2FQIA

Dual binding modes of a novel series of dhodh inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
362
Chain Sequence
DERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRAFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual binding mode of a novel series of DHODH inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
total genus 137
structure length 362
sequence length 363
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2fqiA00
2YPIA 4AWTA 4N9DA 3TAOA 5ABTA 1G4TA 5CSRA 2E6YA 1ME9A 3QPYA 4EIVA 5HQEA 3FOKA 1KM4A 4NT0A 1TRDA 1ICQA 1QOPA 3HQ1A 1LCOA 3BGGA 3I6RA 4ZQRA 1QOQA 3HPXA 2C6QA 1TO3A 3LGEA 1F7BA 1Q6RA 3O6DA 3EX3A 2ZZ1A 2JGYA 1W31A 4AB4A 1KM2A 1LDCA 1WOBA 3RNDA 4FIQA 1I45A 1HO4A 3K30A 2GPTA 1YPFA 1ZAHA 1EWEA 1JQVA 2CLEA 4WQ6A 3Q2DA 1ZJIA 5BNKA 2FIQA 1W5PA 2F7FA 4FO4A 3W85A 1ZFJA 5C5YA 2JKAA 1FXQA 4LV9A 5CSSA 4QAIA 3PULA 1SW3A 2CZFA 2NLIA 3CLMA 3OVQA 1EUAA 3WK2A 1K3UA 1NVMA 3TUUA 4XTDA 1Q6OA 1ZHAA 4GE8A 1Q45A 3P67A 4AVFA 1YPIA 1EUNA 3TSBA 1W56A 1DJNA 2ZZ7A 3P81A 3ABRA 4O12A 2QUTA 4N4PA 2TSYA 3PG9A 4WUIA 5AHLA 3TJLA 2PRMA 1BWLA 3IIZA 3TDFA 1HO1A 1KM5A 3TIMA 1FWTA 2Q3OA 3NQ7A 2JKPA 3W1RA 2NX1A 4YCOA 1EIXA 2W6RA 3U6WA 4N02A 1W3TA 5D2TA 3HGOA 2FB3A 3KFTA 2WKJA 5SWUA 2CZ5A 3QRHA 3N34A 4MYAA 3VKJA 3QMTA 1YDVA 4JR5A 3DAQA 4KKXA 4N9CA 4IX2A 4HNUA 2I1OA 3C0JA 2VELA 4QSHA 2GJLA 3W7LA 1SZFA 3QMRA 3W2JA 5DBTA 2LLEA 1VLWA 3LI1A 3W1XA 4HPJA 4ONVA 1QNVA 4LS0A 3E02A 3G1VA 4K39A 3PB0A 3P8IA 3BW3A 1RR2A 4BWLC 5F1VA 1IXPA 1KV8A 3P84A 2GQ9A 4UTTC 1OHLA 4NJHA 5CZSA 5EA9A 1XBYA 5F2MA 1T8XA 4O13A 3NOEA 2Y7GA 1TPUA 2C13A 3LHZA 2NXIA 2WPBA 2NXHA 2AGKA 1QO5A 1G7UA 1W3IA 1R2TA 3PSVA 1L9WA 2NUYA 4IJBA 3L0NA 2Z6JA 5LHFA 4GFSA 4O15A 1OFDA 3EWXA 1MEWA 3QSTA 3SGUA 3C2OA 3IVSA 2CLKA 4UXDA 3L2IA 4AEOA 3LV6A 1ZNNA 3N2XA 5LKYA 2VFIA 1R2SA 4MY1A 3ZS4A 1P1XA 2V5LA 4CQAA 1A5AA 3NQFA 1X6UA 4MY8A 4O1DA 3SI9A 2C19A 2DP3A 4RR4A 3MI3A 2Y62A 4QQ3A 5EL1A 5HWNA 4HNVA 2A7PA 5H2ZA 3GXPA 2BXVA 4MIMA 3UWWA 3MP4A 5EBUA 2DZPA 2A4AA 5D2XA 3NL3A 5K4XA 3MHFA 5HULA 3MWAA 4EF9A 2X16A 3RU6A 2QCEA 1SO3A 4NJGA 5TIMA 2C0AA 4WD0A 1EWDA 5AYXA 5I3KA 1GTHA 3VFLA 3BLEA 1QCWA 2I9EA 3BG3A 3GIYA 2Z6IA 4MJMA 1MXSA 3TROA 2V2HA 2RKXA 4C1KA 1EX5A 4GJ1A 4HSNA 5AB3A 4O18A 2P1FA 2YXGA 2QCFA 3W7DA 3ATZA 2WNNA 4K38A 4A2SA 1THFD 1TTIA 1TRIA 4IMEA 4JTEA 2VXNA 4QNEA 4HNNA 4UTTA 2BTMA 2CW6A 1RQBA 1PL9A 1QPNA 5IBXA 3T7VA 1QDSA 3LCIA 3LTSA 4RX0A 1TV8A 1L2UA 5L6UA 3LXBA 3O15A 1SW0A 2NWRA 4MPQA 4DEFA 2WV8A 1F74A 3OIXA 1KLZA 5FEXA 3GDLA 1KTCA 4NQ1A 1EPXA 1JUKA 5EY5A 1RQHA 3BW2A 3D0CA 1LRTA 2XN0A 1YADA 3TK7A 3W9ZA 2ZTJA 1WBJA 4NX5A 5I3JA 1B57A 4FNPA 4WOQA 2J9YA 4WOZA 2ABBA 3NA8A 2ATMA 2Y7EA 3T78A 3TXZA 4JTHA 5HNRA 1D3HA 3PG8A 1XBXA 3CIXA 1WA3A 5AHEA 4FNTA 1H1ZA 3F03K 3SW6A 2DJLA 4HIBA 4PL2A 4MYXA 4IMDA 4QITA 5D30A 1KTBA 1ICPA 5KZMA 5EPDA 3PWAA 4HN4A 4O53A 3N2MA 4POCA 2RFGA 3LHWA 4QISA 2A0NA 4MLJA 1XCFA 3NAVA 3RFAA 4LRSA 5C54A 2YZRA 2NV2A 4LY8A 1A5SA 1PHWA 1FUYA 3NQVA 3I7QA 3IV3A 5D03A 1DORA 3UZJA 5EKYA 1FQ0A 1X1ZA 3UY8A 2EKCA 3WJYA 3TR2A 1GPWA 5D32A 3MYPA 2FB2A 2QCDB 1Z42A 2WO5A 4JDYA 4JIPA 3U8GA 2X2GA 2VFHA 4NXSA 3NQGA 4JTUA 1GOXA 3M0ZA 1SO6A 3W6YA 1F76A 3B8DA 3W75A 4ADSA 2E6DA 1TPC1 3P7YA 1GG0A 1MO0A 1OFEA 1HUVA 1W5OA 3JS3A 3NQDA 4JTSA 1A50A 4P2VA 1NAL1 1JUEA 3M7WA 3M16A 3G1FA 4O0KA 3W2KA 4UC5A 5DCDA 3IGSA 4PL1A 2DZWA 3M6YA 2QUVA 3W2MA 3G1HA 4DO4A 2HMCA 4JYEA 2ZA3A 5DCEA 4BI6A 3I7RA 1JQXA 2A6NA 4NUWA 1QR7A 3DENA 2NUWA 1RV8A 1EB3A 3O63A 1C29A 2HS8A 3QQ0A 2EGZA 1BWKA 4GNJA 3W7KA 4JTIA 1VRDA 3W86A 4GUHA 4QNWA 2DZXA 5GVJA 3UWYA 4OT7A 1VZWA 1ZENA 2YR1A 5K4ZA 4GRSA 5AC7A 5G2IA 2OZ0A 4A22A 1MZHA 3L5LA 3EX6A 2WNQA 4X22A 4O8RA 3KVLA 1TPEA 4UTUA 1F6PA 4K36A 4UFJA 4GC4A 2R94A 3UPWA 1SSDA 2VKZG 1HL2A 4FXRA 1YTKA 1YDOA 1TPFA 1H51A 4CNOA 1DVJA 3DFQA 4OWGA 2E6AA 3DHFA 5FF4A 2YDAA 4DPQA 1ONRA 2QJHA 1T0OA 1LLZA 5I3IA 3WFAA 4JX6A 2QEZA 2ALDA 1QWGA 2YFNA 1X8FA 2QCCA 4E0CA 2QCLA 3DKJA 3TX9A 4UR7A 3KRZA 3C52A 3W7HA 1L6WA 2B4GA 3G1YA 4M7TA 3G24A 1F6KA 5BMXA 5HUPA 1QPQA 1VGAA 1YYAA 3NDOA 3BVJA 1VHNA 3IEBA 1KM1A 3G1SA 1PV8A 1VYSX 4UNLA 3W73A 5LNSA 3NPWA 3H55A 4K8HA 1OK4A 4NJKA 1S5VA 1TPB1 3QH2A 4J9JA 3R13A 4LT9A 1IIHA 2FPVA 3NL5A 3UD6A 3LTPA 1XUUA 1PCKA 4TR9A 3H54A 3R2GA 1IXOA 2QAFA 1GT8A 5DY2A 4JGDA 1LOLA 3V75A 2G5WA 1K7EA 4IXHA 4NZFA 2V9DA 4IXXA 4YL2A 1VCGA 5KZDA 3CEUA 3HG5A 4BK9A 3FIGA 2ZA2A 4FNSA 1FCQA 4BF9A 1JJKA 3HBLA 1I2QA 3DFTA 5K9XA 3G1AA 1QMLA 1LTDA 1VCVA 1XXXA 3M5XA 3M5VA 3A5VA 3M5ZA 1OABA 1OVDA 3FEMA 1TPVA 1X1OA 4HT3A 2QR6A 3L0KA 4O10A 5D02A 2CLIA 3A23A 5DELA 3GK0A 4CLMA 3E0IA 4FEZA 1PS9A 1QO2A 1MSSA 1OYBA 3QF0A 2NXGA 2A6LA 3ELFA 2ZQ0A 1SFLA 3LHTA 2W79A 4JD4A 1I8JA 3IIXA 2VC6A 3HB9A 3DXIA 3B03A 2VEPA 3TCEA 3LCGA 2GUUA 2V81A 4UTIA 4YWIA 2EPHA 4O1AA 4KFNA 1YDNA 2DU2A 3QFEA 4JTFA 3EWWA 3ZWTA 3W1NA 3VCRA 3E12A 4PODA 4UTMA 5FF3A 3O6CA 4JS3A 5DY3A 3CHVA 3CM4A 3OHIA 3CPRA 3N3MA 3NQ8A 5CGQA 3NQMA 3THAA 2WSRA 3PB2A 5D38A 1LYXA 4WX2A 3P74A 4OV9A 3STFA 1F5ZA 3Q94A 2TYSA 4NJJA 3PVFA 1KA9F 2JBMA 3YPIA 