2FQIA

Dual binding modes of a novel series of dhodh inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
362
Chain Sequence
b'DERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRAFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title Dual binding mode of a novel series of DHODH inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 137
structure length 362
sequence length 363
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2fqiA00
3UWWA 4TMCA 2VFDA 3PR2A 4I7WA 4O19A 1WV2A 3G1YA 4JGDA 3PBYA 4O15A 1QNVA 3W6YA 2VENA 4N9BA 3O06A 4FO4A 2TSYA 1H63A 1UCWA 4GBUA 1TB3A 5F1UA 1LP6A 2Q8LA 2Y89A 1OFBA 2BX7A 1EWEA 3VCRA 4I7UA 4MKNA 4Y96A 5T26A 1WYIA 4JDBA 1Q6QA 3UPWA 3C4UA 2ZA2A 4O14A 1NSJA 3USBA 3W2NA 2HS8A 3N2XA 3QMTA 3KRUA 4EF9A 2FJKA 5HNRA 2YGYA 1B4EA 1W31A 3IIOA 3L9CA 2P0OA 2YX0A 3GVGA 3NZRA 4K39A 2Y7FA 2FQIA 1R2TA 4JS3A 1Q6OA 2IQTA 3EX2A 3HQ1A 4DF1A 2TYSA 3R2GA 4WJEA 3KVJA 1MEHA 2BWGA 3O1NA 3F4WA 3GDRA 3NPWA 1EWDA 1KFEA 1PHQA 1GT8A 2NWRA 1XM3A 5FF4A 5G5IA 4H4IA 5HWNA 3HGSA 1QO2A 1V5XA 1WBJA 2J88A 3NQ8A 4MIMA 4ADSA 3I7SA 2PRMA 1OK4A 4XUGA 3LXBA 2ZBTA 3ABSA 4ZL1A 3TU9A 2TMDA 1T96A 3DFSA 4WY0F 4LY8A 3LGEA 1AW1A 4FNRA 5K7JA 4BI7A 4LOCA 3E9AA 1LM1A 2P10A 2Z2UA 6ALDA 1H1YA 1S5WA 4E38A 3HG2A 5CSRA 4XBKA 3W1PA 4MZ1A 4HNVA 1AG1O 2CZFA 4MPQA 3O05A 4IMEA 5DBTA 4U4MA 3OG3A 3O07A 4JTFA 2J27A 1QPQA 1MO0A 1JUBA 2R91A 3HGOA 3P7YA 1H7PA 2GVLA 3A22A 4DBEA 3BK0A 3VE7A 1HFBA 2Z0IA 1JUKA 3NZ1A 2VELA 1GVRA 3EB2A 1VPXA 3JR2A 4JX4A 3U6WA 4RX0A 1O95A 3G8EA 3BPWA 3SSJA 4EF8A 1F73A 2FB3A 3O6YX 4DO5A 2V8ZA 2V2DA 1X8FA 3W70A 3W1MA 3BARA 5F2IA 3FLUA 1VYPX 3O16A 4UTTC 1JQVA 1VRDA 1ZALA 1YTDA 4QITA 1LRTA 2AAMA 2B0MA 4WZHA 3W7DA 1TV7A 4UNLA 5I3IA 5C6MA 4Y90A 4RK8A 2DZSA 2DZTA 2GVGA 4RV8A 2CLFA 3E49A 3QMRA 3OEXA 1A5CA 3B0PA 5LHFA 2VFFA 1H51A 1OX5A 3GKAA 2JGQA 2ZCGA 3QSRA 4N4PA 3TX9A 4X2RA 1SO4A 3FOKA 5F1VA 5HUOA 5DXXA 2CLIA 3G3MA 3P61A 4UFMA 2ZTKA 1UJPA 4MJZA 4UTLA 3F1QA 3UZJA 3TK7A 3BLEA 3TXZA 4XBSA 1F76A 1IGSA 3LV5A 3TNOA 3EWUA 2QCFA 4FNQA 3PAJA 1ICQA 1EEPA 3LI0A 1F05A 2DZVA 1W5OA 4AF0B 4EWND 2GQ9A 4GXMA 3CWOX 3HBLA 4KWWA 4L4MA 1P5BA 3LTSA 4O1DA 5D33A 2XN2A 4KFPA 1BTMA 2NLIA 3W75A 4CLMA 1SSGA 3N34A 5FEWA 3WFAA 1VR6A 3W3OA 3FYPA 3IIXA 4LVDA 5HUPA 5AHLA 3W7NA 3JRKA 3LLDA 1B3OA 3NA8A 4PA8A 4M5PA 3P82A 1AL7A 3NQMA 3QFEA 4IX2A 2VC6A 2E5CA 4LVGA 2Z6JA 4HIBA 4QIUA 3HO8A 2J9YA 1GVOA 5D32A 3CM4A 3UZ5A 2QJGA 4K37A 2ATSA 1KM3A 1SW3A 1VYSX 2WSYA 3GDLA 3LV6A 1T0OA 3M47A 5D2YA 3UY8A 3FIGA 4FHAA 1XUZA 3IVTA 3W71A 4MFDA 5F2GA 5F2MA 1LROA 3P81A 5G2HA 2WQPA 3MBDA 2GVJA 3T40A 1FY6A 3LCGA 4RKAA 1HUVA 1VHCA 2B4GA 4GC4A 5HWMA 2W79A 5EMUA 2FDSA 4K36A 4JTTA 4WOQA 3W7HA 3L66A 3PG9A 3NM1A 2RDUA 1DKWA 3HB9A 3JS3A 4LV4A 5CZSA 3E96A 1B57A 5AC8A 2R14A 3S1UA 1ONRA 1KV5A 3G1FA 4MOZA 2H3DA 5DCDA 8TIMA 1KV8A 3SZ8A 3GYEA 2DZWA 3LBCA 2CFFA 4NNCA 4HPXA 3S5NA 1SSDA 2X1TA 1J4EA 3B0VC 1A53A 1Z41A 3I6RA 4OBTA 3DXIA 1LOLA 1IXNA 4ORIA 4AMAA 4E2DA 5AHEA 5LNVA 1L6YA 3O6CA 4G1KA 3B06A 3UWQA 3W2MA 4O10A 5AOUA 4UFKA 4GUHA 1XFBA 3GNDA 5D02A 2GJLA 3B04A 1HO4A 3LCXA 1XBZA 1NVMA 4MY8A 4FXSA 4LS1A 1F6PA 5DCBA 3NQVA 1VS1A 4X22A 1N8FA 3B03A 3N14A 5A8GA 3G1VA 3NQFA 2E6DA 3TMQA 2VOMA 1R2RA 3FEMA 1I8JA 3DFPA 1IXQA 3EX1A 2JBMA 4UTWA 4IUOA 2E5DA 4N02A 3PUOA 3LDVA 5KZEA 1OVDA 3LX9A 5BNKA 3FS2A 1DOSA 1FCUA 1M7PA 5LHEA 2YW3A 4FNSA 3P60A 4XTDA 4YWIA 2HMCA 3N9SA 4IPIA 2UV8G 2A7PA 2V2HA 3GKFA 4NXKA 2ALDA 4AWSA 2JKAA 4OT7A 5K4XA 1OF8A 1YXCA 2FPYA 3W9ZA 1GG0A 3W7IA 5HULA 1TREA 2NUXA 3PULA 5IBXA 2A1YA 1Z42A 2QDHA 1FXQA 3SGUA 1QCWA 4LWWA 4GFSA 3O6DA 1OK6A 1T99A 3O63A 3LTYA 3N19B 5AN7A 4FIRA 2CLKA 1XBXA 3DKLA 3R8RA 1YDNA 2NXGA 3UQNA 4DQWA 3NL5A 2TRSA 5I3FA 3LRLA 4C1LA 2WOQA 4UTWC 4B5NA 2E6YA 5KMYA 1VCGA 2CWNA 4GNJA 5HQEA 1TTIA 3L5AA 4X9SA 1PHWA 4K8HA 2ZZ1A 1FXPA 3LCFA 2DJLA 5AFDA 2ZRXA 1QPRA 1OFAA 4H6KA 1TRIA 4WX2A 1XL9A 3NL6A 3LHZA 3E12A 2Y61A 3CLMA 5CPLA 4R53A 2HSAA 3W2JA 2QDGA 1I2PA 4PODA 1TPDA 1K3UA 3VE9A 4A29A 3FYOA 1L6WA 2A0NA 1RV8A 5LNWA 2BZNA 3M41A 4FB7A 4ML9A 2FB2A 1AW2A 3SR7A 3FJ6A 1DVJA 1OX4A 1GEQA 3DFTA 3MP3A 3W2KA 3PB2A 1TJPA 1QPOA 3W73A 3NDOA 1RVGA 2VXNA 4OV9A 3RLUA 4EIVA 4JY9A 3WK0A 1YXYA 1H7WA 2NWSA 1JCLA 3CHVA 2QAFA 1F5ZA 3NM3A 3IGXA 2NX1A 4R7JA 1IIHA 2X1UA 4IQLA 4NJKA 2P1FA 5FESA 4NT0A 4RZ4A 4RCXA 3TQ0A 3PSVA 1QPNA 2YFNA 2CZDA 1OF6A 3IIZA 1ZAHA 2I9EA 2D73A 4QISA 4LC8A 3S8HA 4IJBA 1ZJIA 2E68A 1N55A 1S5TA 1X1ZA 4GUJA 4MUZA 1SO3A 4O1CA 4DXVA 1CW2A 3DHFA 1K7FA 1GVFA 1OFPA 3G3DA 1QWGA 1XXXA 3G8RA 4CCCA 3TH6A 1SR9A 1G67A 2PRLA 3QQ0A 5EKYA 3CT7A 1O4UA 3FA5A 2YFOA 1LBLA 3TIMA 2GJNA 3EXSA 2W6RA 4M19A 3LHUA 5G2IA 4JTSA 1H50A 3TW7A 3S42A 4N4QA 2ZA3A 4IWWA 4JTIA 1Z48A 2WSRA 4DO4A 4O4VA 4RXGA 3P5ZA 4QM1A 1EP1A 1HG3A 3NG3A 3R13A 4D2JA 3BLIA 4MVAA 1R47A 3TA6A 5E1QA 1VLIA 3MYPA 5C54A 3T55A 3Q2DA 3W7EA 3VI2A 4AEOA 1TSIA 1KM1A 4JEQA 3RK8A 5BW6A 4M6PA 1QFEA 4UTIA 1O5XA 4JTLA 2G5WA 1YDVA 3LI1A 4IMCA 4Q32A 3M5YA 4NNBA 4UNKA 4E2BA 1GPWA 4JYDA 4PL1A 3MYOA 4Z0JA 4UMAA 4KKXA 1FWSA 1OFQA 3NPVA 1H7NA 2J9ZA 3P80A 