2FQDA

Crystal structures of e. coli laccase cueo under different copper binding situations
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
487
structure length
464
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of E. coli laccase CueO at different copper concentrations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 130
structure length 464
sequence length 487
ec nomenclature ec 1.-.-.-:
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqdA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fqdA03
2UXGA 4YSPA 2EIKB 1NDTA 4RH4A 2B08A 3EHBB 3SBPA 4YSOA 3SQRA 4E9VA 2H47C 2GSMB 3PXLA 2YAOA 7PCYA 1WA2X 3FU9A 4UAHA 3IEAA 3TA4D 4A67A 4ENZA 3EH5B 3FSWA 3PAZA 1AZUA 2MTAA 2YARA 1GW0A 2IDSA 2GHZA 1SF3A 1ID2A 4F2EA 4G72B 1NICA 3FYIB 4M3HA 1J9QA 1AR1B 3NJFA 1AS6A 1HFUA 4DP0X 4HIPA 3OMAB 5FC9A 1AACA 1JZEA 3H56A 4BXSV 2UXTA 5B1KA 4YSCA 1F56A 1ZIAA 1GSKA 4MFHA 5EHFA 2AANA 4AKQA 1I53A 3OMIB 4YSTA 5B7MA 2FT6A 1E65A 1A8ZA 1MZYA 2BP8A 3FT0A 2J56A 1JZJA 1CC3A 3CVDA 3QJSB 1KYAA 4DP1X 5D4JA 1RZPA 2IDUA 2IWEA 4YSSA 3MX0B 3NSDA 3S8GB 2YXWA 3ASOB 4YSUA 2YQBA 4K9JA 2PPAA 3KW8A 4GYBA 2TSAA 3UABA 4KO6A 1PNCA 2VN3A 3DIVA 4N8UA 1PZAA 3L45A 4DP6X 4YSEA 1BAWA 4Q8BA 1J9TA 2PP8A 3V9CA 1URIA 5I6LA 1GS7A 1JVOA 1QHQA 3QJQB 2IH8A 1KDJA 5AZUA 2BP8B 2BZCA 1NTDA 3ERXA 3X1FA 2XX0A 3T6XA 2BHFA 1KV7A 3NJMA 2VW6A 4G7RB 1AS8A 1OCZB 5IY5B 4AKOA 1J5DA 2XXGA 4KO5A 2CUAA 3NJHA 2PCFA 2XXFA 2ZONA 5I26A 2X87A 1SHWA 3AG4B 5I6MA 2DYSB 4KOBA 1NIDA 4WKXA 7PAZA 4QLWA 1N68A 2AVFA 2A3TA 1CUOA 5B7FA 1SHXA 2CBPA 5D4IA 3GXUB 3SBRA 1JZHA 1IC0A 5PAZA 3WIAA 1GR7A 1AZCA 2Q9OA 2UX6A 2I7OA 2QT6A 1MZZA 3H4HA 4DPCX 4HCIA 3HEIB 3C75A 1AAJA 3FU7A 5F7AA 1W8EA 2I7SA 1W6LA 1ADWA 1OCCB 1XMEB 2W88A 3PAVA 3ZBMA 2HX8A 3ABLB 5ANHA 4UF7C 2I85A 3NSCA 4NERA 1V54B 2FQGA 4A2EA 2QPDB 4KOCA 1BXAA 1KCBA 1ILSA 1M56B 2BP0A 2CALA 1FFTB 2WO3B 3QJUB 1PLAA 1OCOB 1TU2A 4BWTA 1AOZA 4KO7A 1A3ZA 3ABMB 3NP3A 4L0PB 3ZDWA 2UXFA 9PCYA 1KGYE 4JKNA 3UACA 2HLEB 2VSKB 4HZ1A 2J57A 3NJNA 2IDFA 2WO2B 3WKQA 1ZV2A 2CAKA 1PY0A 3AG3B 4EF3A 3AG2B 3NSYA 1OCRB 1BQ5A 3X2QB 2W8CA 2YAHA 4YSDA 3TASA 2FJSA 2FNWA 5E9NA 3SBQA 2RACA 2HXAA 2BW4A 4WTQA 1L9PA 1MG2C 1OV8A 4KNSA 2DYRB 1IUZA 4NAJA 3ZX1A 4W1TA 2Y1AA 1BYOA 3MBWB 1L9QA 3QJVB 4YSQA 1SFDA 2H5UA 1M9WA 2CJ3A 4G7SB 1SDDA 3IN2A 3EF4A 2DWSA 2PPEA 3EH4B 1AS7A 1NPNA 1WS8A 4A2FA 4W9ZA 3DKHA 2IH9A 2PPCA 1TEGA 1RZQA 2FQEA 4YVNA 3QPKA 2LLNA 4QKTA 2JFCA 4A66A 1JERA 1GS8A 2XV3A 5B1AB 2BZ7A 1BQRA 1EZLA 1SFHA 1V55B 1W6WA 1X9RA 2PPDA 3PLYA 1ZDSA 4HCFA 1SF5A 1CYXA 1OE3A 4BWWA 1WAEA 6PCYA 4BDVA 1PZCA 1BQKA 1JZFA 1JZIA 4YVUA 4DP7X 5TK4A 3X1BA 1CYWA 1PZBA 4AZUA 1AQ8A 4GP4B 3UAEA 3OQRA 2VSMB 4HAKA 1PCSA 1WS7A 3NJIA 5I5MA 5B1BB 1ASPA 1A4AA 2PCYA 1GYCA 1FWXA 4UANA 5F7BA 1WA1X 3PAUA 3RYMA 4DP2X 1JXDA 2GB2A 2FTAA 3CDZA 4BXVA 2B3IA 2CCWA 2JXMA 2AZUA 2XU9A 4FAAB 4BWUA 1JXGA 4DP5X 3CDZB 3T71A 4DPAX 2XLLA 3WNIA 3QJTB 4BK5C 1J5CA 2WSDA 3UGEA 1XB3A 4A2DA 3NT0A 1JVLA 1OOWA 4PAZA 1BEXA 1NPJA 3AY2A 3NJJA 1L9SA 3CVCA 1AZRA 1A4BA 2J5WA 6PAZA 3X1EA 5I5JA 2HRGA 4M4RB 4TXVB 4E9QA 1L9TA 5TK2A 1NIBA 4Q89A 1V10A 5B1JC 1IBZA 4DP4X 2FQDA 5B3SB 2H3XC 1IKOP 1ZIBA 4E9WA 1NWPA 5I6PA 2ZXWB 3N55A 1JXFA 3T6ZA 4FA7B 3QQXA 1A4CA 1NWOA 4N4YB 3X1GA 3G5WA 2YAQA 5PCYA 2FT8A 1KBWA 3T6WA 1IBYA 2YAEA 2GIMA 3WNJA 4E9YA 3UADA 2R7EB 4HCGA 1VLXA 1RCYA 1UATA 1J9RA 3QJRB 5D4HA 1PF3A 3EH3B 3WKPA 4GP5B 1ASOA 3U25A 4KNUA 3UAAA 4A2GA 3AG1B 2J55A 3GYRA 5B1JA 1WA0X 1XB8A 2IWKA 1ET8A 1AG6A 1MG3C 2NRDA 4G71B 4P5RA 3V9EA 3FPXA 3X1NA 1T5KA 1MDAA 2YAPA 2HRHA 1AIZA 2VM4A 2PPFA 4GXFA 1CURA 2GI0A 4CSPA 3FQ2A 3FPYA 3GDCA 1KCWA 3NYKA 4NB7A 1JOIA 1L9RA 1OE2A 4GY4A 1GY2A 3JT2A 3NJKA 1L9OA 2YAFA 5I28A 1BXVA 3ABGA 1E67A 2DV6A 3OMNB 1AANA 3FSVA 4CSZA 4DPBX 1ETJA 4P5SA 3NJLA 4YSAA 2IDTA 1KDIA 4PCYA 1AZBA 1HAUA 1E5ZA 4YL4A 3AW5A 2OV0A 4AX3A 4KNTA 5LDUA 4F7KA 3IBOA 3OM3B 1PAZA 3S3CB 2FQFA 2Y69B 4YSRA 2EILB 1AG0A 3IN0A 4JHUA 3IE9A 5B7EA 1JZGA 4E9RA 3TBBA 2IAAC 2FT7A 2GBAA 2PLTA 2R7EA 2UX7A 2HZHA 2EIJB 2IDQA 1J9SA 2VM3A 3FQ1A 4BDVB 2TSBA 5I6KA 2VMJA 4GP8B 2GC7C 4G7QB 2X88A 2XVBA 1YLBB 4JHVA 2VW7A 5I5IA 2EIMB 1OE1A 3T6VA 2XV2A 2EINB 1PLBA 2AZAA 3DTUB 2GC4C 1A65A 2P80A 1ZPUA 2E86A 3FU8A 1FA4A 3BQVA 3NSFA 1OF0A 4ZK8A 4X4KA 1PNDA 1PMYA 4DP8X 4KO9A 1B3IA 1NINA 3FYEB 3FQYA 2XYBA 4HALA 3PPSA 3BVDB 1NIFA 2HX9A 2BO0A 4E9XA 4AI7A 2P80D 2JKWA 2XUWA 3OD3A 2BP0B 1NIAA 1EHKB 1SDDB 4HHWA 8PAZA 5I6OA 4AKPA 2Q5BA 1ET5A 3ABKB 1M57B 3CZUB 1AZNA 1RKRA 1QNIA 2FWLB 2YXVA 3CVBA 2BW5A 2AFNA 2HX7A 3NP4A 2ZWNA 1SNRA 1NIEA 2OJ1A 3WG7B 1N70A 1R1CA 1PLCA 1DZ0A 3FS9A 2XWZA 2BWDA 2PP9A 5I6NA 1BYPA 1TEFA 1XB6A 5AFAA 2VW4A 2YAMA 1ET7A 2XV0A 3FSZA 1DYZA 2N0MA 3KW7A 3H4FA 4A2HA 5AKRA 1ILUA 3TBCA 1BXUA 1SJMA 4F2FA 3TU6A 2XX1A 1KBVA 1ZDQA 3N2JA 3D12B 3T9WA 4DP9X 2IWFA 1NZRA 2BWIA 4HHGA 1GY1A 1QLEB 3S8FB 3HB3B 3JTBA 2ZOOA 3ASNB 1X9UA 3CG8A 3ZIYA 2DY2A 4A68A 1E30A 3FU7B 1TKWA 1ASQA 3FSAA 1GS6X 3PCYA 2OCCB 2DWTA 4G70B 3S3BB 2MRYA 4E9SA 1E5YA 2PP7A 2QDVA 3AZUA 1HAWA 3WI9A 2QDWA 5A7EA 2UXVA 3S3DB 3NJGA 2QPEB 4E9TA