4IMGA 2GOUA 1G7VA 1GG1A 1SSGA 1NF0A 3NPXA 3GR8A 5DLCA 2E6FA 3EEGA 2YGYA 2QDGA 1VLIA 2OJPA 2A7RA 4NXKA 1WBHA 2DJXA 3EX2A 3GAYA 5LNVA 2E5CA 3BG9A 3QYQA 2CWNA 3QC3A 4OHQA 1ZCOA 2GJNA 4QJ1A 4PCFA 2WSQA 3UWZA 1GZGA 2ZZ4A 2QCDA 3EXRA 3G0SA 5CZJA 4Z08A 3MJYA 4MVAA 1FDZA 1KM0A 3SY5A 1T96A 3TSMA 1KV5A 3EWBX 3DFPA 3PUDA 1R47A 3ABSA 4MOZA 1H50A 1FY6A 1SU5A 3S9YA 1JCMP 1Z41A 1FWSA 2FFCA 4OE7A 1KFBA 2Y88A 1ME7A 4LTSA 2DZTA 1OX5A 5KSWA 1UUOA 3LXAA 4MLRA 1FWNA 3LB0A 3G3DA 3UNDA 4N9BA 2Y61A 1ZAIA 3PBWA 4Y96A 2H90A 5BRBA 4ALDA 1QFEA 1ZALA 5L9FA 3VI2A 3QJAA 4K37A 1WQ5A 3WK0A 2YFOA 1KLYA 3NQCA 1WOAA 4AMAA 2BWGA 4UFIA 5AC6A 1O60A 3PBVA 1FCUA 5H91A 2Y89A 2C15A 2X30A 3F4WA 2E5DA 3GXTA 1JCNA 1ML1A 4HKPA 3LTYA 5AOUA 3WJWA 3UWVA 2Q8ZA 4LUIA 4AHPA 5AC8A 3NQAA 4JTGA 2B7OA 1EP3A 2YW4A 1LBLA 3R12A 3EXTA 3GDMA 3LDVA 2GQ8A 4XWUA 5K2ZA 5DBUA 2FLIA 1I2PA 3FA5A 3LRMA 3W7NA 3UXAA 1K8ZA 1AL8A 1GVRA 3STCA 3U2OA 1TJPA 3VNDA 4AXKA 2GVGA 4OQVA 4ORIA 3UXDA 4UTJA 2G95A 3LLFA 3WK1A 3EX1A 5A5WA 2J88A 3LV5A 3P5ZA 1KFLA 4LVDA 2Y7DA 3IIOA 3TXVA 1QPOA 3GB6A 4H3DA 1YLVA 2VEMA 1KFEA 2QF7A 3SGZA 2X1UA 4DBDA 5DXYA 1FDJA 3LX9A 3BLIA 1M5WA 4O17A 5G2WA 4JYFA 3M43A 4JY9A 3NL2A 1DBTA 3R8RA 2ZYFA 1AL7A 2YYUA 2QCNA 1F05A 2J6XA 3ABQA 1TSIA 3LI0A 5HWMA 1J2WA 3MHUA 4ZZ9A 1RZMA 1GVOA 4EF8A 4BWLA 4RK8A 1I4NA 4UUIA 2QAPA 5LNRA 4CNNA 1YTEA 5IBXC 2C16A 3FJ6A 1XBZA 2J27A 4D2JA 4IMFA 2E09A 2QDHA 5U4NA 1N8FA 2UV8G 4LS2A 1LM1A 1G4SA 4O4WA 3IGUA 3B06A 5CPLA 4AWUA 2ZBTA 4S2CA 2Q8LA 3B4UA 1GTEA 3O07A 5FEZA 1XL9A 5HMSA 3GDTA 2R91A 3OVPA 5C6MA 3CU2A 1GVQA 4A3UA 2CZDA 1CW2A 2QCHA 4L4LA 1P4CA 5EMUA 1S5WA 3M5YA 3ZR4A 7TIMA 5D05A 3TV8A 4FXSA 4ADUA 1IXQA 3W7EA 3DHDA 3W7QA 2JK2A 4LUJA 1WYIA 1H7PA 3W88A 1NFBA 4JIQA 4LC6A 3O05A 3P61A 4U28A 3P80A 3HJZA 2ATSA 4XUGA 1OYAA 2ZFAA 5KZEA 2AAMA 2WNZA 3N14A 2H3DA 3N19B 4XKYB 5CG7A 3BO9A 1K8YA 1FDYA 3UY7A 5DCBA 4Q32A 1OFPA 1G69A 5G1TA 4AH7A 3DU0A 4WXZA 1WX0A 4ZL1A 4MZ8A 4Q4KA 4UNKA 3BK0A 4NNCA 3OVRA 3NL6A 1XDMA 4O28A 4GXMA 4U4MA 2RDTA 2V2CA 4K7VA 1A53A 1J4EA 3DBPA 5CZTA 3WK3A 3MW7A 1AW2A 4HNTA 3S5NA 4ZVJA 5BOOA 2Q3RA 4R53A 1IF2A 3HO8A 4XTIA 4W9TA 3NYZA 4IX0A 1QPRA 3V1PA 3A5FA 3LXCA 2PRHA 3LRLA 4HPXA 3EWZA 3LCXA 1SZNA 3GXNA 4ADTA 3W7OA 3W87A 3DFNA 1AW1A 3QW4B 4S1FA 3B0VC 3NZ1A 4OV4A 2QCMA 4FNQA 4QIUA 5EYWA 4OGZA 3PR2A 3O16A 4K7YA 4JTJA 4UCGA 4QM1A 3W1TA 5E0KA 4NZJA 3W1QA 2ZCGA 2NWSA 3KRSA 4M7SA 1W5NA 4GUIA 2A1YA 4NU7A 1DHPA 3B04A 4Y8FA 1LBMA 3ZFHA 4FHAA 3NGJA 4H4IA 3N9RA 2WOQA 4MFDA 1SO4A 1P5BA 3TE9A 3NR0A 3EKZA 2Y70A 3DI1A 2WQPA 2H8ZA 1ICSA 1FCBA 3TFCA 1TPH1 1A5BA 4N2YA 3USBA 3S1XA 3KVMA 2J24A 3QPZA 5BW6A 5AN7A 2V0TA 4YLWA 1M6JA 3HG2A 3SZ8A 5LSMA 2CLHA 2A7NA 5K3VA 4JY8A 4XBSA 3TW6A 2NV1A 5BMWA 5I3FA 5D33A 4UFLA 4FX8A 3EX4A 1LP6A 1JCXA 3VE7A 1H63A 5FEPA 4UTWA 3W71A 5HR7A 3JR2A 4K6AA 4FB7A 3OEXA 2J9XA 3T55A 3C6CA 4ZQOA 1JVNA 2BZNA 3M47A 1DL3A 1VJIA 2GVJA 4CCDA 4RLIA 3HPSA 3L21A 5F4XA 1OFOA 3A22A 1FX6A 3G0UA 3W3OA 4LOCA 5G4WA 2FDSA 1ADOA 4LVGA 3CQ0A 1UUMA 3UZ5A 4WY0B 4I7VA 4ML9A 2OX1A 3L67A 2VOMA 1AW5A 1S3HA 2NX9A 4YCPA 4PC8A 1YTDA 1Q3NA 4X2RA 3HPZA 3PC0A 3DKLA 2TMDA 4GUGA 3HG3A 4MJZA 5G4EA 3TNOA 1GWJA 3W07A 4UFKA 1OF8A 4NX0A 4PEKA 4JXCA 3PSWA 1GQNA 4WJEA 1W8SA 2E77A 2E1DA 4WY0F 2ZZ5A 5HINA 3GVGA 1FXPA 2Y7FA 3S5OA 1WDWA 4KWVA 3G3MA 2YYTA 1XC4A 3L65A 2C3ZA 1SFJA 4AHOA 2R14A 4UFHA 3KOFA 5IM51 4E2BA 2OMAA 2PE4A 2B0MA 5LNUA 4PH6A 5KITA 2YSWA 2DZVA 1WXJA 3H53A 4Y90A 2VFEA 3G1DA 4JICA 3W70A 4XBKA 3C4UA 1H1YA 4CCCA 3GLCA 1K7XA 2EAWA 4Z1CA 3RLVA 3QW3A 3TU9A 3G8RA 2VFDA 1C9DA 1W3NA 3W74A 3W7JA 5C2XA 1I2OA 3EWUA 1FCVA 2ABAA 4MY9A 5CPOA 1RD5A 5FF7A 3W7MA 1C8VA 1SW7A 3G1XA 4IQLA 2XN1A 3TW7A 5LZLA 2VFFA 2Y63A 1UCWA 3G22A 2AQWA 3HGRA 3S8HA 1O95A 1GJPA 1H60A 1VH7A 5I3GA 2B7QA 1TMHA 2V2DA 3NNTA 2VFGA 3DFOA 3KHJA 1P0KA 1TTQA 4XKYA 4GWEA 1ZY9A 1NSJA 2H6RA 4P61A 4O14A 1PHQA 1VYPX 4NNBA 4EOUA 3JRKA 4ZMGA 3PS7A 3CB8A 1JCJA 1Q6QA 1JR1A 4L4MA 3TKFA 3PAJA 2X1SA 4FNUA 3W1UA 3TJXA 5HR6A 3HOJA 3LBCA 3BGJA 2ZZ6A 3LCFA 3GX9A 3M9YA 1UJPA 2ZRYA 3W22A 2B7PA 5F1UA 3FLUA 4RZ5A 1SZEA 4AF0B 3S0CA 2ISSA 2V8ZA 3EXSA 3L5MA 3RK8A 1KW1A 3W23A 4LVAA 1D3GA 1TQXA 1B4KA 1LLWA 2RH9A 1F2JA 1H5YA 3FFSA 2H8XA 2E68A 2FQIA 3MO7A 4I7UA 1PE1A 1W1ZA 1OFQA 2IQTA 2H3BA 1SUXA 5FF0A 1KFCA 3BLFA 3DGRA 4MZYA 3KAOA 4N9EA 1VQTA 1A5CA 3LOTA 1P0NA 2QJGA 3C2RA 1TIMA 3HMJG 4OBTA 3LCWA 4K8EA 1JULA 2A21A 3W2UA 3QZEA 3S1UA 1J5TA 4O4VA 2ZZ2A 4JN6A 4O54A 3ANYA 2WSYA 1VCFA 3MI2A 1V5XA 1O94A 4BI7A 4KFOA 3W7CA 1TV5A 3IGXA 3KVKA 1FWWA 4PTNA 4Z0SA 1R46A 1JRCA 2NZLA 4IUOA 3L0GA 3HGSA 3THQA 5J5RA 1TV7A 2PCQA 3KVJA 4O1CA 4DF2A 3TQKA 4Z0JA 2V30A 5CKSA 3G18A 5DXXA 3LM7A 2CLOA 1KBJA 4A21A 1MEIA 2EF9A 2O7SA 1L6YA 1M7OA 3NPUA 2ZRXA 4BR1A 4DELA 2O7QA 2XFWA 3QM3A 5D2VA 1K8XA 1TCDA 1AMKA 3CC1A 4FX7A 2HTMA 4Z1BA 5E93A 1W54A 2OCZA 4HSOA 3FS2A 4DF1A 3EB2A 4UTLA 3DI0A 2VEIA 2Z2UA 4NNAA 3MBFA 1LOQA 4WZHA 5D04C 1V7YA 1TREA 3AO0A 1SPQA 3UWUA 3NXFA 3AJXA 4HHPA 4WY0A 4X9SA 2ISWA 1W5MA 1BEUA 1VS1A 4E38A 1UB3A 1G67A 3TQ0A 2FPYA 3C56A 3KXQA 1G4PA 1JUBA 2G97A 