2FQQA

Crystal structure of human caspase-1 (cys285->ala, cys362->ala, cys364->ala, cys397->ala) in complex with 1-methyl-3-trifluoromethyl-1h-thieno[2,3-c]pyrazole-5-carboxylic acid (2-mercapto-ethyl)-amide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
b'EIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title A common allosteric site and mechanism in caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 147
sequence length 147
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqqA01
4FEAA 5IBRA 3PD0A 4PS1A 1JXQA 2H65A 5IAJA 4EHHA 2HBRA 3SIRA 2QL5A 2K7ZA 3KJQA 3QNWA 4JR2A 4FDLA 1K88A 4EHDA 4FGUA 1RWPA 4QUBA 3V4OA 3P4UA 4AWBA 1F9EA 3RJMA 3V3KA 3KJNA 5JFTA 3D6HA 2Y1LA 3D6FA 1RE1A 5IASA 1IBCA 2J31A 2WDPA 3DEHA 2CNKA 2CJXA 2J30A 2H5IA 3S70A 3H0EA 3R7SA 4AW9A 3DEJA 3GJQA 4I1RA 4IEFB 4JQZA 4QUIA 4NOMA 5IANA 3R5JA 2P2CA 3R7NA 5LU8A 1RWXA 2C2MA 2H48A 3NKFA 3PCXA 4NBLA 3V55A 4JQYA 1I4OA 5IC6A 2Y0BA 1SC1A 3R6LA 4PRYA 2FP3A 3SIPA 3UOAB 1CP3A 3H11B 4QUJA 5IBCA 4NOKA 4IYRA 1RWOA 2CNLA 5IAGA 1I4EB 5IABA 1NMEA 1SC3A 2QLJA 2HBQA 3E4CA 3EDQA 3NS7A 1NMQA 4EHKA 4QUDA 2QL9A 5LUBA 2H4YA 5IARA 4PRZA 4QU9A 3D6MA 2J33A 2XYGA 4D3ZA 2C1EA 4FXOA 5I9BA 5LU9A 3IBFA 2FQQA 3NR2A 1GFWA 4EHNA 1RHRA 4ZVUA 2CNOA 4HQ0A 3H1PA 4EHFA 4ZVTA 1CVRA 2QLBA 5LUAA 3R5KA 2CNNA 1KMCA 1SHJA 2H54A 2J32A 3H11A 3IBCA 2CDRA 4QUHA 3GJRA 4I1PA 1RWVA 4QU0A 2CJYA 1QX3A 3OD5A 1SHLA 1I3OA 2HBYA 1BMQA 4M9RA 1QTNA 4ZVSA 4AWAA 4QUAA 2H51A 4PS0A 4D3XA 4JR1A 4QU8A 1RHJA 4EHAA 3DEKA 4D3YA 5K20A 1NMSA 1RHMA 1RWKA 1RWNA 2HBZA 4HVAA 4ZVOA 2QL7A 4QTYA 4EJFA 1M72A 4JJ8A 4N7JA 3ITNA 1RHKA 3H13A 4N6OA 4HQRA 5H0IA 4JB8A 3V6MA 4QU5A 4NOJA 4NBKA 4QTXA 4DCOA 1I51A 2C2KA 2FUNB 5IAKA 4NBNA 1QDUA 2C2ZA 3UO8B 2NN3C 3DEIA 4N5DA 1F1JA 1RWMA 2XYHA 3GJTA 4QULA 4DCJA 4DCPA 4LSZA 1SC4A 1PYOA 2XZDA 3K7EA 4N7MA 4JJEA 4QUGA 3P45A 5IAEA 1K86A 2XZTA 1PAUA 3R6GA 4N6NA 2AR9A 2DKOA 2H5JA 2QLFA 3GJSA 4NOLA 5I9TA 3V6LA 4JJ7A 3R7BA 5IBPA 2C2OA 1RHUA 3KJFA 2H4WA 3EDRA 4N6GA 1NW9B 4ZVPA 3PD1A 4ZVRA 4EHLA 3S8EA 4QUEA 1GQFA 2XYPA 3V4LA 1RWWA 1RHQA 4ZVQA 5IC4A 3BIJA 4JR0A 1ICEA