4CCDA 3ABOA 1FWRA 5FEXA 3IEBA 1VGAA 3IGSA 4A2RA 4M6VA 2NUYA 4UTJA 3BW3A 1Q45A 3UY7A 1K02A 3C0JA 5U7SA 1XI3A 2WKJA 3CTLA 3U2OA 2QEZA 2WV8A 3GXPA 3ZWTA 4K7YA 2CW6A 4CNOA 4OQVA 2H3BA 2QJHA 2ABBA 1FDJA 1NEYA 3GNNA 1OJXA 3B0UX 1EIXA 1KM0A 1FUYA 4LTSA 4FX8A 4TIMA 1PV8A 2B7NA 1R2SA 3B05A 3NGJA 4M7SA 5HINA 1ZCOA 4L4LA 4CQ8A 1DBTA 1IIGA 5K2ZA 4R33A 3P74A 1JQXA 4Z08A 4N9EA 3QF0A 4Z1AA 3CU2A 3F4NA 1JULA 1P1XA 5D38A 2ISWA 1D9EA 4WY0A 3SW6A 4O28A 5IM51 1OX6A 4UR7A 4ZQCA 4W9TA 2V5BA 1GG1A 4JYEA 3PG8A 1BWKA 4QJ1A 3T78A 5EYWA 3PC0A 1TRDA 1I4NA 2NXHA 2J9XA 4PC8A 3QEZA 4JX6A 1EUAA 1YYAA 2ZA1A 3MJYA 3TMLA 4PEKA 1UB3A 2C18A 1ME9A 1IXPA 3UWYA 3Q37A 1JR1A 4AXKA 4TMBA 1ZFJA 2FFCA 1DQWA 2A2IA 1F74A 4RLIA 2QUUA 4ZVJA 4UTTA 1LBFA 3EKLA 5AC6A 4N6EA 5DXYA 3DFNA 1OG0A 3GR8A 1LLWA 3P8IA 3G0XA 2B7PA 4RXFA 3TW6A 1VC4A 3B8DA 1SQ7A 2ZRVA 3TAKA 2X16A 3Q58A 3L5MA 5TBOA 2PE4A 1YDOA 4H3DA 1QOPA 3C6CA 2E1DA 1YTEA 1M5WA 2OJPA 3AO0A 2JKEA 1G7VA 2RKXA 3HG4A 3SIZA 4FNTA 3MI2A 3CWNA 1PIIA 3DFOA 1IF2A 1HL2A 1BEUA 1FCQA 1SU5A 1UBSA 3L2IA 4JTEA 3W74A 3GR7A 3PVFA 3HPSA 2OZ0A 3TC7A 2ABAA 3QMSA 4YMZA 3EKZA 5K9DA 3O15A 3W23A 1RQBA 1KFCA 3IIVA 4HNNA 2FLIA 4M7TA 4UTKA 2XFWA 3W22A 5CZJA 1X6UA 1LOSA 3W2UA 1TPB1 3M5XA 3C8FA 4KFOA 2EF9A 2OT1A 3P62A 2E5BA 5LZLA 3PUDA 1LYXA 1RZMA 3TROA 1W5MA 4CNNA 1LTDA 1VZWA 4RR4A 4UTMA 4MZYA 3TQKA 1K7XA 1KW1A 3MI6A 5FF2A 3IVSA 3LBMA 1LCOA 3IVUA 1D3HA 3PBVA 1H7RA 1F2JA 4FX7A 3L68A 2C3ZA 2ZZ2A 5AHNA 5D30A 4O18A 5G4EA 1RPXA 1KA9F 3I7RA 3SFKA 2HTMA 4N2YA 3I65A 4LUJA 1NFBA 1O94A 4UC5A 4A3UA 4GUGA 3PSWA 2PC4A 5FF0A 2F7FA 3LXCA 2VEMA 5CZTA 3UXDA 1U83A 1FCVA 5L9FA 3W1UA 3EWYA 1F6KA 1TJRA 3DHDA 2VEPA 2YW4A 4Z0SA 3SJ3A 2OX1A 1TIMA 1WDWA 4MY9A 4PTNA 3W1QA 1W3NA 1R30A 3GLCA 1A5BA 2VFGA 4EOUA 1O5KA 4O13A 3GX9A 3NQDA 1AK5A 1CX9A 2GUUA 1A5AA 3NPUA 3MW7A 3STCA 3GXNA 3PBWA 2WJZA 3BG5A 4O1AA 2H8ZA 2BXVA 2DJXA 5FEPA 3C3NA 2CLMA 4N9DA 3A23A 3DENA 3EX4A 2WNQA 1XBYA 2A5HA 2LLEA 3S6DA 4MLRA 3PB0A 3C2EA 1U5JA 2H6RA 5D2TA 4DEFA 1JVNA 1G4TA 2A6LA 4AHOA 1JRCA 1DV7A 3LHYA 1XCFA 5LGZA 1PCWA 3LCIA 1W56A 5D2WA 3UWUA 4JX5A 1EB3A 4O50A 4DO6A 4GJ1A 3QC3A 1B9BA 4MJMA 1RR2A 5GVJA 2QJIA 3ANYA 4JTJA 5F2LA 3BW4A 3W7OA 2A4AA 2A7NA 2ZZ7A 2V9DA 2CZ5A 4YLWA 3BG9A 1DORA 4CQ9A 2CU0A 2YZRA 5TQLA 2Q3OA 4TR9A 3W1LA 1YXDA 4M6QA 4AWUA 5G1TA 4A22A 2E6AA 1F7BA 5D2VA 4JTHA 1LBMA 1W1ZA 4NJIA 4DPPA 1C9DA 4N6FA 4OV4A 3NQAA 2JK2A 1WBHA 3C56A 1YLVA 3HG5A 3DI0A 4TU1A 3NEVA 3TSMA 2X1SA 4Z1DA 2G97A 4OHQA 2OCZA 2QCDA 1SUXA 1THFD 1TPFA 1LOQA 2VFEA 4JNMA 3QYQA 4HKPA 3H55A 3W76A 5D09A 2ZZ5A 3W83A 4LUIA 3MHUA 3P84A 3NR0A 4JIQA 1DQXA 1QO5A 3MP4A 3NXFA 1ALDA 3R89A 3ATYA 3S9YA 4LT9A 3C2FA 4FNUA 3GAKA 1TPC1 2E09A 2H90A 5D05A 2ZRWA 2X2GA 3IIPA 3MMTA 2VKZG 2RDTA 4K7VA 1X7FA 1HO1A 3W7QA 2V30A 4A21A 1XDLA 5J5RA 3DH7A 1HTIA 5K4ZA 3M6YA 4ZQMA 3OA3A 4ZZ9A 2PRHA 5BRBA 2NV1A 1YADA 3C2OA 1T8XA 2WO5A 1K8YA 4MYAA 1TQXA 1RQEA 3EWXA 3H53A 3LRMA 7TIMA 1XC4A 1KFLA 1TTJA 2YPIA 4YL2A 1I2RA 3THQA 1OABA 2V82A 4AHPA 3T44A 3UNDA 5DY2A 1WOBA 3NOEA 5FI8A 4IXXA 1XUUA 1ICPA 4PH6A 3BG3A 5DBUA 3LOTA 3N2MA 4GRSA 3S1VA 3NAVA 3MO7A 1TTPA 5AYYA 3WK1A 5CPMA 3G0SA 1KM2A 3IRDA 4BI6A 5CG7A 2RFGA 4FIQA 2ZDRA 4FNPA 2Y7EA 3GZ3A 2QUTA 3PUEA 1JCXA 5E93A 2C0AA 2QCGA 2GQ8A 1GVQA 4CNPA 3W07A 3QJAA 5I3GA 1KTCA 4NU7A 3BV4A 3W1AA 4JD4A 4ZQRA 3W7RA 1MZHA 5U4NA 1C29A 1FDYA 3MBFA 2YSWA 4ZQPA 5HJLA 2ZTJA 3OVQA 3C61A 2CZEA 4O8RA 5AHMA 3G0UA 1TO3A 1GZGA 1UASA 2W0UA 1KM5A 4JXCA 5LKYA 2YCEA 1Z44A 1H61A 4XZ9A 4UFIA 5K9XA 3FJLA 4ADTA 4OWGA 1OYCA 2C14A 3M5ZA 4Y9AA 4UIOA 1TCDA 4HSNA 3DU0A 1QDSA 1NF0A 3G18A 5HMSA 2DZXA 3G1HA 1ZAJA 2GQAA 3M7WA 4MFEA 3LHVA 3BLFA 3NQ2A 1RD5A 3STFA 3SECA 1QMLA 5DN1A 2AGKA 1LZOA 4HHPA 4OGZA 3KHJA 3KFTA 4JN6A 3W7GA 4HPJA 3TDFA 1A5SA 5C55A 5AB3A 1SW7A 2B7QA 1Q6LA 2V81A 3DFQA 2J24A 4QNEA 1OFOA 3W7MA 2QF7A 3LB0A 3NL3A 4NJJA 4P2VA 5CSSA 4MZ8A 2C13A 2XN1A 2YYUA 2ZZ4A 4LS0A 4ONVA 4AB4A 3NO5A 4LRSA 1GYLA 2Q8ZA 5K3VA 2WNZA 1JJKA 1Q3NA 3S0CA 4Z1BA 4JTGA 1J2WA 1V7YA 1Q6RA 1M7OA 1ME8A 1J5TA 2E77A 3KVLA 4NUWA 2CLLA 4UMCA 1S3HA 3RNDA 1OX4B 5EL1A 4IPJA 2QCHA 1DHPA 2VFHA 4JTUA 4LV9A 3DZ1A 1TTQA 4CQAA 2V2CA 3GXTA 1ICSA 2CLHA 3A9IA 2C1HA 4OE7A 1AMKA 5I3JA 1GWJA 4IMDA 4WUIA 4BFAA 1DJNA 2ZFAA 3D0CA 1H5YA 3QSTA 3W1RA 5KITA 1PS9A 4Y6GA 3DAQA 4MY1A 1KM4A 3EEGA 5CPNA 1K03A 3KVKA 5F4WA 3LCLA 1Y0EA 3STGA 3MP5A 1P0KA 1FQ0A 2ZYFA 5D37A 2QCCA 1KFKA 1TPVA 1EA0A 3S5YA 4NZFA 5LSMA 3P8JA 1LORA 1G6CA 2EGZA 2RDWA 2BSLA 1SPQA 4LVBA 3C2RA 3EWWA 3NQCA 3OVRA 4FXRA 3T7VA 1WAUA 4QAIA 3ABQA 3N3MA 4IXHA 3UWZA 2BTMA 2QKFA 3BGJA 1SZEA 3TC6A 1MSSA 5HR6A 1EUNA 4J9JA 1SW0A 3FFSA 4JICA 1SZNA 1MXSA 4AAJA 1TMHA 1LLZA 1LDCA 2YR1A 2FPVA 5FF3A 1KBIA 4UFHA 3Q94A 4JY8A 1SFJA 1GYNA 3FKKA 2EPHA 3TR2A 2I1OA 4ALDA 4ORMA 2QCEA 4HNUA 1JCNA 1GQNA 4YCPA 1P4CA 5LNSA 4PCFA 1ADOA 3U8GA 4UFLA 2R8WA 3EXTA 1SO5A 5HWJA 1OFEA 1C8VA 2B7OA 3QM3A 3M0ZA 3EXRA 4DF0A 3CEUA 1VH7A 4U28A 1SZFA 3L67A 3BW2A 4Q4KA 5K9CA 3W2LA 1TYGA 1VQTA 2XN0A 3WJXA 3F03K 3OIXA 3S1XA 5CKSA 4NXSA 1L6SA 1PE1A 3ELFA 5H91A 2O7QA 1EP2A 3OBKA 