1ALDA 2QKFA 4GBUA 3W2NA 3A9IA 5D2WA 4TX9A 2QJIA 3TMQA 3LHYA 1L6SA 3GZ3A 4UMAA 3W7PA 1LRNA 4DQWA 3TQVA 3T4CA 1XI3A 3M1ZA 3UQNA 1SO5A 1YXCA 4OU1A 3B0PA 3NM3A 3NQ6A 3STGA 4RCXA 1IXNA 3KRUA 1RVGA 4I7WA 3RLUA 1VYRA 5I3HA 1RQEA 3C2FA 4BFAA 3TH6A 2PRLA 2CLMA 3INPA 5F4SA 2VEKA 2KZHA 3MP3A 3W72A 4B5NA 1LORA 3F1QA 3GDRA 1O5XA 3I68A 5F2LA 2FJKA 5C55A 4DPPA 4RKAA 3GR7A 3UYCA 5K9CA 1F73A 4X3ZA 4LNYA 2C18A 3M44A 5AYZA 4UTKA 3RF9A 2ZRUA 1SR9A 1DQWA 1DV7A 4GUFA 3LHVA 5CPNA 3RMJA 2E5BA 2BLEA 3LHUA 4XQ6A 1TQJA 2OT0A 3LCLA 2DZSA 3A21A 4JNMA 3NM1A 5E1QA 1KM3A 1XUZA 4ZQNA 3W1AA 1W0MA 4RJEA 1Y0EA 4LWWA 4BI5A 5AYYA 1VPXA 2P0OA 2BX7A 5K7JA 2B7NA 5AHFA 5MHBA 4LS1A 5FF2A 5F2IA 4MZ1A 3C61A 3QSRA 4JX5A 4N6FA 5A8GA 3W1PA 1PVNA 1RPXA 4Z1AA 2EHHA 3MYOA 1OK6A 2W0UA 2WJZA 3PBYA 4Q33A 2I14A 5HWJA 5T26A 1H7WA 8TIMA 3SSJA 3GYEA 4AAJA 1I2RA 5FI8A 3TFXA 2BSLA 4KWWA 1TTJA 3IVUA 3PF3A 1LOSA 3CWNA 4TU1A 1TYGA 3C8FA 4FNRA 3IRDA 4AF0A 4TIMA 3TA6A 4TO8A 2P10A 1SZGA 3IIVA 2QCGA 1O5KA 5F2GA 2NX3A 3C2VA 2CLFA 4O11A 1OFRA 2CFFA 3TSDA 1EA0A 3FKRA 4M6VA 1HFBA 1GEQA 3R5EA 3P62A 3L66A 1OX4A 3OA3A 4LW7A 5KINA 1W5QA 2VENA 3R89A 1XFBA 1LROA 4R7JA 3FYPA 3HG4A 4JEQA 3L5AA 3O6YX 1FBAA 5LNWA 4CQ9A 4CCEA 1PCWA 3NQ2A 2JGQA 2HSAA 2TPSA 4EVZA 1XKYA 6TIMA 1OFAA 3QMSA 1DJQA 3W84A 4IPIA 4YMZA 1R2RA 3I65A 4AWSA 1BKSA 3E9AA 1JCYA 1EP2A 2YW3A 3A24A 1GYNA 6ALDA 2GQAA 3TC6A 1MEHA 1VHCA 1TJRA 4CQ8A 4TMCA 1DOSA 2JKEA 3QEZA 2NUXA 2FPTA 3G0XA 3EWYA 4LC8A 4C1LA 2YX0A 1M7PA 2YCEA 3B0UX 1H62A 4DXVA 4IGHA 4UR8A 2ZZ3A 3BW4A 1QAPA 2D73A 3W83A 3C3NA 2F84A 2CZEA 5CZ0A 1KM6A 3MHGA 3NG3A 1B3OA 2A5HA 3LLDA 5FEWA 4RXFA 1YXDA 1ZAJA 3CWOX 4RXGA 2C14A 4LVFA 3W7RA 3DH7A 4DO5A 3MUXA 4RV8A 3O06A 4M6QA 1LRQA 5AHIA 2V82A 3DFSA 3NZRA 2A85A 4O0ZA 3WJSA 1BTMA 3LRKA 1H7RA 3GNNA 4AHQA 1G6CA 3BARA 4O57A 2QUUA 3PM6A 1VC4A 3QQ1A 5D09A 5DN1A 4PFMA 1W37A 3UWQA 2XN2A 1I2NA 1LZOA 4R33A 4H6KA 5J5DA 1KFJA 3HGJA 4EWND 5LGXA 4PA8A 1Z44A 3NPVA 1TPDA 3W7IA 1XM3A 1D9EA 4LRTA 4R34A 4Y6GA 5TBOA 4ZQMA 3WJXA 3NO5A 1Z48A 2ISVA 3CEPA 3PY2A 4MKNA 1O4UA 3BPWA 3FJLA 3SR7A 1G4EA 3GKAA 1IIGA 1JCLA 1K03A 4ZQPA 3NQEA 2CLLA 3T44A 4FIRA 4N4QA 4Z1DA 1WAUA 2RHGA 3SJ3A 2FTPA 3FYOA 5G1YA 5LHEA 4O16A 5G2HA 3S5ZA 2ZDRA 3BG5A 5KTLA 3NEVA 1K7FA 1EEPA 1YXYA 4O19A 3B05A 3I7SA 4LU0A 3PBUA 5F4WA 1OX6A 4MUZA 3CT7A 4JDBA 1UBSA 4YXGA 4NJIA 1EP1A 3O8AA 3GKFA 1NF7A 3W2LA 3MP5A 5G5IA 4UTHA 1GVFA 1HG3A 2HS6A 3F4NA 3UPBA 3PUEA 1GYLA 4IOTA 1B4EA 3N9SA 1LBFA 1DKWA 1XDLA 3W76A 1IGSA 1CI1A 1U5JA 4DF0A 2OT1A 5LGZA 4E2DA 4N6EA 1VR6A 4UMBA 2G96A 3CIWA 1T99A 4LVBA 5KMYA 3EKLA 3P5YA 3W1MA 1X7FA 4JTKA 1GVSA 3CTLA 2GVLA 2PC4A 4S2BA 1FWRA 1N7KA 1AG1O 4ORMA 4FF7A 2V5BA 1H7OA 3PUOA 4DBEA 3OBKA 2J9ZA 3OG3A 4NVTA 5K9DA 4GUJA 4IMCA 1NEYA 3MBDA 2Z1BA 3SFKA 2PURA 2X1RA 4ICNA 4JTLA 3LCHA 3E96A 4XZ9A 3DZ1A 4A2RA 4DO6A 3S42A 3GNDA 4WXYA 3M41A 4ZQCA 3IVTA 3S5YA 3P60A 3L9CA 3Q37A 4JTTA 5AHNA 4O52A 5D2YA 3GDKA 5CPMA 4JX4A 4A29A 2TRSA 1TPWA 3LERA 2X1TA 1TTPA 4M5PA 3IIPA 1XBVA 4KFPA 5U7SA 4Y9AA 4IWWA 3ATYA 4M19A 3Q58A 3S6DA 1ME8A 1JRBA 4RZ4A 2DZUA 3C2EA 3S1VA 3VE9A 4UFMA 1Q6LA 1OYCA 5HUOA 5HJLA 3T40A 3MI6A 4JYDA 1PIIA 1KTNA 1WV2A 4G1KA 3MMTA 4UIOA 2RDWA 1CX9A 2R8WA 4M6PA 2CU0A 3WJZA 1H7NA 3LBMA 2ZA1A 1HTIA 3TMLA 3BV4A 3SIZA 3FKKA 2ZRWA 4UMCA 3ABOA 4UTWC 1OX4B 2Y85A 3TAKA 3E49A 1H61A 3ZWSA 4MFEA 2ZTKA 3O1NA 3S1WA 1R30A 4TMBA 3TC7A 3STEA 3P82A 5FESA 1S5TA 1B9BA 4FX6M 4I9AA 2ZRZA 3G8EA 1U83A 4RZ6A 5AHMA 3W7GA 5AFDA 5D37A 1AK5A 1OFBA 1SQ7A 2A2IA 1DQXA 1TB3A 3HIJA 1KFKA 1OF6A 1UASA 3N73A 1E51A 4O50A 2DORA 1N55A 2ZRVA 4CNPA 3P8JA 1H7XA 2C1HA 3HF3A 4IPJA 2RDUA 2Y6ZA 3SECA 4LV4A 1OG0A 1OJXA 2Z0IA 3W1LA 3NVTA 1KBIA 5TQLA 1K02A 3KX6A 4O1BA 3L68A 3GAKA
chains in the Genus database with same CATH superfamily
1OWQA 2PDNA 2PBOA 1HX0A 4OIFA 1HVXA 3AICA 3CZEA 4PUUA 5CSRA 3QPYA 1E3ZA 2NQ9A 5LXEA 1L8NA 4W8BA 5HQEA 3MCNA 1KO0A 4KGJA 1QOPA 2O55A 4M1BA 1LL4A 1HJVA 3MSYA 2XGIA 1SMDA 1HL9A 4AB4A 2ZZ1A 2JGYA 1H0GA 4QR6A 1TV4A 3RNDA 4DJFA 1T41A 3GHSA 1HO4A 1ZJAA 3UJFA 1HP4A 2GQ3A 5JQ9A 3S6TA 2A3EA 1ZJIA 1U22A 1CECA 4WR3A 4DZ5A 3WLOA 1EYEA 5IXEA 3MSRA 2FIQA 4ZOCA 4R85A 3STPA 1K6WA 3W85A 1ZFJA 5C5YA 4IM4A 5CSSA 1A4MA 3VIIA 4QAIA 3PULA 5BXTA 3CLMA 2FVKA 3QV7A 4DZHA 4GVGA 3OVQA 4W7VA 2WBKA 1NVMA 2W91A 4XTDA 1V0NA 2VEGA 2J8GA 1PBGA 4KRZA 3TNBA 3AZSA 3TSBA 3KDOA 3POCA 2Y5EA 3P81A 4O12A 4LUTA 2QUTA 3VVGA 3PG9A 4WUIA 4G2DA 2DZAA 2GJPA 3T2PA 2A79A 2ZUVA 3CUIA 3H4XA 3TIMA 4MF4A 1FWTA 2Q3OA 4UOQA 2JKPA 4LXFA 2XFYA 2W6RA 1K70A 3AI0A 5HNUA 1VBRA 3AISA 4RW3A 4JFVA 3QRHA 2WC3A 3N34A 3P0XA 3QMTA 1YDVA 4JR5A 4N9CA 1FKWA 1DWGM 3M0YA 3QN3A 2VELA 4B16A 2CBUA 3QTGA 4AY8A 4PRWA 4ONVA 3PNUA 3G1VA 3BW3A 4EPDC 3F4VA 3FDKA 4UTTC 1OHLA 5F2MA 2BHUA 3UW6A 1TPUA 2C13A 4ZB0A 4GYFA 3KW3A 4HVXA 1DJZA 1NWRA 1W3IA 3NZGA 3NXLA 3GFXA 2F2HA 3TC3A 3KRBA 5LHFA 4GFSA 1CXHA 1KGXA 5I02A 3L4WA 1R85A 1ZNNA 3N2XA 2BP1A 3QR3A 2XWDA 1A5NC 5J8LA 3SRHA 3WBAA 2J6VA 3VD4A 5AYBA 3T1GA 2C19A 2J7DA 1GVYA 3IK2A 3MI3A 4GKTA 3MVTA 4HNVA 3SUWA 3GXMA 3HMCA 3H7UA 4JBRA 4MIMA 