chains in the Genus database with same CATH superfamily
1JSCA 3BA1A 3RSGA 4P3NA 5U1PA 4BNDB 5G4KB 4LV8B 3DAOA 4LGMA 5CUQA 1MKYA 4IW3B 4ZYTA 2RH9B 4KK4A 1C1XB 1Z12A 3F6SA 2GBPA 4DDHA 10MHA 3D31A 4QYXA 1DINA 1YNSA 3TBHA 3GCDA 1NQTA 3CKMA 5FDFA 3H2IA 5BSUA 3E3MA 1ULHA 3H17A 1R4ZA 3HN7A 3GVPA 3TF5A 1RAGA 3I9LA 4BMDA 5JXIA 3T7DA 4PGHA 3KJNA 5ECGC 2DQ4A 3LW8A 4LA4A 4AKEA 1U0LA 9LDBA 3ZLJA 4D9CA 4M7RA 1AK1A 1Z62A 2YHAA 4C0WA 4UTNA 5B7PA 2GX6A 4JQZA 2IITA 4D9GA 4AURA 3PFIA 2PX0A 5LU8A 2CLOB 4NBLA 1DX9A 3MWGA 2GBLA 2V6IA 2PX5A 5J2UA 3MM4A 2GBGA 4U4AA 2G6BA 3P27A 1Y5RA 4LQCA 4BE4A 3OCUA 3H11B 3CFYA 4WSOA 5FT9A 1IG0A 2FDCA 2AN5A 3BD8A 5EMKA 1J25A 1TW3A 4FIZA 2FMHA 1Z5GA 5ALGA 3WZLA 5FTMA 5COAA 3IQXA 3MWFA 2X58A 3I5MA 4XGRA 4QJBA 2P9FA 4EHKA 3UMSA 4CIBA 1P2BA 1FVXA 1Y81A 1C9KA 1MRZA 2POQX 3AP3A 4PXYA 1M6VB 3WB9A 5KKCA 3U4MA 1XPJA 1GPLA 1XD2A 5ALJA 5LD2C 5L7YA 1GJRA 4EB0A 5JMPA 3BE4A 5K8VA 3PD7A 4DJ5X 4K5QA 1EE2A 3LZ6A 4BO3A 4NS4A 1UINA 2JBWA 5EUBA 4LCJA 4ARCA 4R8SA 3LY7A 2PUDA 4Q3EA 5KTSA 5U9CA 3DC7A 4JHXA 5KVSA 2OB2A 1KMIY 1TMKA 4ESHA 1I10A 3ZHZA 5A4FS 5KCZA 4XAQA 4OHBA 5CX1B 4AZ3B 4OHXA 2I4NA 2QGFA 4PZZA 3TB6A 1X38A 1I7PA 1AF7A 1XTIA 3PXEA 5IT4A 2XQIA 3WXMA 4Y6SA 3RHFA 3PLAE 4Q6WA 1C5KA 2GK6A 5HIJA 4OQZA 5JH7F 3NBXX 1E79D 3C6QA 4IIFA 3SYTA 5IZCA 4RHUA 1XKQA 4C7VA 2PL9A 3EWAA 4RZQA 4CMGA 4Q9DA 1I2DA 2IXEA 3NC4A 4ENSA 1QFXA 2IHYA 1NMYA 3LFUA 4HDMB 4N8EA 2DBRA 2ZDHA 1RHKA 1Y4DE 2BKXA 5DIFA 4R7GA 1H3NA 3DKKA 4KIGA 4OBEA 4D4MA 1UXHA 3V8NA 2RG1A 3CBGA 1E9BA 2QRGA 4ARZA 1QOPB 1VYVA 3KKQA 2VLIA 4DA6A 3ESCA 3GFRA 5DZSA 2WD7A 4DSUA 2XYHA 3L0YA 4PV7A 4RGYA 3LCCA 5EQTA 1MAWA 3MJHA 2I4OA 2RKOA 1KRHA 2P3QA 4OJKA 3VAAA 4BFUA 3UAVA 4BVGA 1D9ZA 2IC5A 3SF8B 3H5NA 1SM4A 1IB0A 5K5EA 3JY6A 1EYZA 1GG8A 3P20A 3K71B 4DZRA 1FQKA 1OLUA 