2FQDA

Crystal structures of e. coli laccase cueo under different copper binding situations
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
487
structure length
464
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of E. coli laccase CueO at different copper concentrations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 130
structure length 464
sequence length 487
ec nomenclature ec 1.-.-.-:
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqdA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqdA03
1TEFA 1HAWA 4JHUA 4JHVA 1EZLA 1WA2X 1CC3A 1JXFA 2IH9A 4A2GA 3QJVB 5IY5B 2HRGA 1A4AA 4F2EA 4Q8BA 3FSWA 2BO0A 1TEGA 4YL4A 4HHGA 1A65A 3IN0A 2PPEA 5AKRA 1GS6X 4DPCX 1A4BA 5B7MA 2EINB 1R1CA 2CCWA 3CZUB 2EIJB 4YSQA 2BW4A 1SHXA 2PCFA 4HCGA 2XLLA 3AW5A 4KNUA 2VM4A 2XV0A 1NWOA 4K9JA 3FT0A 4DP4X 1A8ZA 1IC0A 1WS7A 3T6WA 2CJ3A 3PAVA 4YVUA 2EILB 2YAHA 4A2EA 1AZBA 2PPCA 4DP7X 1A3ZA 3WI9A 3CDZB 3FQ2A 3HEIB 5D4IA 1ASPA 2HLEB 5B1BB 1NPJA 2YARA 4YSDA 1DYZA 2H5UA 3N55A 3MX0B 1SFHA 1T5KA 1WA1X 1JERA 1JZHA 5D4JA 2QDVA 2Y1AA 1L9SA 2GHZA 3ASOB 3OD3A 2BP0B 1SJMA 3CVCA 3FPYA 3T71A 1BAWA 3NJGA 4KO9A 5F7BA 5EHFA 1FFTB 2Y69B 3OMNB 1QNIA 1ZPUA 3IN2A 1PNCA 1IKOP 2WO3B 2X87A 2DWTA 4Q89A 2PPDA 2FQDA 3S8GB 3NJKA 3PCYA 1NWPA 1RCYA 1AANA 1HAUA 1ETJA 1RKRA 4KO5A 4MFHA 1PF3A 1CYXA 3RYMA 1NIFA 1ET7A 4TXVB 1J9QA 1PLBA 3H4FA 2CALA 4BK5C 4DP0X 1L9PA 3T6VA 7PCYA 1BXAA 2P80D 3MBWB 2B08A 1JXGA 3QJTB 5TK2A 3FSVA 4M4RB 2PCYA 1MG2C 2GC4C 2IDTA 4DP8X 1M57B 4HIPA 3T6ZA 4GP5B 2Q9OA 2UXTA 3H4HA 3AG3B 3ZDWA 1PCSA 3CVBA 5F7AA 3FU7A 3KW7A 2WSDA 3PLYA 2B3IA 4QLWA 4HZ1A 2DWSA 3EH3B 1NIAA 2YAOA 3U25A 3X1BA 1JZIA 1X9RA 1ID2A 3ABKB 3TA4D 2XX0A 1PAZA 2GIMA 5TK4A 1NDTA 5ANHA 3FYEB 2NRDA 4YSEA 4YSAA 1FA4A 9PCYA 2VN3A 1X9UA 4N4YB 4UAHA 1A4CA 1BXVA 2UXGA 2IAAC 1SDDB 1KBVA 3FPXA 2BHFA 1OCOB 4G71B 4W1TA 1ET5A 5LDUA 5I6PA 2YXVA 4JKNA 3GYRA 3WKQA 3NJLA 2DV6A 3DKHA 4YSSA 3TASA 2EIKB 4GYBA 1PZAA 2OJ1A 4E9VA 1V55B 2HX8A 5I5JA 1CURA 1JZJA 2IDSA 3OM3B 1V10A 1AZUA 4DPAX 3JTBA 4HCFA 2AANA 5I6NA 2R7EA 3V9EA 2BP8B 3TBCA 3IEAA 2JKWA 3BQVA 3ABGA 3FU7B 3T9WA 3UADA 3AZUA 1OE2A 2GBAA 5I5IA 4WKXA 3NJJA 3S3CB 4DP2X 2I7OA 5B1AB 1GR7A 2MTAA 4BWWA 2YAFA 1KV7A 3PAZA 4W9ZA 2QT6A 3NP3A 2ZOOA 3OMAB 4QKTA 4KNTA 5A7EA 4NB7A 2J56A 2IDUA 2BZCA 4YSUA 3X1FA 5AFAA 3S3BB 1ZDSA 1BQ5A 4E9RA 3X1GA 4CSZA 3NSYA 1JVOA 1SHWA 2XUWA 1AAJA 3BVDB 2JFCA 1GSKA 3WKPA 3WNJA 3PXLA 1NIDA 1KYAA 1PMYA 1N68A 2IWKA 4KO6A 5PCYA 4N8UA 5B1JA 4YSTA 3FYIB 1OV8A 3NSFA 1BXUA 2ZWNA 8PAZA 1XB8A 2UXVA 3UACA 4FAAB 1OCRB 3AG4B 2HZHA 4E9TA 4E9QA 4G7QB 2XU9A 2UXFA 1W6LA 1SF5A 2YAQA 1AQ8A 2R7EB 1ASOA 4AKQA 2YAPA 3H56A 1KCBA 2PLTA 1PLCA 1KGYE 1WA0X 1RZPA 4HALA 2BWIA 3S3DB 4YSCA 4NERA 4AI7A 3TBBA 3NJHA 4UANA 5I6MA 4GY4A 5FC9A 3FS9A 3ABLB 4GXFA 2TSBA 2HRHA 3QJQB 1E5ZA 3X2QB 1TU2A 1KDJA 1J9TA 1IBYA 5I28A 3WNIA 2DYSB 2BW5A 1E67A 3ASNB 3ZBMA 4BDVA 4UF7C 5I6KA 2VSKB 3QQXA 1NZRA 3GXUB 4P5SA 1GYCA 1J9SA 3UABA 3FQYA 2XVBA 3X1EA 2BWDA 3PAUA 2GI0A 1E5YA 1DZ0A 4G7SB 2I7SA 3EHBB 4G72B 4BXVA 2H47C 1ILSA 5B1JC 1OF0A 1HFUA 5B3SB 4HAKA 1AS8A 4G70B 3UAEA 1KCWA 1ZDQA 1PNDA 3AG1B 5I26A 1AACA 2XYBA 5D4HA 1NPNA 4AX3A 5I6OA 2FWLB 4YSPA 3NJFA 1MZZA 1NIEA 2YAEA 2VW7A 1OOWA 1ZIBA 1W6WA 2PPFA 3QJUB 4P5RA 5I6LA 1SFDA 5I5MA 4F7KA 1J9RA 4CSPA 2HXAA 1GS7A 2AVFA 1M56B 2CBPA 2IWEA 3NYKA 1AIZA 4X4KA 1V54B 1XB3A 1BYOA 3UAAA 4BXSV 1TKWA 1CYWA 3NJMA 3QJSB 4ZK8A 4HCIA 1IBZA 4YSOA 2PP9A 3FSZA 1AOZA 3T6XA 3WIAA 2IWFA 4DPBX 6PCYA 4HHWA 2XX1A 4G7RB 4PAZA 2MRYA 7PAZA 4BDVB 3SBQA 2ZXWB 3AG2B 1OCCB 3CDZA 2VSMB 2FT7A 1JZFA 3D12B 1WAEA 2WO2B 2XV3A 2ZONA 1PLAA 1NIBA 4BWUA 2X88A 1L9RA 3X1NA 4E9XA 4KOCA 4YVNA 1OE3A 3NJIA 2BP0A 2EIMB 1GS8A 1JZEA 1E30A 1J5CA 4A2HA 6PAZA 5B7EA 4E9WA 2FQFA 4KO7A 3ZIYA 1KDIA 4DP5X 3NSDA 5E9NA 1M9WA 3ERXA 2Q5BA 4BWTA 3HB3B 2PP8A 2FJSA 1VLXA 1AR1B 1AG6A 1RZQA 3KW8A 3NP4A 4M3HA 4EF3A 4WTQA 3FSAA 2CUAA 1ILUA 2YXWA 5AZUA 4A68A 1XB6A 2GC7C 1OE1A 2XXFA 4KOBA 2TSAA 3OMIB 2PP7A 3SQRA 1PZCA 3GDCA 1WS8A 2GSMB 2QDWA 2XXGA 2CAKA 2DY2A 2LLNA 4NAJA 1B3IA 3UGEA 1BYPA 2OV0A 3V9CA 1ASQA 1EHKB 1ZV2A 4AKPA 1AS6A 1ET8A 4GP4B 2XV2A 1N70A 1OCZB 1L9OA 2OCCB 2VW6A 3SBRA 2UX7A 2AFNA 4L0PB 3EH5B 4YSRA 2I85A 2QPEB 2YQBA 4A67A 1GY2A 2DYRB 2W8CA 3IBOA 2BZ7A 3FQ1A 1QLEB 1NICA 1JZGA 2RACA 4GP8B 3SBPA 3NT0A 2N0MA 4KNSA 3DTUB 1GW0A 1FWXA 2YAMA 1L9TA 1SDDA 4AZUA 5B7FA 3FU8A 1SNRA 2J55A 2FT6A 2VM3A 4PCYA 2JXMA 1MZYA 3QJRB 2PPAA 1MDAA 1BEXA 4A66A 2FQEA 3JT2A 2XWZA 5PAZA 3ABMB 1AS7A 1ZIAA 1XMEB 2AZUA 1JOIA 4F2FA 2FTAA 3IE9A 1E65A 4DP6X 2A3TA 1URIA 2VW4A 2J5WA 4E9YA 4FA7B 1YLBB 2P80A 1NTDA 1AZRA 4DP9X 3DIVA 3CG8A 2IDQA 2W88A 1AG0A 1J5DA 2J57A 3S8FB 2BP8A 1F56A 1I53A 1W8EA 3ZX1A 2HX7A 3QPKA 2QPDB 1AZCA 3NSCA 3C75A 1KBWA 1JXDA 4E9SA 1BQRA 1UATA 1PY0A 3EF4A 3N2JA 3PPSA 3L45A 2HX9A 4DP1X 2FQGA 1QHQA 1JVLA 2GB2A 2H3XC 2IH8A 2AZAA 5B1KA 4A2FA 1SF3A 1IUZA 4A2DA 2E86A 2FT8A 2FNWA 2IDFA 1MG3C 1AZNA 3G5WA 2VMJA 1CUOA 2UX6A 4ENZA 1ADWA 4RH4A 1PZBA 1NINA 4AKOA 3EH4B 3NJNA 3TU6A 1L9QA 3OQRA 3WG7B 3CVDA 1GY1A 3AY2A 1BQKA 3FU9A