5ECUA 2VM8A 3MP4A 5EBUA 2DZPA 3N4EA 2IQDA 4KRUA 2AQOA 3WBEA 1ZBVA 4D9PA 4E2VA 3MWAA 2WKLA 2G37A 4AC1X 2A3AA 3E0LA 1SO3A 1XLIA 4NJGA 4QHRA 5AYXA 3BLEA 2I9EA 1A47A 1TVPA 2XPKA 3PTMA 1M65A 1AVAA 2V2HA 4QTGA 1EOKA 4YTUA 3L4XA 4JEJA 4O18A 2P1FA 2WNNA 4XVEA 3NVDA 2PFHA 1V79A 4JTEA 2X40A 4PB3A 5B7ZA 3OODA 2OKTA 2PI6A 5XINA 1PL9A 1QPNA 1ZUAX 1QDSA 3LCIA 4RX0A 1L2UA 4IG2A 5L6UA 1Q8AA 1WKFA 2NWRA 4JQ1A 3WLNA 1F74A 3VMPA 5EMYA 5EY5A 4CNSA 3BW2A 4HU3A 3D0CA 3NCOA 4MMWA 1KNWA 1YADA 3W9ZA 4AZHA 2QMJA 4WOQA 2J9YA 3KTSA 2ATMA 4MJ4A 1BPLB 3T78A 3VDBA 1R86A 5AHEA 4LYKA 1P48A 2DJLA 3W4RA 4GC3A 3U2CA 1KTBA 4M8UA 1ICPA 3DDMA 3OOQA 1AQMA 1VPQA 2VT0A 1PPIA 4PN2A 3NIYA 5BCAA 3N2MA 2RFGA 3LHWA 4GXPA 4MLJA 4IGMA 4QDWA 3RFAA 1TWSA 4LRSA 4B4FA 5C54A 4NILA 5JIWA 4NHVA 4LY8A 2QGHA 3I7QA 2VR4A 3WH9A 4W5ZA 3RCYA 1DORA 3UZJA 3DX5A 3PTDA 1X1ZA 3B8WA 2EKCA 3WJYA 6ENLA 4EANA 4UOZA 4EAMA 1GPWA 4B4HA 3ZR6A 1KXHA 3P2VA 3GNXA 4MNLA 2OSXA 2X2GA 2VFHA 3NQGA 4Z1YA 1GOXA 3TJ4A 3GC4A 1TVNA 3A64A 2VX4A 4MM1A 4PMOA 4ADSA 4G7EA 3P7YA 1VKFA 3PZOA 2WZIA 1HUVA 2QT3A 3JS3A 3NQDA 4JTSA 4KEMA 3G1FA 1GKRA 4BF7A 2F6UA 3WEOA 2OWWA 3BAYA 2QUVA 1WE5A 3G1HA 3TR9A 3E74A 5DMNA 4JYEA 2ZA3A 1B3WA 1TWWA 3BCDA 2FKPA 4A8NA 3RILA 4NUWA 3QGKC 4TOQA 1QR7A 1XIMA 1EB3A 3O63A 4RDZA 3QQ0A 3WO8A 1BWKA 2VZTA 3W7KA 1VRDA 3VNYA 4QNWA 1PZ1A 4S3JA 1VZWA 5M1TA 1NDZA 2Z29A 5G2IA 1CGUA 1BYAA 5DX7A 3UU0A 4S3KA 4F40A 1UWIA 4X22A 4ZFMA 3RITA 2V6AA 1EJ7L 1HL2A 3URNA 1H51A 4CNOA 3WLKX 3QC0A 3ZZ1A 1TJ1A 2C79A 4OWGA 1CNVA 4Q4QA 4GH1A 1R9XA 3QVQA 5I3IA 3M7SA 1QWGA 1X8FA 2QCLA 3BMWA 2V5KA 4UR7A 3CV6A 3VUPA 3H24A 2QV5A 3W7HA 5D9MA 1FHLA 1F6KA 5BMXA 5HUPA 4DYJA 1O5RA 3ONCA 2OGYA 1MRAA 3NDOA 1XLLA 3BC9A 2X0HA 3VD7A 1GQKA 1KM1A 1PV8A 2CHNA 3MJMA 1OK4A 2BXZA 1S5VA 4LT9A 1IIHA 2FPVA 3DYPA 3GM8A 1IXOA 4HPHA 2EO7A 1UR0A 1VJZA 1OGSA 3TP4A 4IXHA 3W28A 4YL2A 1V51A 1VCGA 5TNVA 5KZDA 3CEUA 1NIUA 3V5FA 5K9XA 1BYBA 3G1AA 1LTDA 1XXXA 3V4BA 4QG9A 2QS8A 4Y2WA 1OABA 1MW2A 1OVDA 1U1HA 4EXQA 1TPVA 4O10A 7REQB 3A23A 4FEZA 4J3XA 1XLHA 1OCNA 3TTYA 2ZQ0A 1NP2A 3EDEA 4JD4A 2PLMA 4B2DA 3PZMA 3OQEA 3A12A 2VEPA 3TCEA 5JBFA 3VZZA 5AVHA 1TR1A 4YWIA 5J04A 2W3ZA 4O1AA 4GMEA 1Z32X 1E3XA 3W1NA 1UMLA 3WYZA 4F3HA 4UTMA 1I9CB 1OGGA 3MWCA 3A4WA 4HPGA 4JS3A 5DY3A 3WUEA 3BV7A 3CPRA 1J18A 4DNHA 3N2CA 3N3MA 3NQ8A 5CGQA 3THAA 1XIDA 2O9PA 1PKMA 2WVVA 4BA0A 4DLMA 4M0XA 4GCAA 1V6TA 2O56A 5HANA 1NWTA 2TYSA 1KA9F 2JBMA 2GOUA 1XR2A 1NF0A 3MUZ1 3GR8A 4X0NA 2Y8KA 4KEZA 2YGYA 1TR9A 1VLIA 1WBHA 3F4CA 4NI8A 1IT7A 3AS1A 2OO0A 1UA7A 1UUQA 3QC3A 4OHQA 3LNPA 2YOCA 2QCDA 3EXRA 4FP1A 3WD2A 4MVAA 1T96A 3TSMA 3N25A 3A9BA 3M0KA 1UD3A 4I5XA 1JYXA 2PCEA 2XISA 3I6EA 3TYBA 3W01A 3S9YA 1Z41A 4PZVA 1R5YA 4EWJA 2DZTA 1OX5A 3LXAA 2BBFA 4H1ZA 3LB0A 4ZENA 4E2OA 2H90A 1GOMA 3GFYA 4DBWA 1EJVC 5L9FA 4PSRA 4WEVX 3PP7A 4K37A 1RK6A 1QI4A 4HCLA 3ZJKA 1XH1A 1KLYA 2WAGA 4LYQA 3B8TA 3AS3A 2XJ7A 5AC6A 2QVHA 2ACQA 3CTTA 5H91A 1A5MC 4P7NA 4DWSA 1LT7A 4EPKA 3KBMA 1J5SA 2YB1A 4GQ0A 1ML1A 3GD6A 3WJWA 3UWVA 2Q8ZA 3RRXA 4FLSA 4AYSA 1XLFA 1UZDA 1WDDA 2ZVIA 4RE3A 3F4DA 4Q22A 1NTHA 3GFZA 1HJSA 3W7NA 1BXNA 3G6MA 1Q85A 4GI9A 4XBJA 4LCQA 4ORIA 2OLHA 1FWJC 3LLFA 3WK1A 4DLFA 5I5RA 3LV5A 4H6EA 1QPOA 5E6ZA 4Z42C 4H3DA 2W67A 3SGZA 1H3GA 2X1UA 2ZXBA 4DBDA 2VEFA 3O0KA 3IS4A 1M5WA 3UF9A 2JEQA 1AD1A 4JY9A 3QHMA 4PMVA 1AL7A 1RCXB 4N0RA 4I3GA 2J6XA 4ACYA 3ABQA 1XLEA 4MNJA 5HWMA 3LI0A 2C8NA 3RG6A 4EF8A 4BWLA 3GUWA 1R3SA 1I4NA 2PWEA 1K9FA 3TN3A 1V6VA 3JZEA 3BJTA 3BMVA 1UPMB 1E5JA 2CWXA 5DANA 3NUKA 1RP9A 5LXXA 3R94A 3U3HA 4D2JA 2ACRA 3B8VA 2QDHA 1UP0A 3WLJA 3RUBL 2OEMA 1G4SA 4O4WA 1KR1A 4BCEA 2PP0A 5FEZA 3A3XA 3FA3A 2D3LA 3OVPA 1UR2A 5A6KA 3CU2A 4UQ9A 4Q8QA 1CW2A 1E1FA 4NZ3A 3URQA 4B3LA 1BYDA 3WD4A 4NRSA 1HF6A 1T5AA 5KEZA 3ZR4A 7TIMA 5D05A 4ENLA 2NT1A 3TV8A 1MW1A 1AH4A 4XVDA 4QDMA 1CXFA 1IXQA 3W7EA 4NZ5A 1QNQA 1XLKA 3CUFA 2QJNA 3W88A 1NFBA 3R7MA 4JIQA 4LC6A 4U28A 2OVLA 3P80A 3OQ8A 4AVNA 4REQA 5H1WA 2H3DA 3MMWA 2X7WA 1K8YA 4C60A 4ZTXA 5G1TA 4AH7A 4Q4KA 1H0IA 3PZTA 3BK0A 3ZSSA 3OVRA 4GYPC 4U4MA 2ZUUA 1TJ0A 4MJ2A 4URIA 1J4EA 3OZPA 2ZICA 4X0VA 1W3LA 5I7GA 1NQKA 1W9DM 1XLBA 5BOOA 2Q3RA 1DYSA 3V5CA 2CYGA 3QOKA 1IF2A 1ZZMA 2ACSA 1JZ6A 4W9TA 1JEZA 2IPGA 5C70A 3V1PA 5EMMA 3UR8A 3LCXA 3VOHA 3W7OA 6XIAA 3H2OA 3K46A 3PR2A 4ZOAA 3L2MA 4C6FA 4JTJA 4QM1A 1F6YA 3W1QA 1MZRA 2XSXA 4D6CA 1ODZA 3C2YA 1W5NA 1POJA 4ML4A 3NFUA 1DEDA 4H4IA 3W81A 3N9RA 1O5QA 4MFDA 3EKZA 1EDTA 2YBTA 1YHTA 2H8ZA 1P1MA 1ICSA 1Y65A 1BLIA 1A5BA 2GL5A 4FLOA 4CD6A 4P7LA 3UERA 3KVMA 1W1B1 1EIBA 4YLWA 4ZGYA 4NG3A 3HQOA 3SZ8A 2A7NA 3DG3A 2YDQA 1FKXA 4JY8A 4EPEC 5GJMA 4AZ7A 3K8LA 5D33A 1XFCA 5AYIA 1JCXA 3VE7A 4UTWA 5HR7A 3BZJA 3OEXA 3T55A 1W9UA 1HN1A 4ZQOA 1JVNA 3TWBA 1DL3A 4PE8A 4CCDA 2I16A 1J8VA 4YNGA 2QIWA 3KLLA 3BLOA 3RX3A 1KQYA 3AHZA 3W3OA 4QLKA 4IFRA 2W61A 3CQ0A 3AHVA 1GVIA 2DSVA 3KS6A 1E6ZA 4MWAC 1YTDA 4IUGA 2AOSA 4LCSA 3SURA 4RNHA 3L4YA 3IJIA 2PWVA 2MANA 4PB5A 2EG6A 3G5EA 4IIBA 1GEHA 1OF8A 4U3CA 3D5HA 4NX0A 4JXCA 3PSWA 1GQIA 1JXKA 4WY0F 2BVTA 1YNYA 4DWDA 1ONWA 