4N9QA 2RB5A 1MO5A 4M76B 4FNAA 1M2KA 4R3UC 4CM5A 4KB5A 2MSCB 4LZJA 1FP7A 1VRWA 1ZESA 2ZUTA 1K97A 4QPPA 3KSUA 4BX9A 4US1R 1JEQB 1IHXA 1M2WA 3D8TA 4KPUB 4MS1A 5KO2A 4KQFA 3TKAA 5DULA 1DIBA 4L75A 3MTIA 3R5HA 3AC0A 3P0HA 1C7QA 5ALPA 1UP6A 3AHIA 2QV0A 4M8NE 1QOQB 5GGYA 3N0VA 2H1RA 3UCFA 1B0ZA 3K15A 2ZR9A 2RGBA 3LY9A 4DW8A 3KDPA 4BQOA 3RTAA 1KAOA 3OWOA 1RI5A 3TEFA 2QG9A 3BGIA 3LY5A 4KXXA 5L6MB 4DR5B 3QV1A 1TW2A 4RA9A 1JBEA 1G8HA 1CDDA 1H2EA 3FPEA 3OQBA 3ST7A 3L7KA 4RF4A 2O0HA 3C7AA 2WHRA 2PYDA 2FP3A 5DDIP 4EUSA 2XVZA 2QVGA 3HP7A 4CL2A 1BHO1 2NUTB 4BP9A 4S1WA 5MHTA 3C3PA 1AQNA 4ZOEA 4FDAA 4BFYA 4DCGA 1GPUA 2MYTA 3L6EA 2HGSA 1JVNA 3RCBA 4BLTA 4E2WA 2OHOA 4OQ4A 2HA7A 2QT9A 5BP7A 4MGIR 3W05A 5GOTA 4X7BA 3TD6A 2COKA 2ZUCA 3QLVA 1SU7A 2WSYB 2AKEA 5J47A 1Q14A 4RPCA 3HVKA 1ZU5A 4LYEA 5I7OA 5HILA 3N0XA 1MVLA 1NFFA 4O1MA 1C29B 2HF9A 5AUQA 5T8KA 4BJ5A 3WB1A 3ZGXA 4MQBA 1EWKA 3ZGYA 4RFVA 3NU1A 5DN9A 1LX6A 1XLWA 2EV9A 2W6JA 3JQ9A 4J4BA 4RM2A 3T7TA 4X8MA 3W3AD 5C52B 4FZ5A 2Z1NA 4HEHA 2I1QA 3UATA 3H9QA 2JFFA 3EIQA 3O90A 4DA9A 2HWKA 4DPMA 4FD3A 2RIPA 1U9IA 1ISPA 3B5JA 4Q9HA 3VZBA 4WJLA 1HE2A 3PXAA 4A2PA 1K8QA 2VDQB 1AXEA 3GI1A 1MLDA 2LE0A 4U6QA 1JHOA 1AUOA 1DNPA 1L7AA 1ZDMA 2CWWA 2QVZX 2HCRA 4PZ0A 4DV3B 5M7EA 1HE3A 1FMFA 2GVDC 3L0BA 3KLPX 2QEQA 3H42B 3OCZA 1GPDG 1UXOA 1FFCA 2VP4A 1PKEA 2XCTB 2WSBA 4IGKA 3TRHA 3PR3A 2O2EA 1WNTA 3CF4A 4GO1A 4LDNA 2O2JA 4MCIA 1OBFO 3UYKA 1JTFA 1EVLA 5BXYA 3GG2A 1UPTA 4ZC8A 4DLBA 2X4LA 5G0WA 4F5DA 1V8FA 2CB9A 4JLWA 4PONA 2Q3BA 4CPDA 1KERA 3MQ2A 4DCPA 5C3MA 3W3AH 2FWRA 4HRAA 2W90A 1TJ3A 2RJOA 4RTOA 3CR8A 1O5OA 3U7JA 4BVAA 4ZYYA 5I7FA 1TJNA 5BXQC 5CD1A 2WKWA 4FFOA 3EXAA 4Q1BA 3VX3A 1QGED 2HDNB 3HJHA 5JU6A 3NMUF 1MENA 4KXUA 4ZQBA 1O94C 4N6GA 3JAMA 1Y33E 1LSJA 2DECA 1N5RA 1U8XX 2DTDA 1AQJA 4E11A 2HUPA 1A7JA 3AY0A 2SKDA 3DVSX 3V80A 4QG3A 1QYRA 3H5RA 3G9UA 3P9PA 4Y6QA 1OLXB 1J2RA 1VKNA 3AVQA 4WKBA 4CTKA 5LZ9A 4H6VA 4TT8A 4Y2RA 3PHIA 4X84A 1TVMA 