZA 1XF5A 1WGVA 1CZ8H 4F1SA 2RD0A 1AHMA 2XV2A 4PMEA 1SUJA 3T3MB 1H3TA 4OZFH 3WG7B 5FFOA 1AR2A 2R15A 1MCDA 1O75A 4OBSA 1LE9B 3RFZB 1BGXH 3H9SB 2D2CC 3SGJC 3KPOA 1H3UA 5SWSD 1K3ZA 1ZRUA 4PJIA 2DBJA 4ADJA 3MUGA 5D7IB 1MNUH 3FNKA 3C5ZB 1KFAH 2JCCE 3EOBB 1U58B 2F53A 3SE8L 4BHUA 4FQ2L 4AYEC 4Q9RH 2OL3H 2OXGA 3WXWH 4L18A 2BY0A 4UNUA 1THCA 3ASNB 4KWUA 3ES6B 3NEOA 43CAA 2IVFC 2OP4L 4Z7QF 3ZDXE 2K4WA 5HDLA 3HBPA 1DVFD 2QZ5A 3REWB 5JW3L 3Q8CA 4ICXA 3S4SA 5C09B 1YEFH 3MGOA 3EGDA 4PV1C 3FO2A 4QF1A 3KPNB 3B1UA 3INUH 4L4TD 3W11D 1YEHH 4YHOL 3AY4C 2CUAA 3UX9B 3S3JA 3QARA 3ZL1A 1FO0A 4Z7OE 1JTOA 3LRLA 3RI5K 2R4SL 1CD1A 2K0RA 3J7HA 4F8NA 1J1PH 1YECL 4JCWA 5KS9A 4HKBA 1CXHA 4HXAL 5CEYB 4U6XA 3MX0A 2OMNA 5F7DA 4XB8A 4PBDA 3SE3C 1RLWA 3F83A 3P2DA 3BHBB 3C2AH 1CD8A 1XAKA 4KJPD 5LAXB 2IQ9L 2OTUA 4OF7A 4JRYB 1K85A 1ZVHA 1XXFC 4WFED 4NGHH 3ARBA 3DHUA 3FOMB 3TYGH 3HPLA 3H9YA 2ODIA 3ATFA 3I9IA 3KPPA 1JUFA 4LPYA 3B6SA 4ZOCA 2PCXA 1ECYA 1DJSA 2WSPA 4WKXA 3F7VB 2ED9A 4H7VA 4IJTA 5B8CB 2V2XA 3QZLA 2WKOA 3BCDA 4MJID 2FECI 3WMSA 3V0EA 4L29B 1DVFA 3ATDA 4G1EB 2ZOUA 2WLJA 1TZAA 5LLIC 4GLRI 2V5MA 3B9VA 4G8IA 4GSDL 4PYGA 4V1DB 5DC4B 4DJMA 4BHUI 4AIXA 3FFOA 5JIQA 3CBJB 4ZSOA 3IFOB 4D9RE 1YYLL 1Q72H 5I1IL 3VXRA 35C8H 1DYZA 1S7WB 2A6DA 2H3XC 4MDIA 3X17A 1D5ZA 3AROA 5LDSA 1HCYA 4FFZA 2VDRL 5AVYB 1CL7I 4PG9B 1OAXH 1RZGB 2V9UA 3RHWF 7PCYA 4X5WB 1L9MA 1WBXB 3BMWA 4ES9A 4E9TA 2F7OA 2X7LA 5IIEB 1Z1WA 1IVTA 3D5OF 4Q7DA 4WHYG 5I15L 2IMNA 2WTOA 1A21A 1JGUL 3ZLQC 2ED6A 4Z8FH 5GSRA 1QFOA 3CFBB 1NC2B 1PG7W 1X9QA 3CZNA 4PW9A 3FT0A 1ES0A 1UUSA 3HZ3A 2CDEB 4OLXH 4XNZB 3G5XB 1FHGA 1MEXH 2IQAB 3DUHA 1HJCA 4F7EB 2C1PB 5L6YL 1TUPA 4NT6B 1OSPH 2ARJA 1R19A 2E8YA 3M8OH 2O61A 1I8KA 2P5WD 