4JYFA 3G1SA 5AYZA 3V1PA 4WQ6A 4LU0A 5DY3A 3HIJA 1JRBA 1W5NA 2C6QA 3DI1A 3RLVA 1DL3A 1FDZA 1FWWA 3DGRA 4TO8A 4NJHA 1H1ZA 4FF7A 3M44A 1UUOA 1ML1A 2ZRUA 3UWVA 3ZR4A 1K7EA 5BOOA 1I45A 3VNDA 4XQ6A 3EX6A 1SZGA 1VJIA 1W8SA 3KXQA 4LW7A 3UXAA 1G4PA 1QOQA 3HPZA 1GTEA 3W7JA 3A5FA 1NF7A 1OHLA 4LVFA 1TPWA 1OFRA 4YXGA 3NNTA 4UFJA 4NZJA 4WXZA 5G2WA 3MHFA 4WY0B 2A6NA 1A50A 3LXAA 4O17A 1P0NA 4ZQOA 1PVNA 5TIMA 3WK2A 3GB6A 2A85A 2C15A 5CGQA 2TPSA 4R34A 4O1BA 1O60A 4QQ3A 1BWLA 4O4WA 4BK9A 4AF0A 4NNAA 1NAL1 1YPFA 1TV8A 1LRNA 2NZLA 4NX0A 4HT3A 1AL8A 3E02A 3VKJA 3WJZA 1VCFA 4HSOA 2GOUA 4S2CA 3M5VA 1VLWA 4MLJA 3W1TA 4BI5A 4K38A 3LLFA 2QAPA 1TQJA 4AHQA 3M9YA 1WOAA 2Y62A 4PL2A 3TKFA 3E0IA 5F4XA 2CLOA 4Z1CA 1TPUA 3MHGA 1FX6A 2I14A 1SFLA 1S5VA 3BVJA 2WPBA 4RZ5A 3HF3A 2F84A 3W7LA 5KSWA 1I2OA 4BR1A 3B4UA 2PURA 4GUIA 5DLCA 3NL2A 1H62A 1KFJA 4QNWA 3L0KA 4WXYA 3H54A 3KVMA 4UCGA 4O57A 1QAPA 1N7KA 2X30A 4AVFA 3A21A 2OT0A 5EPDA 1G4SA 3ATZA 4HNTA 3LCHA 3WJWA 3VFLA 2BLEA 2NXIA 1ZY9A 3PS7A 4NJGA 3YPIA 3W85A 3L65A 3W87A 3TFCA 1G7UA 1X1OA 5ABTA 3DBPA 1EPXA 2ATMA 4WD0A 1BKSA 4AWTA 5FEZA 2QUVA 5KTLA 2YYTA 2FPTA 3ABRA 3EX3A 1GTHA 4UXDA 2WSQA 5LGXA 1KLYA 2Y88A 3NYZA 3STEA 2Z6IA 3SY5A 3TQVA 2Y70A 3LERA 3WK3A 3W72A 1ZENA 1I2NA 4S1FA 3CPRA 3KRZA 3MI3A 3NPXA 2PCQA 4LRTA 1W5QA 5DCEA 1W3TA 2AQWA 2ZZ3A 4GE8A 3KRSA 3HJZA 3MUXA 3G1XA 3W84A 5L6UA 2A7RA 3PF3A 1KFBA 3GAYA 4ADUA 3N9RA 1UUMA 2FTPA 4Q33A 1KM6A 5D2XA 3MWAA 3ZFHA 3QW4B 2DZUA 1L2UA 1JCJA 4GWEA 3S5ZA 2DP3A 2H8XA 3W7CA 1OFDA 3AJXA 3ZWSA 4E0CA 3QQ1A 1TPEA 1IXOA 3TE9A 4AH7A 3PY2A 1VHNA 3WJSA 3TAOA 2DU2A 3EWZA 3TCEA 2JGYA 1YTKA 3RFAA 4NVTA 4ZQNA 1AW5A 1G4EA 3TV8A 4N9CA 2HS6A 1KBJA 4IX0A 3HPXA 4KFNA 4C1KA 4O16A 4DELA 5C2XA 3SI9A 3NQ6A 4FEZA 1TPH1 2EAWA 5J5DA 4IMGA 4LS2A 5I3KA 3QPZA 1XBVA 4WOZA 3LHTA 3WJYA 5SWUA 3SGZA 1CI1A 4JTKA 4RZ6A 1FBAA 1LRQA 3FKRA 4O53A 5C5YA 2ZZ6A 2QCMA 4ICNA 2RHGA 3G24A 2ISVA 2Y85A 3KX6A 1PCKA 2E6FA 4ZMGA 2KZHA 4XKYA 3V75A 3LCWA 4JR5A 3KOFA 4O52A 3RMJA 4CCEA 5KZMA 3THAA 4LC6A 5H2ZA 3NQ7A 3NQEA 3LTPA 3W88A 2Q3RA 4RJEA 5BMXA 4UR8A 1KTBA 2DZPA 2JKPA 3HG3A 2VFIA 3LM7A 4LVAA 3A5VA 1OYBA 1R46A 1TV5A 3S1WA 1K8ZA 3L0NA 4HN4A 2Y63A 4LNYA 3G22A 3GIYA 1W5PA 3K30A 1ZHAA 1I2QA 1B4KA 2Y6ZA 3QPYA 4YCOA 3OVPA 2FIQA 3NQGA 3CQ0A 4PFMA 5FF7A 3KAOA 1QR7A 5F4SA 3M1ZA 1FCBA 3INPA 2V5LA 4UMBA 2DORA 2O7SA 2R94A 3GDMA 1KLZA 4IOTA 2QCDB 4K8EA 4TX9A 5G1YA 4O11A 3QW3A 2OMAA 3UYCA 4DBDA 1FWNA 2ISSA 4MYXA 3DKJA 5A5WA 2YDAA 3R12A 4A2SA 1L9WA 1PL9A 3IV3A 1EX5A 5I3HA 2EKCA 1G69A 3LRKA 4K6AA 4DPQA 5CZ0A 1GJPA 4IMFA 3GDTA 3RU6A 6TIMA 1FWTA 4XKYB 4P61A 1WA3A 3T4CA 3QRHA 3M16A 3C2VA 3M43A 3GK0A 1RQHA 4GUFA 2ZQ0A 2EHHA 4FX6M 1EP3A 1WX0A 1JCMP 5CPOA 3L0GA 5E0KA 2QR6A 5AHIA 2NX3A 2ZRZA 1W3IA 2V0TA 3N73A 4Y8FA 3PM6A 5EA9A 3G1AA 4UTHA 3L21A 1K8XA 2NX9A 2Z1BA 4QSHA 4O54A 1GVSA 5IBXC 3I68A 3W1XA 4KWVA 4OU1A 2WNNA 2G96A 3CEPA 3W86A 3W7KA 3CIWA 4S2BA 3HGRA 1XDMA 2VEIA 1ZNNA 3OHIA 3IGUA 5DELA 3TXVA 4IGHA 3CC1A 3HMJG 4UUIA 1M6JA 1D3GA 1H7OA 5AYXA 3TJLA 4X3ZA 5G4WA 4UTUA 4BF9A 3NVTA 3UPBA 4NQ1A 2VEKA 5EBUA 3GDKA 4O12A 5LNRA 1W37A 1ZAIA 3P5YA 3W1NA 4JIPA 5AC7A 1WXJA 2NV2A 3O8AA 3TFXA 3ZS4A 3BO9A 3UD6A 3HGJA 3P67A 3R5EA 4DF2A 3BGGA 1JCYA 5D03A 2NUWA 5EY5A 3L5LA 4NX5A 2G95A 2GPTA 1SO6A 3G1DA 3HOJA 2C16A 5HR7A 1WQ5A 4BWLA 4O0ZA 2C19A 3PBUA 3C52A 5BMWA 3TJXA 5MHBA 1W54A 4XWUA 2CLEA 3CIXA 2A21A 2RH9A 3QH2A 2QCLA 1H60A 2ZRYA 2YXGA 3TUUA 1GOXA 1VCVA 4JDYA 4POCA 1XKYA 1W0MA 1KTNA 3I7QA 4EVZA 5LNUA 1JUEA 1E51A 3A24A 1YPIA 3TSDA 2Y7GA 3LHWA 5KINA 1VYRA 1MEIA 3W7PA 1DJQA 3RF9A 5AHFA 5KZDA 3TSBA 3S5OA 1MEWA 2QCNA 3QZEA 3CB8A 1OYAA 2J6XA 4O0KA 2X1RA 4I9AA 5D04C 3EWBX 4BWLC 1ME7A 1H7XA 4XTIA 4I7VA 3PWAA 2Y7DA
chains in the Genus database with same CATH superfamily
3UWWA 4RE3A 4TMCA 3M0XA 5T9BG 2VFDA 1WKEA 4O19A 3G2GA 5T9CE 5FSDC 1A0DA 4P7OA 1V3HA 3UU0A 1QNVA 3CYVA 1RK6A 3W6YA 3R0DA 2YJQA 2V5KA 4GBUA 4H41A 1CGYA 1TB3A 2Y89A 4JAWA 4QS5A 3U9IA 1AD1A 2W63A 3UZWA 3UYIA 2ZA2A 1W9DM 1ZP4A 3U5UA 1NFGA 3N2XA 3QMTA 5HNRA 2QS8A 1W31A 3IIOA 1HP4A 3W24A 5A8OA 4MWAD 1J0IA 4HPHA 3SIMA 4JS3A 1R7OA 4DF1A 3R2GA 1CEOA 3KVJA 1F6YA 3O1NA 4MDPA 1DYSA 4EPEC 3ARQA 3PZIA 5FF4A 4FXJA 4JCMA 2CYGA 4GHRA 4ZO8A 1F3EA 3VIGA 1XLIA 3NQ8A 4B4HA 1UD5A 4ADSA 3I7SA 4ZOBA 1TELA 1OK4A 3LXBA 1XLKA 4ZL1A 1RVKA 3TU9A 1JPMA 2TMDA 5FJJA 3K8MA 1KXVA 3VUSA 2WCAA 4CEUC 4DO7A 4PBGA 1AW1A 4FOKA 4BI7A 4LOCA 1AMYA 1FWHC 1LM1A 2P10A 2ZUWA 4P7QA 4OKDA 2TODA 1NDVA 1S5WA 3HG2A 5CSRA 3QY6A 4W5ZA 1H0GA 1ZBWA 4MZ1A 3S6OA 1XPGA 3QV9A 4MPQA 3VDCA 3V5CA 1NELA 4AD4A 3O07A 4JTFA 3K2GA 3RN6A 3WMCA 1XLGA 1X6LA 3BK0A 3VE7A 1OBAA 1KKRA 1E43A 3AUJA 3FSTA 2QJMA 1W2PA 2INFA 2KX9A 3LSBA 3GVRA 1XYMA 1S2CA 1NTHA 4Y8EA 4JX4A 3U6WA 3MA8A 4X0VA 4PRRA 1EC8A 1UOZA 1XIFA 2ZWZA 5BZAA 2YDSA 3GM8A 1E5NA 2VX5A 1AD4A 2V2DA 5A6MA 3W70A 1XLLA 2PGEA 3W1MA 1XISA 2YDRA 3WQ6A 3FLUA 1VYPX 1C92A 3O16A 4UTTC 5C9RA 4FOJA 1T8QA 2BGNE 1CDGA 4QLJA 1LRTA 4IHCA 4WR3A 5C6MA 3OO2A 2DT2A 2GVGA 2OQLA 1EJWC 5E9XA 4FALA 1A5CA 3BGAA 1XLHA 4QJ5B 4A8NA 2WLYA 1OX5A 