chains in the Genus database with same CATH superfamily
2QKIA 1CFVL 4FQ2L 2EDQA 3DUHA 1H3UA 5D70H 4ECNA 5E51A 4E5XB 4M48L 5G2NA 4CSSA 1DJHA 1MY7A 2BSCA 2HRGA 4ZPTA 1AGCB 5AZ2L 4L0YA 2VR4A 1LLAA 1TEGA 2DLTA 3ARGD 3D39B 3QEQE 3QH3A 4PGBA 4HW6A 4HHGA 4F2MB 1J5IA 3FQRB 2ICWI 1WC7B 1JL8A 1X5HA 3KYMA 3VG9B 3KPRD 2NY2B 3W82A 3QXAA 2A77H 2PCFA 4FQXC 5EIIB 5L9DL 4KNUA 5BCAA 3SKNB 2AK4E 5EO0B 2UZPA 1L0QA 4S0TD 1M3JA 5GRUL 1N0LB 1T89A 3WTXA 4L8DA 4MDJB 1OKEA 5J4MA 1RPKA 3BRFA 2FR4B 4FFZH 2ILLA 5ES4B 3ZO0A 3WI9A 2HWZL 4MCYB 4BFKA 1JYNA 3G9AB 4AENB 5JW5B 5C09E 5IVZB 2FIKA 4PEEA 2E9IA 1QQDA 4PHZA 4FHJA 4LSRH 5SWZB 1T5KA 1S7RA 2IALA 3BYYA 4QXWA 4HMDA 1MQKH 4G6FB 1P4UA 4G7VL 1AP2A 3ASWA 4XBGA 2DYPA 3FPYA 1Y6MR 5FA3A 1XH0A 3FCTB 4KROC 4JFXB 5D2NB 4PTUB 2PCPB 4WK0B 3TBVB 2VR3A 4OAWB 4TNEA 3ABZA 3BVWA 2Y4SA 2FQDA 3DRQB 3QRFM 1Y7VA 4OGYL 3UC0L 5FGSA 1ORQA 3QO1B 4JZOA 1L7TL 2WIIB 4FNLH 5CUSH 4NQVA 5C0GB 1JGUL 3U48A 3WFDH 3O6FB 3AXIA 3VGHA 3VWJC 4PP2A 4AQ1A 4R0LC 2CALA 2VXQA 5E5RB 5GRVK 1L9PA 2X0VA 5C0BB 4DP0X 1U0QA 5ICYA 2ARJA 5GRWA 3FU0A 1G7LB 3IU3B 3KVPA 3QDJE 5E08H 5EWIL 2VDML 5DVNA 5C0AD 5DGRA 2WQAA 4EIZC 1ZT4A 2R1XB 3II3A 3K81A 4PW3A 4EUPG 4I0PC 1J8HB 1A3RH 4ZTEA 2DLFH 4BHUI 2Q2LA 1F5WA 2X4RB 4EDWL 5HJBA 2UXTA 1JXKA 1WJ3A 3PGDB 1JFQH 1V7NL 1ZPLA 2KS0A 3FJTA 2D7QA 4JDZB 1YYCA 3GZPA 3SE8H 5E6IC 5BXFA 1TEYA 2RR3A 2OI9B 3E0GA 1BIHA 2Y36L 5E1QA 4G9DB 3PDOA 4LESA 1A6UH 1QRND 3CCHB 3CGTA 3L2LA 3H9SA 4XNZC 1X9RA 5GRJL 4H40A 3CH1B 2C8NA 2GIMA 4NQUA 4UQ3A 2VERA 2SEBA 5E8DH 3GSQB 3R0NA 4JRWA 3O2WL 1X9UA 2XN9B 3O45A 3X13A 5KANG 3IDIA 2Y7QA 1KELH 1TJGL 3RFZA 3W0WE 1DJZA 2B1HH 5LLIC 3VNZA 1E4XH 3OJMB 3CUPA 4UTBA 4M6MH 2LU7A 1Q9WA 2V17H 3GJEB 2HLAB 3AWEA 2VLKD 4IMKA 4NO0D 4KROD 3TO2A 4D9LL 4ILDA 3ARPA 2ADJA 4D0BB 1DDHB 4KY1L 1SJHB 1TJHL 1X44A 4JM0A 4FQLH 5I1EL 1WTLA 2Z31C 3DUUA 4DPAX 1QI3A 4Z7NB 4OV5A 1JVKA 2JNZA 3WSQL 4F57H 4XP9H 2VMCA 1H0DA 1BF5A 2Z4QA 3GS0A 3AMLA 5EULV 4AEFA 3GMQB 3TIDA 4BIKA 5J13B 3GLEA 2PR9A 1BQUA 1DQVA 4DK3A 3FU7B 1GKOA 4MMYB 4B0MM 1BGXH 1YNLH 2DI8A 3CMOH 4J8QA 1X5GA 1QFWH 4WKXA 3L3HB 4AG4H 2FBJL 2CIKB 4XWOC 1A1OA 3RY4A 3QGVA 3O11A 4MWFA 2YK1H 1M7DA 3GB7A 3GTNA 3LHAA 3GSUB 4PRNA 3V2AR 3CDGB 1M1SA 1YUKB 3BXNA 3QEQA 1E8WA 4NFDA 1ZLVK 2FJHA 2GJ6B 1I1FB 1MJ7H 2Y7MA 4AYID 4I0PD 2IDUA 1DBMH 2IANB 1LO3H 1KXTA 4C55A 1WIPA 3K74B 4DKEH 5AVYB 1KCLA 3BCFA 2WQWA 3ZR5A 3BVDB 1EA9C 3OAZH 3C60C 4MNHB 3QJZA 3ZE0F 4AMWA 5E6ID 4HD9A 5D1ZI 1OAXL 2AMGA 1D6EB 3BDYL 3LV3A 1KYAA 3ULVL 1OF2A 2BSTB 2CCLA 4NKIH 4YDVB 4A6YL 5TE4H 2A4EA 3DA0A 3N6YA 4IIZA 3QG6A 3DPDA 4JO3L 3QUXB 2DJSA 3EO1B 2EEAA 2JIXB 1MCWM 3C09B 2ESVE 5EBMA 1AGFA 5CGMA 5C09A 3WFHA 2FWOB 1RSYA 3ZMRA 4M1GH 2YAQA 1E4KA 4IRSC 3NZUA 1ZHBA 2HJKB 1ASOA 4WW2A 1PAMA 3GSXA 1KCBA 1OM3L 1JMXA 4X8JB 3FQWA 1M7UA 4RZCA 5I2IA 3R4RA 5D2LB 4TTGA 4P4RA 1B2WL 4OF8A 1BZEA 3X2QB 1TU2A 1MLBB 2DEYX 1T3FA 3ZU8A 3GMRB 4B9PA 3MMEB 2ZOTA 3CC1A 4NAMA 5T1MB 1GJWA 4Y4KB 5AW8B 3X12A 2OA9A 2Z31D 4N2AA 1H3PL 3HZ3A 1NZRA 4OIBA 4PREB 1GYCA 3OB0H 3RGHA 4YMPA 5FHAH 4AC2A 4AMKL 2AEPL 1S4IA 3ZTCC 2O6FA 1TQCC 4UQ9A 1QSEE 3M8OH 3QHFH 3ZZQA 3CFBA 5T3XD 2H9GA 2CDFA 2XYCA 3OKNA 4L8SC 3RWGA 2IJ0C 1U8OB 2WQUA 3QDJA 2XG5A 4IHOA 4J3OG 2G5BA 4OD1H 1AACA 3PP4L 2W9EL 3B2VH 3CJJA 3KXFE 4MYWB 5D4HA 2ZNXA 5BOPA 2HMIC 3UO1H 3E8UH 4HIEB 4Y2DC 4FJYA 2ZX6A 2D9QB 4BFJA 4JPWL 3S5LA 5I5MA 4UNVA 3PFUA 1NUDA 1X5ZA 4IDJL 4QXVA 1KGJA 2CBPA 2DQJL 5JDSB 4F7MA 1XB3A 5BV7C 4Y4HA 1FLRL 4ZO6A 1Z5LA 3DX9B 3QQNA 2IF7A 2ZOKB 4TM9A 3PUUA 1UB5A 2PKDA 1T1YA 4WI0B 1DVYA 1I9JL 1KXVC 1FYHB 1IC5L 5I1DA 3UYPA 3SGKA 2FO1A 4P23A 4X7DC 1QO3A 3IMSA 1ONQB 3SBQA 3ZYJA 3W0WA 3W57A 5T5FH 4XPAH 4M6OH 3QORD 4Q9RH 1E50A 3UZEA 5I17B 3IMWA 1UT9A 1MFDH 2DN7A 1FORL 3GXMA 5CU9A 1SEBB 4X7CC 5F96L 4AIXA 4RDQF 4WLCA 4DGUA 5B7EA 1MNNA 5E2UL 2DDQL 1EXGA 4NOFA 4WUUE 3ILEA 1Z5YD 4JFQA 4KXBA 5EU4A 4EMZA 1LYQA 2OMYA 4P3CL 5E6UB 3BSGA 5CEYA 4M5SA 2XNAB 2LFGA 3MRQA 3BZ4B 5TE6L 3VI4B 4JHWL 1G7HB 4GRMB 5AZUA 4GXVL 1XB6A 1BQLL 1KGUA 3L5XH 2EH7H 4J5VA 2FGWL 1QSFB 4XP5H 3U0PA 1PZCA 1ODAA 1EBAA 5EDSA 2QDWA 5AOLA 4OZIF 2X28A 3FULA 2XXGA 3WTUA 4Z7UF 2CLRB 1S7TB 2ROXA 3UROR 4XCFH 2HMID 4AQ8C 4IQHA 4IRZA 4W9IC 5CCJA 4Y2DD 4ALAC 2Q1EA 4HLZG 5LNEA 4RWYH 1KLFB 3WEOA 5L2KB 5J12B 1F18A 4M8RA 2EACA 4R97B 3PIQB 4L0PB 4FL4C 5E8EA 2ZOLA 3V4VL 4IS6A 4PP1C 4Z23A 3VFNA 4XNQA 2OSXA 4HETA 4PGJA 4WI9A 1W15A 3UXFA 1AXTL 2ESVA 5HDWA 1G7MB 4JFEE 1YAZA 4Y5YC 4K3DL 2I24N 5AVTB 2ZUQB 4BEIA 4Z7QE 2R8SL 3ZDZB 2EXYC 32C2A 3HHMA 4N0CC 1DO6A 1SRDA 5D71H 4HIHA 1I4FB 4OSUH 4PH8A 2VDRB 3SJVE 5EBWB 1KN2L 4BZ2L 1GC1L 2PW2B 1MI5B 3JZ7A 1Z7JA 1HIML 3H9HA 2X7LB 2X42A 2XQ0A 3LKOB 1KNOB 1XTMA 5IB3A 5JOPD 1P5UB 2IG2H 3MV7B 2YA1A 2A73A 2BVQB 5AAWC 4O5LH 3ABMB 1AS7A 2A6KB 4WHTA 5DHVH 1WV7T 1GMIA 1P9MC 4RMVA 1EEZB 1K2DA 3RBGA 4OCXH 1URIA 2IMMA 4XR8C 1QATA 1G0YR 1L6PA 1J1OH 3LIZA 4BRJA 4GUQA 1QSEA 3MLZL 4AM0Q 3T0EC 2DLIA 1SHMA 5FDWB 3S8FB 2GABA 2AW2A 3BT2L 1DTUA 4XMKH 1DDTA 1SBSL 4NXSA 4PV8B 3FFCE 4G6AD 3C75A 5FYJE 3TA3C 