chains in the Genus database with same CATH superfamily
1K5WA 3IDIB 4P23D 1Q9LB 4NNYA 4G6JL 1N64H 4N2CA 5DRZB 3VRLF 3SBPA 4E9VA 2AQTA 3BAWA 3NACL 3IJYB 1RUML 5HHME 3PPEA 5DD5L 2BS71 4OZIB 2UUDH 3E7JA 3DTXA 3QE5A 5GRUH 5A2AA 3N1QC 4BJLA 3U7WL 5E4IA 3FW6A 2A0LD 2IDSA 2HCZX 2ROYA 4OGZA 3SEPA 2AJ3B 3TJHD 3PV6B 2VLRA 3KPRB 1WV7T 3C60D 4LVEA 4ODVH 4H5SB 2MHAA 4Z3EA 1S7VA 3AACA 3QQDB 5AAPA 4KQ4L 3U7WH 3UZVA 3LNFA 1JSYA 2WCGA 4M61B 3ULUF 2FJUB 2ARWA 5IW1B 1IC7L 5E00A 3OTTA 2X12A 1ORSA 2XTJB 2MOVA 3K4AA 5EIVA 1CDJA 3SE3C 1JGEB 1NLBH 1NA8A 1MZYA 3GMQB 3MGOA 4P57A 5T3ZE 4K2UL 2EVJA 1KPVB 1NMCC 3I9IA 4Y4HD 3SY0A 4MA7L 5JHDE 4PJBA 4EAEA 3ZL4L 1TQTA 4JFWA 1CDGA 1V7NH 1ZTXH 4QHPA 4Z0BL 3WHXB 4OI7A 4D8PB 1NLBL 4GQZA 2ICEA 3EBIA 4WFFD 3QIUB 4D8OA 4HFWA 2J5LC 4XNZC 4XN9A 4TUUA 3DMMB 3ZKXB 4ABUA 1HNGA 4MA7H 1M7IA 4QNPE 2RTTA 5DUPH 3ZL4H 4QRAA 4LEBA 2YR3A 5DVNA 4EDXB 5IROA 2V3FA 1OAYL 1J1XL 2G60H 5D1ZA 1XSKA 2AK1L 4QHNB 4QRTB 2O26U 3AMKA 2MHAB 4KOBA 3MR9B 5DUBB 3C87A 3TT1H 1OB0A 1J1XH 4U0QB 1UM4L 4OH2A 4OLUL 5CINL 5ETUA 4K71B 1XIWD 1F4AA 3VDBA 5E9AA 4LPWA 1AE6H 4LKCB 4OZ4A 3S7GA 4QWWD 4NDMA 4KPHL 4N6QA 2NXYC 4LGRB 3U1QA 1ES0A 1MZZA 5KYYB 5E8DL 4WNSA 1M53A 3L5WA 1IIKA 5DRZA 3C75A 4NHUA 1MJ7L 3HC4H 1NGPL 4H8HA 3FFDA 4FFYH 1NANH 3J7HA 4TNEA 3QUXD 4G8IA 4L8SC 5DZNA 4ZFQA 1NBQA 2QBWA 3QEQD 2OJEA 4NJ9H 4KRPD 3KPSE 5IQMA 4R7XA 2DYPA 1KC5H 4TQIA 1DQKA 3EHBD 1CTNA 4HSAC 1E4KC 2A77H 4QOKB 2BIIA 4JRWA 4UT9H 3U6XS 1F4YH 3F6IA 1M71B 1ILSA 2BP0A 3QJUB 5CLXA 1L0XA 4QHKI 5D1XC 3MACL 5CWSB 4ZNEE 2W60A 4OZHE 1UWEL 3UBXB 1UXWA 4TUJB 4KUCF 1T20A 2CGRL 4WEBH 1AI1L 4POZC 4EBQH 5HP5A 5GS2D 5FYKE 3RZCD 5ID0B 2WLLA 3MCG1 3QXVA 1NBZA 3PL6B 4HZ1A 5A2IH 3NJNA 1IRAY 3QJXA 4H0IA 5KSUA 1AGBA 2JJTC 2V33A 3NA9L 3VWJD 3OF6D 5D7LE 1L7IH 4WEBL 3WEMA 1AI1H 4EBQL 5EF3A 3KPSA 4XCNB 5EBLB 3QG6B 3DWTA 1RPKA 4KTEL 4JPKH 1X7TA 4JQVC 1IB5A 4OJCA 4ZAKD 4LVNC 4NO0A 2YAHA 3HE6B 4N1HB 3SGDH 1TNNA 3B8YA 1UGNA 4JO2L 1I9EA 3A4EA 3ARDD 4ELDA 5JOPE 2ROXA 4OCWL 2X3CA 1T04B 3I9PA 3AUVA 1E28B 4B41A 1FLRH 4N86A 4NUJB 2ITEA 4KTEH 5JW5A 3K2IA 4NO0D 1AQKH 3GPEA 3Q01A 4NKIL 5E2WH 3BWAB 1HTYA 2NY3C 4S1DD 4K94C 3SZ6A 1U8KA 2H5UA 2MMXA 4GUCA 1FL5A 4UTBA 5DJCA 2QVIA 4MXQC 4HIEB 3TO2B 3PWNA 1SHMA 1SXZA 5AL0A 2MCAA 3EO9H 1W2KT 5KZCD 4BK4A 3U36A 2G2PA 5IV2B 5KSAB 1F58L 3ULVE 4N0YH 5K39B 2WP3O 4ODXB 1ZTXE 5BPPA 5CZXD 5F96H 4K8RD 3CN4A 1Q9KB 2ESVA 2YC1A 4A37A 4CKQA 3HI5L 2XV3A 3JUYA 3MRDB 3ZR5A 2WKOA 3OKKA 5T3ZH 3D4GA 4XPBH 5CN1A 1RMFL 5EOCJ 4XN8A 5DA0B 4JQIA 5ABAA 5IFAH 3R7QA 4BWWA 5ECGA 1WAEA 1G7IA 3Q7JA 3WN5C 2TAAA 3WCYA 4QRUA 1U33A 1UVQA 4TQ8A 3VFMA 4Y5YC 4DP7X 4F33A 5I66A 5KEZA 5LXGH 1CYWA 5D7SL 3V10A 1A1NA 5EPMB 5F7HA 1P4IL 1WWBX 2BVEA 4U0RB 4H8QA 3DSNA 4QGTA 5AVQB 5HTSA 1EEZA 1MHPH 3ARGB 2E6PA 4LFHD 4M02A 1C08B 4ODUB 4DEPB 1W0WA 3B3IA 2Q87A 2IPUK 3LZLA 4KFMA 3QJFA 2Y9RT 2NQCA 3LV3B 1D5ZB 1MHHB 3EJYD 4NQVA 1MHPL 3CFEB 3VSQA 4AH2B 2Z91B 5I1LA 4OUUA 5DVPA 2AK4E 3HC0B 3DV6A 5JUEH 4IRJC 1IGTA 2HLAA 3HNVL 1QBML 2OTWA 1V8HA 5D5ME 4M5TA 3BAEH 4L8SA 3HI1B 5I8EA 1SUHA 1V3MA 3C5ZD 4XMLL 3G5YA 1CFNA 1IQWL 1L9SA 1NBYB 4NQTA 4UAOB 1PD1A 5HI3C 3V0JA 1INQA 4NO3B 3X1EA 4RFNB 3SQBA 3BPLB 4U6YB 4Q89A 4HS3B 3VFWA 2FQDA 5B3SB 43C9B 4NIKB 4N5EC 2ZYSA 4AQ1C 3WOVA 2ZOKB 4BINA 2PMZA 4WHYH 3WIHL 1G9NH 5A3ID 2H3NB 3MBEB 3HUJE 3KNBB 4XPHH 2NNAB 1OP3K 4IKLA 4JCWA 5IIEB 1OF2B 2TRHA 4I0PA 4JG1H 3K72B 5FDWA 4OFVA 4PWGA 1HHGB 5EU6B 5PCYA 4EN3A 1E6JL 1XGTA 2Q7NA 1SXSA 4AMWA 3CN0A 2BIOA 1GMEA 2HJLA 2V5SA 5HHOA 2XG4B 1T1WA 4JG1L 3DV4B 4NENB 4KX9A 1G84A 1JNJA 3KS0J 2BSEA 2R4SL 4OUOA 4XNMA 2JLPA 1E6JH 2J55A 4CBZA 2EKSB 3H8NA 2RB8A 1HOCA 2X28A 4LCYB 3RWJA 4G71B 3FT3B 1HN1A 3IFOB 2EIZA 4HT1L 1WQVT 2BVPA 1AIZA 1BMWA 4Z0XA 1OW0C 2PPFA 4JQIH 2RBLA 3ILPB 3X13A 4HP5A 3QUML 1KGCE 4RCAA 4BCZA 1WICA 3UTSB 3UZEC 1NFAA 4XMKL 3DX8B 4N2OA 5CXPA 1MSPA 2G5RA 3Q9QA 4Z7OB 1YA5A 2W9EL 4XVUD 5D2NE 4NUGH 4ELMF 1KCVH 1T4WA 2NW3B 1TYEB 4YL4A 5EUOA 2HPTA 2VZ1A 3LXAA 1ZOXA 3NCXA 1VACB 3JWOH 4MVBD 4AX3A 1PFOA 3EOAA 1S7UB 2IBBA 3GJEB 1HOCB 1VCAA 3L3JB 4I48A 4XWGH 3HG1A 1JNHA 1G0DA 4KZDL 4XHQA 5IMOA 1XF2A 5DD3L 1KCVL 4BZ2L 3L1EA 2W0FA 5EIIB 2WUBL 3RU8L 3JWOL 5IJKC 5AAWA 4OLWL 4PJ8B 3DRTB 4XWGL 5KW9L 4MMXB 5D7KD 3KWUA 3T3MB 3W2DH 3APFA 1VFBA 2B4CC 1EZUA 1P84J 2X9ZA 3B8SA 5DD3H 3K72A 3BW9A 3LDBB 2MQGA 3W1ZA 1AKPA 1MJUH 2P45B 4HWEL 4KROB 3L4XA 5AW6B 5HGHA 1KWGA 2P5WB 5FWQA 2D3LA 2YJQA 2NNRA 4PG2C 3QXAA 2P80A 3NRPA 4M8RA 4IBSA 1AC0A 1BJ1J 2JB5H 1NOFA 2EH7L 2H45A 5A2BA 1XGPA 3R19A 4LSRL 3VW3H 2DAVA 2H8PA 2DQIH 3BVDB 4KV5F 3MZTA 3RWCB 3N44F 1AFVL 4O2CA 1PBYA 2X4SB 4PLJC 5AAMA 3V0EA 3ZDZF 1BZOA 4G1MA 5E8EB 5GGTL 3GLEA 5I16B 1KBGH 1I9IL 4AKPA 1R4XA 4MA8H 4QHLA 4BSWA 1L6ZA 3BUQA 5FYLD 3RL2A 1NCGA 1ZHBA 3EYFA 5B38G 1FSKB 1U8IB 1P7QD 4LHUA 1J8HB 3M6DA 1IC4H 2BW5A 4EUPG 1TZHB 2WXJA 1EXGA 1KBGL 3N44B 4N6RB 3VACA 2AXJA 3DX9A 4YHOL 5KSBF 3HUJF 1KTLA 5DMJB 1P7BA 3FTSA 1TCRA 1T4KB 5I6NA 1U8MA 1H19A 2NDGA 1JF6A 1SBBA 3MRNB 4FNLH 5G55A 1CFBA 1WZLA 2VLLA 2V5MA 