2AL2A 4M1BA 2ZCGA 1FOBA 3S2LA 5T8GA 5F1VA 2G3JA 5A6TC 5HUOA 4HD5A 1E70M 2CLIA 3G3MA 2OLAA 4EKJA 1S1RA 5BXPA 4PRWA 2IPFA 4UFMA 4XD5A 1NDYA 4UTLA 3F1QA 3WQGA 3T81A 1GZJA 1I1XA 5DRCA 3UZZA 2PD9A 3FCPA 3QN3A 3C0SA 1S2WA 1E1EA 4J4KA 1OQFA 2PS2A 4C91A 6XIAA 1E1CB 1WDSA 4EWND 1W2VA 4AF0B 1OM0A 1TMLA 2P5NA 4KWWA 3L2MA 4H8UA 4MMWA 3ITOA 4O1DA 3MSDA 3C2YA 4XZIA 4LCRA 4JTAA 3N34A 3SO7A 3FYPA 4LVDA 5AHLA 3F7JA 3JRKA 3FA4A 2G50A 4PA8A 2BASA 3QFEA 1V0NA 3RM9A 3AMGA 3CLWA 3PZMA 1GJUA 1IWPA 5G4HC 4XAPA 1SW3A 4FLOA 1PXGA 1AODA 4JFVA 2YBTA 1YW1A 3ECQA 5D2YA 2QPUA 4HPNA 1EC9A 3KS5A 1Z9AA 1XRVA 3W71A 2DUZA 1TG7A 4UZSA 4PUUA 3LCGA 4RKAA 1HUVA 1VHCA 4GC4A 2W79A 6XIMA 4WLCA 4BKNA 4V2XA 3L66A 1W1A1 4GY0A 2PWFA 3E1F1 3WL0A 3JS3A 3EB4A 3KBSA 3KEHA 3ENLA 1QPKA 1WZAA 2R14A 5D9OA 3VKBA 3UVIA 1ONRA 4PMXA 1KV5A 3G1FA 4MOZA 1UR2A 5GJMA 2HK0A 3WD4A 1BWVA 4X63A 4HVXA 3DDMA 4JN7A 4XAGA 3S5NA 2Q6ZA 2YL8A 3ZLHA 3B0VC 1Z41A 1G94A 3DXIA 3CZKA 5M3WA 4ORIA 1L6YA 4G1KA 3B06A 3UWQA 3HZ3A 5AOUA 2NQZA 4B4FA 3UBPC 1HO4A 3B8VA 3P0XA 4W8LA 1NVMA 2XM1A 3CQKA 4M29A 4WDUA 3GDBA 4HMNA 4XO6A 1F6PA 3N14A 5A8GA 3LBOA 3TMQA 2EG6A 1OC6A 1IXQA 1HKJA 3EX1A 4WVXA 2JBMA 4UTWA 4IUOA 4ACYA 3R1ZA 1Y5XA 3ZSSA 3PUOA 3LPOA 3JVAA 4PGLA 1EX1A 1M7PA 5LHEA 2YW3A 2HCVA 1CXFA 4XTDA 4LEQA 3AWOA 3N9SA 2HQAA 2UV8G 2A7PA 3GKFA 4EAYA 4GIYA 1OF8A 3S2MA 5T91A 5HULA 3PULA 2A1YA 1Z42A 3T0CA 3SUTA 1FXQA 3WNMA 2QIIA 3O6DA 1OK6A 1CZ1A 5AN7A 4FIRA 2REQA 1XBXA 3V4BA 2NXGA 2CKRA 4DQWA 2CHNA 4UTWC 1IGWA 3VAVA 3UR7A 4K8HA 2ZZ1A 3E0LA 1UWUA 3WLPA 1OFAA 1H41A 4ATWA 3M0IA 3NL6A 4HTYA 4GNKB 3SSZA 2Y61A 3CLMA 2HSAA 4AVNA 2ZX8A 1UROA 4A29A 1XG3A 1EL3A 3CL8A 1JNEA 1Q63A 3FYOA 1L6WA 4J28A 4EK7A 3G6LA 4FB7A 2FB2A 3AYRA 3FJ6A 4KWUA 1DVJA 1OX4A 3MMUA 3W2KA 3PB2A 4OV9A 2AQOA 3J7HA 3DC8A 1U2YA 3R79A 1TMQA 3URQA 3WK0A 4HHHA 3CGTA 1YNPA 1JCLA 3VMPA 1F5ZA 3UWEA 1IIHA 4NJKA 4IQLA 1YPXA 5FESA 1GW9A 3ARTA 3WD0A 3AHXA 2CZDA 1DXEA 1OF6A 2REQB 4J3ZA 4AG0A 1OD8A 4RE2A 4LC8A 1W32A 4R7WA 4YN5A 1N55A 2HK1A 2OWXA 1UC5A 4MUZA 3UG4A 2PDCA 1K7FA 2A3CA 3G3DA 4F4RA 1QHZA 4CCCA 1Q6EA 4C6PA 4ZODA 1E4IA 2AL1A 5EKYA 3VOFA 3CT7A 3PP7A 1FTXA 3N29A 1KC7A 5XIMA 3EXSA 2W6RA 2DVXA 3MANA 1E6PA 1BXNA 1B3ZA 4CU6A 3V0TA 3TW7A 2OSYA 1GPFA 4Q8MA 3S42A 2BP1A 3TQPA 4PR4A 4JTIA 2YL6A 3R58A 3PNUA 4QM1A 1EP1A 3NG3A 4GIAA 2YOCA 4D2JA 1SJBA 5C54A 3TYCA 4AY7A 4ZCWA 3CYJA 3VI2A 4AEOA 4JEQA 1CGVA 3KBJA 1RXOB 1VBRA 1WE5A 1BKHA 4JTLA 4ML4A 1UKOA 5I23A 5CSYA 1UWRA 5CLWA 3WDQA 1OFQA 1FWDC 1MDLA 1R85A 4CCDA 4REQA 3T42A 3IEBA 4ZB2A 3A3HA 1JD7A 3IAPA 1BSIA 4M6VA 4UTJA 1HNYA 4D6GA 3UY7A 1K02A 4QDMA 3VNZA 5KZ6A 3CTLA 2QEZA 5AKQA 3RJYA 3MKVA 3N2BA 4K7YA 4Q4PA 3WEMA 4OQVA 2H3BA 3OLDA 3R10A 1BYAA 1TUFA 1I0BA 2XISA 3CASA 4TIMA 3EWCA 2B7NA 5C70A 3CV7A 3NO3A 4YVXA 4TV6A 4CQ8A 1IIGA 3CZEA 5K2ZA 3ARRA 3C3UA 1TJ2A 1E0UA 1DJYA 4CUCA 1OZQA 3RPTA 3LPFA 2BVDA 1KGXA 1PZ3A 3AHTA 4AW7A 4DWSD 2V5BA 3GYCA 3TA9A 4QJ1A 3IJLA 5EMLA 2DVTA 3PC0A 1TRDA 3VDBA 3ME3A 4PC8A 3QEZA 1VRXA 2ZXQA 2WXDM 4PB4A 4EAMA 4DN1A 5XIAA 3H7UA 4ACZA 2GLKA 1IXPA 4NAEA 2XIJA 1VJSA 3T0DA 4LNCA 2FFCA 1PTDA 1F74A 3MMDA 4IIGA 2AOSA 3NOYA 2QUUA 5FA5A 1V3IA 2HBXA 1LBFA 4N6EA 3PPFA 3DFNA 5DXYA 2R1NA 4YJ5A 5JIPA 1LLWA 4LALA 1N8WA 2NQ5A 3WQFA 4RXFA 3TW6A 3AXXA 1SQ7A 3BDKA 1EJ7L 3TAKA 2PE4A 2AMXA 4TX6A 3WIJA 3C6CA 4I8DA 2OJPA 3AO0A 2JKEA 3A3WA 1FVPA 3HG4A 3MI2A 4YNGA 3GIPA 1IF2A 1HL2A 1CIUA 2QV4A 1SU5A 1UBSA 4JTEA 3W74A 1VFOA 3AALA 3TC7A 3QMSA 1PKMA 2WPGA 1RQBA 1OCQA 3PTMA 1TVPA 4XK2A 3NFUA 3W2UA 4H6QA 4NZ5A 2YL9A 1C3FA 4KFOA 2XSXA 1Q4NX 2WK2A 1W1IE 3GW3A 4QROA 1LYXA 4Z17A 1W5MA 1LTDA 1OADA 1VEPA 1KW1A 5FF2A 1ISYA 3TYEA 1PX3A 3IVUA 1D3HA 1SFSA 3L68A 2ZZ2A 1KRMA 1J96A 2HTMA 2E28A 2CBVA 1HJQA 2ZWYA 2HE8A 3BZJA 4PUMA 2OLSA 4DAIA 2JIWA 3ARZA 2O0TA 1U83A 4FLRA 1F6KA 2VEPA 3VOCA 4Z0SA 1HKIA 1S2VA 1XQKA 1WDWA 4PTNA 2E4TA 3W1QA 4F0LA 1W3NA 2OEKA 3VABA 4IGNA 1RBLA 4Z2IA 3NQDA 1A5AA 2WJZA 3BG5A 4O1AA 5AC4A 5FL0A 2CLMA 2OYKA 1D2KA 2PODA 1ITQA 3DENA 3OG2A 2LLEA 4MLRA 1W9XA 3SRDA 3C2EA 4AX7A 1HKWA 5D2TA 3B8SA 4DEFA 1G4TA 1JZ4A 5FJUA 5EB8A 4J35A 1T40A 3LHYA 5LGZA 3ANUA 2OWWA 3BURA 3ZOAA 4MJ4A 2NW0A 4DO6A 3WH5A 1XYCA 4K2SA 4EPBC 3VDHA 4GQ0A 4X9YA 3RRXA 3TTSA 1R8LA 1RALA 3BG9A 4GOAA 4AVOA 2P8CA 1S5MA 2Q3OA 1IZJA 1QNPA 3W1LA 2I17A 2D2HA 2QZRA 3VU2A 4XIAA 1Q8AA 4A22A 4D8LA 1IR2A 1XD0A 2D23A 1C9DA 4A05A 4V27A 1YLVA 3U7BA 1E6NA 3TSMA 3SCSA 4GYJA 4OHQA 3PZGA 4OBRA 4AZCA 1NQ6A 1J0ZA 2J75A 1LOQA 1NP0A 4HKPA 4XVEA 2QHAA 2ZZ5A 3W83A 2J13A 3ARYA 4AEFA 3UCCA 3P84A 3MP4A 3ES8A 4AQLA 1OY0A 4LT9A 4FNUA 3V35A 4Q4MA 2E09A 5D05A 2YCLA 3CHCA 4XAYA 2PDGA 5I3DA 5EMYA 5G1MA 4OTKA 2OPJA 1XDLA 5J5RA 3ARVA 3DH7A 2FHFA 4BEQA 2UY5A 3BUVA 1BLIA 3FA3A 4ZZ9A 2VDIA 1WAWA 1X98A 4Z42C 4TVDA 4I6VA 1IT8A 1IE7C 3REQB 1K8YA 4GY1A 3H53A 2DQWA 4G7EA 1P6CA 1KFLA 2YPIA 4L61A 3ZSTA 1I2RA 3THQA 1OIMA 2NSXA 4AHPA 1SMAA 4IF2A 1WOBA 3BQ6A 3NOEA 2PDWA 5HQLA 3URNA 1ZBKA 5DBUA 1JD9A 3AS3A 1Y5WA 2NLYA 4IT1A 2F6UA 4GVGA 2I5IA 1DIKA 5CG7A 3H2NA 4FNPA 4AZBA 1R9ZA 1KD0A 3MT1A 3CHFA 1A5LC 2C0AA 