1XCWA 5JA9A 2DBJA 1DN0B 3KXFA 1RJLB 3HFMH 4DP1X 2M83A 3FUNA 3HVNA 5I1HH 1YMME 3AT9A 4MQTB 5TGBB 1KPVB 2OK0H 3V0IA 3KJ6H 5FLUA 5DD1L 1IARB 5JLZB 4B27A 2FNWA 5F6HJ 1IEBB 1JPST 2BLFA 2X4PA 4PB9L 4ZQTA 3J8F7 3P73B 5ENWA 3VFPB 3NCJL 3SE3A 3L3DA 1HI6A 3IF1A 4OZFB 2X1QA 1I8UA 1BEYH 1MFBL 3C2AH 1CTOA 4PP1D 1F6AB 1T0OA 5DQJB 1KTKE 4PGEA 4PJCB 1FBIH 2Y2WA 2CDEB 2BY3A 2P3YA 2LAGB 4LPXA 4R4ND 4QY8B 4PB0L 1DO5A 3BEVB 4LOEA 1HAWA 2CIIB 4ZMZA 4H0GA 1MCPH 2BFVH 5JR1H 3BSHA 3GJFK 3O4OB 4ZMYA 1XIWB 1CN4A 4WEMB 1HU8A 1SJXA 3AU1A 4AUYA 2EXYD 1A3QA 1UACH 4N0CD 3N0AA 1XBRA 5SX4I 4H5SA 1U6AL 4S1SL 4NO3B 1A65A 1TZGL 4GS7C 5AALA 5F44A 1A4BA 2JKSA 5B7MA 5J5EA 5I0ZA 2GY7B 5EC1A 3SY0A 3I9PA 2EUWA 2NMSA 4FQQB 3CBRA 3UBGA 5FEBA 3MOAH 4I0KA 4WUUA 5JDJA 3KPRA 3F12B 3QDME 4LK4A 4DP4X 3KZ8A 4YHMH 1CXHA 5D8JL 5F3HB 4YHIA 2IIJA 4F3FB 1NMBH 5FOBB 1CG9A 4PWGA 1ZANL 3T0ED 1YC8A 2A1WL 4GI8A 1ZT1B 4QRUB 3UG5A 4A39A 3TA3D 1LEGA 3OD3A 4LDOB 4Z8FL 1RIHL 4HS6A 3U83A 2IFFL 1GYUA 1DLHB 4MZ3A 3VYPA 1F8TL 2IBGA 5LG1A 2O6EA 1CD8A 1EEYA 1AQDA 1URLA 5ANMB 3TF7C 4KXAA 4ICWA 4K9EC 4Y19B 3SDCB 3JYCA 1G84A 2VZOA 4ZOEA 4X50A 4UB0H 3ARDD 4YHKL 1TJIL 3ECWA 1S5HB 2H8PB 2OYKA 5FCUL 1G43A 2WZ6A 1RKRA 3FFDA 1A1NA 1ETZA 2J20A 1RULH 3FTVA 3MJ9L 1G1CA 4H8VA 1ID5I 3RYMA 3PV6A 2OZ4H 4EI5B 1WFOA 4JFEA 3GZQA 4P5TB 5I1GH 4QDGA 4XZ4A 4P2OA 3BVTA 1MCRA 3VO0A 4DVBB 3FO2A 4GKOA 5DS8B 5I66A 4NFCA 2XETA 4QPEA 3MBWB 4MA3A 4OFKA 2H1PH 3VH8G 3A24A 4B5ZA 3QZNA 5GGQL 3APMA 3L13A 5DI8B 5C6WH 2KBGA 1NM9A 3SJVA 3HNVH 4MQSB 4ZD3L 1A6AA 1HKFA 3C8KA 4EBQL 3H4HA 3WLBB 4YE4L 3MI6A 3TEUA 3RUGB 3L3GA 4ZZKA 4K5OA 5K9JH 4YDJB 2HTKC 5GGVY 5C3IA 1LDPL 3QXDA 4ELKA 1ZLWK 2WCGA 4Z18A 5ESVB 3EH3B 5E9DB 3WXWH 2X2YA 2WXMA 1Q9OB 5EPMA 4GKZA 1F11A 3TH4T 4HS8L 3TBSB 1JZIA 1WFIA 5AOIA 3VQMA 4FQXA 1Z3GL 2G0KA 2PETA 4LSPH 5D6DA 5L2JB 4GQRA 2Y1ZA 4YSEA 2HRPH 2WD0A 3OLDA 4Q2ZA 3FFCA 5AKVA 3SPCA 2R4RL 3LH8A 5EMYA 5E24E 4ODWB 4J1UB 3C9NB 4OF7A 1XD1A 3MRGA 2LT9A 3EDEA 1YMMA 4XVOA 3UTQA 4LLWA 2V3EA 1MHPH 2VLRE 1NAML 1IILE 4FLHA 3T3PB 3DETC 4PJBF 4GT0A 1QR1B 1VZHA 1TMCB 4YBHA 2JI1A 4FG2A 1K4CA 1S7QB 2HX8A 5D70L 2IQ9H 5D7LB 2DM2A 2IBZY 1KJVA 2VLKA 4RMWA 5KUMA 4D9QE 5IKCB 1BZ7A 1T0PB 3QQ9C 5SWSD 3WEXB 3WIFA 3B2DC 2QGCA 1MW0A 3CSFA 3OQ3B 4F1ZA 2XA3A 1UVQB 1JHTA 3CZSA 5D7SH 1JDDA 3DNKA 4R84A 3MFFA 3CZNA 1UZ6E 2A77L 5CD3A 2AKRB 1FG9C 3JTSA 2MTAA 2ADIA 2Z1KA 3VWJA 2ENSA 3N44B 3MOQA 4B60A 4MZRA 3KPPB 1V05A 3NP3A 2DW5A 2QMJA 3U4BH 2BVUA 1XF1A 4FFZL 2ENYA 4AQEB 3FTYA 4TULH 3L5WA 1U92B 5CN1A 1YN7A 5EZLB 5E1AB 1IE5A 4OD2B 4NHUB 3WTTA 5DC9B 3RVTC 4Z77B 4LSRL 5C3TA 5F7UA 2HTKD 1GSKA 3MRJB 5A2KH 1MQKL 2Q8BH 3OLEA 3QDMA 4EPSA 4MNQD 5FW7A 2BK8A 2NCEA 1PX3A 1YDPA 3QFGA 4BH7A 3FYIB 1KLUA 3NK3A 3QC6X 1BXUA 4L9LB 4JPIA 3T4AA 5CFAA 4JY5H 1K85A 1PD0A 4FFVC 3VXSD 1PEWA 4S10A 4FFWC 3EOAA 4PJ8D 1HWHB 4AIEA 2B9AA 3MGOB 4PG2A 5D7JC 2EUXA 2VDNB 3BH9B 5CUSL 4FNLL 1BX2A 3CE1A 3LNIA 4OGAD 4LF3B 4W9LC 1PY9A 4XH2A 3FF7A 2W80C 4QXTA 4R3SA 3TWYA 3WFDL 2AV1A 3BT0A 3E9UA 3AVEA 2WAHA 4RIRB 4DEWA 3N5AA 3VQ2C 5JIDA 3FO0H 4UU9B 1EANA 3TWCH 5AQ0A 3OJVC 5BRZE 5CEZD 1T6VN 3OF6A 4HF5H 2WVSA 2DYSB 4G3YH 5E08L 4FG6C 4BDVA 4NQCD 4ZG1A 3QQ9D 2PYED 5C0IB 2DWEA 3MNVB 3U36B 1MHEA 2HCZX 1A3RL 3F04A 2DLFL 3G5ZB 4XC3H 3DRTB 1SDAB 4K2UH 1V3MA 3TTSA 4GRLC 5ABZA 1JFQL 4U1HB 2DIJA 1SJEA 2D3NA 4LLVB 2WTOA 5CGTA 4BXVA 4KKRA 3SE8L 5MEOB 4NO5A 4IJ3B 4JNXA 1HXYA 1HH9B 4JFFE 1EJ6A 5L4FA 1GGIH 2XYBA 3ZE1E 4R2GB 1HE7A 5C97A 5I6OA 3K2UH 1J88A 5EEVA 1A6UL 4TLKA 2J5LC 2FJFA 3L4VA 1XGRA 4HGWB 4ONFH 5E8DL 1ZAGA 2COVD 4DKDC 4L3EB 3D34A 4CSPA 4G8IA 1T7VA 4WGVB 1KELL 3U79A 3TEZA 1ZS8A 1KJ2A 3IDGA 2PMZA 3TYFB 2B1HL 3VYNA 1E4XL 1TJXA 4PJFE 5B38B 5IQNA 2TRYA 4M6ML 2J21A 4LCCC 3I75A 4Y2OA 2V17L 2KLRA 2OCJA 3C60A 2AXGB 4FN0A 1EXUA 1P7KB 1UUNA 3WY1A 4DO6A 4WWID 4DPBX 3OSVA 1XXFC 3QUYB 3DJ9A 3UTZB 5C0DA 7PAZA 2PWGA 2XWDA 2FCBA 5F9DC 5FV1L 1KJ3H 3ROLA 3W37A 5D1XB 1XV8A 2XY2A 1XO8A 4FFWD 2O6CA 4FQLL 2VSMB 3PP3K 4X0KB 3P30H 1A7PL 4U0RB 5GGTH 3EAKA 4AYFB 5L4MA 4F57L 4XP9L 1FAKT 4F37K 4RDQG 4J4PC 2VLRA 4F9LC 3QUMA 1TQTA 1OE3A 4IRSA 4KAQH 4NO2A 3NJIA 3NVQA 4U3SA 5AW5B 5ILTH 4KPHH 4PWIA 3CXHJ 3OHXA 1BGXL 1I3VA 1NGYA 1YNLL 3CMOL 3DO4A 1QFWL 3IJEA 3O0RH 1K4DB 3WNMA 4AG4L 1QZNA 2VNCA 4HUXB 2H26A 2VDRH 4Y4FB 3OG4B 2QQNH 4W68A 2YK1L 1S9YA 3STZB 1CGXA 2P7TA 1N2RA 5MENB 4H88H 3DV4B 2XFXA 1AG6A 1MJ7L 3VRLF 4AV4A 1DBML 1LO3L 2H0EA 1QLFA 3GLAA 4GRLD 1YAIA 2VT0A 3QIUC 1FG2A 1NCWH 4JFYA 4DKEL 3PWUB 1BYNA 3H9YA 3JVFC 1SOQA 3FF8A 4NI6A 4U1SA 5C0FB 5GSVA 4NNPH 4RQQA 5AW4B 1I75A 1NL0H 1THCA 4LKXB 2ED7A 2J7LA 1MHCA 1FZMA 1MFMA 2V4LA 4YDLC 4NKIL 1EMTH 5TE4L 4NAJA 1TPXB 3DX6A 2C34A 3SE9H 3U6RA 1DVZA 3HW7A 1ASQA 5AZEH 1E5UI 3DMMC 7CGTA 4MMZB 4QRSA 4M1GL 4LAQH 1YN6A 5EUKA 4OJYA 3EDJA 3L9YA 4W9CC 3DX2A 1NCBH 1IZJA 3BIKB 3BESR 4ZW6A 3P4NB 1VCBC 2GT9A 1HZKA 3QZOA 5GXBB 3RWDB 1W0WA 4OF3A 4BD4A 2APTA 2E7CA 3LEXA 1R24A 5KBMA 3DXAB 3L95A 5D1ZC 5IQ9A 1Z9SA 1QBLH 1XH1A 3LQAC 2KL6A 2XVKA 3GBDA 4OZFH 1MHHA 1Y1DA 4YDNA 1IO4C 5IROA 1FFOA 4MB4A 3P2BA 1KXVA 