2P90A 4BO4A 1QF7A 4RHEA 1NQUA 5C37A 1ONSA 2Q5OA 4BMSA 3ER9A 4NJMA 3H2JA 2AW5A 3FRIA 3SS7X 3C3CA 5IJ9A 2J6BA 1NP6A 3JATA 3LNTA 4LJYA 1PTKA 3GRZA 2Y1LA 2QP3A 1YB4A 3E3AA 1S8NA 2JLCA 1NA5A 2GNPA 1K1EA 1QH8B 2JIZD 1X7GA 3FNQA 2OQIA 4MZDA 3DXXA 3UM9A 3VM6A 3ZWWA 2IH4A 1SKAA 3OO1A 3Q7TA 3NDRA 4WBNF 1V6CA 1QRSA 2G1AA 3D6TB 1ORWA 2QTVA 2CJWB 3H4MA 4EBFA 3NASA 2B5VA 2W2XA 3H2ZA 4JQOA 1THGA 4B33A 4KR0A 4OXIA 2OTCA 4G0WA 3Q9NA 5E1MA 1W59A 1NMEA 3S7ZA 1L7RA 1BRTA 1NJ8A 4LBWA 1F8GA 2E4WA 3T15A 3DDNA 4X0EA 3ZW9A 1APBA 1OFIA 3KYCA 1M6HA 2FPSA 3F47A 4U7GA 2O7NA 1K5HA 3C1TA 3AUJB 1MA0A 4FMCF 3EZ2A 1JFVA 2DWOA 4D45A 4NNPA 2XNHA 2QRJA 3COPA 4M7PA 3UAZA 3ELWA 1RIIA 3H8VA 4KQCA 5AW6A 4MJXA 4JI8B 3RTGA 4CL3A 3IPLA 3WADA 1V16B 3RARA 4G4SO 1R12A 2VBCA 4URFA 3E22A 3S55A 1U98A 3GPIA 1SVIA 2VWPA 3QVXA 2BFFA 4Q1AA 3WP0A 3VR6D 1JDZA 1KEZA 1NW3A 3DMYA 4A36A 5CLIA 4E2ZA 5FV4A 2AXQA 3I5YA 1QLJA 4MZXA 3L40A 3IE1A 3HR4A 3FZNA 1CIPA 5ITZA 3A7EA 4ZCQA 5BV8A 1NVXQ 4MRNA 4RL4A 1L4NA 3CLTC 1G8SA 1GSHA 1RRPA 3AL2A 1FNNA 1II0A 3KYDA 3FUWA 3OA0A 1BMQA 1XZGA 2ZCVA 3R3ZA 3MWEA 4IIDA 3UMRA 3UT5B 3VX4A 3WK5A 1H5NA 1WCXA 2VTKA 2X86A 2O8BB 3QVUA 4C1BA 4HC4A 1JKXA 2NZ2A 1W0KA 3C2QA 5TGTA 4PLWA 4DUPA 1VE7A 4HWTA 2VZLA 3N5CA 1Q74A 4UARA 5JATA 3WKAA 2VRCD 2AFRA 2IELA 1WW2A 2JFXA 5ESRA 2PKCA 1NQOA 1DELA 2Q3MA 3HP1A 5LYJB 4GNRA 1Y3AA 3A05A 4NBKA 1JSXA 1U2GC 1XJQA 1YDHA 3GDGA 2H2HA 2MSKA 5EEGA 5A3JA 1C3XA 3HHEA 5EAIA 3KQLA 3DO5A 1UFQA 3ZJVA 1PR1A 1UQTA 3H7AA 4O4IF 3KQSA 1Z0UA 2VHZA 1OT5A 4K26A 1LC0A 3LAWA 1PJSA 1XELA 2GHRA 4X6YA 3HABA 1S0UA 1ILWA 1TA0A 4RHFA 5FWXA 1RPZA 4ZT7A 4QZVA 4CNQA 2IH2A 2FSVA 5DNCA 5JR3A 1UMDA 4CIDA 2IOFA 3FW1A 3P5BA 2TMKA 1IZ7A 4YMHA 3M4XA 2C3OA 2HPZA 2QE6A 1MW9X 2FW7A 3HKEA 4XQCA 4E0BA 3WYGA 5LQUA 1EQ2A 1V1RA 3EFEA 5TS3A 5K3FA 3VVCA 6REQB 1GTJ1 3PD0A 2X9QA 4ZOLF 2MOKA 1E3IA 1ONOA 4MW4A 4IGFA 4PPFA 5BR8B 2PBRA 2HLDD 2XX3A 5MFZA 2VJPA 1RADA 2QF7A 1IBSA 1BVUA 1EUDA 1I2MA 2EP7A 