2QCGA 3HPFA 3QV7A 2VGFA 4D9PA 4JHMA 4MKSA 3VD5A 4QQUA 2R9RA 4GJIA 2P0IA 4HHMA 3W7RA 1Z89A 5U4NA 1C29A 4L6OA 4Y7EA 2XGBA 2ZTJA 1QBBA 4O8RA 2UY4A 1Q6GA 2W0UA 1KM5A 2GGGA 2YCEA 1O68A 1Z44A 3VNLA 1K9TA 1HW6A 5K9XA 4LCSA 1GOKA 1MDRA 4W88A 3PZQA 1UKSA 2C14A 4J2PA 4UIOA 1E15A 4QCFA 3URAA 4HSNA 4G7EB 4J2MA 1NF0A 7PTDA 3G18A 5CC3A 1PBGA 3EOUA 3KUMA 3VC5A 3IGHX 2OKOA 3G1HA 3P14A 1JZ7A 1TVLA 2Q71A 4XUYA 3TW9A 4DJFD 1RD5A 2J7BA 1UQZA 1QI2A 2PDUA 2NQHA 3XIMA 2AGKA 5DN1A 1VFFA 2OOFA 4HHPA 4JN6A 3KFTA 4A3QA 4GFIA 1JGIA 2X8RA 3W7GA 3TDFA 4GC3A 1A5SA 1G0CA 3HN3A 3W28A 4EPKA 2V81A 3DFQA 1DJWA 3W7MA 3RPDA 2DIEA 3NL3A 1A3HA 1F4AA 5AVNA 1TWDA 4HK6A 4LS0A 3VILA 4HMDA 1AZ1A 2VGBA 2WNZA 2WC3A 4Z1BA 2ZC1A 3F4VA 1Q65A 4ASTA 1M7OA 4GLEA 1JL8A 2QMJA 4K1GA 2JQXA 3WSUA 2E77A 1X8CA 3L4TA 1Q6CA 3VNYA 5C2GA 2CLLA 1RA5A 5EL1A 4MKVA 2R1KA 4US5A 3DZ1A 1H5VA 3SCVA 4FXFA 3GXTA 1ICSA 2CLHA 2WJDA 1CECA 1O12A 3B9DA 3M0VA 1UR0A 4UQ9A 1AH3A 3QSTA 5KITA 1WDRA 1PS9A 4QX4A 1OSEA 4FMVA 2W27A 4K3ZA 3E5PA 3KLLA 3B40A 1WXYA 5IRPA 2OZ8A 3RXZA 3UR8A 1P0KA 1TPVA 1PEZA 2BNJA 5HBFA 4NZFA 4U10A 4WKAA 1G6CA 1R3QA 2ZUSA 2FGBA 1ISVA 1EJVC 1DJHA 2BTMA 2QKFA 3F5LA 3EWDA 3BGJA 5A6AA 3TTYA 5HR6A 1EUNA 3H23A 3AWNA 2VWSA 1TJ0A 4QSFA 1SZNA 3GNXA 1MQPA 1S3TC 3ZJ6A 4DZIA 1H0IA 4HOXA 2YR1A 5FF3A 1D7FA 4UFHA 2G0WA 4JY8A 4ALDA 3WBAA 1JCNA 4M56A 4Q4RA 1ADOA 4GZJA 2R8WA 3HFTA 3GY1A 3ZXWA 3E2VA 4I9TA 1N82A 2PTYA 3M0ZA 4UBPC 3CEUA 1XIIA 2FHBA 3AXIA 4B16A 1LL7A 4YPJA 2JE8A 4Q4KA 5LIYX 4TOQA 2A79A 4I5UA 1Z6KA 3F03K 3XINA 5CKSA 4NXSA 1L6SA 1PE1A 1V6WA 5H91A 2CERA 2RDXA 5AYZA 4W7VA 4AZ7A 4OIFA 2PFHA 4IQDA 4TO8A 3QGAC 3H24A 5M03A 2WAGA 3UWVA 5BOOA 2BGSA 3KXQA 2ZXAA 1G4PA 1NM9A 4C60A 3SAZA 3K1DA 4LVFA 1TPWA 1OFRA 4AWEA 5I2UA 2DH3A 2FZBA 4FI4A 3NNTA 4WXZA 1REQB 3N6JA 3MHFA 4DNMA 2PZ0A 1A50A 4O17A 2VR5A 5TIMA 5M5DA 2C15A 5CGQA 1Q5MA 1Q7MA 1RUSA 4O4WA 2VOTA 3V5OA 3SN0A 2FZDA 4LYRA 2I7GA 1EJTC 3UERA 6PTDA 3VKJA 1VCFA 2VQUA 4HSOA 4S2CA 3W1TA 2F6XA 4GQBA 1JYXA 4AHQA 3DESA 2VP8A 3KWSA 3ITXA 3QHMA 3E0IA 4AD1A 5F4XA 4Z2LA 3W81A 1V3JA 4Z1CA 2WKLA 1S5VA 4RZ5A 3NZPA 1WUEA 2F84A 3M07A 3W7LA 1AZ2A 1JYWA 3LGDA 4IP5A 4I5XA 1EEXA 5DO8A 4UCGA 1QAPA 3CZ8A 4MNKA 1CGUA 1XLBA 3BJFA 1KR0A 1M1BA 4KW2A 4HA3A 3FGCB 4L7ZA 1G4SA 3ATZA 7XIMA 2DEPA 3WJWA 4AIEA 4LYPA 1W91A 3PS7A 4B9YA 4ES4A 2EPLX 4GI4A 4JIRA 3H70A 2XIQA 3TFCA 5ABTA 1EPXA 2DGAA 2ATMA 4WD0A 3BAXA 4WIWA 1VD6A 3RLHA 3TYBA 1GTHA 3T6CA 3STEA 4GVHA 3NTYA 3WK3A 4AZGA 1FP9A 2VRKA 1ZENA 4S1FA 3ZQ9A 1DXFA 3MI3A 3PPCA 3CWHA 4AISA 4JNZA 1W3TA 3H2FA 2ZZ3A 4J3SA 2PU0A 4H00A 3KRSA 3HJZA 1DIEA 3SJNA 3DECA 3D3FA 3MUXA 1KRCC 3VGFA 3W84A 1KFBA 4IIEA 4ADUA 1Z69A 3IJQA 5FAGA 2QIWA 2FTPA 4Q33A 5D2XA 2R1LA 3OIHA 3U48A 1HJVA 1JCJA 4HK7A 4B3KA 4C1NA 3HMCA 1OFDA 4JTQA 3QQ1A 1IXOA 3BLKA 1A5NC 4LANA 3WJSA 1TVNA 1XWYA 3TCEA 1MQRA 1WKDA 2JGYA 2XSBA 3U3HA 4GKTA 1XICA 1IT7A 1KBJA 3RO6A 4LQ1A 3A64A 3DBNA 2W61A 4IX0A 3HPXA 2WJFA 2OR2A 1MW1A 2PBOA 4C1KA 4O16A 2V6AA 3ORWA 4ROQA 1GOQA 4DELA 3SI9A 5C2XA 1TV4A 3GNOA 2ANUA 1ISXA 3GE7A 1MUWA 2YXOA 5J5DA 4IMGA 4YVVA 1W9UA 3LZ5A 3O0FA 2BB0A 4IMAA 1CI1A 1SJCA 4WJXA 1FBAA 3MUIA 3AZTA 1CXKA 3N1AA 3APYA 4HHLA 1KXQA 1PCKA 2E6FA 4ZMGA 2VD9A 3V75A 1LG2A 4CD4A 5KZMA 5DX7A 3NQ7A 3LTPA 3TEVA 2AKMA 3GHTA 5BMXA 2GK1A 2DZPA 1ZCCA 3VFCA 3UJEA 4LVAA 2ZICA 3A5VA 1EJSC 1K8ZA 2VD8A 1TX2A 3GUGA 4HN4A 3G22A 4AC7C 3KWXA 4NAFA 1B4KA 2J7FA 3OYXA 2QULA 1I9CB 1BYDA 4JFTA 1W6TA 3VTRA 3KAOA 1QR7A 5JMUA 1FCBA 4B3LA 4IICA 2J4GA 1R9YA 4TX9A 5ENLA 5HMFA 3N11A 2OMAA 4WJ8A 4XO7A 2PTWA 2FTWA 4XZNX 4HP5A 4L9ZA 2CEQA 2GUYA 2BHYA 3T2OA 1AH0A 2ISSA 3WDJA 2C1GA 1HJXA 3R12A 1L9WA 1U33A 3IV3A 2Z4GA 3GTIA 5I3HA 4HBKA 1FWCC 4CD6A 3LRKA 5FAJA 4UR9A 5CZ0A 3RU6A 1WA3A 3AZRA 3QRHA 1LWJA 1NFPA 4H9MA 3M16A 3C2VA 3GC5A 1RQHA 4MJ2A 2ZQ0A 1EDQA 2CXEA 2FVMA 1YX1A 2V0TA 3N73A 3VCCA 3G1AA 4CD8A 1K8XA 3CTTA 3I6TA 1B0IA 4O1FA 1Y65A 1GVSA 4FPSA 2PBGA 4GZEA 3I68A 2G96A 3T4WA 4AC1X 1N8IA 1ZNNA 3DHUA 3OHIA 4AMCA 4AYSA 2F38A 3AXMA 3TXVA 2HWGA 1RD6A 2DSKA 4S3KA 3TJLA 1CGWA 3JZUA 2DH2A 2FKPA 2ZVRA 2QV5A 3NVTA 4J40A 3SUWA 5EBUA 3GDKA 5HAOA 1W37A 3P5YA 3CPUA 4L1GA 2YB4A 3SUVA 3O8AA 9RUBA 1JNDA 3ZS4A 4FR6A 1NIUA 3UD6A 3HGJA 3C5QA 3E38A 4BEUA 3R5EA 2WLZA 3QTPA 1JCYA 2NUWA 1XYAA 1PTGA 4P8UA 4QR6A 2OQHA 1XSIA 3SDOA 1EOKA 1IEXA 4HA1A 1WQ5A 4BWLA 2P88A 3CAQA 1I6NA 3PBUA 5CLTA 3VGHA 2W92A 4GGBA 5IOBA 2MUCA 2J7DA 4HB7A 2A21A 2RH9A 1GOXA 3CK5A 3MUZ1 4KCVA 1VB9A 3WD2A 1W1TA 1JUEA 1YPIA 5FACA 1F3TA 1E0XA 3RF9A 1MEWA 2QCNA 3QZEA 3WDIA 4O0KA 4M6UA 1BTCA 4H01A 4I9AA 5EFFA 4GYKA 1C7SA 1MVYA 3VXGA 4BWLC 4DJDD 4H9UA 4UOJA 4OVXA 1TWWA 3PR2A 4I7WA 1O1ZA 1WV2A 1RLDA 3B4YA 3S9IA 1VENA 3F4DA 2BOEX 5CGMA 3IPWA 3DIPA 2QUNA 4ECLA 1H63A 1UCWA 2VRJA 1BG4A 3ARPA 2BX7A 4LY4A 2HXUA 1EWEA 1WYIA 3BAJA 3S47A 1UR8A 3C4UA 4MWAA 1D7KA 4O14A 1NSJA 1QI5A 5I07A 4EF9A 4RE0A 4AU0A 5J04A 4ZE5A 3LLXA 3L9CA 2YX0A 3GVGA 3NZRA 2Y7FA 2FQIA 3CV6A 1R2TA 1BQCA 3WNLA 1GVIA 3HQ1A 4H7VA 2TYSA 4PMZA 2CC0A 3CL7A 1A5UA 4W7WA 1WKYA 5LIUX 3GDRA 1XIBA 3WH7A 3F2DA 5M1TA 4NF7A 