2HFEA 1FWXA 5E4EC 4PU2A 5I71B 1A4JB 3DX1A 2X4UB 5FHAL 2AQTA 1FQ9C 4GUOA 1XL4A 3QXTA 3FU8A 5AVQB 4YGAB 5E8NA 4J4PD 4WK4B 3M8OL 3QHFL 2FT6A 2EDOA 4QRAA 3IMBA 2WUBH 4FLOA 2G3XA 5KOMC 1IEAB 3UEQA 1R34A 5HYQB 5F88B 3PGFH 5DJXB 3IU4H 5KJRH 4EDXA 3FOLB 1CFTA 4WTZA 5PAZA 2AI0H 4PRDB 4BYHA 4LASH 2L7QA 4JFPA 1XGPA 2W60B 3B8YA 3OL2A 4OD1L 2FTAA 4CRPA 3B2VL 2GK0A 2UY7A 3N06B 2IH1A 3WNNA 4E41B 3UO1L 1BLIA 1D7CA 3TZVB 3S9DB 3K8LA 5DJCA 5TF1H 3E8UL 2HFTA 4XZUB 3UTTE 3EJZC 5EORH 3MV8E 2DLEA 3IMRA 1TIUA 2QJDA 3I2CH 1ZVYA 5IVOA 1VGEH 4LBAA 2HX7A 4JFFA 4OLUH 1IKFH 5DEZA 4HIIB 2Q0ZX 5GHWH 3PPSA 1WDAA 4DW2H 3EYVB 1FZKB 4KRMB 2GAZA 1A22B 1SLVA 1OB0A 3ULVC 1ZWIA 3FTGA 4YXKH 3VM5A 4FMFA 3BVNA 1DEEB 2FK9A 1IUZA 3PWPB 4L29B 2PN5A 2XKSA 2VJ8A 1M1XA 2PO6B 2ED6A 4NNXA 2WP3O 2YD6A 5LGJA 1AZNA 1B3JA 3QHTC 1NUNB 5T5FL 3UBXI 2WLZA 4GKNB 4XPAL 2A9BA 4M6OL 4OCYH 4PBWD 4PJFA 3FQTA 3DGCR 1U2CA 2ZXGA 5FYLE 4Q9RL 5B21A 4PMFA 5E6SB 4B9JA 3DLQR 1FL5B 3M46A 1MFDL 3EFFA 3KLAA 1IAIH 1RK1A 3LXAA 1MUJA 5D1ZD 5AUMB 1EZLA 4OU3A 2D3JA 1TSRA 2P26A 4HKZA 1TITA 3LNEA 4I1NB 3LKQA 3VRJA 3D30A 3JT0A 4LHJB 4Y5YA 3C6LB 4FF9A 4BFGA 2A83A 1CWVA 3QEUB 5TFSH 2V9QA 4LKCB 4KU1A 2W07B 3BH8B 1WICA 1JZ2A 5DQ9A 5DSCB 3L5XL 2WJ7A 1TKWB 1KBGH 2EH7L 4KI1A 2OL3A 5LKNA 4XP5L 2XLLA 1IFRA 3B5TA 1IKNC 2R83A 3ZT7A 3S5LG 3C5JB 4NDMB 4XCFL 2B9BA 5D4QA 5T1KB 1BJMA 1ZLSH 4UAOC 2BINA 4L8BA 4PJ7E 5AAWA 1AZBA 3RTQC 3PDDA 4DP7X 1P1VA 2FX8H 4QAWA 3TPUA 4WK2B 4RWYL 2YPKA 4WW1B 1GKEA 3VB9A 1O5PA 4IRJD 2AJSH 4V1DD 1FO0B 5T1DH 5EC2A 1WA1X 2BHYA 1BFSA 3GIVA 5CD5C 3TNMA 5FB8B 4KVNH 4JZJA 4KMQA 2F18A 2YRBA 3MJWA 4Q4IA 3WIIH 2MCAA 1BQHB 3L3OC 1ZPUA 3AXHA 2VB5A 4XXDA 1CU4H 1KTCA 5DHXB 2FHFA 3I84A 3QFDA 3STBA 4YR6A 1EHLH 1CE6B 2E6JA 4F7CA 3IS1X 5FYKH 2DTMH 5D71L 4X9YA 4U3CA 3KNBB 1L0PA 4OSUL 1FAIH 2N4IA 1DFBH 1EFXB 1A21A 5HYJD 3UERA 1OGAD 4CC4C 4NQCE 2IPTH 4ZMOA 4HK0A 4BH8B 1PZSA 4IEFB 4ANVA 4NQDB 2IG2L 3OJDB 5A2LH 7PCYA 1MFVA 1T04A 4O5LL 4LCYB 1MCIA 3AS3A 4N2IA 3PL6C 5JHDD 4ZMNA 4OZGB 4OCXL 5ESAA 1V3LA 2UV3A 2IDTA 3Q8FA 3MLUH 3WHE1 3CU1A 1J1OL 1LM8V 1NFIB 2NY3D 3EOTH 4AEIH 4UDUB 1X7QB 4KKCC 4MSWB 1IEHA 2I9LA 3ZDWA 1YEJH 4GRWE 1EEUA 1IC7H 2WM0A 4XMKL 3RQ3A 4UOW1 5DS2A 5EG6C 5DFVD 3GSOB 1UM5H 2UVFA 1PS3A 5EU5A 2ZE0A 3HFML 6TAAA 3FUIA 3WY3A 1QBAA 2OXHA 4KX8A 1CBVH 5IF0A 4JPKH 3UTTA 2XVLA 3EADA 5CLXA 1DBAH 4M43H 5F7DB 4QHNB 3MV8A 1MVFA 4K5NA 4OLYH 1E28A 3KJ6L 1C16B 1PAZA 2OK0L 3M17A 5FO7B 2ZTBA 5ANHA 3RTQD 1JGEB 2IAMB 4YSAA 4ZW3A 1G9NC 4EI6A 4PRPB 5FO9A 3ATDA 3QE5A 2UXGA 4Z0BH 5MHSE 2MWCA 3MRLB 1OO2A 2CLZA 3U46A 4DPRA 3RU8H 3UAJA 1E5CA 1Z2KA 5CD5D 1BEYL 3C2AL 1JGLH 2C1OA 3WENA 2VO8A 4R4BB 2YXVA 3FBQA 5BZDB 4JANA 4N2HA 1FBIL 5I8EA 1BVNP 2PWDA 2R4SH 3RVWC 2VDNH 4GYBA 2HG5B 3P69A 3VCLA 3RKPA 1MCPL 2BFVL 4G8GE 5JR1L 2EE0A 4NQEB 1I8MA 2DLGA 1BM3H 2PW1B 3RURA 3SZKC 3L54A 1UACL 2VUOA 3RIFK 3QFJB 4BKLB 3DBXA 4ANWA 3WEBA 1GC1C 3T3ME 4YEFA 3VFUB 5GRZA 5D1QC 3I3DA 5CEXA 2VJXA 4MA1C 3NESA 3KM1A 4Z7VE 4ISVA 3KPOA 3IYLW 3NMEA 1OE2A 3PQYB 4QCIB 4X8XA 3CFQA 4W9DC 3I6SA 3VTAA 3MLTB 3MOAL 2QVFB 3PAZA 4HKXB 2XIIA 4WSJA 2ATPA 4YDKH 3EOBB 1CCZA 4OLZH 5G5DA 2PXYC 4YHML 1PD1A 1AIFB 1ZHNB 5DDHB 1NMBL 4KKCD 1C5DB 3A47A 5J6HB 1MVUB 4GSUA 3BLKA 4QKXB 4QNPF 1AHWA 3M1OA 5J1AA 2NSMA 3AROA 1QLRA 1HEJC 3QYCA 1OPGH 1MWAB 3MRCA 5ID1B 5L0QB 2XACC 5F6HI 5MI0C 2P5WD 1KIUA 4ZQKA 4N26A 2YGVA 1BF2A 3DVIA 4JQIH 5E2TH 1ZHKB 3L4ZA 2NNRA 1TVHB 4PJ7A 2WN2A 3AXLB 4W9GC 3DTXA 3WN5C 2EIZA 4JO5A 1I8KA 2QQLH 3C6SB 4G7QB 1E2VA 4UB0L 1NC2A 3B2UC 3MCLH 4AXWB 1DSWA 1U8LA 5KSBF 1CYGA 2F54D 4PY7B 1IJ9A 1RUQL 4UNIA 2VC2B 2XPYA 3SD2A 5BQDA 3MA7A 1G6RB 2VL4A 1RULL 4HALA 2BWIA 4JGMA 2OZ4L 1KGCD 1AKJB 4A7VA 4X4YA 3ZKNC 3NJHA 4AGQA 4H0IA 5I1GL 2ITCB 2ITDB 4BFEA 3QJQB 3PFQA 4MCZB 2MJWA 4U6TA 5HHVH 3SQOH 4UT6L 3BWZA 3B2PA 1KBPA 4ENEC 3F01A 1WBXB 2K8QA 2H1PL 4J2QA 1VFUA 1S78D 2Y3AA 1U8KB 2DQTH 1NKGA 2Z0BA 5LB1A 2LABA 3ARED 3GXUB 3HNVL 1J9SA 2EC9U 1YY8B 3ES6B 1IBHA 1P84J 2BWDA 4NQCA 1W0VB 3AQZA 3SDAB 5C0EA 1AGBA 4UINH 4G72B 5FKAB 4PJDB 5D1QD 4N2EA 5K9JL 2BY1A 3DSNA 3S6CA 1JGDB 4JRYE 5KS9F 3EO0A 3NDYE 1EJFA 1Z66A 5DJDA 1H6UA 3CSYB 1CDYA 2YWZA 4L4TB 3WXWL 4AX3A 2HJLB 3L3IA 3S4SA 5BVPH 4AGPA 3IETB 4HWZB 3S98A 1S9XB 1ZIBA 2PXYD 4LSPL 1JNJA 2XPZA 1BVKA 4OFYD 2HRPL 1G4RA 4BCZA 1FL6B 3QI9C 3NZHH 2CO7A 2E9BA 5F3BA 2IWEA 2E74C 2UWEE 2WLIA 4FA6A 1JPEA 1DVTA 4JS7A 5HY9A 3INUL 3GSNA 5T1JA 4GW5A 1R3JA 2BVPA 4P2RD 2CRYA 5JIHA 3TV3H 4CMMA 4HCIA 2AXWA 2H6PA 4PJBB 3F7YB 5E23A 5D72H 4PJAE 3SN6N 1MHPL 2NX5E 4MBOA 3ZRFC 2IC2A 9CGTA 1HQRB 5DLLA 4JLRA 2E7LC 2R9HC 3CAFA 2EE9A 5DVLA 4R7DB 1T0NA 1BLNA 2IQ9L 3KD4A 5F0LB 4HH8A 3D12B 4R7NA 1FYTD 2CHNA 4XPBH 3VGFA 1KGXA 2JJUA 1BVNT 3STLB 3KE0A 5I76B 3D4GA 2IV8A 4IGBB 5D7JA 1N12A 4NZTH 3ZR6A 1G9HA 4HOXA 4AZ8B 3MCKB 1DQQA 3KYNA 5D7SL 3K5RA 1PPIA 2BXYA 2GSGB 4N8CH 4G8GA 4WWNA 4A2HA 3CHPA 1OSYA 4BSVB 4GW4A 3D87B 5IIEA 5AB1A 4FHBD 1QTSA 4G1EB 4K55A 5JQHC 3D50A 2CR0A 2ZCZA 3U4BL 3RWIB 2UYLB 3RPBA 2XZCH 4TULL 4UM9B 4Z7VA 2LVCA 4PJ5B 2P8PA 1U3HB 4ZAKB 1S7WB 2XC8A 