2VW4A 4PJ5B 3K6NA 1J7VR 1DQLH 1YVLA 3GI9L 4LLMA 3U4EA 2A9MH 3IAGC 5KVEL 4G8FA 1UUSA 1Q1JH 3ZTNL 4F2FA 2BVQA 3PF2A 2BSTB 4FNRA 1X5FA 4OB5H 2IAMA 1CLYH 1EX0A 2Y72A 3D12B 1T0MA 4Y7MA 3GI9H 4NQUA 2EC9U 1EFXB 4FABL 3U9UB 3NESA 1UD6A 3BPOB 1YJDL 3OJMB 1U8CB 4KITB 5BZWB 1WBXB 2BWIA 5DT1L 1TDQA 4LCWA 4X4ZA 4OB5L 4HXBL 1HEZB 4PYHA 1HNFA 2B77A 3ZZ1A 4NP9A 2AAVA 3DXAB 1I1AB 8CGTA 2JNZA 1OLLA 3RDTD 1MCJA 3I50L 3TZVB 3REVB 5HHXH 5EFIA 1S7RA 3HG4A 5SWQA 4YUEH 4JDVA 5B8CA 4G70B 1UXSB 4TULL 4YDIL 2ADGB 5HGAB 4ALAL 4FQQB 4QDGA 2R9HC 4HXBH 4PSRA 1FFNB 5EBWB 5JPMC 1HAWA 1KPRB 1BQUA 3T3ME 1Z5LA 3HLKA 2UXVA 5INDB 3NJGA 1JBJA 2YPLA 3BI9X 3VXMD 4O02L 3VRIA 2A7BA 3O9WB 1CS6A 4HWNA 5FUZL 5CGBA 2R8SH 4C4KT 3FUEA 2Q86B 5JLZA 1EAPB 4JZOB 4Y4KC 1TQBB 4FXGB 3FU9A 3IEAA 2HFFA 4XI5C 3CXDH 4EI5A 3EYVA 1Q0YH 2BSTA 2OSLA 2MTAA 2IGTA 2P42B 3B2DC 2N56A 4HWBA 4R7LA 3MGAA 2QQNL 3T6QC 1R5IA 4CVZB 1WE5A 1CDCA 3NCYS 4IU2B 5E08H 4EI5D 1QBLL 3LNIA 4PV9A 2F1EA 1NJ9B 4GI9A 4ZYKB 4N9OB 3R8BB 3VXPB 3MV9D 2BIPA 2BERA 5KSUB 3LX9A 1A7OH 1G7LB 2KDYA 3RP1A 4X4XA 2J88L 2NPLX 4WK2B 5KTEH 3BUTA 1EJFA 2Q76B 4AEIL 4TUJA 2FWOB 2XWRA 5C9JB 4X99B 2TSAA 4QTIL 4D3CL 3MRGB 5F6IB 5FK9B 4DP6X 2DBLH 1KB3A 4HXAL 1PYWA 3RWCA 5JQIB 1OTUD 4Y8DC 1JZ3A 4K3EL 4OF8A 5KBPA 1B4JH 4GT0A 3X1FA 1RZIB 3BUBA 1I1YB 3EZJB 5TH2A 2WGNB 2Z7YA 3FFDB 5AW8B 3VYPA 4Y16B 2A6IB 1PG7L 2RALA 3LZQA 5C0CD 3P73A 1NCJA 2NYYD 4LFHG 2G3ZA 1WD8A 1AKJA 1A6UL 5I26A 3S36L 4ODVL 3QIBB 2Z4QA 4D0CA 1OW0A 4DCQB 1JWSA 1MNUL 4YWGH 4MJIA 3THML 3T04D 2FK9A 3LRLA 3VH8G 1TPXB 4YFLF 3KPQB 4ABWA 1IC7H 4TNVF 3VD3A 1BHGA 1R3JA 1EDQA 3C5ZA 1KB9J 2N01B 5ESQB 3HUJA 1G1KA 3QJHA 3RPKA 4MQTB 3LKOA 3HG1B 3H4HA 4HCIA 1BOGA 1XGUA 4PREA 1MQKL 1S7UA 3GJEA 3L3JA 4I48B 5D1ZB 2EXWC 4ZMYA 4AV4A 3RVWC 4LMQE 2C1OA 2IALB 4ZMZA 5F3HA 4BFKA 4B50A 4MD4A 2ENYA 1M4KA 4HPYL 1ZPLA 2C3WA 2JV6A 4LOFA 5EEYA 1W72L 5C07D 5GS1C 4HOZA 1A7BA 1JPST 2C1PB 3PHQB 3HZMA 5DUPL 3TOPA 4BK5A 3FCTB 2CALA 2H0PA 4Y2OA 3SDDC 4HPYH 2Z7UA 1AOZA 2Y5QA 4L3ED 4Y4FB 5T1MB 2ESVE 5E2UH 5GS3A 1IAIL 4XWOC 4L0PB 3AU0A 1JZ4A 3BZFB 4QAWA 1OAQL 2N7SA 4BSWB 3MRLB 4DKDC 4HF5L 5HYEA 1KEGL 4UU9A 1H6UA 4YR6B 5C0AD 4KH9A 5CP7A 3SYPA 2YWZA 5CINH 1WAAA 3HHMA 2WP3T 4ZS7L 2HJLB 4YHZH 3QWNA 3DJSA 2XFXB 5EBMA 1SYSB 3V4PB 1E9QB 2ZSWA 1MCOL 2X4OA 3F5WA 4LESA 5A6MA 4N8VB 3AMLA 4JHAH 5EA0H 2Z8WC 4F1ZA 5JOEA 3U0PA 5HDOA 4KPHH 2DWXA 5C7XL 3PV6A 1YEHL 3M1BB 4TVPE 2FJSA 4D9RD 3SPHA 5AG9A 1NM4A 1J0YA 4JFOA 4X8CA 1FORH 1MJ7H 2A6JA 1C1EH 1U8HB 1QWUA 3MLTA 1S7TA 1BFTA 1F4HA 2KQNA 3SPVB 3ULVD 1XZWA 3GXNA 4GO6B 5H37H 1QUPA 4J3SA 1L9QA 3CUPB 1OCWL 1WWCA 2A77L 3V52H 4EOWL 4QT5A 4XAKD 4HG4J 1P4BL 5I8OH 3QFJE 4NOFA 2ZPKL 4PJ8A 1AGCB 1F4YL 3SCMC 3PXJA 1ZA3A 1VHPA 3WELA 5DEZA 1R5VA 1M3IA 1U2YA 3IN2A 4PJ9A 1GMIA 4M3KB 1UWEH 4KK9D 3D85D 1I7ZA 4IM8A 3EZ8A 4AT6A 2CGRH 2VDLL 4RGNB 2QR0A 5FM5M 4LO9A 3K3QA 2VN5A 3W38A 2E59A 5BZDA 4YN3A 4HK3J 3V5HA 4F9LA 1RU9L 4J1UA 1A6ZA 5B1AB 5L2KB 1P6FA 3ZU8A 1PG7X 1XF4B 3DX6B 4TMPA 4CKVX 1KLGA 3N1FC 4A6YH 4DNLA 2Q8AH 4AK1A 3SO3C 1FZOA 4JPKL 2ZUQC 3LRMA 4K8RL 2YLHA 1JPSL 1QZNA 3C6LC 3IJEB 3LEYL 1RU9H 5GGVL 1BQKA 4YVUA 5I5RA 3GSRB 3VNZA 4GP4B 4B9FA 4S2SB 3RIAF 1IEBB 5GGRB 4EZLA 4HAKA 4P46B 4AJWA 1K8IA 3VFVA 5MP6L 2NY1B 3DA0A 2YPKA 4G9FE 4IYKA 4LASL 5IHHA 3UTTB 4D9QE 2OBGA 1AQKL 2V7HB 2NX5E 4XXDA 1D2OA 1IEAA 3I85A 5JXEC 4FTVD 5J6HB 5E2WL 2XTJE 4ATTA 1U8PB 1JXKA 5HHOB 3JVFC 3MBED 4Q9CA 4C55A 3MRRA 3TLRA 3K2KA 1RXLA 2B14A 4FHBD 4AK2A 4LASH 3LIZH 4P2YA 3IMUA 4W9EC 2FYYA 1JG9A 1KXVA 3UXFA 4KFZC 1HE7A 5I17B 1AVAA 4JZJB 2Q3AA 4RRPA 5K39A 3HC3H 3IDGB 4PWHA 3P9LA 3QEQE 3RUGB 3LIZL 1XB3A 4HUCA 1BLIA 1OOWA 3LQZA 1RUAL 1FI8C 4FFVD 3DBXB 3C5ZC 5CUSL 3TONA 1KCUL 4YQXH 1IGMH 1UD8A 1IGCL 2I60H 8FABA 4AVHA 5DQ9A 5T3ZL 1YEDB 4J3VA 3GXMA 1EEYB 3ASWA 2J8UE 3TBWB 1F6FB 1NIBA 5TF1L 4IDLA 5ITBL 1SXNA 4RWYH 1PY4A 5B3JF 1TTRA 3EG9A 1VKXA 4YQXL 3RUGF 5D2LE 2WLIB 4FKEA 3BP4A 1YNTB 4UIMA 2OTWB 5TJWK 4TL5A 4JG5A 4XBPA 1IGTB 4EXPX 3Q6GL 4OFKA 1A4CA 4J3XA 5FGRA 1UZGA 3X1GA 3ME0A 4XN4A 1LMIA 5D2NA 1A1OA 2FHBA 3AWEA 2FZ3B 1SN5A 1YJDC 2DZEA 2B20A 2VDLB 4NP4L 3ZO0A 2A4CA 3P02A 4X9YA 4D0DA 4W9IC 5I2IA 2O5NA 2D4DA 4XO4A 4EI6B 4TVPH 3LNDA 1WGVA 4TSBL 2DWYA 5AVVB 5JUEL 3QDGA 5CN2A 3L5XH 3HNVH 4K3GA 4Q56A 4KKBD 4Q9QH 1UXWB 4Y9BA 3T8XB 3FC8A 1G5AA 1I7TA 2Z3FA 1L3NA 2BLFA 1XCTB 4P0DA 4TSBH 4F7PB 2WQAA 4F7MA 3CTTA 1AXSA 5C3TA 1FYHB 4WI9A 1ICTA 3JT2A 2ATKB 1QX1A 3CLFH 4C83B 1RLWA 4HV8B 1WK0A 1KJ2A 1H6EA 1MXDA 1S2EA 2ITDA 5HJDA 4G9FB 3F8UB 4MKTA 3C8HA 3G5VA 4G8IB 3UZQA 4M8VA 4ODXA 4JFYB 4J3BA 2V2XA 1PZDA 5BW7A 2VZVA 2O4EA 4XCFL 1N6QH 1GHFL 4HFUL 4YSRA 1DO6A 1JZGA 2KL6A 1M05A 3OZ9L 4BH7A 1OAXH 2OSYA 4PG9A 1HESA 3IS0X 2YGPA 1C16B 5BZZA 2F58H 3HRPA 3MJ6A 2F08A 3RHWK 4YPGB 1M2VB 3LYRA 2TSBA 5I6KA 4N8VA 1QFWM 3U0PB 2ODIA 2CLVA 4H26A 4PV1C 4XHJC 1EANA 2EYSB 4HT1H 1W72B 1M7XA 3FQUB 4C56D 2OCFD 2IPTH 3L4WA 3MOAH 3TFBA 3MI6A 5JA8B 3EGXB 2AS5M 4DAGL 2Z35A 5ALCH 4NCC2 4NFBA 3NN8B 2CXGA 1M7IB 1FH2A 1D5XA 4DQOL 2WKGA 1FDLL 5F9JA 3VXUA 2VYRE 5EMYA 4F24A 1OT4A 