3LS9A 3QZAA 2YCIX 3IS4A 4IIFA 5JUVA 2PRMA 3ABSA 3PJUA 5TNVA 5C9ZA 3UEQA 4LY8A 4HK5A 3V36A 5K7JA 3TLLA 1CNVA 5GJNA 2Y8VA 1VIWA 3E9AA 4PUDA 1O6IA 3QR1A 2IKHA 1H1YA 4E38A 1FH8A 3W1PA 4W84A 4KRTA 2BS9A 4HNVA 1AG1O 2CZFA 3TVAA 4IMEA 4UQEA 3MKCA 3TYZA 3QVQA 3WFLA 5FCZA 1QPQA 2R91A 4HNLA 4MWAB 3HGOA 1AQMA 1H7PA 2GVLA 2VEGA 4FK9A 4IFOA 4H2CA 3EA1A 1DP0A 4OUIA 3ZIZA 1BYBA 1O95A 3SSJA 3BPWA 4EF8A 4LUSB 4EX4A 2FB3A 2VT0A 1JI2A 4DO5A 2Z1KA 4KEVA 4H6EA 1X8FA 2BVTA 5F2IA 1NOFA 4BZYA 4PCPA 3MZNA 1CLXA 1VRDA 1ZALA 2ZUNA 3SY8A 2AAMA 5I3IA 4RV8A 3F2BA 4D72A 1PKYA 3QMRA 4DWDA 4GD0A 3OEXA 2DSZA 3PFMA 3GRIA 5LHFA 3VX0A 2VFFA 3OZMA 2RJGA 2EPNA 2A3AA 1D8WA 1Z3NA 2W91A 3P61A 4C6BA 4RW3A 4MJZA 3VIMA 3WZ0E 3BLEA 4B5VA 4XBSA 4GQRA 3LV5A 1LQ2A 4JBRA 1P1MA 3TNOA 3PK7A 2XVPA 3AHYA 5LYRA 3FJ4A 4H2HA 3PN8A 1K4HA 1W5OA 4GXMA 3WBYA 1EDGA 3CWOX 1T6MA 2XHYA 4L4MA 1XH1A 2BY3A 3W75A 2NLIA 4P8XA 3N4AA 2ISFA 1SSGA 5FEWA 3WFAA 3ARWA 1VR6A 3W3OA 5HUPA 1UD8A 4ZBCA 3W7NA 3LLDA 1B3OA 3NA8A 2V69A 1V0LA 4M5PA 3AIWA 2DFAA 3NQMA 4IX2A 4PCTA 2R6OA 3SURA 2ADAA 1J9YA 1SVDA 1TE6A 2VC6A 2E5CA 1RHCA 2P8BA 2VZSA 4NYYA 4AY8A 5D8WA 5AZ0A 3FK4A 4QIUA 3HO8A 3WLQA 5D32A 5AECA 3UZ5A 3T9PA 2ATSA 1VYSX 2Q8XA 4J7RA 2PWEA 1US0A 1W8GA 1XUZA 2VRQA 2XZ7A 4LUTA 4JIHA 2WQPA 4Q8PA 2B4GA 5HWMA 5EMUA 2FDSA 2OZ3A 4WOQA 3W25A 2RDUA 2I16A 1GOWA 4MTVA 2OYLA 3HB9A 3H26A 4IPLA 1B57A 4L9YA 3K4DA 2OFJA 5EMKA 3S1UA 2GL5A 2H3DA 4H8NA 5DCDA 5HXMA 3AROA 3AMKA 2WZIA 3BAWA 2OVLA 3LBCA 3RCMA 4V15A 1WPCA 1SSDA 1QBAA 1A53A 2D2JA 3I6RA 4OBTA 3RRAA 1BXBA 4I8YA 3O6CA 5REQB 4IM4A 3DHPA 4J3XA 3GG8A 3FNDA 4E4FA 3GNDA 5D02A 3QHNA 1XBZA 1J0JA 4FXSA 3ITGA 4LS1A 5JH2A 1PIGA 1VS1A 1BRLB 5DMNA 3NQFA 2E6DA 2TAAA 5BRQA 2VOMA 4UQCA 3R8HA 1JDAA 5CBIA 3MWCA 4LUTB 1XSJA 2OYMA 3SY1A 2E5DA 4E8DA 1MRQA 3PZUA 2OZTA 2PI6A 3AYTA 5BNKA 1E4LA 1DOSA 1FCUA 4JKKA 4D6CA 5C8BB 4FNSA 1YE4A 4ZFMA 2Y5SA 3WLOA 1UR4A 4WK9A 3WQOA 4ERIA 1W9PA 3NSMA 4P7RA 4R5EA 2RGMA 5IBXA 1ODZA 4Y9MA 4LWWA 2F2HA 1T99A 3PZOA 2XIMA 3LTYA 2CLKA 2CLPA 2VL4A 3UQNA 4F0HA 4HU3A 5PTDA 3KCLA 3PTQA 3LQLA 4C1LA 2WOQA 4Y9NA 1UWAA 4B5NA 2E6YA 5KMYA 1VCGA 2CWNA 4GNJA 1TTIA 4GZ7A 1QNQA 1UWIA 1UP2A 4JFWA 2DJLA 7A3HA 5AFDA 5IDZA 3GNRA 1TRIA 4WX2A 3LA4A 1XL9A 3LHZA 3EDKA 3E12A 1L8PA 4H6RA 2PDFA 3K5XA 1I2PA 2WANA 4PODA 2PDMA 1TPDA 4YTSA 1BHGA 1HN1A 2QNEA 5CC5A 1TCMA 3WMBA 1B30A 3WNPA 1GEQA 3DFTA 1JDDA 3ZT6A 2I5GA 4F2TA 3W73A 1RVGA 1VFUA 3RLUA 5I09A 5D9NA 4EIVA 1VPQA 2F6KA 4HCLA 1YXYA 1DXIA 3NM3A 3IGXA 2NX1A 1MYRA 4R7JA 2P1FA 4NT0A 4RZ4A 3PSVA 1QPNA 1X38A 3IIZA 4BF7A 3S8HA 4IJBA 1ZJIA 2E68A 4XV0A 4EWJA 1X1ZA 4AZ6A 3U4AA 5M17A 4QHRA 1GVFA 1OFPA 3AS0A 3GXFA 3R0KA 3G8RA 3MVTA 1GKQA 1YMYA 9CGTA 2PRLA 1A5MC 3AXHA 1O4UA 2YFOA 3OVGA 2WNWA 3BH4A 3MV11 3TIMA 1A5OC 3PWIA 3OZOA 3CHEA 4PRTA 4TUFA 1OCBA 3A4XA 3RMEA 1H50A 3NGFA 3G6MA 2ZA3A 2CZVA 4DIAA 2XVLA 1JZ3A 1Z48A 2WSRA 4RXGA 2GVYA 3P5ZA 2G3NA 2J8TA 3GVWA 1LUCB 4Q3MA 5CPQA 3TA6A 5E1QA 3MYPA 4YIWA 2A3LA 1NWRA 4Q4QA 3W7EA 3RK8A 1OGSA 3OPSA 2IW0A 3RPMA 1JAKA 5B80A 3KCOA 3ARSA 1EC7A 4Q32A 3M5YA 3E3HA 4E2BA 3VMOA 3MYOA 3KL0A 4Z0JA 5F7UA 1E71M 4D8AA 4KKXA 1UD6A 1J79A 2J9ZA 3MUAA 4PMUA 2QGHA 4DVOA 5FEXA 2D3NA 1VGAA 3IGSA 1UWSA 3BW3A 3C0JA 3NCOA 4CQDA 5ABFB 2WKJA 4J1OA 4ZOCA 2WV8A 4M51A 2J78A 1AQFA 1QNOA 4PMDA 4B5UA 4CNOA 4AUBA 3UXKA 3M6DA 4BY3A 2VEFA 1NEYA 1LT8A 3GNNA 2WVUA 1KM0A 4LTSA 4FX8A 1ZS2A 4KCUA 4ZXOA 2ON3A 3E74A 1DBTA 3A47A 1AJ2A 4DWSA 4R33A 3P74A 5C9UA 1R3VA 4AIUA 4JIEA 2ZOXA 2C91A 3P3BA 3WLTA 4Z08A 4F79A 4N9EA 3QF0A 5RUBA 5AYIA 3UP8A 3F4NA 3VNIA 5D4YA 4WY0A 1D9EA 2PLCA 4DAFA 1GG1A 1A0EA 1ISZA 1I4NA 2NXHA 1VBJA 3AISA 1ECEA 4C90A 5I5RA 4ZOEA 2ZA1A 4GGHA 1E6RA 1UB3A 2C18A 2YLLA 2BVWA 2X0YA 4HYVA 3OP2A 5FOOA 3Q37A 1JR1A 4AXKA 1ZFJA 1UBPC 3WLNA 3VOJA 3FAXA 4F2BA 3WF3A 3CMGA 1UMLA 3WX7A 4ZVJA 3EKLA 3LSCA 2Z26A 3U4FA 4HSHA 3P8IA 3G0XA 3GFXA 4NILA 3TYUA 4ENLA 1VC4A 2BGQA 3R94A 4XVDA 3RM8A 3WMSA 3WDHA 1S2TA 2JALA 4H3DA 1YTEA 1M5WA 2CETA 2CPUA 1XYZA 2G3FA 2XVKA 1FWJC 1QI0A 1L6FA 3VNKA 1TR9A 1EFZA 2RKXA 3SIZA 4FNTA 4B5SA 4DWSB 3AIVA 3DFOA 1BEUA 4H83A 3GR7A 1EZWA 2GSHA 3HPSA 5BU6A 3WH9A 3R8GA 1GOOA 3GBDA 3EGJA 1S38A 1K9EA 3UR2A 5GNXA 3EKZA 5K9DA 3AQUA 2QMKA 1EXBA 5I79A 4WCJA 2FLIA 1JZ8A 4KQNA 2XINA 4UTKA 2XFWA 3W22A 1UQYA 2QT3A 1J93A 2C7FA 3VDGA 4KWSA 5LXEA 1TPB1 3C8FA 4LH8A 1MFVA 2EF9A 5BRPA 2OT1A 3AIQA 2E5BA 3VOIA 4IIBA 1XINA 3UF9A 1OB0A 1E6SM 5LIXX 3W26A 3V18A 5MF5A 3CV2A 3BCFA 4HN8A 4MZYA 5EGRA 3SRHA 3LZ3A 1R38A 3N15A 1VFSA 3PBVA 4FX7A 1F2JA 4ATDA 4RL3A 3PZTA 5D30A 1RPXA 1KA9F 1EA9C 1NFBA 1O94A 4A3UA 1UH3A 3DERA 5ABGA 1MW3A 3CUHA 1IV8A 2PC4A 3BOLA 4E2VA 2VEMA 5CZTA 3U2ZA 2VUYA 3W1UA 4XD3A 3B9NA 3EWYA 3DHDA 4GO8A 3SJ3A 3QLDA 2OX1A 1V08A 1XLJA 1R30A 1MW2A 1A5BA 3QR0A 1O5KA 3KBMA 3GX9A 3VM5A 1CX9A 5A6BA 4RZBA 3NPUA 3UR5A 3MW7A 1XLAA 3PBWA 2H8ZA 2WCGA 2Z1SA 3C3NA 3IK2A 4PTXA 3W82A 3A23A 2WMHA 4DJED 1GORA 3KTCA 2A5HA 2YLAA 1IHIA 4HNCA 2Z00A 3ITCA 3VINA 1B1YA 4L4PA 1XDJA 2D0FA 3ICJA 4AHOA 4B5WA 1XCFA 4C65A 1QNRA 5D2WA 4JX5A 3TTEA 4O50A 4DZAA 4P8WA 3CUJA 