4M24A 2YCJA 3CL7A 4E8DA 5CLWA 2PGEA 2R14A 4UFHA 5CSYA 2YA2A 1S2WA 2VQUA 3CHFA 2PDJA 2B0MA 1PZ2A 1RLCL 1JPHA 3M0IA 4E4FA 5LNUA 1YNPA 2DZVA 5ABHA 5IFTA 1TMQA 4YTRA 3SCWA 3U5YA 2ZWYA 3U7VA 1A3XA 2RJGA 1K7XA 1L2QA 3T0TA 4UWMA 4RE4A 3TOPA 3QW3A 3CS2A 4ZB5A 3G8RA 3HV9A 1S1PA 2H9AB 3W7JA 3BAJA 1FCVA 1IV8A 1RD5A 4XAFA 5FF7A 2GUYA 2OX4A 1XIJA 3UXLA 3G1XA 4IQLA 2GZXA 4RDVA 1BSLA 1X8CA 3S8HA 1GJPA 1H60A 3EOUA 1J0HA 3SUTA 2VJXA 5EMJA 3MQTA 4M6UA 2PPGA 1V6YA 1TTQA 3AOFA 1L6FA 1ODUA 1PEZA 1ZY9A 4B90A 2H6RA 4UQCA 2IKHA 3B40A 4O14A 3VIJA 1SYTA 4NNBA 3JRKA 2XVKA 1CGYA 1F3XA 3CB8A 3AXMA 1IEQA 3RPTA 3PAJA 2W9MA 4FNUA 3W1UA 3TJXA 1FOBA 3UBPC 3CHCA 3BGJA 4OVXA 4L80A 2BVWA 5GQBA 4D6FA 1AZ1A 2BOEX 2ISSA 3S0CA 1KCLA 3SO7A 2QHAA 2YCKX 3W23A 5XIAA 3SN4A 1CXLA 2CPUA 1ISVA 4RE2A 4CU8A 1B4KA 1PIGA 1LLWA 2RH9A 3GG7A 4DAFA 2HK0A 4AD5A 3QV9A 1L8PA 3WQPA 1PE1A 1W1ZA 2VOTA 5T91A 4L4PA 2H3BA 3N6HA 4C6QA 4QAWA 3MKCA 3B4YA 4QLJA 1E4MM 2A21A 1I60A 4O4VA 4JN6A 5B80A 4GIEA 1XYAA 2F6KA 4I6KA 1TELA 4W5UA 4DI8A 4QFUA 1FWWA 5I03A 1JRCA 1OCQA 2PCQA 4HD5A 1P0DA 5A6LA 2X8RA 4AIEA 3SQMA 5CKSA 3WH7A 2PDHA 2IXUA 4A21A 3UJSA 1NH6A 2PDYA 5BRQA 1TKKA 3W38A 4Y9PA 2I7GA 3WG6A 7ENLA 3ZQ9A 3GHRA 2X05A 3H2EA 1K8XA 4LUYA 3CC1A 3AHTA 1PTGA 2OCZA 1V6UA 1CLXA 3E0VA 3B8UA 4DF1A 3DI0A 1EHAA 4S23A 2VD8A 1KBBA 1IWAA 2WYSA 4UQAA 4E4PA 3V36A 4WZHA 3WH6A 1DIOA 4QG8A 3VILA 1TREA 2QGYA 3NO1A 4WY0A 4JQ4A 1VIWA 1TWIA 1XLJA 1VFSA 2X09A 3GE7A 4E38A 3VCCA 1UB3A 2FPYA 1F4AA 1HKWA 2NQJA 1MNZA 3T2QA 4GBUA 4XAGA 3A9IA 3KBSA 4TX9A 4UR9A 5CJMA 4IFKA 1KRCC 4F0LA 2OPJA 1WNOA 4IIFA 3DYOA 3SCNA 3LHYA 3GZ3A 1RPKA 4LYRA 2OEKA 5E9XA 3NQ6A 2Y8UA 1RVGA 4MG4A 1CYGA 3RLUA 2ANUA 3PJXA 1T40A 2YJQA 1G5AA 1DWIM 4OBRA 1H2JA 4H2HA 2PRLA 1I75A 3VD5A 1YBQB 2VEKA 3W72A 3GDRA 4QEEA 5F2LA 2WMJA 4DPPA 1QW9A 1F61A 1F73A 1UA3A 1OCJA 4UTKA 5AYZA 3M0LA 1DQWA 3FGCB 3SCSA 2A3LA 3N13A 2Z2BA 4C6MA 3KUMA 2CBIA 3AQUA 2BLEA 1CENA 3UVIA 4AIOA 3FDGA 2HBXA 3NM1A 2GSEA 1XUZA 2Z28A 4ZQNA 1W2VA 3W26A 2AL2A 5K7JA 2CZVA 5MHBA 2BHZA 3C61A 3QSRA 1CCWB 4GIAA 1RPXA 3WLIA 3VCNA 3GYCA 4E6MA 5GJPA 5T26A 1G94A 3KBJA 4PTWA 4C6IA 8TIMA 2P0IA 1WUFA 3GYEA 4AAJA 4AY1A 2P53A 1QU4A 3TFXA 4C6OA 4JFSA 1TTJA 3ME3A 1XINA 3GW0A 3WH5A 1KC7A 4WDXA 5MKGB 3PJWA 1XDJA 4GKLA 1LL6A 2RDXA 3S83A 1E72M 3TA6A 3IIVA 4DUXA 1MWOA 2Q02A 2NX3A 2RUSA 2FZNA 3HZ3A 1UD8A 3M4HA 1JZ7A 3SCTA 1XF0A 1PTDA 1OX4A 5EBAA 5KINA 3R89A 5JIPA 1LROA 4R7JA 3VO0A 3HG4A 3N4FA 3ANUA 3TWAA 4XX6A 4B5TA 4QBXA 1CWYA 4CQ9A 1PCWA 3AYRA 3RO8A 3NQ2A 2JGQA 1XG4A 3KHDA 2Z26A 4EVZA 1OFAA 1RAKA 3QMSA 3P0WA 3I65A 2ODOA 3LZ5A 1KRMA 1BSIA 4DY1A 1P0BA 2VO5A 2BOGX 1GJWA 2J8TA 1E6RA 3KBWA 5A8NA 1KBLA 4ZOBA 1KGWA 2NUXA 1MQQA 3KTCA 3G0XA 1IT8A 1US3A 4CD8A 1PTAA 2ZZ3A 2GWGA 3C3NA 1R38A 2QMKA 5FSDC 4Z2GA 1KM6A 1C90A 5HJXA 2V68A 1MFVA 3VNKA 3NG3A 3CWOX 4RXGA 3WQGA 1RBLA 3DH7A 1EA9C 4D6JA 3WQ5A 1W1PA 4PBEA 1H7RA 5BWAA 1EQCA 1LG2A 4O57A 1BF2A 4PFMA 3SB0A 2XN2A 3UG8A 1I2NA 1IYXA 1LZOA 2RGMA 5I24A 4ATWA 4QE5A 4V33A 5FA5A 1KFJA 4KT2A 3WFZA 5I07A 4ATDA 5LGXA 3GTXA 1VFHA 3NPVA 3W29A 4DUVA 3SSZA 3W7IA 1W9XA 5AC5A 1S5NA 4HGXA 1J10A 4LRTA 1TUXA 4Y6GA 1TMLA 3EPOA 2E9LA 1I0DA 3ENLA 3CUJA 1M1BA 3BANA 2ISVA 3U48A 4OFCA 1O4UA 3BPWA 1NDWA 4I8DA 2D20A 3ERPA 3SJ3A 3FYOA 1Z6KA 3WBYA 2WC4A 4O16A 5M17A 2HXTA 3BG5A 4F66A 3O9NA 5LA2A 1J6PA 2WZMA 4GHRA 4FSAA 3B05A 2HEJA 1JL8A 3PBUA 1OX6A 4CD5A 2P5NA 3WL1A 1UG6A 4PCPA 3O8AA 5TF0A 1GJUA 1IHIA 1HG3A 4AQLA 3ZM8A 3N9SA 1LBFA 3W76A 5D4YA 4DWSD 8XIAA 3H2MA 2E9MA 1PYFA 4H8UA 1L0PA 4DF0A 2OFJA 2OT1A 1HKVA 2EG8A 1XV8A 4UMBA 3BSHA 3CIWA 3W1MA 2WZHA 1GVSA 1FWAC 3PNZA 3XINA 4FF7A 3OBKA 3OG3A 4IMCA 1NEYA 2C1GA 2Z1BA 1OC5A 1LF1A 4AZGA 3TA9A 4DI9A 2ZX6A 1HT6A 3NYDA 4WDWA 4A2RA 3S42A 1D7FA 4AX6A 4ZQCA 3S5YA 5A2AA 2HQAA 1J0ZA 1TZ9A 4JTTA 5DRCA 5LIUX 1HKIA 3RM8A 1QOXA 1DTUA 5CPMA 1TV3A 2TRSA 2V5DA 3LERA 2X1TA 1SJCA 2IPWA 3WLPA 1PJ9A 4KFPA 1V3LA 1R7AA 3UEQA 1XSKA 5HQMA 3S6DA 1JRBA 3S1VA 5HJLA 2I56A 3SY8A 2D23A 3R1ZA 1KTNA 1UR3M 2DQWA 1XQKA 2ZADA 2ISFA 1H7NA 4UCFA 1HTIA 2FVMA 4GPNA 4JKKA 4WGXA 3ABOA 4A6GA 1JZ5A 3LGDA 3HM7A 4YJ5A 3GG0A 2Y2WA 2ZTKA 1FP9A 3N6JA 3O1NA 1REQA 1S5TA 4WGHA 1U83A 4RZ6A 1SFTA 5CAHA 1AK5A 5HAOA 1SQ7A 1TB3A 4A3RA 1UASA 4O50A 3QGVA 3PBMA 1E51A 1N55A 4CNPA 1H7XA 3P14A 3SECA 5A69A 4CVUA 2PTDA 2Z0IA 4H83A 3T05A 2AGTA 2KAUC 3GW3A 4LF1A 4RZBA 4N9DA 1JGIA 2J4GA 1G4TA 2E6YA 2PLKA 1XIHA 2DSZA 4HU4A 4ZQRA 3OZYA 1QOQA 4US5A 1QASA 1NOUA 3E5PA 2XVNA 1UD6A 2CBJA 4DNMA 1F7BA 1VAHA 3O3RA 1KM2A 2XSBA 1WOBA 5M5DA 3K30A 3CJPA 2GPTA 4JL1A 1YPFA 3S9ZA 5ABEA 1EWEA 2OO6A 4PGLA 3VGBA 2FHBA 3N2OA 4M29A 5BNKA 3H26A 4IIDA 2C1IA 1W5PA 2F7FA 4FO4A 3RX4A 4B2DD 3APGA 3AYSA 2JKAA 1FXQA 1XLGA 2HV5A 4LV9A 2NV9A 2Q09A 2NLIA 2CZFA 3CPUA 3BOLA 3EGJA 5I78A 1YW1A 3FVMA 2DT3A 1EH9A 3K13A 4GJJA 1E1CB 5I2UA 1ZHAA 1Q45A 3P67A 2GK1B 4R5EA 1YPIA 2XH4A 1EUNA 1W56A 3ABRA 4WSHA 4UQDA 4JIEA 3VDAA 2TSYA 5CSUA 5AHLA 4L5ZA 3TJLA 3VNLA 3QKEA 3ARXA 3BCFA 3A3WA 1BWLA 3TTSA 1O7AA 3BXWA 2CXEA 3W1RA 1E4NA 3U6WA 2XUCA 4N02A 1S3TC 3HGOA 3AXXA 3K1GA 2WKJA 