5ADPL 4LHUG 4P46C 4RAHA 4PLJD 4DGWC 1SXBA 1DLFL 3PL6A 1PSKH 1RVFL 1ZSHA 2FWUA 2E76C 3GJFB 3ZE1E 5ES4B 4QRPB 4QRBA 2E7MA 5IVOA 2ICCA 3U0TB 1XGQA 4KVNH 5FGSA 1T20B 4R6UA 4NWUL 3GFUA 2OYKA 1RKRA 3CVBA 5ADPH 4HS6B 4IBYA 4ESKA 4HOMA 5DJYB 1PSKL 1RVFH 1OGTB 1J88A 3CZEA 5KW9H 3GSQA 2NY5C 5C08E 3DRQA 5AD0B 1DDHB 4ZODA 2AJSH 4P59H 2X10A 4L8CB 2J7LA 2OL3A 4HWEH 2Y1ZA 2Z7ZA 1IV8A 4PQXA 4V1DA 1CDBA 3RIFF 3WXVH 2PW1A 5DDHB 4MJIB 2Z4QB 1KFAL 2GJZB 3MV7B 4LCIL 5T1DH 5T33H 3UGXA 3L9YA 4EIGB 4KMQA 5CEZE 3VI3E 2CCLA 12E8L 4UT6L 4FXLA 4Y2DB 1K5NB 1MI5D 1JUFB 1RHFA 3WXVL 4X7DC 3CFJA 1NZRA 4HDIA 3WJMB 2ARJA 1ZLWK 3TN0C 3ZN6A 3JWDH 5K9OA 2OMTA 1L5GA 5DC2A 2JIXB 3BUPA 3MV9E 4NQDB 4P5KB 1SY6A 2X1WL 3QB7C 4MD5B 2X4OB 3RTQC 12E8H 2PABA 2ZCZA 4GS7C 1ZD6A 4P3CH 3PCYA 1ODAA 4KKAC 4PD4J 3HZYB 1NCWL 3ZRCC 4OFYA 5DJ0B 4RBPH 3DXAE 4JPVL 1N0LA 1N59B 3WFHA 4YHOH 4HSQA 5DS1A 1CU4L 3NFNB 4E9TA 3T4YA 1DANU 1GCFA 5IT2H 3WTTA 1YEKL 4RH4A 3ROLB 2HVKA 4F8QA 3ARSA 4Y4FA 5T1MA 4PRPB 3STBA 1DLHB 4YHMH 2OPCA 3L16A 1M1XA 1UHVA 1ZKAA 5HPOA 4PRPA 2VDOL 2WPGA 3D4CA 2HVKB 3WO4C 2ZCLL 4XT1C 5BW7C 1YEKH 1Q1JL 1FBIH 2XWBA 3OKDB 5GS0D 4Z7WE 4Y5VA 1ID2A 5KS9A 5KVGH 3GMQA 3KL5A 4NC1E 3QUHA 4X9GA 5E1GA 4DCQA 4YHML 2MIZA 1N18A 1WTLA 4RNRA 1EZSA 2FECI 5DD1H 5F1NB 2I9TB 1AACA 4P2RB 5F70A 5L88H 3TBTB 1FBIL 32C2A 4M61A 5L6YH 4MXVF 2GT9B 3FFCE 1M3JA 2R1YB 5KVGL 1IGJA 4I0PD 5DGRA 4ELME 2CO7B 4JFXA 3KYOA 4OLZL 3I50H 5HHXL 4HX1B 4AQ1B 3FAXA 1IX2A 2AJ3A 2NY0C 3BEWA 3JV4B 3MLSH 3CFJB 4NNPH 1T5WA 4ALAH 1A6WL 1N8ZB 2IDUA 3HG0A 5C09B 3WNOA 1U3ZA 3MJGX 4NZRL 2XN1A 4WKZA 5K33A 3B2VL 2WJ7A 4GKLA 1LWHA 2FUQA 2P7TB 3L45A 4NGHL 2F61A 1BAWA 1TTBA 4XODA 5HYIA 5DDHA 4AY0A 3QJQB 2HMID 5D6DA 5HGGS 4H1LG 3ALXA 4F2ME 5AWNH 3CFCL 1HEZA 1G7LA 3H9ZA 4WJ5A 2F19L 5DEGA 1WTGT 2R59A 3HZVB 1CDHA 3SKMB 4PV9B 3T0XA 4UI2A 3CZFA 1SY6H 5E7FA 2GTZA 1CT8B 4WKXA 3T0VA 1EK3A 1K4CB 4MB1A 3V0HA 3WEBA 3MV7D 1PL3A 1QBLH 4GMSL 5CBAB 1LILA 2DWEB 5PAZA 3VG0H 3GBNL 1JYVA 3CWGA 1YYLH 1CDUA 4LXFA 5F7WC 1IFGA 4N28A 3GJFA 2GTZB 5IJBC 3BFOA 3JYCA 2A1WH 3K81A 2NY3B 4JNXA 3H9HB 1ORQA 1UM5L 5HYJD 1W8OA 4LBAA 5DLML 5C1MB 4HPHA 3GK8H 2ZSVB 5LO7A 2KZBA 1UYWH 1U2CA 3EOTL 4QTIH 3NRFA 5LCVA 5AZEH 2BX5A 4Z7VE 1KYDA 2KPNA 4HXAH 4UQ2A 4ZOCA 4X6DB 3NSCA 4EKXA 2EE2A 4F7TB 1ZRUA 4XB8A 1W91A 3REVA 5F71A 2ZG2A 4K8RC 5E8EA 3EOTH 1BD2D 1MH5A 1KJVA 1P5UA 1S9WB 1ZT7A 1DQQB 1P7KA 5FLUA 3ABMB 4LHQB 1DSWA 4CSSA 1HC1A 2IIJA 1U8CA 3ZDWA 3LN4A 2VIRA 1F13A 2UXFA 4OM0H 1G0YR 1U58B 5AVYB 1JHKL 4D2NA 2R69A 1U8QB 4MCYB 4FP8L 3AXIA 4JBSA 2WMPB 1Z66A 4ENEC 3BWUF 2DEXX 1WFMA 3THMH 4JDVB 3PWUB 4WI0B 5E1HB 3TBTA 3ZL2A 1SUJA 5IQOA 3OSVA 2HN7A 4OV5A 3G5ZB 3CH1A 2O6EA 5KYXB 2F8IA 4R84A 3UX9B 3GSXB 4XNXH 3L3DB 3TBYB 5MENA 1CVSC 1GYWA 3AREC 2AMUA 5E5UB 4YSDA 4BQ9A 4KGLA 2EICA 1JZ6A 5IJDC 2XWBB 4I2XB 4JAMA 1XIWA 2NTSP 4IMKC 4IMKA 3NTCH 3MLPA 3GIZH 3NCEB 4FEMA 1L9MA 4XNXL 1H8SA 3FH8A 4XN7A 4OCXH 3QUMB 4MJ5B 5LUMA 1U3YA 1MKFA 1Q9OB 2YD5A 3GDBA 1W72H 2Y06L 5DHXB 3DUSB 3EO0A 2O61B 3KVDD 1M7UA 3C09B 3NTCL 2IBGA 2XFGB 1OGAA 4K5PA 2BY1A 4M5YH 3A4FA 4XNBA 2BOLA 1MCPL 2X70A 1PQZB 3APNA 3MRQB 4QXWA 2DQHH 1W16A 2IH9A 1TEGA 1XTLA 1BPVA 2MKWA 5T5FL 3QULA 1UCBH 1FZKB 4N2MA 4JLRB 3SHSA 4FEIA 5HDLA 4UINH 4YVNA 1T21B 3L5HA 3QAZB 2IOMA 1FZJA 1KIQA 2O5YL 3Q8FA 2Y5TB 1P7HL 1H6FA 3EUDA 2OZNA 4R97B 4X5LA 2DMBA 4K7PY 4LCCB 2GYSA 2F8XC 5T5FH 1EAOA 1DVFA 1S6NA 4PJIA 5KZCB 1ZDSA 1MCOH 4PM1A 5DJ8B 4M9PA 3N04A 1PDKA 2N0KA 1ZANL 4NENA 2K78A 5CHNB 2O5YH 2V2TA 3TPUA 2EO9A 1FFOA 4MTMA 3GF8A 2G30A 4MBOA 5DEFA 5CZVH 3H9YA 4MMXA 2HT3D 3BUYA 4MB4A 4N2IA 5ICYB 3KPSD 1C1EL 1EEUA 5DZAA 1J0ZA 5B1BB 2OTUB 5BNXD 5IFJB 3MA9H 3Q8CA 3CFKB 4YHPA 4PB0L 2OKMA 4O5LH 5C7ZA 3MUUA 1UD4A 5CZVL 4JN2A 5I8OL 1FVDB 2WVUA 2AXWA 2X2UA 3P9LB 3PAUA 1LJMA 4QRPD 2WSKA 5DMIL 3PV7A 3SGEH 3U2SA 2IEPA 3EKCA 3R4DA 4U6VL 2YFOA 3BP5A 5CP3H 2P49B 3GBML 4P23A 5J06A 1J5CA 5E1IA 4ORGA 3WHE1 1SDAB 3L3GA 2OXGA 4L1SA 4X0KA 3B6SB 3QSKB 3UTSA 4F80A 4I0KA 2BFVL 2N1TE 3NJJA 4JY6B 1USQA 4R4ND 5HI5D 3K71A 5FUCE 5HHVL 3DO7B 1FJ1B 5E8NB 1PPIA 2VITA 4A6YL 4K71C 2Q8AL 3R0NA 4Q9RL 1X6LA 1EBAA 1FJ1A 1QI3A 2WAQA 1V10A 1AP2B 3GZKA 3FT4A 2FLMA 1KBPA 2H3XC 4WWKB 2W91A 3QFDB 4P9HH 3KL0A 3MODH 4MS8C 5KBLA 2XPGB 4MJJA 5FPIA 1FL3A 2B1HL 4PJAE 3HPJB 3PP3K 1BJ1H 4GG6B 4XOCA 5IROC 1JPFB 3QQXA 5TFSL 3U83A 5EWIL 1FLTX 4X6CF 3QEQB 3Q13A 1U95B 1HHGA 2UYLB 3X13B 2HTLC 3ZDYB 3CGTA 3H0TA 1S5IL 2BVPB 5D55A 3ZRFC 3RVXC 2UY7A 4MZ2A 4U2YA 2ZOKA 3AITA 3VFGL 1SN2A 4XMVA 4YDNA 3N41B 2XZZA 2DLGA 5MEPB 1FFQA 2OXGB 4X0KB 5FYJD 1DFBL 4X6CB 3TNNA 4YFLI 4HPOH 3RKDC 2W0LA 4K15A 1S7SA 1RI8A 5EC1B 1TTFA 3CCHA 3NABL 1FE8H 3SJVD 3IYLW 1CI5A 3U9PL 1JPGB 5IGXH 1IGML 2I60L 4JL2A 1DFBH 1E5AA 5C0CA 3O4OB 4IEFB 2QTVA 5FYKH 1JAEA 1A14H 4Z7QE 4LRNH 3NABH 5I76B 5ICUA 1FE8L 1N10A 4P2QD 2WXFA 4A39A 1UWYA 3WS3A 1KIRA 1PX3A 3F5WB 3IKCA 4L1HA 3QEUB 4CGTA 4GQ9L 3QULB 4XPAH 4MZ3A 2ZXGA 4O2FA 1A14L 4Y8AA 1WUNT 3UBXG 4BZ1H 2QGCA 1CFVH 3L6FA 4WW2C 4M43H 1J05B 5FA3B 3RBGA 4N3TA 4P48A 4F58H 1SYVA 4BGDA 4MDIA 4LSPL 