1LGVA 2KH2B 3CDCA 3WL9B 4XCYA 3PJNA 3KYAA 3SQRA 3GDCA 2Q8BL 3CX5J 1RZGA 5GS2H 4QO1B 3VFWA 4U6VH 4DZ8B 1LMIA 1NDGA 2DQEH 3F58H 1J1XH 3E80A 1F4WH 1BECA 2WBXA 3OWRA 3C2SA 4JY5L 3L7EA 1IM3A 1XF5B 1N70A 3SDXE 4AMXA 1P2CB 3NZ8A 1Q9KA 3WIHA 3QCVL 1BOGA 3ETBF 3ULVE 3A6CH 1BJ1H 1XCQA 4XCEA 3IJHA 1QPKA 3JV4A 5HPOA 1I7UA 1CDHA 3P9MA 4EXPX 3AY4C 2BERA 4CN1A 4PLKC 2DYRB 4M4PA 3FO0L 4LMQE 4PWHA 2J8UE 2F19H 2VITB 3HZMA 1Z1WA 2Z92B 3TWCL 3KCPA 2MPAH 4HF5L 1WD8A 4G3YL 2BNRB 5A7BA 1I85A 1JCVA 1T5XB 1QEWB 2M26A 2Z93B 4WFEE 3COOA 3ZRCC 1E9OB 4XC3L 4JPQA 4U1MA 4RSYA 4K2UL 2A6IB 3D8MA 1TZIA 1OAYH 4C47A 4ABQA 2H1XA 3ARGB 1CICB 2A74A 4U1IB 4UUJB 2XTJE 4A66A 3VUAA 4PJEE 4S2SA 4JM4H 1GGIL 5IJKA 1AY1H 5I0XA 3WTVA 1FZJA 1NCDH 3K2UL 4DP6X 1DHKA 3CFTA 5B4MD 4S1RH 3IMTA 3V6ZB 4E9YA 4WI3A 2GIXA 4DJMA 3Q13A 4GAYA 4PGZA 2B5IB 2W88A 2OMZB 1T1ZA 2J57A 3I3BA 3L2MA 4N68A 4ONFL 3R7QA 1ZRUA 5BW7A 3ZKXC 4JRYA 3HAEA 3O9WC 1IQDB 5IJDC 1AO7E 3GD1C 1RK0A 4E9SA 4HV8A 1X5FA 2YZ8A 4X9IA 1UATA 4M7ZB 3WV0A 1PY0A 3EF4A 4P5MA 4X6EB 3QIUA 3LDBC 4PJGF 4TVPE 4EN3A 5CKAA 4DH2A 1FO0H 1IVLA 2WP3T 1XAKA 1QA9B 1KJ3L 3IB4A 2WQSA 2YPLE 1MEXH 1MG3C 2UWEA 5DJYA 4M5YH 3P30L 2OMXB 1MJJB 1EZUA 3PWLB 5AW1B 3HUJE 5DURD 3L6FA 4JDVA 1ADWA 4LBEB 5DHYA 5GGTL 1UXSB 3ARFB 3DMMA 3DDFA 3UO8B 5AAPA 1NGWA 1Q1PA 4PJAA 4B9IA 3BUYB 4YXLH 2BSSB 4FJ6A 3VB8A 2NX5A 2W95A 1GY1A 1F90H 2ZCLH 4KAQL 1CDGA 2BM3A 4XI5C 5ILTL 1S7XA 4FXKC 4KPHL 5HI4D 3BO8A 4PLKD 4HGKC 1T22B 3LRKA 4ZBJA 4H8QA 1TEFA 3O0RL 3TCLA 2ZG3A 4H20H 3MNZB 2VDRL 2XQYA 5JOFB 1VEOA 2QQNL 5I9QB 2WQVA 2KZ1B 3O3BB 4HZLB 1JPSH 2YN3A 1HHHA 4H88L 3TN0C 2APWA 2NTFB 4D0DA 3WJMB 4ZOAA 5MEQB 2ERJB 4I2XB 3GKWH 5KW9H 4WWKC 2BSRA 3JV6A 4LLQB 3FT2A 5AKRA 5IQLA 4DPCX 3O8XB 4ZPVB 1NCWL 2FECI 1MCLA 3OR6A 3OAYK 3CZUB 2EYSB 1RJYB 2CJUH 2M2DA 3H54A 3MLRH 1LILA 1SHXA 1IRAY 3LB6C 3MUHL 4NNPL 1NL0L 1J1PH 3MTXA 2NPLX 4PS8A 4ZUVA 5LWYH 2APSA 2Y23A 3G6JE 1EMTL 1H9DA 3BZEA 2Y7NA 1IC0A 3QIWB 4JAMA 3SE9L 3I9GH 1N19A 2R2HB 2JCCF 1U8CA 2PPCA 3MLWH 5AZEL 3T77B 3HEIB 1M42A 5KVGE 3HC0A 2DQMA 4LAQL 3ULSA 2DL2A 3CN1A 2VZUA 2MEJB 3IGFA 4WV1B 5INCA 5BOZG 5D4JA 2QDVA 2GHZA 3U9UA 1NCBL 1TLMA 4XRCA 3I3EA 4N1EA 3CVCA 1JV2B 4MJ5B 3DHJA 1R5WB 3OMNB 4Q56A 5HDBB 5I0DA 3P77B 5LJYH 5I1CH 1QBLL 2J2ZA 2WO3B 3SDXA 2J72A 5AYQA 1UZGA 3BPLC 4KRPB 3S8GB 3GJFB 3HR5B 4A6YA 5HGGS 2WTPA 4ONOA 1NGZA 3QR0A 4O51B 1JMZA 1ETJA 4BSWA 2FNBA 2P4AB 4TMPA 4AW7A 2WUBL 1PIGA 4XI5D 2FZ3B 1UCTA 2NY0C 3PGFL 4C83A 3IU4L 5KJRL 4LPCA 1QSVA 3JWNE 1JD7A 4NCC2 2AI0L 4LASL 1D9KA 1JXGA 3MJ8A 4UDTA 5GIRA 5TK2A 3VFSA 5FFLA 1JNHB 1ZK5A 5FS5A 2CH8A 3KPNB 4DP8X 3FT4A 2QFPA 3GXPA 4HUWB 1YYLH 4LMQI 5TF1L 2VZ1A 4GP5B 4HWBA 5EORL 3TN0D 1XR9A 1NC4D 3WGVB 1RSFA 4MQXC 3I2CL 3Q8EA 4ONGH 1FFPB 4KGLA 4PJEA 3HZYB 1B4JH 1VGEL 4JE4B 4M93C 4NRYA 4OLUL 1IKFL 5D5ME 3MU3A 4XAKD 2N56A 5GHWL 4E36A 4J8RA 1ITCA 4DW2L 4UV7H 5ACMA 2F8VA 5GISH 5TJWK 3TVMC 2WB1A 1LHZA 1BZ9A 4YXKL 3ZK0A 4KZEH 3D3VB 1MWAH 5F89A 5IBUB 5F3FA 5ISZB 4G43B 3GBEA 5C0JB 1HNGA 1E43A 4NI3A 2Z35A 1P7QA 1AO7A 2A6JB 4LPTA 5TTRA 5KVDE 4TQHA 3OPZH 4YFLI 4OCYL 4R7XA 5BPPA 4G71B 1SYVA 3SCMA 4TUJB 4HCRH 4GG6B 4ZMVA 1BPVA 4K5PA 2Q3AA 3F5WB 5HGBB 1IAIL 3FKUS 2V5MA 2F7IA 4WSKA 1RZJC 2YPLA 4KX7A 1V3KA 3RIAF 2VC2H 1IGTA 4L8CB 2YD9A 1A2YB 1A4KA 2BSEA 3QW9A 1G6RH 3CPLA 5JA8B 5DEFA 2JK5B 4KXDA 4X99B 4ATWA 2CO6A 2IOMA 2GJZB 5TFSL 2FJGB 1TCRB 2WVTA 4WTZG 2WNKA 2B0SH 3U0TA 1ZT7A 2B39A 3CU7A 1KIQA 1KBGL 5I5IA 2NY0D 1GW6A 1ZLVH 5F7WC 3PNWB 3HCVB 3CFDA 3K1KC 4CC4A 4ELME 4YGVA 4FTVE 1U4FA 1J5OH 2OSYA 3CFEB 4XBPB 1ZLSL 1CVRA 1MCSA 4NB7A 4OT1H 5IWLC 2OQJA 5B39B 2P5EB 3PL6A 3TH3T 4Z3HA 5EEZA 2FX8L 3VFOA 5KSVA 2EECA 3T8XB 3NEXA 2HH0H 8CGTA 1JRHH 2AJSL 1ED3A 5T1DL 3VXOB 4PS7A 1WUZA 3K6SB 2EDBA 1IAII 4PR5A 3G6JA 3SE4A 3PXLA 4KVNL 3MCG1 2IDCA 1JK9B 5I30H 3TVMD 3WIIL 5BUPA 3GPSA 1T4KB 2VR7A 4RAVB 8PAZA 1XB8A 4YHYB 3ZGHA 4NFBA 3FRUB 1CU4L 4G5ZH 4I48B 5DEGB 1NCCH 4AIZA 1EHLL 3RNQB 3JV0A 2UWEF 2ZXEB 5FYKL 2DTML 2JE8A 2AJ3A 4MBRA 4UWQB 1VSCA 1FAIL 1G9EA 1DFBL 3WAJA 2CUIA 1X3DA 1SMOA 3ARTA 3QORB 1OSZB 4UANA 5DZVA 1DVFD 2IPTL 3CFKB 1WWBX 1PJ9A 3S97C 5JPNC 3IDJB 1HL5A 3T65B 5J7CC 4OFVA 5HD8C 3EYFB 3FQNA 1I8IA 1UURA 2QMKA 4JRFA 4O2CA 5J6GA 5KTEH 3QQXA 1MIMH 3MLUL 2CE6A 3EOTL 3QS3A 1OP5K 1OK0A 4AEIL 5HHOD 4X2UA 2F5AH 2APBA 3X1EA 3GNMH 4LB8A 4Y0GA 1IM9D 3OB8A 3RGBA 4WKZB 2QQKH 1YEJL 4G7SB 3EHBB 1IC7L 1FVEA 4JN1H 1JHKH 2E47A 4QRPB 5B3SB 2NUTB 2YUWA 2DZEA 1UM5L 1YECH 3P4MB 3FCUB 1ZDQA 1FFQA 4NP9A 2VQ1A 1H19A 2WXIA 1CXIA 3BD5A 5EUOE 4XGZA 5HVHC 4U7KA 5IW6B 2OP4H 1CBVL 4MMXC 4YSPA 4A7SA 4JPKL 2DQFB 2YAEA 1DBAL 4M43L 4BUGA 4D3CH 4OLYL 5FM4A 2EDMA 3M88A 3QJUB 4P5RA 4XPFH 5I8CA 1SFDA 4S1DC 2ZCKH 2MH4A 2AS5M 1M7IB 3KJ4C 4WGKA 3Q2WA 4MCNA 2JI3A 3QUZD 3BZFA 4Z0BL 1HINH 2PXYA 2IH3A 1E7UA 4RRPM 1EUTA 1QFWM 2WWMC 3RU8L 4DK6A 1CFQB 3EJCA 2YUVA 1JGLL 3V0DA 5IV2A 2FAUA 3C08H 4LEOB 4LQ1A 2WGXA 4H8HA 1NUFA 1MW1A 2PP9A 2AEWA 3NIFE 1T7WA 5IHLB 4NSKA 2R4SL 5JOEA 1T1XB 2VDNL 5DZOA 1WRFA 1MW2A 2OX5A 1IBDA 3ROOA 5IB2B 3B7UX 4OI9A 2JB6A 3ATEA 