4E08A 3OCWA 3S2SA 4D9KA 1E2HA 5FWYA 1JKFA 4QDZA 4CNBA 4F4DA 5KZMB 1SKQA 1YVEI 3SLGA 3MJTA 5A7FA 4X1KA 2ZW9A 1A4XA 1U0GA 3W90A 5F73A 3D6HA 3ITKA 1TEVA 3JCZA 5B58C 2I7DA 4PLGA 2I9KA 4G85A 2OFFA 3V00A 5I48A 3SJCA 4YBZA 2C03A 4MPJA 3MWKA 1BD4A 3NDJA 4Z1OA 1S8OA 2WWTA 1CR1A 4O5OA 1UJ2A 4D7AA 3LQ1A 3CRZA 1RWBA 4B3MB 3ZBTA 4BCCA 4LYDA 1HG0A 4G25A 1O89A 3PT5A 4XYEA 4FEEA 1L5NA 3FOZA 4JJKA 3PVZA 1Z6PA 2IYOA 3GBVA 3AR3A 3EVDA 1NDUA 3ED1A 3PC8C 5I4IA 3ONWA 3ADPA 2HYIC 1HL7A 1QANA 1I4EB 3SZMA 1F6BA 5KJ6A 1Z4JA 4R16A 1BW9B 4IDAA 3WYCA 1SK8A 4QUDA 4AF7A 2HPHA 4KQ2A 3MHTA 4TTAA 3DMFA 1I5RA 2WIKA 2AFIA 3K05A 3HADA 3KL2A 1QQ6A 2ATEA 4I55B 2YWGA 3FVRA 3UENA 3V1KA 4E3WA 3WLFA 1UP7A 4W5HA 2A2ZA 3BQMB 2VO1A 1Z5NA 3OPQA 1LPSA 2P9EA 1OBVA 5DWDA 1KORA 3TTVA 4ANFA 1TYBE 5JCOC 2R1ZA 1RHRA 2GASA 3N8GA 1JDSA 4MRPA 3KQYA 5HF9A 4KVAA 3BSFA 2QUKA 1G4HA 1S5PA 1Y9JA 2GRJA 2IZ6A 3WE7A 4BC1A 3IUBA 1A95A 3DT8A 4CEIA 2JGDA 3FYSA 4LCEA 1XWWA 2BMEA 3TL2A 1LRLA 2C4VA 1S9HA 3PHHA 4EFLA 1QPGA 4PTZA 1MHPA 3ZCSA 4C7XA 5DM4A 1Q1AA 4D57A 3DV0B 2J4DA 2HU8A 4JT8A 5FEMA 1JL3A 1KPGA 2VNSA 1TA4A 4ZI7F 5ICCA 1AKUA 3NLLA 1O94A 3Q8WA 3ESXA 1UL1X 3NIWA 4MV4A 1FL9A 3ZXXA 2NXEA 4ALLA 4OH7A 1V43A 1ZFNA 2B4TO 1SCBA 4DG5A 2HU2A 2WP8J 2O2ZA 3FJ1A 2ZREA 3INRA 3LV8A 4IQ8A 1RHJA 2OV4A 3L8YA 3QQPA 3QM1A 2QS9A 4WZBA 3RFVA 1AU9A 5DK6A 2BEJA 5F7JA 2VDVE 3DFUA 2ORWA 3K5HA 1R88A 1ZOSA 3NC1C 2FETA 3L1JA 3QVWA 5KREA 4HT3B 5L95A 5M34A 2V8OA 1B4DA 1QBKC 2DQSA 2NZ8A 2QG4A 3CRW1 3EMKA 3N05A 3K0EA 4W5WA 4YT5A 5FO1A 4RZXA 4F21A 2JAHA 2FEMA 2Z5LA 4MI1A 1TCBA 1FA9A 2X1LA 3I9FA 1PLLA 1QB7A 2G06A 4B7CA 1DRJA 4BFVA 4EQ6B 2PRZA 1A2QA 2BEWB 2KBFA 3U1TA 1I7QB 3IEUA 2Q8PA 2CUZA 3SZOA 2XZTA 2VQ3A 1XRPA 3OJFA 1GGFA 2OB1A 1ISSA 3NP9A 4OP2A 2DMRA 4DCSA 4EO9A 1POXA 4YIHA 3VR5A 4YY3B 3D4BA 5FQNA 1E94E 2JD2A 3JASB 2YZ2A 3OF5A 2C2HA 4WXPA 4LTDA 2RD2A 2HYDA 3PEVA 4OSPA 1NYLA 1B6GA 1TO2E 4OXQA 3SM3A 4WH0A 1T8UA 221PA 2BGIA 1N8KA 1S8AA 3ZIAA 5AKEA 