1MRQA 2VI0A 5SWUA 4IQJA 3IARA 4PMRA 3SUUA 4X9YA 4KKXA 3DAQA 1VFMA 3LZ3A 3E38A 3WMBA 1SZFA 1UR1A 2GFTA 5DBTA 3OLEA 3W1XA 4HPJA 3UCQA 3UXKA 1DHKA 3E02A 1ZSXA 4K39A 3A13A 3T0CA 3OLGA 3PB0A 3P8IA 4H6QA 2ICSA 1IXPA 3P84A 4YVVA 2GQ9A 3B0XA 2VX6A 3EWDA 4C6BA 1XBYA 2EBNA 2X7VA 2Y7GA 2CXGA 4GY0A 2NXIA 2WPBA 4CEUC 2D2JA 2VMFA 3AROA 3CAVA 1R2TA 3EDFA 1DWJM 1L9WA 4E5TA 4CQCA 2D2OA 1M04A 3AHXA 2YXOA 1AJZA 3NO3A 1MEWA 3IVSA 3L2IA 5DT7A 3V35A 4IHCA 4DXXA 1P7TB 2VFIA 4GA8A 1R2SA 1C8XA 4MY1A 3ZS4A 8XIMA 1A5AA 4O1DA 3PZVA 2DP3A 3CO8A 3WDJA 2YCLB 2R1LA 3UZYA 2A7PA 3SIMA 2BXVA 3P6LA 3UWWA 1GHRA 1SFSA 5T8GA 1CB2A 4ICMA 1FWIC 4IP7A 5D2XA 5K4XA 3M0MA 1QI3A 5HULA 3UFYA 2YA1A 4H7CA 3WDQA 4EF9A 2X16A 2QCEA 3BJSA 2C0AA 5I3KA 1QCWA 3GIYA 3BG3A 1XCXA 2RKXA 1KD0A 3AWNA 4GJ1A 4H01A 1JZ8A 1HJWA 5A2CA 3ATZA 4A2SA 1THFD 1TRIA 3N15A 4I5UA 3WQEA 2D1ZA 4HNNA 2Y5JA 4H8NA 4HYVA 2BTMA 4NL1A 2ZE0A 2CW6A 3CZ8A 3GIQA 3T7VA 4GX8A 4Y7EA 3LXBA 2L5HA 1Q6FA 4DEFA 2WV8A 4HA1A 3H4GA 3GDLA 4W8LA 1EPXA 1RQHA 1PWMA 1JIBA 1LRTA 3O7UA 4ERIA 2D2GA 4GYPA 2ABBA 3NA8A 4HK6A 3R4IA 3TXZA 4QE1A 3C0QA 2G0WA 2IPFA 1D3HA 1XBXA 1WA3A 4WDTA 1H1ZA 1ENUA 4HIBA 4PL2A 3DCPA 2NW0A 4IMDA 4QITA 3SCUA 3K4WA 5KZMA 3OO2A 3QHNA 3PWAA 2QVNA 2FVLA 1M3UA 5CCZA 1VF8A 4J40A 4LAUA 4QISA 4KWSA 1XCFA 3FAWA 4WK9A 4X2PA 1U33A 1LLOA 4W87A 3LENA 4X60A 1A5SA 4HYRA 4DJDD 4QRNA 2DVUA 5EKYA 1FQ0A 1DJYA 5HPCA 4CN4A 3MYPA 1RHCA 3EBVA 3WIJA 2WO5A 4JDYA 4JIPA 3U8GA 3QZ6A 4LUTB 3M0ZA 4M56A 3V0SA 3W6YA 3W75A 4FLQA 1GG0A 1MO0A 4XZMX 5FOOA 1Y5WA 1UWRA 1JUEA 3M16A 3W2KA 3IANA 3BMXA 4P8WA 3ZT5A 5DCDA 3M6YA 4DM1A 1M53A 4DO4A 5FKYA 5DCEA 4V15A 3ES8A 4KWOA 1S2VA 3DENA 3RR4A 1RV8A 3VNMA 2DPEA 3TEVA 2DSWA 3W86A 3ITXA 3C3UA 5GVJA 3UWYA 1EOMA 1K6AA 1ZENA 2YR1A 5LA1A 4GRSA 5AC7A 1C8YA 4TX8A 4WJXA 3QV8A 3HU7A 2OZ0A 1XH0A 1MZHA 3L5LA 4JQ2A 2WNQA 4O8RA 4ZO8A 1F6PA 3BZGA 4K36A 4MNMA 2R94A 4KERA 4GG9A 4ZB2A 5BU9A 3RCMA 1YDOA 1TPFA 2Z1WA 4L1GA 3G1RA 5A6SA 1JDDA 1I6NA 3DN5A 2GWNA 1YMYA 4ASTA 4HJFA 3DHFA 3P3BA 1ONRA 3UZWA 1T0OA 4HMCA 4TVUA 3AS0A 1VFFA 4JX6A 4DJED 2QEZA 2X1IA 2YFNA 2P8BA 4GINA 1QPKA 3TX9A 2R9RA 1L6WA 1PSCA 4M7TA 2ESCA 1VGAA 3H21A 3A4XA 1H5VA 3SCVA 3W73A 4CCZA 1ZB5A 1LQ2A 1W3JA 1KGUA 3NPWA 4GX9A 3UG3A 4K8HA 3QH2A 3R13A 3REQB 1V93A 4TR9A 4HHMA 2QAFA 1E0WA 5I0DA 5DY2A 1WPCA 2G5WA 5H8PA 4HA3A 4NZFA 4JCMA 4BHYA 2V9DA 3ARQA 2VWSA 1MQRA 3FIGA 3B8IA 4TTGA 3HBLA 3VFCA 3CNYA 1QMLA 1VCVA 3M5VA 1E9IA 1NOWA 2CCRA 3FEMA 4NY2A 2Z7GA 1M41A 3RPMA 2AMGA 1I0BA 3GVVA 3GK0A 3E0IA 4JL2A 3DBNA 1QO2A 1MSSA 1SZRA 1FWGC 1UJQA 2X42A 5IDIA 1PKLA 2A6LA 1X39A 2ZX9A 3ELFA 1SFLA 1WKEA 3LHTA 2W79A 3CAWA 1I8JA 3T08A 4GIRA 2VC6A 4QG6A 3B9OA 1GHSA 4JFUA 3B9NA 3T0BA 2PSNA 2GUUA 3MKKA 4KFNA 4HPNA 1YDNA 4JTFA 3G77A 1G1YA 4XD3A 4BQ3A 3CASA 4DJDC 2YDRA 3CM4A 3OHIA 1WKDA 3V1HA 3VDCA 3ZR5A 2WSRA 4MAVA 3SDOA 3N9KA 5D38A 3NGFA 3P74A 2B81A 1GOQA 2WWDA 3Q94A 1FA2A 3TN5A 2J7HA 1KB3A 4ZBCA 4IMGA 4BEUA 1SJDA 4ECLA 1GG1A 3E2QA 1SSGA 2ZOXA 3NPXA 4TVCA 4Z2HA 1Q2SA 1W17A 2QDGA 2A7RA 4CN6A 4E8GA 1RLDA 2POZA 3IJLA 1E9LA 2ZUNA 1E4LA 1YPXA 3WNNA 3LU2A 4QJ1A 3FNDA 3PJTA 3BQ5A 3MZ2A 2ZZ4A 1S2CA 3G0SA 2CNCA 5CZJA 3MJYA 3RJYA 3SQSA 3SY5A 2Q71A 1EGMA 4A3HA 4H9UA 3KOZA 2PWGA 2FFCA 4OE7A 3WENA 2UY2A 2DSKA 1DE5A 1FWNA 4N9BA 3UJEA 3H8AA 5GNXA 2IKIA 3GG8A 2DVTA 4ALDA 4PCNA 3WX7A 1ZALA 3D6NA 2PDIA 4YHGA 3VI2A 3WK0A 3GC5A 4IISA 4AZBA 3T8QA 2OU4A 4F2BA 1J79A 4KMQA 1WOAA 4D8LA 5A6JA 4QE4A 1O60A 3MUIA 4CKQA 1FCUA 2Y89A 1VFUA 2C15A 1KCKA 5EB8A 3SCOA 4DJEC 3WLRA 5AOUA 3PAOA 4LUIA 4AHPA 3NQAA 4JTGA 1EP3A 4JHOA 1LBLA 4RL3A 3EXTA 2OEJA 2J78A 3AIQA 5K2ZA 4WIWA 4PULA 1YX1A 3T6CA 3POHA 4IPLA 4R27A 3LSCA 1AL8A 1GVRA 1V3IA 2BB0A 1TJPA 2V38A 3UXDA 4HZ6A 3WF1A 3DYMA 3H7VA 2J88A 2WHMA 3W00A 3P5ZA 1KFLA 1GUVA 2REQA 3IIOA 3JZUA 4HOXA 4OUEA 4ZO6A 1EC9A 3ID7A 1KRBC 1YLVA 2UBPC 2QF7A 1F3TA 2PGFA 1XRFA 3BLIA 3LN3A 3FVDA 2A3BA 2D22A 5G2WA 3RR1A 1MW0A 4FLRA 4QDPA 5C9WA 1AA1B 4BQ5A 1TSIA 4GOAA 3MHUA 5GNYA 1GVOA 3PZGA 2D69A 2FHCA 1JI2A 4CD4A 2QAPA 4JQAA 4CNNA 1YTEA 4ZA0A 3CAQA 3NEHA 5DMYA 2C16A 1EHNA 5CGTA 1ISZA 3D47A 4IMFA 2JALA 2W92A 1DJWA 2EJAA 3VC6A 4FPSA 4F0MA 1W91A 3W24A 3IGUA 1IT0A 5CPLA 4AWUA 2ZBTA 3B4UA 4PRRA 1B3XA 3MSGA 3WUGA 2R91A 4BS0A 3LS9A 4CN1A 1GVQA 4H19A 4GFIA 4OTKA 1S5WA 4JTRA 1S2UA 1C93A 4D6HA 1IZCA 4D8AA 2EPOA 3IJ6A 4ICCX 4D1IA 4H6RA 2HZGA 3S2JA 3P61A 1M7JA 1OYAA 2WVVB 2ZFAA 2AAMA 2WNZA 1PZ0A 6A3HA 3ZT7A 1FDYA 5DCBA 2OXNA 4QS6A 3SCPA 4K8GA 3SUSA 4CQBA 4MZ8A 4UNKA 5CC3A 3N18A 2CHOA 4UQBA 1JNDA 1BGAA 4O28A 4H8VA 1KCXA 1Q5MA 2RDTA 2V2CA 4E3VA 1A53A 3DBPA 3MW7A 2BG5A 2GGGA 1JF6A 4QJ4B 2WSKA 4IX0A 1U2YA 2G3JA 5DFAA 3GTFA 1B90A 4C65A 2J7CA 3LD5A 3DFNA 2CETA 4N7QA 4S1FA 4W85A 3PN8A 4QIUA 4YU1A 2IMRA 3AXIA 5EYWA 4OGZA 2UY4A 2VZSA 4PCTA 1UHVA 5E0KA 4HA0A 4W8AA 2WB5A 1MXDA 3PZ9A 4M7SA 3UG5A 2PZ0A 1UWUA 4I8YA 2A1YA 1DHPA 3B04A 4MHBA 3ZFHA 1XPYA 7TAAA 1P6CA 2WOQA 1P0EA 1SO4A 3TE9A 3VYLA 4YTQA 2V63A 5A3HA 2WQPA 3USBA 3S1XA 3QPZA 5IOBA 1UH2A 1JD7A 1W3KA 1MI3A 5LSMA 2Z1VA 2HWGA 4HN8A 3F2DA 3TW6A 3MVIA 2CIPA 