3WIHA 5I1EL 5BRZA 2YSTA 2A9CA 4NP4H 5FDYA 3QFJB 4ATWA 1CFVL 3DV6B 2IH1A 2QL1A 2F1BA 4QUOA 3KCPB 3NIDF 1K4DB 2K7PA 3CVIH 1MW0A 4I18A 4LL4A 5IWLC 2D31A 5IP4A 3VU1A 1WFUA 2C1PA 3ZDXE 5CGMA 1TG8A 3KBFA 1UT1A 3PGDB 1I1AD 2GVYA 1OSYA 5F2FA 5FHBL 3ZJAA 3EXLA 4HA1A 2J2ZA 2FATH 5JPNC 2PWEA 4U3SB 3NSXA 3QHZH 1WC7B 2RQEA 3EJJX 5C8JA 5GJTH 5T1KD 5GZOA 4C56A 5C86A 2XIDA 1IL1A 3QXUA 5D6CB 3O4LA 4XPGL 2BP0B 3QUYA 3ZT7A 4XNUH 3IE4A 3FCSB 3MQIA 5T5NF 5IQLA 1HH6A 1TQCB 3MV7E 4PJ8C 3UZEA 1RH8A 3DMMD 1VA9A 2Z1KA 4TPRH 2F74A 5GJTL 3QR2A 4NC0B 4IOFD 3LS4L 3QIUD 4OIAA 1BAFH 3LDBC 3IDXH 3TA3D 4NX0A 2QQQA 3OZ9H 3RGHA 2JF1A 3BGFB 5JW5B 1D5MA 1LWJA 4Y4HB 5IV2A 4DWHA 5C92A 1CIUA 1ZVSB 1QACA 2NUTB 3B56A 4YK4B 3HE6A 3JZYA 3QNXA 1A7RH 1R33A 1FL5B 1I3GL 3ARDB 3KJ6L 3JTSB 1NC2A 4FI8A 43CAA 1B6DA 4QXUH 1LTXA 2Z31C 3QGVA 4BBWA 4EDWH 5JHDD 3ZKQD 1OQOA 3UAJD 4IKNA 1U3NA 3ZVVA 1ADQA 5EO0A 1E2VA 1E7VA 5FM5O 4LBEB 4PWKA 4X6EA 1FDLH 4JZJC 5CU9A 2IMNA 2V9TA 2KERA 3BPLC 3JTBA 3OQ3B 4D0BB 4IDJH 3EFFB 4EDXA 5LQBL 2VAJA 2XVGA 1QLRB 3MXWL 5JHDA 2MPAH 2XNAB 1TJGH 1DLFH 3SJVB 5BZDB 1GC1L 2JK5A 4UILL 4WI3A 4J7RA 2P48B 3P3YA 1RZGA 4KVNL 5IVZB 3PIQB 5DFVD 2VLKE 4X7TB 1Q0EA 3BHBB 1I7ZB 3RNKA 3K8LA 4WJ5B 3SODB 5AB9A 1HH9B 1GXEA 1IC5H 5ICXB 3MRFA 1KTDA 3RDJA 1TJGL 2E7LA 1NCUA 1H3WM 1TZAA 5E6ZA 3D07A 2X4PA 2VLME 3MRMA 1P6AB 2OR9L 4PRAB 3SY0B 3UTQA 1TZGH 2YPVL 4NJAH 3MTXA 5CBAA 5L8JB 5C0GA 1E8ZA 2ZNXA 4KRPB 7PCYA 2KDGA 5KJRH 1UG9A 2GY7B 7CGTA 3SKMA 3ARTA 3O3DA 1C12B 1JVKA 3HZVA 1MW3A 3CN2A 5IW6B 1T22A 1SF3A 2PCPB 3GTNA 2DYPB 3QQDA 3O4OC 3H3PH 3KJ4B 2A9DA 2X44D 4WWKD 5TE6L 2BMKA 1BZEA 1MHEA 1X5GA 3EIFA 1HFUA 4N0CD 4Q4EA 5FC9A 3JWNE 5HY9A 4P8QA 4ANXA 2VXUL 2YPVA 2DKMA 5C0DA 2P8MA 1KNOA 4YSCA 3WFDH 3JWDL 5EF2A 2E7BA 3D0AA 3OZLA 3BEVA 1QPPA 5IMMA 5DO2D 1UZ6F 3ECQA 4UOW1 2GJ6B 2PWHA 2VNCA 2UWEF 3O6FD 4RESB 1N6VA 4I4WB 1DVFD 2K3TA 2UZXB 3WFDL 3FL7A 2BNUB 2IWEA 4YSSA 5JMRA 3O3AA 3UMNA 2GI7A 1CR9H 3QRBA 3FO1A 1PZAA 2G2NA 3QDGD 1CU4H 3D3VA 5J4MA 1MJJA 5EO1A 5EB9A 3GSWB 3V4UH 3M88A 5AZUA 1CR9L 5JOFA 5TQ0H 2OQJB 1WFOA 2BHFA 3T6XA 5C0BB 5B39B 1VZGA 2VCOA 2R2EA 1H3TA 1G94A 3KPRD 2VDOH 1NOLA 3U30B 3DDGA 2EXTA 3V4UL 4OZFA 4JO5A 4PRIA 1DBMH 5TQ0L 1HHHB 2X87A 4XH2A 2N1KA 4Z77A 4RRPM 3DGGA 4QHKJ 1JNNL 3KPRA 1GZQB 2KYIA 3WY3A 3MPCA 1XGZA 3PUCA 4TNFA 4F8LA 1F2XK 2IADB 1F6LL 2EDQA 3F2LA 3DIFB 5F3FA 1J8SA 2R1WA 3OVUB 1AZCA 2HLFC 3GSNH 1X9QA 5ANMA 4N0UB 2IVFC 2VB5A 2QT6A 1N5YH 4QRRA 2GJZA 2ENJA 2X6CA 3GS7A 3HZYA 3MV7A 1RJLB 1S4IA 3N06B 4U1JB 5J5EA 4AYDC 5A16B 3PHAA 3TVMB 1JI2A 3VXQA 2DH2A 2DEYX 4UQ3B 1AAJA 1QD0A 5I1GL 1OP4A 3GSNL 3V5KB 3VXME 3IAPA 1O9WA 2NY6D 2OL3B 5LLIC 5M95B 4BHUI 3CFIC 1XR9A 5GGRY 3U2IA 1EDYA 1GGIL 1N5YL 3IRZA 1EGJL 1BIHA 3I2CH 4V11A 1UJ3B 4HETA 1BXAA 3HG1D 1HXYA 1DJXA 4PJGE 5JIMA 3QXWA 4QRQB 5SV4A 2WXOA 1N4XH 5DGQA 3GZPA 1RSFA 5EUOF 1M7DB 1O6SA 5AOZA 3ZSTA 4PLNC 1OTUC 3ARPA 4F9PA 1S9VA 5J6GB 2ADFL 2GK0A 2BSCA 5FHAL 3RVVD 2V7NA 2AQ2A 4DEUA 1OL0A 2B9BA 5CN3A 3WKQA 1A4KB 2RIKA 3AG3B 3GLAA 4TYUA 3VXPA 5T3XH 1HXMB 3WFBL 2FO4A 5TPWH 4XN5A 1BQLH 1ZEAL 3LEXB 3Q05A 1X44A 5I1CH 1CLOL 5IJCC 3KPOA 4H1LH 5EUOB 3OC8A 3ZE0B 2E7LC 4HS6A 3L4YA 2DM7A 3P0YH 3SDXA 5GRZA 5DVMA 5SWZD 4BEIA 1KTCA 1BQLL 1ZEAH 1HYRC 5D71L 5FF6B 2YZ1A 4FNPA 4WTZA 5I1CL 1HJCA 3GK8L 1HEJC 1TETL 4X5WB 3BP7A 5ESAB 4W1TA 4NUMA 1B0WA 3A4AA 3P0YL 4JKWA 2HVJA 3ET9F 4DKEH 4GO8A 4KJQD 5CJBA 3IGLA 5D71H 3ZL1A 1SFDA 3O9WA 1HZKA 2F7OA 4XPFL 1YEEH 1M9WA 1QR1B 2W9LA 1XH0A 4NBXB 3NH7L 2I32A 1O6TA 1ZGLP 4QJ4B 3WNNA 5IMKB 4PRIE 4PMFA 4YXKL 25C8H 2CWRA 4B95C 3SDXE 4OM0L 3V95A 3BN3B 4I2XE 2ED9A 1JFQL 4NT6B 2EAEA 1NBCA 3VWKC 2LLNA 4Y5XC 5HYSA 1JGUL 1BWMA 4FP8H 4OGQC 4I13B 5B3NA 2AEQL 3BKMH 4HCRA 4RQQA 5D1QE 2IPKB 1EZLA 2FHFA 3QYNA 3GQFA 3B7SA 4N0CC 4HCFA 2A73B 4FN0A 5FYKU 3QP3A 1ZK5A 3IMVA 1YYCA 3FFCB 2JJSC 2ZNWA 2E6QA 3CVHA 5C0AA 1MRDH 3FFOA 1JZFA 1BWWA 4Z6AT 3AJ7A 1MWOA 5F0JB 2QQLH 4PJ5E 4AZUA 2EC8A 3OKEB 3Q2NA 4G8FB 5CILL 3UAEA 1OY3B 4LNRB 1I3RA 4GUQA 4LU5L 4JFYA 4JM2C 3ES6B 2BNQE 3GEWB 4TLTA 5DS2A 5EZLB 2E6JA 4PJGB 1WJ3A 2OYPA 5I8EB 3AVEA 5LWYH 1YG9A 1T4KA 2Y06H 3BSZH 4PWJA 1E8XA 4UWQB 5GGVY 3UGUA 1MJ8H 1CGYA 3HR5B 4Y5VC 3ZQ9A 1DSYA 3T4AC 3CDZA 3WENA 3PJSA 3UERA 3GC3A 4H0GA 2FSDA 4XE5B 1HWGB 5GGSB 1R75A 1LE9A 3BKYH 1QSFB 4FAAB 3CDZB 3BSZL 2XLLA 1XR8B 4X8JA 1E43A 1S9YB 1GAFL 1GPOL 3KS0H 3IF1B 5GZNC 3QJFB 1YNTA 4YDKH 3CZLA 2OR7A 2VE6B 3PJNA 1QBAA 3O2DA 4KJWD 5AB2A 4G9FD 2CG9X 3QR0A 4M7LT 4PJ9D 1VGEH 4HMDA 3MV8E 5D1QB 1AZRA 5JIPA 4GAYB 1KEMH 1E9OB 4DVBA 1A4BA 2WB1A 1U42A 1YEDA 1SLVA 3TEYA 4P2RD 1XGPB 2DMGA 4O4YH 3L9RA 2V8MA 1JF1A 4LEOB 4X9BA 4DP4X 3JTTA 3M1CA 1VGEL 4U1HB 5FUOL 3HRZA 1MNNA 4HUWA 2HLFD 4UQIM 1NWPA 1J0IA 4RAUA 2EZ0D 1OALA 4X5QA 5DUJA 1A3QA 4MAUL 4J12A 3O2DL 4N4YB 1CICB 1JHLL 2EUZA 5LNDA 3C6LD 3HN8A 4YBLB 4LDEB 2VDPB 3WNJA 2ZKWA 1UB5A 3EFOB 3S37H 4E9YA 5ID1A 3WKMH 3FB7A 4ODWB 1S46A 4KKZA 1NMCB 3MV11 4LMQI 3BRFA 3RG1C 1PFCA 2YQ2A 3BAKA 1LEIB 1U8PA 2FR4A 2NY0D 1LHZA 4WHDA 5EORH 3GXDA 4KI5C 3O8XA 3S37L 2OSWA 4NS0A 1CJYA 1HQRA 