1ZA3B 4QHUB 1BM3L 3NUKA 1WAEA 2XV3A 3WN5A 4S11A 1ACCA 5DO8A 4WO4C 4TNFA 3SY6A 1A9EA 4MAYA 4FFTA 4YAQB 2Q6WA 1IGYA 1I1AB 3WMSA 1GZQB 2ARWA 4KKPA 1GZPA 4AYGA 2XQBH 4GUPA 1GS8A 2ZPKH 1KTJA 4DOHE 1QABA 1J5CA 2DMKA 2VR6A 1FNGA 5T3ZE 4YDKL 5HD8D 2AQ3A 1HCVA 4Q74A 2WXGA 5HHQB 4OLZL 5C7XH 3H0TA 4APQC 1JG9A 1MCHA 3ZTDC 1RZQA 2VH5H 2V9TA 2NY2C 1MRCH 3VXRD 1YEWA 3BGFB 4HPOH 2ZCHH 3VG0H 1IC4H 1OPGL 5DHMC 2CKBA 4KKZA 2PP7A 4Q6KA 1GGCH 1HOCA 2X0UA 1KB5B 1KYOJ 1UM6H 3BAXA 3HPLA 5KBKA 4ELMA 1UB6B 3B4NA 4ZDHB 4FTVA 4IOIA 5KZCB 1KPRA 2GI7A 4I1RA 2WWOA 4JQIL 5E2TL 1T2JA 4L1LA 4N8PA 1T2XA 1JCKA 2CDGA 4JJ5B 3KM2A 5DJ6B 1DLFH 3V9CA 4LOFA 5J57B 4KI5E 5I15H 3L4CA 2QQLL 4ELDA 4U1KB 1C5CL 4S1DD 1BFOA 1J8RA 2F8OA 5SWQA 5MERB 2N1KA 3MCLL 3GMOA 3ZE2F 1KIPA 4NNYB 4WNQB 3DYOA 4XNMA 3VMNA 3WDHA 3O6MH 4R5VA 1EV2E 3CTTA 1MF2H 3FHAA 3N42F 5D2NC 2OSLA 2P24B 5EF3A 2I85A 3QCTH 3O4LD 3QI9A 2K3HA 5I1KH 4XP6H 1QFHA 1UADC 4HWEH 2YRPA 2W8CA 3QNXB 3BI9X 4JRXE 4TNWF 5HHVL 1WBZA 3SQOL 1TYEB 2DOCA 3CPUA 1CXFA 4BQCA 4X5LA 5F9JA 3ZN6A 4OGZA 4AV0A 1WD9A 2DQTL 2HKFH 4JR9H 4TF4A 4UZGA 2Q86A 3O6FC 2E7LA 1L9TA 3NIGE 4C57C 4FKEA 4WO4D 1J87A 1OPOA 1TNMA 2WCSA 3LKSB 1SNRA 5EH1A 2VAAB 1C5BH 1ND0A 4OKDA 3OWEA 4UINL 1HQ4B 4PBXA 1YVLA 4X4ME 1HZHH 1J5HA 1U91A 4Y2NA 3VFVB 4TSAH 5IK3A 4JDTH 5HGHA 3KDMB 1UOVA 3MJ9A 3RY6C 4OF5A 1K5NB 4ACTA 4NN5B 3D39D 4IMLB 5BVPL 5CBEA 2ZAHA 4FG4A 2FUTA 2XDHA 2FBOJ 2FX7H 1U36A 1GCFA 2AV7B 5J11B 2YEQA 2VDPB 5E03A 4E2OA 1XGUB 3SO5A 3C5XA 4JY4A 3ZX1A 3NZHL 2ZKHH 4CAGA 2OI9C 2ZQKA 1TMQA 4OLVH 4W9HC 3DBSA 1XZ0A 1JNNH 5L8JB 1NCUA 4Z7IA 3OKMB 5EUOA 2X4QA 2O6DA 3QHZH 3TV3L 2HX9A 4EXKA 4XCNB 3W5MA 1RP8A 1GPOH 5D72L 4Y5XB 3FO9B 1UFUA 3S5YA 4AQZA 3P54A 1GYAA 5FUCE 3CFJA 5CLZA 1T1WA 4POYA 1KPUB 2E86A 1UZ8A 3O3DB 3BFWA 5ETUA 5SWZD 5A43C 2OTWB 2QHRH 4G6FD 3WHXA 2J12B 3ARDB 4HJJH 3WN6A 4ZTOH 3S2AA 4XPBL 4TUOB 1O6SB 5JQIB 2WXFA 2Y2YA 2JQAA 3VA2C 2W59A 5KUKA 3RWEB 2XWTA 3CVDA 4J3TA 4A2MA 4XNXH 4NZTL 5IB5A 1YPZB 2IFGA 3GJFH 1V7MH 2B4CH 3CIAA 3RWHA 3QNFA 3JWDH 4G6KH 4N8CL 3RNKB 1T21B 4B9KC 1P7HL 2KDGA 4R5TA 5BS0E 2KZWA 3PWNB 3OC5A 5J13C 3O6FD 2JELH 4ODUA 3AS2A 1W80A 4CVZA 5EZIH 2XZCL 5IMKB 5J9PA 2R0LH 2X6CA 5C0BD 2Z8WC 1BM7A 4NXKA 5IG7B 2O1AA 4MTMA 2C9QA 1WZAA 5H37A 4BBWA 3S4SG 3VXME 4G11A 3V52H 4AJ0A 3S48A 4JFDE 1NWOA 4P06A 4NPYB 3EG9A 3OMZA 1CLCA 4LE8A 1J8HD 4U6VL 2DQEL 3F58L 1J1XL 2BXZA 1F4WL 3DX7B 4MQ7A 5CM1A 4K7FA 4C59B 1R5VB 2BY2A 3VD9A 3MBEA 2M1KA 4X5XB 5EU3B 1JPFA 1HNYA 2BJMH 3RI5F 4IOSD 1QTYT 3A6CL 3OXSB 2WQXA 4DKFH 5JIPA 1P4LB 3QUXC 3Q6FB 1WWAX 3IRZA 3MSPA 3C09C 3TONA 3T6QC 3WLWD 2Z91A 3O9WA 4A55A 3NJGA 4OB5H 1N5YH 1IX2A 5EHFA 3GUTA 1KACB 1NAKH 3TF4A 2V2TB 3LZOA 4IU2B 4F8OA 2F19L 2XN9D 4N90E 2MPAL 2JF1A 1VB9A 3QUKB 1RCYA 1HAUA 3KLLA 4U33A 4LLMA 5DGQA 4XVJH 4DEUA 3R18A 2AJUH 1PZ3A 4XMXA 1OAYL 1W72A 4UYPA 3BD3A 3AWFA 4ZFOB 1NEPA 1RAMA 4JRXA 2VL5A 3KS0H 2E7HA 4Y4KC 5DA4A 4X42A 5DMYA 4Y5VB 3ZYOA 4NKOB 4JM4L 3TBYA 3W3BA 5E8PA 1B6DA 1JZ3A 1AY1L 3K2IA 5IMLA 1NCDL 1T0MB 5KYXB 1QEXA 4S1RL 4H0HB 3OKOA 2QGBA 3M1BA 3N1FC 3QA3A 1N59B 3KLSA 5FA4B 4URKA 5ESQB 4X4MA 2V7NB 2GBUA 2VE6A 4MDIA 5BMFH 2ICES 2CM6A 4LNRB 3Q8BA 5DJ2A 4UTAH 5HGDA 2MKWA 2AK1H 1RZIB 2YMTA 4WWKA 1NOFA 4HZ1A 3QXWA 4DSYA 1NIAA 2ADYA 2YAOA 4NUJB 1HE8A 4HJ0D 1N5AA 2YUZA 4KITB 1FO0L 2BC4A 4UBDC 5IFJA 3LRGA 2FATH 9PCYA 1A9BB 4KKQA 2KMWA 2WXKA 4M5YL 3VXSB 2HT3C 2KLSA 1N3NB 4PJ8B 2GFBB 4YBLB 1LNUB 1U8HA 5CNHA 2FSEA 1P5VA 3ENEA 4H26B 4WWPA 4YIQB 5LDUA 2P28B 4YXLL 3IPFA 3QUXD 2BHZA 2ZCLL 1F90L 2ZWZA 2JIXD 2WTRA 3D2UA 2QPFA 4MD4A 3BHBA 2ZF8A 4ZS6C 4UT7H 2VRAA 4KDTA 2ZUUA 4OLWH 5E56A 3OX8A 4H20L 2HPOA 5CP7B 4ZUWB 1U41A 1MFNA 3QNYB 1JPSL 3CLWA 4FGMA 5EFIB 1SUHA 3LN5B 3QJOA 4YLCA 2FO8A 2ORBH 3GKWL 5E2WH 3HE7B 4YFEA 2E9JA 2ITEA 2JKTM 4MJ6A 1GOHA 1JTTA 3W9DA 3BVVA 1P6FA 1FE8H 4J3OH 1EAQA 2CJUL 3MLRL 4NKMA 1PIFA 2H3KA 5I1LB 4Y4KD 5G4MA 5TPWH 1HOEA 5BS0A 1J1PL 4WI8A 4JDEB 5LWYL 2ZX7A 4D9RE 2NOYA 4G1MB 3M1CA 3WE6A 2HFFB 3HAEG 3SYAA 3I9GL 4RRPA 1EUUA 4ODSH 3FAXA 5I73B 3MLWL 2BZCA 5CLWA 2MOVA 3K80A 4KHTH 4YSUA 2L7UA 3L1FA 1R3HB 3PHOA 3QEGH 1S9WA 2CLVA 3GC3A 4HIXH 4YNYA 3VXMA 1XHHA 1D7FA 2JFCA 2PTUA 4JFDA 1TVBB 4BV1A 3BRGC 4N6RB 4P04A 1KCRH 2IWKA 3TIEB 4PD4K 1LP9B 2EAEA 1JZ7A 1DJIA 2ICWB 3NDZE 2WB7A 4QRRE 4Z6AT 5J12C 5I1CL 4OGXH 1YEGH 1FP5A 2EIBA 4UBDD 2LFEA 4R97C 1XVSA 4E9QA 2WBJD 1VGKA 4MXWH 1R5IA 3TEWA 2R7EB 4ZPTB 3KGRA 3TBWB 3QH3B 2HT3D 4PGBB 2YAPA 1MSPA 1DJYA 1FZOA 3TOPA 5GRVL 1PEZA 3KYMB 4YSCA 5H35A 1E7VA 3U6XA 3TBBA 4X8GA 2XQYG 3FCSA 2ZUQC 3QXAB 4I9WE 4WRLA 1FVDA 2G75B 4ZS6D 2AQSA 3BUBA 3QPQC 1HSAA 1Q94A 3KGTA 4D7PA 5KVEH 4RLDA 1ZA6A 1PCXA 1D5ZA 4L8DB 2QR0A 4YX2H 3P4LA 2R23A 4JKKA 5GS1B 1HKLH 4TLSA 3NCFB 1WFUA 3EDKA 4P5SA 3VXQA 4QXUH 1YYLL 2GBVA 2H7WA 5CINH 1D2OA 1P5UC 3VYOA 5EO1A 1TQUA 2FIKB 3NTCH 1QQDB 3REVA 4ONGL 5IMOA 2QZQA 2FUQA 1QBMH 1B4JL 1S7RB 2IALB 3SPVA 2NW2A 4BKTC 2F1BA 1AP2B 2HUEA 2CGZA 2CHWA 3BRDA 2DYPB 4HBQA 1JWUB 2YD0A 1M2VA 4UV7L 5GISL 2N7SA 3E3QE 1XGQA 1GAFH 4KZEL 1HHGA 4HLZH 3WUWB 1MWAL 3P3YA 3WS6A 