4MJMA 2QJIA 3ANYA 3UCDA 3T05A 4DBSA 3CV1A 1VFLA 2EKGA 4K8GA 2G3MA 4IP4A 2YZRA 1E9LA 1J0YA 1UH4A 1XLFA 1XQLA 4DRSA 4RE4A 1NWUA 4LSBA 4MB4A 2W3ZA 3S1GA 2D3LA 5CJNA 4U3AA 4DBUA 2E6AA 3WG6A 4DPPA 4G5DA 3H4WA 3NUKA 4OV4A 2EPOA 2JK2A 1WBHA 3C56A 1K1DA 3HG5A 5GNZA 2H9AA 2DSUA 2FTYA 2J7HA 3DI0A 3NEVA 5MKGB 4Z1DA 2G97A 4G2DA 2I9UA 3LG3A 3FY1A 1V8EA 4MB5A 3OGVA 1THFD 3OYZA 4X2PA 4PE8A 4MHBA 3H55A 5D09A 1GHRA 2PDYA 3R7MA 1WDDA 3NR0A 4FAMA 1QO5A 2J25A 4KIEA 2DSVA 4Y9OA 2FYMA 3R89A 3GTFA 1JG9A 3C2FA 1M9HA 4O0QA 3GAKA 4D71A 3F5KA 3MMTA 4IFKB 2RDTA 4PUEA 2ISDA 1HO1A 4XZBA 3BOXA 4ZQMA 1TWSA 3M0YA 1EPVA 2PRHA 2NV1A 3C2OA 4BA0A 2WO5A 2W67A 1PKNA 1RQEA 3LRMA 1TA3B 4D6DA 2DQXA 4ZR8A 2Z27A 4XAZA 5DY2A 2OU4A 2OOGA 4UTFA 1ICPA 4PH6A 3CHDA 3N2MA 4GRSA 1YBQB 1Z8AA 5AY7A 4H7CA 3I4EA 5CPMA 3P6LA 4DYKA 1KM2A 3IRDA 3SCOA 3VZYA 4BI6A 3FXYA 2IKIA 3GNPA 3OGSA 2ACUA 2DDXA 2R1MA 4E8CA 3H2EA 3B8UA 3QJAA 1QK0A 2CBJA 2YB1A 3MSYA 3BV4A 4KF1A 4JD4A 3TJIA 2D0GA 2JFEX 4ZQRA 5I6SA 1MZHA 3POCA 2L5HA 1EBHA 9XIMA 4ZQPA 4KWOA 3C61A 3CUZA 1TO3A 4XAFA 2YCKX 2VR4A 1H61A 4XZ9A 1TFVA 4OWGA 3KZSA 4KEZA 1E5JA 2QJNA 4ZXLA 2A3BA 4Y9AA 1GKRA 1UG6A 3NYDA 3E2RA 5TAOA 3VNMA 2O56A 2GQAA 4MFEA 2R82A 3LHVA 3BLFA 1E4NA 3FHQA 3STFA 1HJWA 1QMLA 5H6HA 5EMJA 3UZXA 6REQB 4WSKA 1LZOA 4WSJA 4P5UA 4QP0A 3BSMA 3VX1A 4Q6JA 1SW7A 3EDDA 1JEZA 1Q6LA 2J24A 1U5HA 1BYCA 3VMNA 3IACA 3AIUA 4P2VA 2DUAA 3G5EA 2ZZ4A 4L9XA 1BF6A 4ONVA 5CXPA 4LRSA 1GYLA 2E8ZA 1YQ2A 1GOIA 1JJKA 1ZUAX 2IPJA 4JTGA 1V7YA 1Q6RA 2E9BA 1FHVA 4IIDA 2CBIA 3JU2A 4MGGA 1TIWA 1S3HA 3RNDA 4LV9A 1TTQA 2V2CA 3KDNA 3A9IA 3AMCA 3CUGA 2WM1A 5H1WA 3JW7A 3PJWA 4IMDA 4AXNA 1VEMA 1O7AA 3H2AA 3WLIA 4PCNA 1DJNA 3D0CA 1H5YA 3W1RA 2X42A 3TTQA 4X61A 4Y6GA 1WXZA 3D46A 1DE6A 3QC0A 4IZGA 1KM4A 3CQJA 3SGGA 2YL5A 4S23A 6A3HA 1Y0EA 3STGA 1OC5A 4X0NA 4O8AA 1FFRA 5LSMA 3P8JA 2WW5A 2EGZA 3KP0A 3SBFA 1SPQA 4ZTYA 3EWWA 3T7VA 2Z7GA 4QAIA 5I03A 3UWZA 2XZ9A 1SZEA 5CH9A 3TC6A 5C7HA 3FFSA 4PUNA 3B9AA 2X41A 2Y8UA 3HURA 7REQB 3URBA 4HU8A 4MNMA 2CKSA 3TCSA 1GYNA 5A94A 3MKKA 3H4XA 2JF7A 1JZ2A 2ZUMA 3BAYA 4ORMA 3EYPA 2Q01A 3WBEA 1GQNA 4PCFA 4XZMX 3KHDA 4UFLA 2CCRA 5HWJA 1G5AA 3THDA 3QM3A 2PB1A 1VH7A 3CUFA 3I3EA 1SZFA 3S4TA 2HNHA 4ZO6A 2XN0A 3S1XA 2EG8A 4YTUA 1V0MA 1UZ1A 3N6HA 2WC4A 3ELFA 4RV3A 3OBKA 2I56A 3V1PA 4LU0A 2QW5A 2R24A 3HIJA 1JRBA 2J7GA 2PAJA 4ERGA 2C6QA 2XG9A 4M80A 2NSOA 4NJHA 1H1ZA 4C6NA 1UWQA 4A3RA 1ML1A 4E4PA 2GFTA 4PUWA 5DRIA 1I45A 4MSSA 1SZGA 4WHBA 1W8SA 3UXAA 4R9XA 1QOQA 1GTEA 3OLEA 1OG6A 1IEQA 4S3JA 2WSKA 1DWAM 3LYEA 4UFJA 4XZWA 5G2WA 1FWAC 3N2TA 3GU1A 4NHVA 1FH9A 1PVNA 1HQTA 3GB6A 1F61A 2A85A 4CQCA 1NDZA 2BFGA 2TPSA 3PAOA 4R34A 1HGYA 1E1CA 4QQ3A 1K70A 4AF0A 5HPOA 3SQMA 4Y9PA 1NAL1 3WQDA 2PDIA 1YPFA 3T0AA 1XIGA 3WH8A 3W38A 4NX0A 1OIFA 4B2DD 3I3DA 4TVCA 1GYMA 2E8YA 3M5VA 2XIIA 2VVSA 4QEHA 1BVZA 2QAPA 1TQJA 3ITVA 5D9PA 1GW1A 3PJXA 2D0HA 2FGLA 1EYWA 1QTWA 4L6DA 4WGHA 4G7FA 3FSUA 1TPUA 4C6QA 3BVJA 2JF6A 2WPBA 3HF3A 1UOKA 2GGEA 2P3ZA 3APGA 4F9JA 5KSWA 1I2OA 4BR1A 5E6ZA 3TN5A 3N04A 3HQOA 1KFJA 2XVNA 3VD4A 4QNWA 1A0CA 3GHRA 1XLDA 1V6TA 1XGEA 3H54A 3LNMA 2E9LA 1FP8A 2POZA 5EPDA 3A3XA 2Z2BA 3LCHA 2EEXA 4HU0A 5LIKX 2NXIA 1QXLA 4N42A 1ZY9A 5FKYA 3W87A 2HE5A 2WMIB 3PFRA 1FWFC 3OA5A 3B9OA 1C7TA 5I0DA 4AWTA 1DJGA 1D8CA 2JIEA 3UESA 4LBSA 4UXDA 1DTNA 3NYZA 4S39A 3FYYA 1M7XA 2C0HA 3VGBA 3W72A 1LLOA 2Z24A 3GD6A 3SCPA 2ASHA 1HZYA 1W5QA 1K6AA 4MADA 3GO2A 1GVYA 3CMFA 3NZQA 4JHOA 4XKMA 2X7VA 1XIEA 1H11A 3P93A 2A7RA 3PF3A 3GAYA 3RX2A 2BG5A 1UJQA 1UIOA 1EQCA 3QW4B 1L2UA 1E6QM 4GWEA 3S5ZA 2DP3A 3W7CA 1GVEA 4IISA 3TE9A 1DIDA 2HXTA 2DU2A 2PWGA 5ABEA 3EWZA 1X39A 1AW5A 2BVYA 3PZ9A 3TV8A 3BSHA 4N9CA 4DHGA 3AYSA 5FJIA 1GONA 5EBAA 1EHAA 2FH6A 3FXGA 4FEZA 3CAVA 3T0TA 1TPH1 4G9PA 4DZHA 3V3WA 3U2CA 3EBVA 5CQ1A 3QPZA 1XBVA 3W4RA 1XKJA 1PYMA 4RZ6A 2XJ7A 3FKRA 4LEFA 4ICNA 2IPGA 1VBUA 4ZB0A 1V3MA 4QG6A 1Z32X 2F8QA 2KZHA 4GYPA 4UNIA 1EF2A 1OZMA 2P76A 3V5FA 4CCEA 3THAA 5BOFA 2Q3RA 4JL2A 2PC8A 4RJEA 3LNPA 2Z7KA 2PDPA 3ISIX 1OCJA 1SYTA 1XYFA 4FR1A 4NZ4A 3LM7A 4RPPA 2BY1A 1YNYA 1UW9A 1TV5A 3S1WA 2Y63A 4LNYA 1VFTA 1W5PA 3K30A 3LMZA 1I2QA 4HZMA 3WELA 1G01A 1LWIA 2NQ9A 1E4MM 1V03A 1CPUA 4KPLA 3WCZA 2O7SA 1AH4A 4IOTA 3WNNA 2QCDB 4GYPC 3PWGA 1BGGA 1AFSA 3BSGA 4O11A 1NQKA 4WSHA 3V1HA 4IG2B 2AGTA 2DV0A 3L4ZA 3QHOA 4Q8WA 4DBDA 4QRNA 4Y2WA 3O2LA 4MYXA 3DKJA 5A5WA 1S2UA 4LPCA 3RLGA 4DPQA 1J8VA 3T07A 4IMFA 4RDVA 6TIMA 3TNBA 1VAHA 4I9JA 1T7LA 4XSMA 5DFAA 3M43A 1XPYA 3UG8A 5CPOA 2QR6A 1JFHA 5AHIA 4EACA 1W3IA 4Y8FA 3L21A 3LMYA 4DNHA 1TR1A 2O9TA 3W1XA 5BCAA 2W62A 3CEPA 3COTA 4L56A 1CT5A 1XDMA 2WMFA 1UZHA 3GH5A 5CG0A 1PWLA 4G8TA 1NP2A 3H2OA 3CC1A 1DWFM 1UPPA 1M6JA 2YA1A 4JQ4A 1PJ9A 5AC5A 3IARA 3IJ9A 1XIMA 4JQAA 4JCLA 4QTGA 2OB3A 4O12A 2ZUVA 1WB0A 2GVEA 2YA0A 4JIPA 1M41A 4HYWA 3TFXA 3HQPA 2XIBA 4CN6A 2VDGA 3BO9A 3P67A 2OODA 4DF2A 1J6PA 4W89A 3PUGA 4E3TA 1T41A 1R6WA 2HISA 2RUSA 1R3WA 3DFYA 4H8VA 3HOJA 1KRAC 2C16A 2DW7A 5CC6A 5HR7A 4HU4A 5BWFA 1FH7A 2C19A 2CNCA 2EJ1A 4LAOA 1AVAA 1V3KA 1RA0A 1VCVA 4JDYA 1UKPA 