4YS1A 1IGWA 5I3FA 4HU0A 4UFLA 1Q6GA 2VTFA 4FX8A 4IF2A 4FA3A 1QRQA 1H63A 1P6BA 1UMYA 1UZHA 3OGSA 4FB7A 4DJEA 2J9XA 3C6CA 3FEQA 3M47A 3WDIA 3IJ9A 1E55A 3WQ4A 4RLIA 4JQ3A 3HPSA 3MSDA 3ZLGA 3GTIA 3A22A 3UG4A 5GJNA 4DM2A 1IZKA 1M9HA 3ABZA 4NAEB 5G4WA 1EX1A 1TFVA 4GK8A 1UUMA 3WQVA 2GGEA 2C91A 1JXJA 4ML9A 2OX1A 3L67A 2VOMA 1AW5A 1Q3NA 1O68A 2VZUA 4X2RA 3ITVA 5I06A 3VPLA 2HVOA 1XCWA 5CC5A 4PMNA 1BD0A 3HG3A 1R3TA 5G4EA 4Q8NA 4HA4A 3MT1A 4PEKA 3VOIA 1W8SA 1Z69A 4NZ4A 4DWSC 5HINA 3WF4A 4IGSA 1WDWA 1A3HA 1FHVA 4L65A 3DFYA 4C90A 3G3MA 1RP8A 5CPSA 4C6KA 4NF7A 4HTBA 3RXZA 2C3ZA 1OIFA 2HISA 3WY1A 1V4YA 4J27A 3VZXA 3I4KA 3JUGA 5HATA 5AECA 4HNLA 3OU8A 2Z24A 3H53A 1F3EA 3G1DA 1MDLA 1EJSC 3RYSA 4JICA 3W70A 4FXJA 3E5BA 3ABXA 4XBKA 1H1YA 4CCCA 1B3ZA 3I3DA 3TU9A 2VX5A 1C9DA 1W3NA 1JFXA 2ABAA 3BAKA 3VNIA 4HK7A 5A6BA 1XH2A 3H22A 1BAGA 4XO6A 3E2SA 1C3FA 3W7MA 1SW7A 3TW7A 4A8IA 1RALA 4J1OA 5LZLA 1NM9A 3AMKA 4DJDA 1NQ6A 1BF6A 4MSSA 4GLEA 1K9TA 2TAAA 4B5XA 2NQHA 1BHGA 2E8YA 3BAIA 1PX3A 3CIVA 5C8BB 3ZVHB 1TMHA 4GZ7A 2V2DA 2VFGA 1UZ1A 2YL9A 3KHJA 4JTAA 1P0KA 2DIEA 2BY2A 4Q7NA 3BSMA 2PZNA 5DEZA 3SCRA 1R9YA 1LG1A 1B3YA 1JR1A 3THUA 1J11A 4GNKB 5HR6A 3HOJA 3GX9A 4JZ5A 4U2ZA 5F1UA 2Q6ZA 2V8ZA 3EXSA 4UOJA 2BMBA 2J7BA 3CH9A 1KW1A 2WXDM 4LVAA 5JH1A 4Y9MA 5C0QA 2JIEA 3S2MA 1F2JA 3WNLA 4R9XA 4B5VA 1OFQA 1R0MA 1VBHA 4WCJA 4C7DA 1YEYA 2VL4A 3KAOA 4N9EA 3AMGA 1XKJA 2C7FA 3C2RA 2BOFX 1TIMA 3BOFA 1YDYA 4OBTA 1Y5VA 3TVAA 1JULA 3W2UA 3QZEA 4JKMA 2Y1HA 4O54A 3MI2A 3RMEA 3VIPA 5F7UA 1V5XA 2VRKA 2PF8A 4M3PA 2WMIA 4Z0SA 4IUOA 2OZ8A 3THQA 3E3HA 4XUYA 4DF2A 1XGDA 3TQKA 4GZJA 4Z0JA 4PMUA 1EXPA 3D46A 4D8ZA 1RH9A 3PZIA 4BZYA 1Q2RA 5DXXA 4NYYA 3LM7A 3BURA 4P5UA 4PMYA 4S3AA 1MEIA 5C9ZA 2EF9A 2VCBA 3GH5A 2O7SA 3W6LA 4AZCB 1L6YA 1QATA 1DJXA 4BR1A 4DELA 1RA0A 3H2CA 3KP1A 4U33A 2XFWA 3QM3A 5D2VA 2PP1A 1AMKA 1ECQA 3KCJA 2AMXA 4Z1BA 4XZNX 3CWHA 1D7KA 5FAGA 3LPOA 1OB0A 1BVWA 3O0FA 2Z2UA 1JAEA 5EFDA 2YXXA 3MBFA 2GJXB 1K1DA 2XH7A 2PDGA 5FIPA 1V7YA 3TONA 3GC2A 4Z2JA 3AO0A 4JHMA 1SPQA 2SFPA 4NZ1A 3UWUA 3NXFA 3AJXA 4HHPA 1RCQA 4HK5A 2DSUA 3WQ8A 3BAXA 4GQBA 1G67A 3C56A 5DT5A 2G97A 4GI8A 4JTCA 5A94A 3W2NA 3D3AA 2JFEX 4GH3A 1EQPA 2JQXA 2QJIA 3CMGA 4KCUA 3W7PA 4L1WA 1ZCCA 4DQWA 3TQVA 3T4CA 3UT0A 1XI3A 1ZU8A 1YXCA 3STGA 1IXNA 3KRUA 2BDQA 1PKNA 3B9AA 3FXYA 2XYLA 2G4JA 3C2FA 4BFAA 2PU0A 2CLMA 4W7WA 1UOZA 4A3QA 2KZHA 3AALA 2DIJA 5FJPA 2FZDA 1V3JA 1X7IA 1WDPA 2OOGA 2V69A 1E6XM 3J7HA 4DRSA 3GR7A 3UYCA 4EE9A 5K9CA 4X3ZA 2I17A 4LNYA 3LUTA 2XDFA 3F7JA 3IAQA 2ZRUA 1QW7A 1WZMA 4NAFB 4ROPA 4B5SA 3AIRA 1ITUA 2E5BA 4XQ6A 3LHUA 4EX4A 1TQJA 1HP5A 1ITXA 1RBOB 3LCLA 1RK5A 2AKZA 1V6XA 4Q7BA 4H7VA 3VZYA 2E28A 2FGZA 1UIOA 3A21A 4JNMA 3CYJA 1KM3A 1XIGA 4H9ZA 2XFRA 5I6SA 1QNPA 2INFA 4GZEA 2DH3A 1W0MA 1EC7A 1XICA 2BX7A 1R87A 2PGRA 5F2IA 4MZ1A 4C6EA 4JX5A 2Z7KA 1FVPA 3MYOA 1OK6A 3E0WA 3GNPA 3PBYA 3CZKA 2OZTA 3WF0A 3BL3A 5HWJA 3UGRA 5HQLA 1UKOA 3HPFA 1R3QA 3SAZA 2EJ1A 2X2YA 3GVWA 4KWWA 4AD0A 3PF3A 1JZ2A 4GISA 1LOSA 3WKZA 4FNRA 3IRDA 4TO8A 1IEIA 1SZGA 3FA4A 2O9RA 1YQ2A 1O5KA 4LUSA 4LEFA 3C2VA 3OZOA 2AAAA 5CBBA 1OFRA 4IP5A 3LQGA 4M6VA 4OUIA 3THDA 4G9PA 4YPJA 4E4UA 3V0TA 3OTRA 3HQNA 1D8WA 4PCSA 3RIKA 4LEQA 2EXOA 3OA3A 4YYCA 1E71M 1W5QA 2VENA 4GY1A 3LNMA 3BLDA 1SMAA 3L5AA 1NELA 1OZQA 3AC0A 1FBAA 5LNWA 2VDHA 1S46A 3BGAA 3CUHA 4PUWA 3ZIZA 2HSAA 1PAMA 2HCVA 1XLMA 5BOEA 3W84A 3IWPA 1R2RA 4TXEA 4WKAA 1TX2A 1BKSA 3AFBA 2Y0FA 3QR0A 4EP8C 6ALDA 3R0DA 4MAZA 3A4JA 3MDUA 3WEMA 2WQDA 5HMFA 1DOSA 2E67A 2JKEA 1UOKA 3QEZA 3GY1A 4QSFA 1XGEA 2NVCA 4LC8A 4C1LA 1M7PA 3KCLA 3B0UX 1H62A 4YTSA 4UR8A 1E56A 2EKGA 2CZEA 1GZ1A 1CTNA 4K1GA 3H4WA 3MHGA 4TX6A 2QPSA 5B7YA 2PP3A 1IQ8A 4LVFA 1OG6A 2V3EA 1JAKA 1TX0A 2J74A 4TV6A 2V82A 3DFSA 3AXHA 3NZRA 3UXIA 2WSPA 4ZODA 1G6CA 3VD9A 4X63A 2HE5A 1VC4A 3KL0A 1K4GA 5DN1A 2P3ZA 4IL2A 3KTXA 3GIPA 2PDKA 4DX3A 5C71A 5IDZA 1VPYA 1PZ3A 3WDPP 3T4WA 2PTXA 4JFTA 3CL8A 1EZ2A 1DIEA 2WZEA 1XM3A 1D9EA 1V08A 2WMGA 4IFKB 3IK4A 3AMLA 3OIHA 3NO5A 1Z48A 4MKNA 4IP4A 3SR7A 4GABA 1JCLA 4ZQPA 3ITYA 4AX7A 5G1MA 4DB7A 1QW8A 4FIRA 1WAUA 2RHGA 2FTPA 1WDRA 1QTWA 4OOZA 5G2HA 1J93A 2ZDRA 2PC8A 5KTLA 1IEXA 1EEPA 4RV3A 1EJXC 4O19A 1WDSA 4XD5A 4C6LA 4D6IA 4ACZA 4MADA 3CYVA 4MUZA 1W9PA 4YXGA 4NJIA 5A6BD 3PUEA 3NWRA 3FGCA 1DKWA 1IGSA 3RM9A 2HJPA 4QEHA 4E2DA 4N6EA 1WZKA 1VR6A 1XYCA 2G50A 2PWUA 1PYMA 1T99A 5KMYA 1DXIA 2ZE3A 1QNOA 2PC4A 2TODA 1H7OA 1T6MA 3QYSA 2J9ZA 2AL2B 2D0FA 3SFKA 4H9TA 1E0TA 4LALA 2VP8A 1OQFA 2PDQA 4LGXA 4XZ9A 3DZ1A 4DBSA 1M01A 1J0YA 1OCBA 3GBEA 3GNDA 4WXYA 3IVTA 3MO4A 5FD0A 3ZOAA 3Q37A 1N8IA 2PMQA 3UPMA 3AMCA 4DJFC 1HL8A 4O52A 3HQPA 4H9XA 1BXCA 2BHYA 3CAKA 3ATYA 2OYMA 1ME8A 3DEQA 4PUNA 2FTYA 3T40A 2VGBA 3S9IA 5E09A 4M81A 1GPFA 1CLKA 3HFTA 4N42A 1WB0A 3OHMB 2RDWA 6REQB 3WJZA 3LBMA 4GD0A 4TVDA 3BV4A 1JZ4A 3FKKA 2ZRWA 2FGLA 1OX4B 2Y85A 3TAKA 3E49A 1H61A 3ZWSA 3VTRA 3VNZA 1OIMA 3WELA 3FN9A 2XVPA 2QQ6A 1R30A 4L9YA 2WVUA 3TC7A 3STEA 4FX6M 3W7GA 1PXGA 4L4OA 2A2IA 1OFBA 3USZA 9CGTA 3N73A 1EJRC 1FFQA 3E1F1 2DORA 4HMDA 3SGGA 4AIUA 