4Y6OA 5KVVA 1G38A 4YIKA 3FOCA 1PEKE 3I1FA 2GPYA 3I30X 3PXCX 3QKSB 3FFXA 2EBUA 4QYMA 3SX2A 5JAOA 4A15A 5P8WA 1UBGA 2QTTA 2CYCA 3RUEA 4QJ3A 1IY0A 3ZZ0A 1VJGA 2CLHB 2A9KA 4KDFA 3QBDA 5DYWA 1H8HD 4KOEC 4A8PA 3L8HA 1K6MA 3ZQJA 2IUEA 4FDLA 4IQ0A 3AHFA 3OECA 2BKAA 1Y8RB 1ZM9A 1DJQA 2OFPA 3RABA 4PYNA 5J2TA 1YQQA 5AMXA 4B79A 2C9MA 4EG7A 2O07A 2FEAA 1GLGA 4EI8A 7REQA 3OX1A 3B9BA 5JPDA 1ILEA 4L0QA 1SHUX 3WK8A 2XKKA 1DC3A 4EELA 4AS3A 2X7HA 3ZG6A 4WGFA 3BFXA 1O0SA 3ZU6A 2A5YB 1GADO 4L85A 4A4DA 4CTOA 2ZJ6A 3RVQA 5ABPA 3M82A 3PPIA 1P31A 3EB9A 1QFSA 5CCBA 2QN7A 1OH7A 3PRHA 3QJ5A 2QPOA 5HQ3A 4Q05A 4YYEA 4FN5A 4TX1A 4N0QA 3I23A 4BNUA 1RXWA 5EOVA 1A77A 5CTJA 5HQJA 4YP9A 1C2TA 1OFTA 1RI2A 3QPVA 4HWPA 4XD2A 3WIDA 4AJ2A 3AVOA 5EIAA 4XWOA 1XP8A 3GBPA 2RC5A 4PANA 1UM8A 4I9NA 5FNVA 4X00A 3VZQA 5BR4A 4D97A 1XQ1A 4MINA 1M5TA 1E2BA 1QO7A 2C42A 2FWPA 3FAZA 1EXMA 3F3KA 1P7WA 3ZE9A 4FMDB 2WHEA 3DLCA 3LKDA 3SXPA 4COKA 4KI7A 1CY0A 2BP7A 2YYAA 4FMPA 1P3JA 4NVRA 1TKAA 3W5VA 1WSAA 3U31A 2WU3A 3PWSA 3FTCA 3UCEA 3A9RA 1KI4A 3G8YA 3UKJA 1VLZA 4GQBA 1Z7YA 3MT8A 2AN1A 4FNMA 4R40A 3UXHA 4EKNB 4F56A 3LTEA 4ZI5A 4ZMRA 1BYIA 1DRKA 1LPMA 3CNLA 4AWAA 3BJZA 6GPBA 3D43A 1UPFA 3DOUA 2PH3A 4X9XA 2Q6VA 3TMKA 3E7PA 2RGGA 3AW8A 1IXSB 1SFRA 3HI6A 4WE3A 3VHLB 4OQEA 5A5GA 3T9AA 1EFTA 3O3OB 5BV0A 3S28A 3B1VA 3HFRA 1ECFA 3AI7A 2C04A 3O4JA 2WNHA 4HQKA 4KJXA 4QLAA 5BOSB 1SHKA 4P80A 4DJFC 1GNRA 1THZA 1NJSA 3SYNA 2VDWA 4BXOB 2QNRA 3D9QX 1LNQA 3MELA 1RBMA 2YFHA 3LLMA 4PW0A 1TOAA 3L93A 1GWNA 3B6ZA 1XQXA 5F35A 3TIVA 2VTVA 1SXJD 3I28A 1C4WA 1PKXA 2OL4A 1ZIYA 2PCLA 3V4SA 3EZ9A 3PEYA 5EJIA 2QW1A 3Q7RA 3GRPA 2AQ8A 2YWDA 4DQVA 3KQHA 1O6GA 3OLQA 4A91A 1S3SA 1IY9A 3KOWA 1G17A 2E49A 3A6PC 1GZ4A 3R5SA 1UPUA 3PC8A 2SKCA 4WA7A 2PMBA 5HKBA 2Q3EA 4HB2A 4DCNA 1PUJA 1PYDA 3KXIA 1Y6GA 2JCBA 4EMSA 1RHQA 3LUKA 1R8YA 1E2EA 4JR0A 1XLUA 4KUHA 3WK4A 4KREA 2I1WA 3JAWA 2E85A 4DUGA 1R1DA 3HKDB 3OLYA 1O4WA 2AOWA 4RZUA 2H00A 2OM2A 4QGHA 