1U6AL 3DUUB 3KLAB 2R27A 2FLBT 3FH5A 4EVNB 1NGZA 2YLKA 2BSSB 4FQHA 1NANI 3MRCA 2HRHA 4LGPB 3HNSL 2GI0A 3KGUA 4JUTA 2XTJD 4C56E 5IBTH 1V7ML 4WU7B 1RHHA 3NYKA 4F37F 5F6IC 1KIUB 4HVBA 1BZ9B 4GY4A 3WMPA 4K9EC 3O6KH 2NT0A 1QBBA 4Q9RH 3EOYG 4CMMA 4KRPC 3UBXI 3ABGA 4PTUA 3EGDB 1JZ7A 4NI6A 2V4LA 4CSZA 1T5XA 3QC6X 2BNQB 5GHWL 1WFTA 4AG4H 2AW2A 4PJHE 2F53D 4PS8A 1K8IB 3VGDA 4TS6A 3P2TA 5EZOL 3KPOB 1JGLL 2YN3A 3C5SA 4JJ5A 4C4BA 2VLMD 4FQJL 4W6YB 2EXSA 2EKSA 1OEZW 3M7FB 3P69A 3Q2VA 3JWNH 4UDTA 3O45B 5C6TL 3OWRA 4ONHA 5HHMB 1AG0A 5I23A 1RL1A 1OP9A 1IU1A 1NEUA 2FT7A 2R7EA 3BFWA 3GUTA 1XF4A 4FQJH 5AYQA 5J1AA 5SX5K 2IDQA 2JJUA 5L2KA 1GA2A 1NUNB 2VM3A 1HHJA 3M8OH 3WN5A 4KK6D 5EZJA 1SMOA 2GC7C 4U6XA 5GGTA 3VUAA 5IIEA 3SDAC 5SWSA 2NY6C 3F85A 1E4HA 2CHXA 3A47A 4JHVA 4WSKA 2B3RA 1U8OA 5IHWA 3RPIB 4ZFOA 1LQSR 3NEEA 4LVOC 4N3UA 1HT6A 3AGVA 2XWTA 3M8OL 4QEGA 5CU5A 4F93B 2YMXH 3EADA 2GCYB 2QZ5A 2X6AA 3SKJH 5LGHH 5IGXL 4AEFA 4N9GA 1I9JH 1V27A 1AGCA 1NM9A 3MRPB 3QUKB 5AYUL 4PR5B 5FYKL 1WBYB 5ESVB 2LT9A 4LRNL 3GHEL 4MJ6B 4HIXL 5CP7B 2R2HB 4PGDB 1OM3H 3SKJL 1A9BA 5DJ8A 1BF5A 4FJZA 3QR1A 3MX0A 5AYUH 3EFDH 2XKUA 2VLJE 4YZFE 4FQ1L 3TYFA 5JTWA 1K8DB 2DB8A 2JMRA 2LVEA 1AZNA 4HIXH 4PU2A 1OGAD 3HZ3A 3MBXL 1KB5L 1HHKB 1OZTG 1YQVL 4WEMB 1DHKA 2CLRB 1A3RL 3FUHA 2GJRA 5TDPA 2XFXA 5F8RC 4OCMC 4N90D 2H1PL 4J6RL 5IFHH 2PP9A 3MJ9H 3D8MA 4M1GH 2W1NA 2C9AA 1KB5H 5DTFB 4PHXA 3TV3L 4ZW8A 2BRRL 2J6EL 3ULVL 3OKOA 3RZCC 1LP9E 5E8OA 1QI5A 5CS7A 3KW7A 3H4FA 4A2HA 4P9MH 1NCBL 4NM4H 3KYKL 3DUSA 3D39B 4YHNB 1DDTA 4R96B 3MJ9L 3L9BA 4MDRA 3RWFA 4AIZB 2PW2B 4IRJD 2Y7LA 1B0GB 4RMQA 5DK3A 3RNQB 5FCUL 4DUXA 1JV5A 4XVSL 2Q8BH 5LN8A 2H2SC 5GGSY 4CW1A 5I1AA 1NCBH 4NM4L 3UJTL 2E5EA 3C5JA 3V0AC 3WYRA 4WDIA 3S8FB 1REIA 5C3LD 5HJBA 3K1KC 4GRLD 2J3SA 2EO1A 2HPOA 5CD5D 4XOAA 5E2VL 1UGKA 2Q8BL 2VAAA 4LZKA 4XNUL 4XVSH 1F4WL 3ZUNC 2ADIA 1WVZA 2FX9H 4B27A 3VGAB 3PWPB 3S3BB 4L1LA 4WWID 1FFPA 2QDVA 3WLBB 4Y1SA 1U36A 3FUFA 4JFQB 1XSJA 3DVFA 4BELD 3PABA 2WM0A 2MCMA 4WGWB 2G5BB 3KEHA 1BA9A 4HKZB 3P3TA 3KR3H 4Y1AE 5D7IB 5BQ7A 1T80A 2X7LA 4J8RA 3BQUA 1R24A 4A67A 5C0GB 2ZD0A 2ZXQA 5L9DH 1OZUA 3UJIH 5AENA 2L4OA 4UM9A 4IIQB 1QQDA 4GBXC 3KJ6H 3CE1A 4HQQL 2BOCA 3T0EB 4GINA 1QR4A 1S3KL 3MJ8A 1MREH 1J9QA 3LKQB 1JPTL 1I1FA 3NJFA 3BE1L 3PYCA 5KOVC 2VN4A 4H25B 5L9DL 5G4OA 5EUKB 4IS6A 1H8NA 3HFFA 4JY5L 4KKLC 4L4TA 1A2YA 3HS0A 5B1KA 3L4CA 1J12A 4IS6B 4O00A 3G6JE 4A04A 4MFHA 4AL8L 2MPAL 2YGNA 1YMHB 1GC1H 2J44A 3ARBD 3MYJB 3S35X 3ZLQC 4ZUVA 1A8ZA 5H37G 1QLEL 4NKMB 3CNKA 4JY5H 3QI9A 2DWEA 3NBNA 4OCSH 1UOVA 1RUPH 4H8WC 3X3FL 2BSDA 2XWXA 4X6FB 4HS8H 4K9JA 5FFGA 2PPAA 3RAJH 4GYBA 3VE0A 5H35B 5AW5B 1DQJB 4FG4A 4L9LC 5E56A 1XGRB 1FH5H 4NM8L 5FKPA 1OXYA 4NJAL 3X3FH 5E9DE 2ZT9C 2I24N 3AXHA 4QCIA 2IBZX 4D9RE 4YHLH 3QNXB 1F6AB 5ILTH 1KSRA 1GOHA 1IEHA 4RLDA 1R0AH 2CUAA 4U4IA 2A4EA 4EI5B 4F7CB 1R5WA 5AVTB 5BS0E 1TYRA 1X6NA 3H3PL 4TL4A 5D2LF 4YHLL 1IZJA 3ULUL 1G1YA 1O7SA 1QSFD 1N26A 2BSBA 3OX8B 2Q86A 4K0OA 5IB2A 5JLZB 2XSKA 2VXUH 3V4VH 4TNWK 2VO5A 4JFSA 4OTXH 4A7QA 5K9QI 5I1AB 3EW3B 3CLWA 4YNYB 3EYQC 4OD3H 1T0MB 1UXMA 2GFBB 5LBGA 1I4FA 1LO4H 3KPNB 1QVOB 4MS6A 4H40A 3UFIA 4OJDH 2GT9A 5K59E 1MFAL 2WBXA 3D39A 4YHNA 4A6YA 2VERN 3TZVA 1DSFH 5F7AA 2WO4A 1MCSA 4QMEA 2HT4C 4LLWB 5I73C 1NCNA 3F6JA 1ZLUK 2NY4D 3ETSA 4HLZG 4W9LC 3VSUA 4WDIB 3MXVH 4OJAA 1SOXA 2CDEB 4ERSL 1AD0B 2DI8A 2K3HA 1W0YT 3QAZC 4JDEA 1EH9A 5E4EB 3HHRB 1OCOB 1TZHA 5AL8A 2I25N 3FKUS 2DIEA 2BVQB 4RA3A 1A3LH 4IRZL 1WT5C 3SD2A 4NHCH 1KN4L 1CMOA 4MNQD 4ZMTA 4YS4A 3LIZA 1IBDA 1KGYE 1QATA 1KV3A 4JRYD 5K9KA 1WBZA 2BSED 1JNNH 1UZ6E 5C08B 3TO4C 4MHHI 1BFVH 3QH3B 3AG2B 1CL7I 4WI8A 4PR5A 3ARXA 5TDPB 5AW4B 5JW4M 3MGTB 3RZCA 2XA8L 3HVDA 1S78D 4LLVB 1HYSC 3GMMA 1QUNA 4IMLB 2KZ1B 4P5KA 3GKWL 1D7BA 1FNHA 3PXHA 2Z1PA 2DM2A 3IB4A 3JWNC 5EU6E 2RACA 4ODBD 3RL2B 2X4RA 3ZY7A 3BDYL 5I1GH 2NSMA 2DYRB 2XA8H 4X5XB 2FBJL 1JPGA 4PN6A 5D5MF 1I7RB 1NFDB 1UZ8A 2PXYB 4NN7B 4ZTPL 4ZPVA 4AGLA 2NMSA 2NY7L 4J2XA 4M8QA 4AL8C 3BO8A 2BVOB 5FO8B 2XRAL 3SCMD 1ZVHA 3GBDA 4G7SB 3T65A 4FXKA 4PGCB 2WLNA 2PPEA 2RMNA 3NGBC 3UAJA 3MLYH 1WS8A 3U46B 2EABA 1BBDH 3EBGA 1IT9H 4N2LA 3G6AA 3AM8A 5GRVL 1YEIH 1LEGB 1U8OB 3VQ2C 1UT2A 4HIJA 4Y1TA 5D5MB 4KGJA 3WGUB 4DKFH 1OARL 1J0KA 5DJYA 3QPKA 4XNQA 1CGWA 3R0MA 2Z31B 4E2OA 1DQTA 4CL7A 1S7XA 2BZ7A 5DJAB 5T3XL 4PTUB 4G43B 2ERJC 4OLVH 2J21A 5MI0C 3H7LA 3SOBH 5E99H 4KTDH 3Q2WA 4BFOA 4ZO9A 2VLJD 1Z3RA 1BVNP 3B37A 1WAAE 1YDPB 2VDRL 1CL7L 1TQSA 3X1BA 4P5TA 3AABA 1TXKA 2VWEE 1ZTMA 2P5EA 2P28B 1X5HA 2OULB 2RCSH 3UPCA 1HEHC 3FTYA 4YE4L 2QADC 4HIQA 3TIDA 1ZE3C 4M4PA 5I18H 3ARED 3UROR 4DKEL 4R90L 5GQBA 1LEIA 1G9HA 4JCMA 4OVUA 1KGWA 1E3XA 5H8DA 1NOAA 5FIEA 1F8TH 4L29B 4KQ3H 4YE4H 3B2PA 3EJYC 3UMTA 1EAJA 3SB3A 4RISH 4QO1B 1A21A 5HYQA 3L95A 4G83A 2NNAA 2DQEH 5F88A 4YXHH 3ZE0F 5D5MA 3BVNA 4JRFA 1AGEB 5DYFA 1FNGB 2E7CA 4DGIH 4KQ3L 5DMKB 3V0VA 1LD9B 3O2WL 1KIPA 3QCTL 1AR2A 3HRZB 5IMLB 3QIWD 4RX4D 3TV8A 1EJ6A 1VADA 2CO6A 4ZUWA 4K55A 2HWZH 5DHMC 1BZ7A 1IBZA 2ID5A 1YNKL 5GJSL 2VR5A 5J1TC 4JMXA 