2C5DC 3LRLA 1KB5H 3R8BB 4LOVA 4E42A 1DVXA 2AP2A 3Q2NA 2V5YA 3NYKA 3OPZL 3PU7A 4BXSV 3Q1EA 4NZJA 4HCRL 1C8QA 4ZK8A 1Q4NX 4PP2B 3NAAH 1MRFH 4ABWA 4CDGC 1J8SA 4W93A 2X2UA 1UT2A 2ARJB 1YNTA 3ISRA 4U1LB 4HUMB 4UIMA 5L2KD 3U4AA 1A47A 1F1GA 2VC2L 2MRYA 1N8ZA 1J48A 3MRMA 1G6RL 1ZT4B 3CDZA 4BK8A 2GY5A 1RJCA 4KXZH 2ZSVA 3E6FA 2ZKYA 3VFGH 2VLME 1NIBA 5ICUA 4URTB 2X3AA 4P4KD 4E9XA 2OMWA 1HL9A 2B0SL 5BXFB 2ZYIA 1OVZA 3L48A 5T5FA 5IP4A 1OGTA 3L9RA 1N9PA 3FBKA 1F2XK 2WCPA 1OCWH 1XIWC 4AV5A 2WVVA 6PAZA 3PDOB 3X11A 3QPQD 3ZIYA 5HJ3A 4OIIH 3H9SB 3KBFA 4X6CB 1J5OL 4WTXA 2PP8A 2V0AA 4LRNH 2SEBB 2E9GA 3MROA 5AVZB 2VISA 1ZD6A 3OZLA 4OT1L 1AR1B 3NIDB 3NP4A 3VX1A 3QIBD 3O45B 3X13B 3IDIB 3PABA 4YZFE 1FH5H 2Y7QB 3VWKA 3RFZB 3MV7D 2HH0L 1UQSB 3V7AE 4CSTA 4U05A 1JRHL 1PKOA 3DI3B 1X9QA 4RGMC 5T8IA 4Z1PA 1JK8B 1Q9WB 1DQKA 3OKKB 6CGTA 3K0WA 4XX5A 5FO8A 1H6FA 4FYSA 1OIOA 1WSST 2ALAA 3TH2T 5CGYC 2VDPH 3TO2B 5I30L 1NCOA 5EF1A 3BPCA 2L8AA 5M95B 3WFBH 5AEAA 5CR1A 1IBFA 1QFUH 3GRWH 2C3WA 1MRDH 4Z7WF 4G5ZL 4KUZH 2PCXA 1NCCL 4OV5B 4MMXA 4NLHA 5CJQH 5DJZA 1KB9J 1H0DB 2VW6A 2Z4QB 3V0HA 4MJIE 4I18B 2JWYA 3QYMA 3JTTA 2KZBA 4A67A 2Y07H 5IEKA 4QHLB 3RFRA 4QRRA 3SDCC 2C1PA 4HXBH 4WFFE 3RWFA 4F9PC 1I3RA 4BINA 1UXMA 1JJUA 4NT6A 3GGWA 3O11B 1SY6H 1M7DB 3GB7B 4Q6YA 4PRNB 4ZJ9A 5F21B 3BXNB 3QEQB 4I87A 3VE0B 1R3KA 2FJHB 5GS3A 5KTEL 4EI5C 1SJVA 2C9AA 1XF4A 25C8H 1KXTB 1JRHI 4RAUB 2F5AL 4P5TC 3GNML 5HGAA 2QQKL 4JN1L 3F7RA 1JHKL 2AK4B 2GTZA 2X2JA 2GCYA 1GOGA 2ZXQA 1XIWD 1YECL 1YQ2A 3LV3B 2JI2A 1PDKA 3FUEA 2NT0A 2BSDA 3OZ9H 4HYTB 4M5ZH 1CTNA 2OP4L 4HD5A 4ACPA 3RDJA 5EBLA 5GSRB 4OM0H 1AGFB 2EO1A 4D3CL 5C09B 3WFHB 3BDBA 4XPFL 2IDQA 4J3VA 1AGCA 1IGFH 1GTNA 2ZCKL 2BP8A 5DHVA 3D39A 5MP6H 1ZHBB 5DO2C 2GJ6E 3ZL2A 3BW9A 3BAYA 1HINL 1T5WA 3GSXB 4APQA 2IANE 2ATKA 3NSCA 4L2YA 1XSIA 1BQRA 3FQWB 3IDUA 4IRJB 4YXHH 1QP1A 4DKAA 3GTTA 5I2IB 3T1WA 1GTFA 1H3VA 3C08L 3ELAT 5EIIA 1QHQA 3SKNA 1VADA 3G5XA 3PWJB 1IVTA 5CGYD 1TU2B 1T3FB 1SOXA 5J8OA 3DO3A 3ZUNC 3CN2A 1KIRA 1FFNB 3P3SA 5E6RB 5JW5A 4AENA 1CUOA 1QWUA 3PPEA 4O4YH 3W38A 2K6ZA 3AQYA 3OPUA 1ETB1 1NCGA 4IKLA 5SWZA 3CFBB 3QUHA 2H9GB 1CFSB 3TU6A 2CDFB 5ID0B 2WXJA 4Y19D 3LTVA 3SDCD 3OKNB 2BNQE 3OVUB 5DZJA 5HYSA 2XQBL 2XTLA 1F86A 2ZPKL 4IHOB 2NXZD 4JFXA 4YHPA 1B4TA 2G5BB 1UWXK 4OZHE 3ZKSD 1TTFA 3IGLA 4W9JC 2XWRA 4I8DA 4JM2A 4UQIM 4YHOH 4ZUSB 2Y6SC 1BPLB 5C7XL 4EI5D 4LSQH 3S5LB 3JWNG 2BO0A 2VH5L 4P5TD 5C0GA 4HPOL 3FCBA 2ZCHL 3WXVH 4F7MB 2EINB 3VG0L 1B9ZA 1IC4L 4X5PA 3G7TA 4Y4HB 3B9KC 1Z5LB 3SPGA 1IFHH 1DZBA 1GGCL 1UB5B 1UM6L 5LAXA 1K8DA 3D85D 3MGTA 2IXQA 3ZVVA 4KNQA 1BF8A 2ZNWA 3GSRA 2VTFA 3QJFB 1KCKA 5DS1A 5I1DB 2EILB 2YAHA 1P0SE 3DURA 4A2EA 3GM8A 4P23B 1QO3B 2Q7NA 1DLFL 1TFPA 3RY6A 1A3ZA 2NY5H 3F6IA 5I15L 3W0WB 1NFDF 3X3GH 2D7OA 5T1LD 2WOBA 5H94A 2V37A 4YSDA 5DO2D 2CU9A 2FX9H 2OTPA 2X40A 2XIBA 3MX0B 3O6ML 4N86A 5E9DD 2X2IA 3LD8B 1MF2L 2FGZA 4EIUA 5EEUA 3GBMH 3QCTL 1M71A 4L9LC 1SJMA 3BAWA 5I1KL 5IB4A 1F3DJ 4XP6L 4HWEL 5FV2A 1FLTX 2G3MA 5E8OA 1E4WH 2H32B 3BUIA 4AJYV 3JV5A 3IAGC 3HMXA 1EJOH 3WMQA 3IPEA 3TJHD 4JZNB 5EU4B 2NW3A 3CH1A 4JFQB 5B8CA 1MWOA 2OMYB 4TLUA 2HKFL 4JR9L 3MRQB 4GPVA 2E27H 4MJIA 2X05A 4AVKA 1AANA 2J1KA 2NDGA 3ZDYE 3D09A 2B1AH 5CHNA 5K93A 3PE9A 5FYKD 4WO0A 1FNHA 3HA0A 1C5BL 5HDQH 2NT1A 1SLXA 4NRZB 1HZHL 4WUKH 3H4FA 3U0PB 5SV4A 1OWRM 4X6BA 4TSAL 2HLAA 4JDTL 1GRWA 2EDRA 4AGLA 3QRGH 2NYKA 3U1QA 4D0BA 2B08A 4I1PA 2YPVA 3QJTB 4JFHE 4M4RB 2VWEC 1MG2C 1AZZC 1HXMA 2DL9A 2FX7L 2QSQA 4JY6B 3UMTA 3P4OA 4AGMA 4MD5A 4UT6A 2Q9OA 3RX8A 2HSIA 3T2NH 4IJ3C 3NQIA 1YZZA 1UUSA 3JUZA 3SGEH 4KZDH 4GI9A 2HRLA 2RFXB 2EDFA 3EOYG 3JBG7 4JPVH 3SBWC 2ZKHL 1KYUA 1XT5A 4OLVL 3ZSSA 3FU7A 4R2GC 4V2BA 3QR2A 4WJKB 5EU6E 3VFNB 1JNNL 3NA9H 1R0AH 4NRXA 4CBPA 2EEBA 4QRTB 2DMCA 3QHZL 3WBDA 4CKVX 2NXYD 4N2KA 2ZXAA 3U7WH 1GPOL 2O72A 3V8CA 3ZDXF 5K9QG 1QSFE 5HI5C 1SQMA 2FYYA 1NOLA 2VMFA 3GSUA 3G08B 3CDGA 1JN6B 4FXTA 1B0RB 2GJ6A 2IANA 1IGCH 3NCEB 2QHRL 2ZYHA 5E70A 4HJJL 4X6DF 4I88A 4JGJA 4ZTOL 3TGXA 2GSIA 3KHOA 4RESB 4NPKA 4JKNA 4H2CA 2H0FA 3GYRA 1UXLA 3IVKA 3QUYC 4Y9FA 1D6EA 4XNXL 2DV6A 2KZKA 4PJIF 1V7ML 2BSTA 3KPSE 2B4CL 5D1XC 2A73B 3POHA 4M5TA 2VOTA 4PMEA 1PZAA 3JWDL 4G6KL 2NY1B 4U0RC 3FL7A 2C9VA 3B7SA 3FDWA 4PJHE 2J73A 3OM3B 2FWOA 5CCHE 1QSEB 1R3LB 5KAQF 2C3HA 5C6PB 3ZYZA 1MH5A 2JELL 2HJKA 2IO5A 5TQ2H 2CK2A 5EZIL 4NKDB 3TBCA 3ZDZE 1UWYA 5LN8A 2BNQA 2R0LL 2W94A 1JF1A 4GO8A 4LDLB 2F53E 3FHQA 4OZHA 2V3DA 4Y4FC 3PHQA 3ZSTA 3KXFB 5IHHA 1MI5E 2KQMA 4MKMA 2NQ3A 3S3CB 3FB7B 3TNNA 3V52L 2YAFA 5J1TC 3CWGA 4Y4KA 2EKJA 4QKTA 4NCC1 1SOSA 4YHNA 4PREA 2YSSB 2IEPA 4Y9CA 2X09A 5ENWB 3MLVH 1ZDSA 4OGQC 4HSQA 4OFDA 4WHDA 2E3VA 3X1GA 2O61B 3CXHK 4TS6A 3R0MA 3L3DB 4JN2A 3IF1B 1NMAH 4HS3B 3HG5A 2BJML 3DVNA 1W8OA 3HHSA 4H1LB 4R7LA 4R2GD 3S8WA 3KYOB 4DKFL 1X4YA 1TPXC 4M8QA 3VDAA 4PGEB 1F97A 1U8OA 4M61A 2G9HA 1BXXA 1L0YA 4G8FA 3LX9A 2YD7A 4H44C 4KO6A 4AYDC 1N5YL 4OB5L 4Q6IB 2X4TB 3ESMA 2KT6A 4MMZC 1NAKL 2ZWNA 4L3ED 4G80A 3V4PA 1HYSC 5IBLC 5IZ7A 2J6WA 4W9EC 2GJRA 2XKNB 3HS0C 1EH9A 4P99A 4QJ5B 