1TQHA 1KF0A 2IVZA 4QXQA 4DCUA 4JT2A 2PBLA 1BMDA 3RIGA 5JCOA 3WQQA 4G63A 5TLSA 1V6AA 2IU6A 4HADA 4UUOA 1J2YA 1T6YA 3OZWA 4I3HA 3KYIB 3AUAA 4HEJA 1EG2A 2ECQA 5EWMA 3KQWA 2ORED 4AROA 5I4KA 4M1TA 1UZNA 2GZMA 1TYAE 2WIGA 3LY8A 1PV2A 1WB4A 3DE0X 4MEBA 1JDVA 3N9IA 3VHQA 1GQYA 3T4XA 4EG5A 1EFPA 4FZ3A 4F9EA 4WHMA 3UGJA 5SZKB 2I62A 4J03A 4RFLA 1VE1A 4HY3A 3DKRA 4Z3KA 3MFQA 4H18A 5J58A 4Z4IA 2ONKA 1CZHA 3D8NA 5CB4F 2H9YA 4HDOB 3RU3A 1Y9DA 1HYQA 4IIVA 4JBGA 2B21A 3TSWA 1IBLB 4LF7B 4CV3A 4KNYA 2W11A 3VNUA 1U0SY 4KKXB 4B9AA 1TMOA 4XTCS 1WCIA 2AV6A 2C57A 3D0OA 4X8HA 3IOCA 2OSVA 1SOUA 2Y0CA 3DMDA 1MX5A 2FW9A 3AM5A 1U7XA 2R7NA 3C5WP 4ZTBA 3ZGOA 1L7PA 1CTQA 3QPUA 4IJ5A 3TLJA 2JGIA 4FLMA 1T24A 4FXOA 4LF4B 5G41A 2CYBA 1SQSA 3F1KA 3ZKWB 1I2ZA 2IYLD 3ZJ5A 2HO4A 3CNNA 4A8JC 4AICA 1UT5A 4EECA 1IRIA 1JHQA 3U9TA 4WNIA 4M9SA 3ROFA 3UFBA 4YCNA 2H1OA 2WZQA 3ZY3A 4QQFA 1SXJB 16PKA 1BCRA 1TTPB 2OLEA 2ZBGA 3M1YA 4XX1A 1O7JA 2QY9A 2ZYHA 4KQ6A 4TXHA 4YCBA 1X1EA 3FCAA 5YASA 3NTOA 3C4JA 3G3EA 2VH2A 4KXQA 4M1KA 3GAAA 3JZFA 2QZJA 2YHIA 5TT1A 1Z4LA 1WE2A 3LO5A 1TCUA 2QT1A 5LOVB 1GGHA 3GJRA 1OTXA 3GGOA 4ZZ1A 4NRDA 3EVEA 4OREX 3FFTA 1X1CA 4R2JA 4WAUA 3EG5A 1Z73A 3RIMA 3WC4A 1E58A 1OIWA 2GLTA 1DC6A 5LQMA 3R09A 1M7GA 1NVDA 2EL9A 5AJTA 2VAVA 5E7IA 5L8VA 2O0KA 1KS9A 2AHRA 5C4MA 3SHTA 1N2IA 3AEQB 2P77A 4ZFNA 1V1JA 2BGLA 3P0FA 1Q1NA 4OFWA 3M5WA 1KL7A 4O2BA 4COOA 4W7SA 5CFLA 2GZHA 2NPOA 5A3QA 1GFSA 1KAQA 1Z4IA 3KKNA 3I4CA 3K8YA 2DE0X 5E6RA 3L6BA 2WD8A 3R9IA 4US2R 1DEXA 3G23A 4UVDA 5JT1A 1K8ZB 3AUFA 3PK0A 1X1SA 3HC7A 3A28A 1EBUA 1W4ZA 4K9QA 4PO3X 4YJ2F 4Y30A 1YJ8A 4EY8A 2IYEA 3R9XA 4QO7A 4RMHA 2W6CX 2XQFA 3ASYA 4ABTA 4M2LA 3O7WA 2JKVA 1QO9A 4QNRA 3H0CA 2GWHA 3GLFB 2X3UA 3G17A 1Z3IX 4LYYA 1XMJA 3JZMA 3A9UA 1JLSA 2M6RA 4MW5A 4BLRA 5BQ3A 5ILOA 2CLDX 2QQ0A 2J6HA 4ARBA 4F7DA 4K2AA 4R7TA 1ANKA 3K53A 2FMTA 1YS7A 2XQGA 2ADOA 3L6RA 5DKFA 5L4LA 2XAAA 4DADA 5A4MS 3PVCA 3JALA 3IAS1 4TLBA 2FZWA 5LBTA 3A9SA 