2YBUA 1M65A 1GGOA 1V02A 1J18A 4YYFA 3A24A 4J3TA 1AJZA 3TSDA 1KGWA 1VYRA 1X1NA 4ATLA 1JYNA 1DJQA 4L6HA 3I3BA 4DJDA 5KZDA 4GVIA 3CB8A 3RIKA 2X1RA 2EXOA 3POHA 3VD9A 3K8KA 5D04C 3EPOA 3DYPA 2D22A 4M1RA 5BYWA 1ME7A 3T2QA 3WQEA 4ROPA 3PWAA 1WCGA 2PDHA 1Q4WA 3PBYA 1KRBC 1E73M 4O15A 4W85A 1TUXA 3MO4A 4INFA 3O06A 2B81A 2OSXA 3VIFA 1POJA 4LF1A 3MCNA 1IYXA 1B3XA 1LP6A 2GQ3A 2Q8LA 3CH0A 2EG7A 4NI8A 1OFBA 3VCRA 4I7UA 4Y96A 1Q6QA 3ZR5A 1AUSL 2QDEA 3USBA 3W2NA 3GHSA 2Z1VA 4Q8TA 3KRUA 1OGBA 2FJKA 1MUMA 3VOGA 1CXHA 2HBVA 4H9YA 4BQ3A 3WQ8A 3AC0A 4ERAA 2IQTA 3EX2A 1UYQA 2E40A 4B9ZA 4M0XA 4WJEA 2BWGA 3RX3A 4HMEA 4K1WA 3F4WA 1EWDA 1KFEA 5G5IA 1GT8A 2AMGA 3KS6A 4DLMA 4H4IA 3HGSA 2PA6A 1A4MA 1V5XA 1O5RA 3ZM8A 1WBJA 2J88A 4P8VA 4XUGA 1K9DA 1ONXA 2XYLA 4A8IA 3DFSA 4WY0F 3LGEA 2VWTA 3SM0A 1OGGA 4HTBA 1U1UA 2Z2UA 3EZ4A 5FSEC 1OD0A 4W4QA 3JZEA 1VPYA 1PZ2A 5DBTA 1MI3A 2ACQA 3OG3A 2UY3A 3GW0A 4NRRA 2J27A 2VZUA 1MO0A 7ENLA 3P7YA 3A22A 4I90A 3GXDA 1HJSA 1D3CA 3KLKA 3VZXA 2VELA 3QGVA 3EB2A 3K8LA 3RCYA 1VPXA 3JR2A 4M81A 3UETA 3G8EA 4IGSA 2O4MA 2V67A 3NXLA 1F73A 4S3GA 3MDWA 3O6YX 3WLSA 2V8ZA 3AI0A 2YIHA 1XLMA 3L23A 3NSXA 4B15A 3BARA 3ZMRA 2XWDA 1YTDA 4QITA 1P0EA 2B0MA 3LEPA 4UNLA 4Y90A 4RK8A 2DZSA 5HOSA 2DZTA 2WWDA 2HPMA 1ONWA 4MUPA 4QE5A 3B0PA 3SCRA 1H51A 5LA0A 3QSRA 4N4PA 3TX9A 4G56A 3WY1A 1W1B1 3L12A 4QAWA 3SCTA 3QKEA 4X60A 3E0FA 3N9KA 3SEPA 4NKCA 3M64A 2ZTKA 1UJPA 2JEQA 1MW0A 3UZJA 1GJWA 3TK7A 2VR2A 5I06A 3M0KA 1TWZA 1VIZA 4YHEA 5A2CA 1DWHM 2CBUA 2QCFA 4D8ZA 3PAJA 2FDMA 1F05A 1ZP3A 1X97A 4S3DA 5E09A 2GQ9A 4PYSA 2OGYA 4LGXA 4Q8QA 1UR3M 3EKGA 3HBLA 2VX7A 1FHLA 2WVVB 2HVOA 3DX5A 3TP4A 1P5BA 2XN2A 1BD0A 1PDYA 1K4GA 2PCEA 3IIXA 4DBWA 3KCJA 3O9NA 4HMCA 4PMYA 2OXNA 1ZRQA 2WJEA 3OZPA 4LVGA 2IKJA 2FGZA 4LAUA 4HIBA 4WKHA 2CWXA 1GVOA 2BODX 4GX8A 4AIBA 3CM4A 5E6YA 4YYCA 3DC0A 2WSYA 3M47A 2QPXA 3BMVA 1PDZA 4LFYA 5F2GA 3Q4DA 1LROA 3P81A 5F2MA 5G2HA 2GVJA 4HNOA 4G1NA 3TR9A 2QYGA 4K36A 4JTTA 2WZMA 3BWWA 1X6NA 3PG9A 1KCKA 3REQA 4C6LA 3NM1A 1DKWA 3OOQA 4LV4A 5CZSA 3BJSA 3E96A 5AC8A 2W9MA 2J8GA 3IAQA 4UQAA 2XH7A 3MPGA 2XGIA 3CQHA 2XUCA 4QE1A 2DZWA 2CFFA 3ZVHB 5M2FX 3M4HA 4HPXA 4NNCA 1K6WA 1QHPA 4D1IA 1LL6A 1E0VA 3BC9A 4JNYA 4F8XA 1LOLA 1ZQ5A 1IXNA 3VGGA 2HJPA 3ZJKA 2VHLA 5AHEA 3GS6A 4O10A 4GUHA 1XFBA 1V93A 4URIA 3B04A 3WMLA 5DCBA 1LF1A 1N8FA 1YEYA 1SFTA 2OG9A 3G1VA 2VURA 4GQQA 3DCPA 3AIBA 3IANA 2GYIA 2WZTA 4PSPA 5CC7A 5DMLA 3QQWA 3TN4A 4Q8UA 3LDVA 5I77A 3PANA 5EMMA 3RYSA 1UPMB 4AZ5A 2GJXB 3P60A 2HMCA 1L2QA 1DWIM 3LENA 3HQNA 2V2HA 1HKVA 4AWSA 2VC7A 5CGTA 2JKAA 5K4XA 4MM1A 2PDBA 3NEHA 1YXCA 4C6OA 3W9ZA 1P7TB 3W7IA 1TREA 2NUXA 1B9ZA 4GFSA 3O63A 4PMRA 4S3EA 3DKLA 3R8RA 1HIZA 3NL5A 1Y7VA 2TRSA 3WBXA 4AYGA 5I3FA 3LRLA 1DWGM 1V7AA 3BMXA 5HQEA 5XINA 1E6XM 3L5AA 3N4EA 1PHWA 1UZ4A 4H9ZA 4U3CA 1FXPA 2OO6A 3LCFA 5C9WA 1QHOA 2X2YA 1QPRA 3SFWA 3UVAA 2PDQA 1J01A 2VGGA 2GWGA 3NJ3A 2VNCA 4R53A 3AHVA 2PU1A 2QVNA 3KE0A 1K3UA 4IFRA 3VE9A 3L7RA 2ONEA 1RV8A 3AICA 5LNWA 1OC7A 3H4GA 2Y5EA 4ML9A 1ITXA 1E9ZB 2VXNA 8RUCA 3UJSA 5DMYA 5J8LA 2ZE3A 1HX0A 3RU8X 3ALFA 4JY9A 3DEQA 1NWTA 1H7WA 3CHVA 3VKDA 5E9AA 3V0UA 3AU6A 3NDZA 1Y5VA 3BV7A 4RCXA 1ZAHA 2I9EA 2D73A 3CQIA 5A6SA 3QOKA 4RW5A 1S5TA 1SO3A 4W8AA 4O1CA 3DHFA 1DE5A 5FJPA 1TZ7A 1QWGA 1XXXA 1K77A 1Q13A 3UT0A 4Z2GA 3K13A 3VIJA 3A9BA 4PSRA 1XG4A 1S2AA 3QQ0A 4QE4A 4S3CA 4IQEA 3FA5A 1DTUA 3GXIA 1LBLA 1F8IA 2GJNA 3CPGA 3KZPA 4L80A 4MB1A 3MS8A 3ID7A 4R3UA 7CGTA 2X09A 5B7YA 3HFYA 4PZVA 4JTSA 3W02A 2PDLA 1EGVA 4IWWA 3C86A 3QY8A 3HPAA 1HG3A 3R13A 2FVLA 1F4HA 4KGJA 1R7AA 4CD5A 3VVGA 4PMOA 3BLIA 5D8ZA 4MVAA 1R47A 1JI1A 4R7OA 1VLIA 1XGDA 2FHCA 4E4UA 2FZNA 1TSIA 1KM1A 2XGZA 1XX1A 4H7ZA 4PUJA 1XSKA 4PN2A 4M6PA 1QFEA 2VZVA 4Z2JA 2G5WA 3BQ5A 1XLCA 4V28A 4IMCA 3ERPA 3O7UA 4JPGA 4UMAA 3HV8A 5HNTA 1H7NA 3WLHA 4RNIA 3MMWA 4A2RA 2NUYA 1Q45A 1FWGC 4CVWA 4BQ5A 1XI3A 4HA0A 1XS2A 5EFDA 3GXPA 3MQTA 2CW6A 3MV01 3QXBA 2Y2WA 2HROA 1ZTVA 2QJHA 1OJXA 3B0UX 1EIXA 4GMEA 1FUYA 3N12A 3TN3A 1PV8A 1R2SA 3B05A 5AYBA 3B8IA 4CNUA 1M7JA 5H8PA 1FKXA 1JQXA 4Z1AA 1REQA 1B3VA 1P1XA 5D38A 3SW6A 5IM51 2OO0A 4UR7A 4M3PA 4RDYA 4W9TA 1BWKA 4C6DA 3NVDA 5EYWA 5A69A 5HQMA 4WGXA 1C93A 4QGCA 1XJBA 3S5SA 4GNVA 3CO4A 3AFBA 3UG5A 3BL3A 3TMLA 3MJYA 3HTWA 3WQ5A 1ECQA 1ME9A 3UWYA 2DT1A 3EPNA 4TMBA 4A6GA 3BANA 3VD3A 5HJYA 1NY1A 2V5CA 1Q6FA 4HZ7A 3EEZA 3OQ8A 3TWAA 3GUWA 4UTTA 2XPKA 4ZFCA 1M68A 3WF1A 3T2PA 3GR8A 4BQ4A 1DJZA 2GGIA 5ECVA 3SQLA 3WNOA 2J66A 5ABHA 3EDEA 2YXXA 2X16A 3Q58A 1NWSA 5TBOA 1YDOA 1EJXC 1O1HA 1KBKA 1QOPA 2E1DA 2WMKA 4NL1A 2BY0A 4GKLA 2PZNA 4U2ZA 1F3XA 1G7VA 4US6A 1PZ0A 1XFCA 4JKLA 4LXFA 1FCQA 3L2IA 1UA7A 3PVFA 3FGCA 4JFSA 2OZ0A 4Q8NA 3C0LA 2DW6A 4KIRA 1JPHA 4I9MA 1RK5A 4AD0A 2I5QA 1EO5A 3FEQA 3ZR6A 4GI8A 4MAVA 3IIVA 4HNNA 4M7TA 1WZKA 4JFUA 2UY2A 1HL8A 5CZJA 4AD2A 1X6UA 3WLKX 1TWIA 4FLSA 3RR1A 3R43A 2ODOA 1C8XA 3QFWA 5LZLA 4U5IA 4CNNA 1US2A 4UTMA 1C8YA 4IJRA 2YKKA 1SR0A 1P6BA 5ECUA 3MI6A 3W01A 1U30A 3SCNA 1V6YA 4GACA 1LCOA 5A2BA 2C3ZA 3GZAA 4GYFA 5CBBA 5AHNA 4O18A 5G4EA 4I3GA 3SFKA 4C6CA