1CTMA 1VEMA 1RJZA 4PJCB 1CWVA 2QQLL 4H1LB 4QJ3B 1T0NA 3EJZD 2ZXWB 5D7JA 4LU5H 2CA4A 2NNCA 4Q2ZB 5ERWA 4CN6A 1T03H 1IBYA 2GBUA 2PYEE 3VXNA 4MAYC 4WVRA 1HSBA 5C09D 2WTRB 5DHYA 3T1FB 4HJ0C 4HCGA 4HWZB 4ISVB 3LRHA 4BFEA 3SKNA 1KXTB 3P4NA 4PRHB 4FHKA 5JXAL 2H6PB 4YEFA 1VENA 1T03L 5HVGB 5I71B 1B4TA 5LAXA 3ZDZE 2IWKA 3RL1A 3F62A 2MNWA 2BXYA 15C8H 3EO0B 1QFWH 3OKEA 4JDTL 1ZT4B 1S3RA 3CZGA 4Y2DD 5AVWB 4XZUA 3P4OB 4BK8A 3U6RA 4UYQA 4LPYA 5AOMA 5JXAH 4AE0A 2Z91A 4YHKH 1RIHH 4TQHA 5GIRB 3H2WA 1KEML 3OPUA 5JOPD 2W81C 3QARA 1E7UA 2C9VA 4I3GA 1JTOA 5GZNA 3PQYD 2LGNA 3CFTA 3NJKA 3T2QA 2W95A 4FERA 4O4YL 4ODTH 3IU4L 2A74C 1AANA 4XC3H 3RQ3A 3ARGA 3A67L 4PJ9C 4LSQH 4Y4HC 2X9YA 2Q7YB 2OV0A 4GXUM 3II3A 3PQYA 5EPMA 3K1DA 4PRHE 5IG7A 3ENEA 4F8PA 3IBOA 3MUGA 4LSDA 3IRCA 2E9GA 4AVIA 2ICEC 3C6EA 3VFNA 3A67H 1U8QA 2GAZA 4LSQL 3PDOA 4E9RA 4R4FL 4UOZA 4MA3B 4JZJA 4G80B 4JPSA 4NYLB 4HJ1A 3S96B 1QFWI 1I7UB 2EDOA 2VDQB 4KUZH 2HJFA 4L3CB 2D7NA 4EN2A 1HDMA 2XVBA 4JE0A 4PIRF 3CJJA 5AOKA 5BS0A 1OE1A 4ZFOL 5D7KE 1AHWC 4OCYL 1JD9A 5CSZA 1E27B 5D72L 3DETD 3DTUB 5IJKA 1RZ7L 5AAMC 3FT1A 1LO2H 3UYOD 3MO1B 3O6LH 5TGBB 4K23L 4W9GC 2X0WA 2YK1L 3BXNB 5IHZB 1KBKA 2WZAA 3FYEB 1A6TA 2ORBL 4AM0B 3NCYP 5I1DA 1NIFA 1UWXH 2APVA 2ICES 4YDVB 4LCUB 1ORQB 4XX1G 4YXLL 2DBJA 5LN4A 3ARFB 2I9LB 3HR6A 3A6CH 3CLEL 4X5WA 1JYXA 3O6LL 2YD2A 3WLWD 1U92A 3D39E 2VLKA 1L6PA 5CEZL 5I6OA 2AXGA 2CLZA 1ET5A 4KKRA 2IC2A 2NQ3A 3K6FA 3WY1A 1F5WA 1TTCA 1NGWA 2K4WA 3IGAA 5C6TH 4JMNA 4YXLH 4ZUVB 1FNFA 3A6CL 3CLEH 4NN5B 3U1SL 2ZE0A 3ZR6A 5CEZH 1SRDA 1KJMB 4Z7QF 1PLCA 2QKIB 5HHOE 3TVMD 3V4VB 2BY0A 1HXMA 2ICWI 3FS9A 2XWZA 2RJMA 3U46A 1KB9K 3FONA 3MOQA 3OB8A 5D9SB 5DD5H 2KLSA 5HJ3A 4ETQB 4FJYA 2XV0A 3EUUA 3TCLB 2BP5M 2BOCB 3T0EA 2VSDA 4NHUB 1SQ2N 1WHOA 4HZAA 1SJMA 3BN9D 2WBJA 4XVTH 2JJTA 2WW8A 3F84A 4PP1D 4Y9GA 3S2CA 2KZKA 1TITA 3VWKB 5AUMA 4OZ4B 1CD0A 2D7PA 3HLAA 1ONQA 2X4RB 4OI8A 2ZG1A 5D7IE 1JE6A 1A7QH 1LEKA 5C0FB 1DUZA 4JQXA 4X5PA 3MR9A 3BH8B 3QG7L 4X50A 3NUKA 1PD0A 1Q38A 4FQ1H 3MV8B 1N2RA 4QYOA 3TH4T 2OCCB 3O6FB 1J5HA 2DQFB 3MCLL 4LCWD 4NIYE 3QYCA 4APQA 1V7NL 5BV7H 2CPCA 1UADC 5F7KC 3RKPA 3QJOA 2B4CH 2QSTA 3WIFB 5EV7A 1MCFA 2QGDA 4P23C 2H1PH 3DMMA 3DMMC 3ZKXC 2ALWA 1JDAA 2B08A 1TSHA 2AF2A 3GO1L 2AERT 2AGJL 1OOAA 3BCDA 4GSUA 4JDZB 4UAHA 4AV0A 2HT2D 1CICC 4LLUA 3EH5B 3FSWA 3OG4B 4B96A 1T7VA 4P9ML 4JM2F 3WY4A 4R2GB 4BV1A 2D3NA 2D8KA 1GW0A 2A0LC 1MEXL 3HE7D 4C8XA 3GO1H 3LS5H 3QRFM 2GJ6A 1ZJBA 1NICA 4JY4B 2OJZH 2CKBA 3MROB 4OZHF 5C0BA 1Q0XL 3T3PF 1AS6A 2GJJA 3K0WA 4FFZH 1JK8A 4PJEF 4XN1A 1UM4H 2XBDA 1S9XA 4JJOA 5C0DB 3AT9A 3BZ4A 1MEXH 3JV6A 1XGYL 1F56A 2AI0L 3EDDA 1QVOA 1RZKH 3BIAX 3NGBB 5EHFA 1KCSH 3BKJL 3QPQD 3C5ZB 3CDFA 5ESQA 2H1XA 3KLQA 3RVUC 4G8GA 3D0LB 4HCRL 2MQ0A 3SOTA 2J56A 3CVDA 4UDUA 3DX0A 5K9JH 4OM1H 1NGYB 1FHGA 2HFEA 3EDJA 3SN6N 4F5CE 3HC4L 1NGPH 5CKGA 1PZSA 3G5XB 2J25A 3NA4A 4TSAH 1ZLUH 4B0MB 4X9FA 1YAIA 4L8DA 3EO1B 2P8MB 4NPJA 1J9TA 3IJHB 1QHQA 2P5ED 5DFVC 2EUVA 2NCEA 5C9KA 1KY7A 4GQPH 4PRAA 3T4AB 2BP8B 4Z3JA 2EECA 2AXHA 3ERXA 5HVWA 2X4PB 3ESMA 3RVVC 1MHEB 4HD9A 3OLGA 3FONB 3UJIL 1BVOA 4QPEA 4G8AC 1LL1A 2NYYC 2RH0A 1ZWIA 2KQMA 4PJAB 2EXYC 3QDMB 2JH2A 3VE0B 3RFZC 3C9NA 2WNGA 3BE1H 7PAZA 3SJVE 3RWHA 4ZD3L 2CGZA 1J1PL 5IK3B 1G9MC 5HHNB 3WDIA 1MFBH 1T2JA 2UZPA 2EO7A 2VLKB 4B6ZA 5E9DB 1Y0LA 2UX6A 1DQDL 1AQDB 1WWWX 2Z6FA 4NN6C 4ZD3H 4WNQB 4A2MA 2BCKA 5D7IF 3LAFA 1GJWA 3FUJA 3MKKA 4NPYB 2VM9A 2X4QA 2CR0A 4APQB 4U3CA 4P4KD 4LRIA 3BGFC 4NKIH 1THCA 4MA1B 1FH5L 1HZHL 2XKNB 4H2CA 5D7JD 4FJ6A 5ACZB 1IVLA 1BZ9A 2E27L 3F83A 4TVUA 4WHTB 1GGBL 1R24B 2EDHA 3WD5L 2R29A 4PVMA 4R5XA 1QG3A 2HB0A 1LP9F 3RY5A 4QOKE 3EO9L 3I6LE 4KRNA 4HEPG 4HJJH 3SE4C 2AQNA 2GJPA 1NGZB 3OKNA 1F58H 2LTQC 3IDMA 3QEHA 1R6VA 4XP5H 5E1QA 3DC0A 2JELH 3WD5H 5IOPA 1NMBL 1Z5LB 3Q6FB 4BH7B 2VSKB 4HK0B 5D70L 3VD1A 1SJEB 2FR4B 1S7QA 4HKJB 3ZK0A 2WBJB 2G75B 3WEOA 1CD8A 4L2YA 4OKVB 3CIAA 5GPRA 3PFQA 4U3SA 3NZ8A 1NDGA 1OCRB 1ZJAA 3LQAH 5D70H 4D7BA 4Q6IB 2FEDC 5EDXA 3TASA 3OLDA 1J10A 5BZWA 4B9IA 4C83A 1DSFL 1X7QB 3RNQA 4GRWB 1I7TB 3T8XA 2C9RA 2GUYA 3RVTD 4FA8A 1KFGA 3QFJA 2DMCA 5C8JB 5T1JA 4N22A 4PGZA 1MLCB 1WC7A 3QQ3B 2GG1A 3LPOA 4JCLA 4YH6A 3VXSB 1BECA 3P0GB 2ZOLA 2ZOWA 4U4BA 3MRNA 2ZWKA 3TA3A 1P1ZB 4B3EA 1IGFH 4OV6F 4FI6A 3FTZA 3WIIH 4RMTA 2Y23A 5ENWB 4ISVA 4U6HA 1RZQA 3TFKD 4PS3A 3RUGE 2WWOA 3SCMA 1Q9WA 1FVCB 4YMPA 2X4NA 2FQEA 2XCMC 3IKCB 1XD1A 4XMXA 1IGFL 2Z34A 2FD6L 3OGCA 4ZSOA 4BM7A 5ERWB 3Q8EA 1MHCA 1XF3A 2ZUTA 1JNLL 1T6VN 3CXFA 2F54A 1X9RA 3PLYA 4R2GD 2Y7NA 5C0CB 4MDIB 1NC2D 3FRUB 4FLSA 2VDPH 1G9ML 1UASA 4W9JC 4XZ4A 1MCLA 2MCPL 3CCHB 1TFHA 2FHCA 4TUOA 1WUZA 3FU5A 4LNRA 4B0MM 2W59A 4BQ8A 3ZE2F 4XB3A 3VXUD 4WI2A 5HJGA 4PIBA 2FBJH 2GCYA 4Y19A 1SM3H 3ARBB 4HUNB 3ESOA 2VDQH 4JS7A 5G5DA 1NEZG 2D7MA 4YO0B 2UUDK 4FCAA 2Z64C 2XVKA 4IEFA 4P2OC 1GGYA 4G6MH 1MVYA 3CX2A 4ZFOB 1VJSA 5HGHB 2YUVA 1R3LB 4DP2X 2J73A 4ONFL 2FTAA 1WDAA 2BIHA 3H7BA 3L3OA 4RMSA 5I17A 1I82A 5JDJA 2VDQL 4WV1B 3OR7B 2D7OA 1BBDL 3IFLL 2CDGA 2CSPA 5BXFA 1ECYA 4BK5C 2B1AH 4GG6A 