1S5IH 2V9RA 2WNGA 1AO7E 2WZ5A 3FTXA 4Y1TA 4ZPVB 1CLZH 3LZLA 4NPKA 4POYA 1S7UB 4C56A 5E4IA 3NIFE 4WW2F 1KLFB 2Y7QB 1HQRA 1U2HA 4UTBL 5BOZG 3DO7B 2I60L 4POZD 1ZWIB 3D7PA 2W65A 3BKML 4NKOA 4ZO6A 5I1EL 4AZUA 1IL1A 1ZXKA 4U6YA 3QR1A 2OBGA 1EAPB 4Z3HA 5DJZB 5ACLA 2VLJB 3VXSE 4HK0B 5BNXD 5CCKH 5T8IA 2JKLA 3VA2C 2A6IA 3HI6H 3EDKA 5A2LH 3MBED 3V4LA 2BO0A 3S37L 4OGYL 5CS7A 2GTZA 1QVOB 4G8FA 1OO2A 3UJJH 2B1HH 1SHMA 1VA9A 1HSAB 1JK8B 3HS0A 4GRLA 3ARFA 4XP4H 4XXDB 5EZPA 3FO1B 4X8JB 4YDIL 1SJEB 2DQTL 2R56L 2ODHA 1N10A 4NSKB 1T1XB 4K3GA 1XGPB 4XCFL 2I32A 1AGFB 4BFIB 1NBQA 1DTUA 5D1QB 1YEDA 5KYWB 2P5WA 4JFEB 5FUCE 4OLYL 3CBRA 3T4AC 3UYPA 1TQTA 4L8SB 4LL4A 4FFYL 5IK3A 5CAYB 4ELMA 1W6LA 4K3JL 1RPKA 2DYRB 4UYQA 3OHXB 3JVGC 1SQMA 1VADB 3MBEC 1GZPA 1ZS8A 2MHAB 2OX5A 4XE0A 5J5EA 1H3PH 1IE4A 2QQKL 3MRPA 4AV0A 3K71A 4G6KL 2B15A 1NIBA 5C0FA 1Y18B 4DZ8B 3JWOC 5FO8A 2AMUA 1J05A 5CSGA 4AZ8A 5JXAH 4DKDC 1USZA 1QOKA 3IETB 5FDWB 1IGCL 1MIEL 1U95A 5CINH 3LZOA 4AK2A 3H4FA 2YK1L 1K6QL 1U92A 2BMKB 3L4WA 5A43C 3HE6B 3HUJE 1A02N 2YUVA 1P5UC 4XCEA 3F6IA 1NIEA 4H5SB 1WISA 3GSOB 4OQ1A 4ZNEE 2HLAA 1U21A 1Z9SB 4BH8A 3EO9H 2IO5A 5FX3A 4OFVA 4YHZL 1PS3A 2BVEA 2GSIA 4PJ7E 1J1XL 3E9UA 1DEEB 4XWOD 1QD0A 1AG0A 1MW2A 2XA3A 3U79A 1WPCA 5I8OL 5LWYH 2BHUA 2ARWA 1WE5A 4NPYB 2PMZA 5ES4B 1DQDH 1L0QA 3CDFA 3NIDB 1CE6B 1WVZA 4RDQF 4QR7A 5F6HJ 3T0XA 1GPOL 3BPNB 3IJ7A 2YARA 5ABAA 3QG6B 1ND0A 3VH8G 4I85A 4HIEA 5I28A 1HESA 4NOFA 4Q6IC 3L7FA 5AB0A 4ODVL 3MODH 4IOIA 3GRGA 1LK2B 2Y6TE 3LNIA 4PJGA 1XF3B 3SY0B 5EZOH 2DMGA 3UAAA 1N8ZA 2DLTA 5ANHA 2VXQL 3NK3A 2SEBB 1E8XA 3SBQA 4XWOC 4U1KB 2NNAA 4HIHB 4XMWA 3RUGA 4B9IA 5D2NE 4KI5F 2YJQA 2PO6A 4IRSB 4ZK8A 2L04A 4KK8D 4XP9H 3DX3A 1NGWB 3MCKA 5MP6L