3AU1B 1UYWH 2YS4A 3TS8A 4HA1A 2WSKA 4H5SB 4I4WA 4XVJL 3BC9A 2FWUA 2AJUL 5I18H 4RAHA 1XF3A 1W0YT 2B59A 3DX9A 4N5EC 5KSAC 5EC1B 4K7PY 3QUYD 3ELQA 3SY0B 1KGWA 5DRNA 5C86A 1ZLDA 2RBLA 5D1XD 3MBXH 4WUUB 2O4EA 2ZWYA 2EE3A 4PJCE 4PLOB 3TT1H 1ADQA 5I71C 1BD2E 4W4NA 3ASNB 4B53A 5KANI 3P9LA 4YHIB 5ELIA 1CG9B 3UABA 5H37G 4BQ8A 2BVYA 1TSHA 4F58H 4IBQA 5I17A 2I27N 3II1A 3GRGA 5BMFL 3A4DA 4ATTA 1ESOA 3UTOA 1LEGB 4ES9A 4M6AA 4Y4FD 4UTAL 4HS6B 2RMNA 4R9HA 1AS8A 1EAJA 3QSKB 2AK1L 4POZD 1RUKH 2J44A 3TZVC 1FGVH 4LL1A 5FECA 1DQLH 1EEYB 1AQDB 1G0DA 5MEND 1R6VA 2IBZX 2WLYA 3VI3B 4MYPA 1JPTH 5CIPB 4AY0A 1JZ5A 4DFHA 2NZIA 3SDDA 4UTBH 4CN4A 2DI7A 2FATL 2GBTA 4F7KA 4U3XA 2X41A 2M8XA 3UIZA 2GW5A 4B0MB 3FFDB 1A1NB 1ETZB 3HG1D 4C56D 3PV6B 3DDGA 1IT9H 1QSFA 2JKRM 4JFEB 2QLVB 4F7TA 5IVXE 4JVWA 4P2OB 2PO6C 3CIQA 3B3IB 2IMNA 2CO2A 1ZXKA 5I66B 2WHVA 1RP9A 4I3GA 4UT7L 4Z7QB 4MA3B 3DARA 3IKCB 4OLWL 1HYSD 3J2PA 4GAFB 4GXUM 2ZXWB 3SJVB 5DLMH 1A6AB 2MFNA 3C8KB 3MV9E 1PLAA 1TETH 4GKLA 1U33A 4YLBA 3DK0A 2ORBL 1YMHA 2LR4A 3PIQA 5E2WL 4EKXA 4CC1A 3L3GB 3DXAD 3KPSA 3IDNA 4JO2H 3RY5A 2YD8A 3TBTB 3QJHA 4XBEH 4F8QA 1GJIA 2MCMA 2EIMB 2NY7H 1QPPA 4OZ4A 5GGTA 4ELKB 1FE8L 1A7BA 5TDNA 1WUNT 5TPWL 4XVUC 4PJHA 4QRQB 3C6LC 5DMIH 5EPMB 4GKZB 2R0ZH 4KO7A 1F11B 4E9WA 4FXGB 1LE5B 5IFHH 5GZOC 1CD9B 1QR4A 3RZCA 8FABA 4JCWA 4MXVE 3B8SA 4GAGH 4IU3A 4M8UA 2WINA 3MLPA 5IB1B 4FZEH 2P47B 4ODSL 4Z7NF 2VZ3A 4Q2ZB 3NN8A 4KHTL 3FFCB 1LJMA 2F53A 4I9XA 5EBWA 2EIEA 1KY6A 3QEGL 1MI5A 4A7GF 4HIXL 4LSTH 5L8LB 1Z9LA 3LKOA 2X7LA 4I3RH 3MRGB 1YMMB 2E0PA 4M03A 1MREH 5LN4A 4LLWB 4E41D 1KCRL 2BVQA 2A6KA 1D6VH 2EVGA 1AGDA 1MIEH 5GS2D 4BQ9A 4D2NA 2C9PA 4OGXL 5E7BA 1YEGL 2H2SD 3UBHA 4GP4B 1BZ7B 3WIFB 3N1PC 4MXWL 5FDWA 5AVXB 2AAAA 1XWVA 2E75C 4KJPC 1KC5H 2JLLA 4PV8A 3C5ZA 4MZ2A 5D7IE 1JHTB 3LEVH 1ACXA 2K45A 4C4BA 2VR9A 4FDWA 3PWPD 3R19A 3MFFB 3QDAA 4FHKA 3RRQA 1TR7A 4IOFD 4ZMWA 3JTSB 3VW3H 4HPYH 5EOTA 1U8MA 2BMKA 3L1GA 1QUPA 4TQIA 3SBPA 1QUNB 5KVEL 3RVVD 3QWQB 3HLKA 4LCWE 4YX2L 1CE1H 3MOBH 4N8VA 1HKLL 4IBUA 3S35H 1S9KC 2AQPA 3P73A 2WZPA 1KCVH 2AGJH 5D7LE 2Z7YA 4QOKE 3L5WB 4QXUL 3VFPA 5CINL 2Y5TA 4ZX6A 1NJ9A 2GJJA 4M6NH 4QIRA 3NTCL 3D0AA 1PW3A 1U2HA 5LGYA 3L1OH 2X10A 1F6AA 1QBML 1BEXA 3LS5H 3FOMA 4PJCA 3QDMB 5L6YH 5CZXC 1BD2A 5D2LF 3FT1A 4QY8A 4XVUD 1XMEB 4RRPG 2AZUA 1YDPB 3C6LD 3IAQA 1KLUB 5AB0A 1AYOA 3D0LA 3ESVF 3T4AB 1GAFL 1S7UA 1SN2A 4HP5A 2P80A 3EYQC 4X9BA 1G87A 3EOAB 3UTSE 4JCMA 1KB5L 1J5DA 3TJEH 1N7MH 3D06A 1T6BX 5CBAB 5E5LA 1ES0A 1BX2B 4H7VA 1XR8A 4XH2B 4JVUA 1CGTA 4QXTB 4L1SA 4R3SB 3DC0A 3FK3A 3WY2A 2AV1B 4LCIH 3SGJA 1IV8A 1NLDH 4LHUA 2L7EA 1NCJA 1BDYA 5IHBA 3NAAL 1EAPB 1MRFL 2OAAA 2IH8A 4PW9A 4N0YH 2IAMC 2MNWA 2XWCA 1H3GA 4A2DA 5F3HA 3O2VH 1A7QH 3RVUC 1GGUA 2P8MA 1BA9A 1LD9A 3L8QA 2DWEB 1MHEB 4JFSA 1ZT1A 3DSFH 3QWOA 1GHFH 5K9KB 4QRUA 2G9KA 3VFGL 3EXJA 4KJPD 5IVXA 2IBBA 2H32H 2ZF9A 3IRCA 5F7NC 4BKSC 2C9XA 4BZ1A 4AKOA 3NJNA 4RWHA 4RGOH 4AK2A 5EOQH 5C0CE 3S37H 1OARH 3BPNC 1DVUA 2IVFC 3OAUH 5KJ7E 1OCWL 2P49B 2Q20A 5A2AA 4AJWA 3NQKA 4YC2B 43C9B 1CFBA 4OIIL 3MV9A 2FJFB 1X9LA 5I74B 1EFXD 2H8PA 5CSZA 4LRNL 1XGRB 5CU5A 5LBSA 3SE6A 1A4AA 3OAYH 1UGKA 4J3UA 3L3JA 5TDPB 4DT2A 4NQDD 1FH5L 3A67H 4G42B 3FTXA 4L3AA 1R1CA 4TV3A 3NACH 3R7RA 2VWEE 2EIJB 4GH7B 4YSQA 1DVSA 2F2HA 4F7EA 4LVNB 4P5TA 4PWFA 1QWNA 4DVBA 5C0RH 4C54A 1VFOA 3APFA 3G5YB 5DS8A 2JJTC 5CZXD 2IV9A 3I75B 2MSPA 3QBTB 1Z9PA 2OMUA 4K71B 4K9JA 5C2UB 1AKPA 1EXUB 3MBWA 2YKKA 2B77A 4PRIE 2VDPL 1BVOA 1U4EA 2WLHA 4CNIA 5DZNA 4F91B 5EIVA 3WFBL 5DI8A 3EYQD 3ROLB 5HTSA 1QFUL 1VPOH 2YIHA 3B34A 3GRWL 2V33A 3NBNA 1MRDL 5L0QC 1ZS2A 1LO5B 4KUZL 4MX7A 3VI4F 5CJQL 1NFKA 3BGAA 3MC0A 1SFHA 4DUVA 4Z95H 2VLRB 3G9VA 3TESA 3QUMB 2WLNA 2Y1AA 4N2BA 4ODHH 2WWKO 4IRSB 3AU0A 4KK8D 2WPGA 1FGNH 1OAJA 2Y07L 2XICA 4U3SB 4Y9EA 4KK6C 2X6UA 3GMPA 1VAHA 3OHXB 4HBCH 1NGYB 2WLLB 3CVIH 4HXBL 5ESVA 2F08A 3IJEB 1O9VA 1FFTB 3T2OA 1JBJA 1OALA 3IN2A 4PRPD 2H26B 4Z0XB 3HVDA 3V0VA 3UP6A 1SY6L 3RVUD 1MAMH 4YO0A 2P7TB 3BCDA 4ZI8A 1N2RB 4WI7A 2RAMA 4EKJA 4OCRH 4A38A 2XFXB 5D7IA 25C8L 1RURH 3RZWA 5CZRA 1HILA 1QLFB 3BFOA 4QHMB 4JFYB 3C9NA 1VRSA 5GZNA 4EZJA 2HTLC 3MLYH 3LIZH 1U42A 3T0BA 4PWKA 1MHCB 4NQED 1FZMB 4XN8A 2FBRA 1MCOH 1EFQA 3HBZA 2WAQA 4LCWA 5GS0D 1C9SA 3QZBA 3OZ9L 1S7QA 4M5ZL 3QFJD 3DX6B 5D7LA 3BUDA 4JJOA 4QOKA 3U6RB 3GSWA 3SDAC 4OM0L 3WEXA 2YFNA 4XB8A 1XSOA 5I0YA 3SO3C 5H8DA 1IGFL 5HPMA 5MP6L 1PCSA 3B6SA 3BQUD 4FNPA 1ACZA 4J3SA 1UVQA 1YJDH 2QVTA 3ZE0E 1K8IA 3HIZA 5DJ8A 2YOAA 1ZVNA 3KW7A 4RMQA 4YXHL 3D18A 2GT9B 2DWSA 1W0WB 2AKRA 3VFMA 1GOFA 3LEXB 1R24B 3B9KA 3L95B 1Z9SB 3KPPA 4N24A 3UTSA 3K7UA 3ABKB 3TA4D 3FCGA 4PW4A 2AEIT 5I16A 3QK0A 4H1LH 1FFOB 2NRDA 4Z78A 4XN4A 4AQEA 2HFEB 3KBHE 4F15B 4LZKA 1SEQH 1U92A 2CXGA 5EZLA 5SX4H 1RHHA 1Y18B 1PGRB 4O4YL 1UD2A 1SDYA 2BOBA 5JIKA 5E8NB 4Z77A 2BIMA 1ZHLA 3QZMA 3QDGD 1HDMA 3LYRA 2QADD 5BRZB 4KK6D 4EDXB 1OGPA 1CFTB 3DK2A 1QTPA 2OXGB 4LQFH 3RX5A 4JFPB 3FN9A 1XGPB 2BS71 1DVFB 4L9LA 2GK0B 5F6IB 2IH1B 1V10A 1QSZA 4YHOL 5AKTA 4ZFOL 3GHPA 4FABH 2NY6B 4LNVA