3HF3A 2QJJA 4LV4A 1OJXA 5H8MA 3FYYA 3DUGA 3H23A 4Q3MA 1KBIA 2E9BA 1EL3A 1E0UA 4AC7C 1WUEA 3L68A 3GAKA 1OFOA 4QS5A 4AWTA 4INFA 3TAOA 5ABTA 1KKRA 4IGNA 1NDYA 4WJ8A 2R1NA 3FOKA 3HQ1A 1LCOA 1A49A 3AZRA 3BGGA 4J3UA 3HPXA 2Q01A 2I5QA 1B1YA 4Z2IA 1TO3A 1TA3A 3LGEA 5REQB 3W25A 2PWHA 3EMQA 1I45A 1IWPA 2XIMA 3SEPA 2CLEA 2UZ9A 3Q2DA 3SUVA 2DV0A 4ZE5A 5CAKA 1W3HA 1V3MA 2RJHA 4D71A 2DT0A 2Z27A 2JIWA 1EUAA 4PUMA 1JPMA 1E70M 3TUUA 1Q6OA 4P8VA 2CC0A 4EKJA 1XWYA 3WMLA 4GE8A 3MDWA 4AVFA 4EK7A 1DJNA 4HJWA 2OQHA 4ZSUA 4S3CA 3RGTA 2P88A 4N4PA 1J9YA 1W1VA 4W86A 1QNRA 3K1DA 5A6AA 1Y7VA 2PRMA 3VKAA 3QXBA 3IIZA 1XLAA 1HO1A 1KM5A 3NQ7A 4MPKA 2Y8VA 1EIXA 3CK5A 2GYIA 1VBUA 2BGSA 3ES7A 5E70A 6CGTA 5D2TA 2FB3A 3KFTA 1HXJA 2DEPA 3NQBA 3GNOA 1W1TA 4IX2A 2I1OA 1IZJA 4XKMA 4QSHA 5FL1A 4PMDA 2DW7A 1PWLA 2F9RA 2UY3A 1NDVA 4C6CA 4MNKA 4KPLA 1RD6A 1VLWA 3L4VA 1QNVA 4LS0A 3XISA 1E6QM 5LIXX 1RR2A 3AYTA 1BXBA 1KV8A 5AZ1A 1FTXA 3JU2A 2FZ9A 4JTDA 4NJHA 5CZSA 5CG0A 4RW5A 2IW0A 4XAYA 4ZE4A 2NXHA 1NARA 2PWDA 1G7UA 4NIRA 4LPCA 3U0HA 1S2AA 2NUYA 4IJBA 3VA8A 1E0VA 3CLWA 6TAAA 3IJ7A 3VGGA 1ZP3A 5FJJA 4O15A 2VRJA 3QSTA 1CGXA 3ARRA 4UXDA 2CLKA 4AEOA 3LV6A 3VIHA 1J12A 4B5UA 1MXGA 1P1XA 3BTNA 5A8OA 1YIXA 3NQFA 4MY8A 3QFWA 2GVYA 2QXWA 3SI9A 2NQLA 3DESA 4RR4A 2Y62A 4QQ3A 5EL1A 5C9UA 3LSBA 3QGAC 2QPUA 3WL0A 2GDUA 1O12A 5H2ZA 2OG9A 4D72A 4HBKA 1UKQA 8CGTA 4KQNA 3KEHA 1V7AA 4JOMA 3WUBA 4MWAB 1VD6A 4JIIX 3URAA 5A8QA 1S39A 4B15A 2XGBA 4LB3A 4F8XA 4WD0A 1EWDA 1UW9A 3WFLA 4MJMA 3TROA 3NTYA 1REQB 4HSNA 3R43A 2YXGA 2QCFA 4K38A 3VU2A 1TTIA 4IFOA 3EA2A 4IMEA 4XIMA 3ARTA 4QNEA 3L23A 2VUYA 1A3WA 2BY0A 1RQBA 2CEQA 1EJWC 2EEXA 3LTSA 5D8ZA 1TV8A 3C86A 1SR0A 1SW0A 3R58A 2OWCA 4CQDA 3GZAA 1KTCA 4NQ1A 1JUKA 2XN0A 2ZTJA 1WBJA 5I3JA 1G0CA 1B57A 4WOZA 4PMJA 2Y7EA 3BUVA 4JTHA 4PSPA 3PG8A 4D6DA 1QK0A 1E40A 4FNTA 3N12A 3FHAA 2FH6A 1MUWA 1JDFA 4MYXA 5D30A 1BVZA 5EPDA 5FACA 5AY7A 1JF5A 4FALA 1TG7A 1N82A 4R88A 4EAYA 1K8CA 4LQ1A 2A0NA 4GQGA 4DN1A 4WKFA 3NAVA 4LFYA 3H2NA 3KL5A 1PHWA 1FUYA 2GDVA 3NQVA 4I9JA 1DTNA 3IV3A 4DUOA 2V5CA 1ZPTA 1POKA 3H7RA 2QNEA 2J62A 3GU9A 3TR2A 1E1CA 1R3WA 2CKSA 1R3VA 2PEVA 1AJ2A 2AKMA 1XHGA 2GK1A 1Z42A 4JIRA 1EEXA 4JTUA 4GACA 4AG0A 1JD9A 1F76A 1S1RA 3B8DA 3ICJA 4LANA 1ZLPA 1W5OA 4IMAA 1A50A 2D0HA 4ZXOA 3M7WA 1LQ0A 4QROA 4UC5A 3WQFA 1F07A 3IGSA 4PL1A 2DZWA 3CHEA 5BWFA 2HMCA 3ZVIA 1RBAA 1J0IA 1JQXA 2A6NA 3H12A 5H6HA 1XS2A 2NUWA 3JW7A 3ZYZA 4F2UA 2HS8A 1TE6A 3WDRA 4GNJA 1X6LA 4JTIA 4EACA 4GUHA 5A95A 4H41A 2DZXA 4S3GA 4OT7A 3R0KA 3MU7A 1V02E 3LPPA 2J13A 4A22A 1JDAA 3MTWA 2ON3A 4AWEA 3KVLA 1TPEA 4UTUA 3KBNA 4GC4A 4KF1A 1SSDA 4WHBA 1KBKA 4FXRA 1EJUC 3ZXWA 1MW3A 1DVJA 3GG1A 3THCA 3UYIA 4DIAA 2XTKA 3RO6A 3V0UA 4DPQA 3GUGA 3CV7A 1QI2A 1VJSA 1LLZA 2ALDA 2VVSA 1KXVA 2QCCA 2QDDA 1AH0A 1IR2A 2FHFA 3ARVA 3C52A 3PTQA 1P7TA 1VFLA 2B4GA 3A4AA 3G1YA 1EYWA 3G24A 1YYAA 4C1NB 3BVJA 1QBAA 2G8ZA 1VHNA 2EPMX 3C0LA 3KCOA 4V1XA 3G1SA 3IV8A 4UNLA 5LNSA 3PANA 3H55A 2ZIDA 4NJKA 2QF8A 3K2GA 4RNFA 1FH7A 3UD6A 3LTPA 1PCKA 3R2GA 2PB1A 5FL0A 5LA0A 1LOLA 2QUMA 1K7EA 4I9MA 3C8NA 2BASA 1I1XA 4P8XA 4IPNB 1BG9A 2XVGA 4JIHA 4FXFA 2VQTA 4BK9A 1FWBC 4HTYA 4FNSA 2VCAA 1JJKA 3DFTA 5D8WA 3A5VA 1EDQA 4Q8WA 5T9CE 1X1OA 5DELA 1LUCB 1PS9A 3K5XA 2GSJA 3QF0A 3MB9A 4TQTA 2NSOA 1EJTC 3LG3A 1QVBA 5ABFB 1FWDC 3IIXA 3HB9A 3ARWA 3DERA 3B03A 1ZS2A 3LCGA 4I6VA 4JNYA 3S47A 2V81A 4GY7A 2OELA 3QFEA 3ZWTA 3VCRA 5HA7A 1GQLA 4PODA 1GQJA 5FF3A 1UIPA 3O6CA 5E0CA 3CHVA 4S39A 3VAVA 1UH3A 4P7QA 3NQMA 4XSLA 4ZXLA 4WX2A 2E8ZA 1QXLA 5CZKA 4XG1A 2J66A 4OV9A 3I6TA 1Q63A 4FOKA 1F5ZA 3ZLHA 1GVEA 2QDEA 2JE8A 4W4QA 4S38A 2XGZA 4R7OA 1CGVA 5DLCA 2E6FA 2OYKA 3EEGA 1K9EA 5EFFA 1RY8A 3BLLA 3FK4A 2BFGA 1UD4A 1F8IA 5CEWA 5LNVA 1UR8A 4EPBC 1MVYA 1KWKA 2XZ7A 3QYQA 2GJNA 4YYFA 2WSQA 3UWZA 4S3DA 3NURA 3VIFA 4LF2A 4J3WA 3BWWA 4Z08A 3B8SA 3TZNA 3FAXA 5FJTA 4LAOA 3DFPA 3PUDA 3TLLA 3UZZA 4MOZA 4YWSA 1FY6A 1JCMP 1FWSA 3MV11 2WC7A 2GDQA 1KFBA 1ME7A 2PUZA 3N29A 5KSWA 2WK2A 4MLRA 1UKSA 3G3DA 2ASHA 3PPFA 4GYKA 4FMVA 2Z1KA 2Z1XA 4AY7A 1XIIA 2PLJA 3EWCA 1LWHA 1H41A 1BKHA 2F6XA 1Q8JA 3LMYA 3BLKA 4MB4A 3MV01 5LIWX 1OD8A 3QZAA 2BWGA 3LPGA 3HFYA 4MB3A 2Z25A 4MWAE 3F4WA 2E5DA 5MF5A 1JCNA 1T8QA 3TYCA 4HKPA 4US6A 3M0VA 2NT0A 3DECA 2O4MA 2B7OA 2YW4A 3R12A 4ZTYA 1RUSA 3LDVA 4XWUA 2FLIA 1I2PA 4U5KA 3LRMA 4XK2A 3MY9A 2HK1A 3UXAA 1NWSA 2YA0A 3U2OA 3STCA 4Q4SA 3VOCA 3WNPA 1XIFA 3PUGA 4PB4A 4AU0A 3KBVA 4UTJA 4LX4A 2ACUA 2ZXDA 4LVDA 2Y7DA 5HNTA 3TXVA 4L6OA 3GH4A 3ARUA 3GB6A 1PX8A 3EOOA 2BODX 2VEMA 1FH8A 5DXYA 1FDJA 3SCQA 4D6GA 4CUCA 2QYGA 3REQA 1FRBA 1FWHC 4JYFA 4U5IA 1DBTA 3R8RA 2XZ9A 1DIDA 2QCNA 4ZZ9A 4IZGA 2G3FA 4F9DA 2HDJA 3KP0A 1LJYA 1V6WA 3KS5A 6PTDA 5LNRA 1EC8A 3BCJA 4J4KA 2J25A 3WZ0E 2IKGA 1EXBA 1XBZA 3IJ8A 1UC5A 3UR7A 1HKKA 4J35A 2O4QA 4GGHA 1N8FA 3VIOA 1LM1A 4FR6A 4YVXA 3B06A 1CB7B 3MUY1 2R1MA 2Q8LA 1GTEA 3O07A 5C6MA 1RJQA 2QCHA 4L4LA 1BRLB 3M5YA 3XIMA 1XJBA 3ONBA 4FXSA 3UWEA 4ADUA 1W32A 3A3HA 5BZAA 3T2OA 2JK2A 4LUJA 1H7PA 4I5RA 2XIOA 4XD4A 2OOFA 3HJZA 1V0MA 2ATSA 4QCFA 4FOJA 4XU