3STLB 2ZUWA 1ZK9A 5KN5B 2CO4A 3PS6A 4ONFH 4HIHA 3NT0A 1OAUL 2XDHA 3T0EC 2BNQD 3C8KB 3O11B 4JPIA 1TO5A 1T7YA 2YGQA 1G6RL 1H5BC 4MJ2A 3DO3A 1JNHB 3LB6D 5DJDB 3RIFK 3JXAA 3P54A 3HHSA 1KGUA 5EC2B 3SOBL 4V2BA 4FC3E 1NFDF 4XMKH 4F91B 5CR8A 4E9QA 1I8LA 2WUCH 3LMJH 5FB8A 4Y2NA 2C3HA 3ECVA 1UH2A 3MNDA 4NUGL 3L17A 4I9XA 5B39G 2AV1A 2J20A 4RFEB 3VB8A 4MQSB 5FGCB 4XMPH 5EOCL 2A6DA 4Z78B 4X0NA 3QUZB 4JW3A 2DDQL 3Q3GB 5GSRB 2YAQA 3D5OF 2JCCE 3D51A 5FECA 4U1GC 1RZFL 4OLWH 1J48A 5IB1B 3C6SA 3LKPB 3OV6A 3VI3A 4TSCL 2WLYA 4JN2B 5D4HA 2DDQH 1AO7A 3QWQB 1I1AC 2Y07H 1A9VA 4PJ9B 3ARFD 3VTMA 4X9IA 1LE5B 1MJUL 4NO5A 4YXHL 3L4TA 3STLA 1UD2A 2GJ6E 3FO9A 4HKBA 4AGOA 1VADB 3PG2A 5EU5A 2FE0A 5CLTA 4I0PB 4KNQA 3VXRD 1WAAF 3T0WA 4PRPD 1L9RA 1ZLSL 1GY2A 1X5IA 2HWZL 5EZPA 3ATAA 5KAQG 3S9DB 1E67A 2HSIA 1L0PA 1HHIA 3FSVA 2LU7A 4J4PD 4M56A 4PS4L 1EXHA 2IDTA 4G6AC 2CXKA 4XXWA 4X6BA 3VXRA 1R47A 4M03A 2V2WB 2WAHA 2XICA 1F4XH 1TR7A 4N87A 4MA8L 5HI3D 4KNTA 2VMEA 3MUJA 3V0WL 3TYGL 1P5VB 4G9DA 5DD6B 3VMOA 1F1DA 2DF3A 2F8VA 3S3CB 2OMZA 5FS5A 1IBGH 5K9KB 3UTZA 4UU9B 1IGIL 2I5YL 4UQEA 1YN6A 3H6JA 5JDSA 2F54B 3DIFA 4F15B 2O61A 2EIJB 2EZ0C 5TDNA 3HC0A 3N1PC 4R7DB 4F8NA 3VGHA 4RGNC 2B59B 2G2RA 2LU5A 3Q3GA 3LPFA 4LLVA 4RAVB 5DC9B 4PEEA 1IGIH 2I5YH 2D2OA 3DJRA 4P5MB 1AHWA 4B9ZA 4PRIB 3CPLA 2VR4A 2A9ML 4FNTA 2W0PA 4HG4K 1XSOA 2P8PB 4PJCF 3DI3B 1PLBA 4NKOB 5DR5H 4LNVA 3O4LD 4WUUE 4HUVB 1JWMB 3O8XD 3QUYD 3VGFA 2FH6A 3ES6A 1NCHA 1KTJA 1T1XA 1B3IA 2NLJB 1J11A 1QSED 1YJDH 4HKXB 1VFAB 5DT1H 4LSSH 1PGRB 2E9IA 3G04A 3GSUB 2XI9A 2OMWB 4XC3L 3UYPA 3WFCH 4AI7A 1DN2A 1TU2B 3OD3A 2GFBA 4PJDE 5HHMD 2GPZA 1SDDB 3QQNA 3TH2T 2Q5BA 1IAKA 4L0ZA 4MQXC 2Z93A 5GS0H 2EVFA 3OZKA 4ZPVB 2CDFA 1AJ7H 4Y88A 5EUOE 5I73B 3H3KA 4Z7WF 2CE6A 2OJ1A 3SE9H 1DZBA 3H7BB 3M45A 4AOFA 3HBGA 1R3LA 3K46A 1A7NL 4O02H 3IXTA 3LXCA 5GS0L 2ZX9A 4R5TA 1AD9B 2HA1A 1ZS8B 1A0QH 2OX5B 4Q58C 4YC2B 5FUZH 2GQHA 3L7FB 3NCJL 2ZWYA 4OZGF 1BG1A 2A38A 5E0QA 1O5DT 4KUZL 4X4YB 3D06A 4XX1E 2Y7QA 3I6SA 4QCIB 1DYZA 3ARVA 4OQTA 3CXDL 5C07A 1ZGLB 4KKLD 3UG5A 3QI9C 5GGQH 4Z7WB 4U1KB 3I9AA 3LHAA 3NCJH 5J13C 3DPBB 1INEL 3P77B 2Z31D 3TCXA 2H0FA 2O6DA 3FU3A 3SPJA 1T1YB 3DARA 3N2JA 2ZICA 3A6OA 4ZS6D 1ANUA 4A63A 3TO4B 1N3NB 3G6JA 3IDNB 5KYUB 5F7MC 3N40P 1GH7A 4M00A 4QXVA 4HHGA 3LHPH 3SDXB 5I1JL 4G2AA 4EE2A 2OMXA 4JFEB 3SDDA 1DEEA 4YGVA 3W5MA 3P40A 3UP6A 2VMFA 1RK1A 4GFTB 3BHBA 1BQHB 3VXOA 4K3DH 5A2CA 2FO4B 1E4JA 2GKIA 2OMNA 1B4LA 3BVWA 1RK1B 4H13C 3TA3B 3WI9A 3A21A 4ZBJA 4GG8B 4LEEA 4E5XA 3M17B 4S10A 3IMBA 1WHPA 3SDXF 1G7MB 2CHZA 2A74A 2XQBL 3FRPB 5HHNA 3UC0L 3SQRA 1P7QA 3RWHB 1KLUA 5EO0B 1E2ZA 4OFYD 4R26L 1I4FB 4W68A 1BBJB 5E9DD 5CZRA 5BQ7B 1C9SA 1KUMA 4JZOA 4UT6A 3NZSA 3VNYA 4ENZA 1YECH 1CFQA 2VJ8A 5GS0C 2O5XL 1HWWA 4Z7WA 1CD1B 1RURH 3FQRA 3V6BR 1X5KA 3DOHA 1BX2A 4NWTH 5IB2B 2OJEB 2K8QA 1I1FB 1DBKH 3QQ4B 1EQWA 2VUYA 4DP0X 1IGJB 4FLOA 5E5MA 3US0A 1YECL 2NUTA 3PDGA 4ZO8A 4XP1L 4M5ZH 1TVBA 5CMAB 5IB5A 2J71A 3UYRH 1RURL 3VA2C 1DVQA 4PJFE 1JMZA 2I9TA 1ES0B 3F7YB 3ZYJA 2X7LB 4J8RB 1DBKL 5DVKA 3AXLB 1D5IH 3MA7A 3I3DA 4KQ4H 1CB4A 2FT6A 4I9WE 1N8ZA 4KAQL 5C09A 2WQXA 5I30L 4DP1X 4O9HL 1D5BB 1L0QA 1BJMA 3LNEA 4KXBA 2FJGB 4AJ0A 3MCLH 3CMOL 3EYUH 3DYMA 3KBEA 4HX1A 3OXRA 4G8EA 4BFNA 2YXWA 2WBWB 4PJDF 1JV5B 4LPXA 1B0GA 4F20A 4WHYG 1Z9NA 4OQTH 3PWPA 3D2UB 2PP8A 1F3DJ 1Q94A 3T3PE 2DIJA 2ZUUA 3SYAA 4GKSA 2OZ4H 4Z0BH 1ZTXL 2VLLB 3I74A 3NJMA 2PWGA 3EJSA 2VQTA 2VZTA 4MB3A 5F7DB 3I6GA 4V2CB 3C5XA 1A2YB 4UTCA 4BFFA 3VQ1C 3KDMB 3NQIA 1BFOA 3KYMA 1D6EB 1O9ZA 1MN4A 2OJZL 3WHXA 2OZ4L 1SHWA 5IESH 1QZ1A 2HYMA 2V6HA 2HAZA 3V8CA 1IE5A 3MJ8B 4QLWA 4NNXB 4IIZA 2YJLA 5D4IA 5AVRB 3CZKA 4YHZL 2VXTL 4CVXB 3CDYA 3MLZL 1YN6B 3PDDA 3PWPE 2PXYC 3R8QA 3S4SA 5DJ0A 3FTXA 5E00B 5C7XH 4U2ZA 2X4SA 3NCMA 3S35L 4HCRH 2DQFA 5KG9B 2QFRA 1P5VA 3L5IA 4G9DB 3G6DH 4R0LC 3T08A 1JL8A 1N2RB 4OM1L 4FNSA 4UT9A 2RD0A 2Y2YA 3JBG7 4X7FC 2WKLA 4N9GB 3SDAA 4CU6A 2X38A 4Z7AA 1W6LA 4DZBB 3ESPA 3QJZA 2B7DT 4TSAL 1SEQH 2JQZA 3VXRE 3FOLB 4J4PC 1DDHA 4PJHB 4CDHA 2ARJB 4HDIB 4OZHB 1FV1B 2XIIA 3MMEA 1P4BH 2XBZA 3MN8A 2G5UA 2QPDB 3T77A 3TM6A 1AY1L 4FQXB 4FFYL 3R06A 3N6YA 2V3EA 5TQ2H 4C54A 4AYEC 4XP6L 3TF7C 3LOWA 5J1AB 2DICA 5DURD 2VDLH 4N68A 5FUCC 2B39A 5L8KB 2K6ZA 2F7RA 3DYPA 4NO5B 5CLYA 3TH3T 3ESUF 5CEXA 3D85B 3UACA 3J27A 4PJHF 4QF1A 1E5BA 3IGUA 3CN3A 3CSTA 4ONHB 1ZV2A 4KJYA 5EU7C 5IMOB 1EUUA 1J1PH 1P6WA 2X1QA 3MJ7B 4LOUD 5AB0A 5F9JB 3WTXA 1MFBL 2KBGA 1QRKA 4OVVA 2B16A 5EIQA 3OPZH 3RGVC 4BKTC 1UA3A 4ES9A 1DQDH 2XNAA 5I74C 3SJVA 4DKAA 4XC1L 3C2SA 2P5EE 2R15A 1NGWB 3IGAB 1K3ZA 2FNWA 3QUZA 4HOXA 4LBEA 1W8NA 1FC2D 4N90E 4F9LC 2NUPA 4RZKA 4PGBA 4YC2C 2LU3A 5B3JE 3BLKA 4I89A 2OA9A 4XC1H 5D93C 3N43B 2GW5A 4ZDHA 1SVZA 3L2MA 1NDMA 3PAYA 5GS1A 4L48A 4POYA 3HN5A 3RFRA 2E27H 3BXNA 4TLKA 4P4KB 2ZYHA 4M7JL 3P9MB 3QUXA 4Z9KB 4B7IA 2J1YA 3EH4B 3T2NL 3Q43A 3GMPB 1A25A 1BP3B 4MMZB 3ECWA 3HC3L 4PV8A 4PCKA 5D7JC 5J8OA 1ZLVK 1J0JA 3CC5B 4FYTA 1FZMB 2JELL 1LLAA 3KXFD 1MLBA 2JJSA 3QISA 2E8ZA 4M7JH 1UB5B 4XAWH 4DHLA 4QKTA 3T2NH 1UENA <