4ZYZA 1VRVA 2W37A 5LP6B 2GO7A 4C0KA 2Q28A 3FYHA 2OESA 3JQDA 5EZ5A 1OOEA 1FSPA 1PNVA 2VJCA 3GP3A 2RGRA 3M5CA 2C7GA 3TLGB 3TR6A 2KWIA 3NXKA 4GYKA 3LBFA 1C8KA 3AEUB 3S5UA 2FEXA 1D1QA 1N4DA 1PJ3A 3SR0A 4EY7A 1KAGA 1UCFA 2B1RA 3QEBZ 3E5HA 1NJ1A 3D3QA 3HNRA 4PCVA 4A23A 4TYNA 2QI9F 3FETA 4EUKA 3N2LA 4MULA 1AV6A 1XZJA 3C6XA 1SKUA 3LYAA 5JDIA 1XMIA 2HTFA 4ERXA 3KSDO 4I50B 4M99A 1X80B 1EJ2A 1XF1A 2AFVA 1JQBA 1NL3A 3MBKA 2DFDA 4RKYA 3F5DA 1HQDA 1XNRB 1KFEB 4B5LA 1DKOA 1XXLA 4BNJA 3RBAA 3GP5A 4D4GA 3PDUA 2ZCUA 5C1BA 3FZEA 3GLGB 1WKBA 4BFWA 1FTYA 1MNQA 3LUFA 5A05A 2A0XA 1YE5A 1YZKA 4R41A 2PY6A 5TQJA 1KS2A 4XASA 1LW7A 3OIWA 2A57A 1SEVA 3GLHA 2Z4TA 5EC8A 1WP9A 2LRHA 3WIEA 4L4SA 3ZDBA 1BMFA 3CNHA 4YDQA 4FK8A 5LMZA 4UXIA 2JF0A 2DHRA 4ZU3A 4TYYA 1PR2A 2GCPA 2DUMA 1N6OA 3DG9A 1EZ1A 4DXHA 2AJCA 3QFTA 2PWBA 3EFOA 1OFGA 4MMYB 4Y9SA 3AESA 5JZMA 1LVGA 1OVMA 2BHRA 2W70A 4B32A 4HSEA 4ZKDA 1LXCA 3E84A 2QJRA 2Z2YA 2Z4SA 1P4JA 3ZHXA 3X0DA 4BNWA 2QVBA 4X20A 1GRCA 3W5HA 721PA 2CV2A 4I0WB 1YCHA 2V45A 4RVSA 1T1SA 3L6CA 2AZ4A 1GCGA 4RPGA 1MC5A 3HCRA 2ZJZA 3H18A 3QYAA 2DR2A 4BBAA 3CNOA 1S2IA 3VR3A 5IN4A 4O4JB 2ILTA 2WD9A 4NIMA 4MV6A 4YO8A 2GZ3A 2I4RA 3AX6A 1A7KA 1XMSA 3ND6A 3VBCA 3OEWA 2CXXA 2CVQA 4G8DA 3B12A 5KOJA 1B16A 2V7PA 4G0MA 3V6MA 3RFCA 1X92A 3JWJA 1F1BA 4I3GA 3JQ7A 1IU9A 3WGIA 2JLZA 5I01A 1QTIA 1EP3B 1H66A 4MPRA 4RGQA 3FKSA 3W6ZA 1X1TA 2CVZA 1JNYA 2Z8ZA 3AFGA 3ESZA 3JQEA 4UNQA 1G3MA 1QHXA 2GEBA 2Q6TA 1RKXA 4V0LA 5IAEA 4X24A 1UBCA 4YMSA 1E6WA 4TZKA 3PUJA 2WSLA 4YV0A 1VMIA 1GEGA 1ECPA 4TT3D 5C8XA 4J90A 4LF5B 2JJMA 3IT1A 4TXLA 3EIOA 4MRMB 3G0DA 3ROMA 1PL8A 3EPKA 1FSFA 3QU4A 3DHYA 3OLWA 4Q24A 5IC4A 1XAGA 2IU3A 4L50A 1GG5A 2VNAA 3GJ4A 4OKIA 4XCXA 3U0VA 2FZEA 4WJKB 5T57A 5AK4A 2YTZA 3FSGA 3DO8A 3FMFA 3ECSA 2RBKA 1OXXK 2OCIA 2NOAA 5UKDA 4OK6A 3DEFA 4A8JA 5K8IA 4N5NA 2C5LA 3DKVA 4UTPA 2QAJA 1TGVA 2R86A 3IODA 3W8FA 3RDPA 4W9RA 1ZVJA 5JEDA 3FNFA 2XZLA 3QIVA 1PDOA 3EARA 4G89A 1LVUA 1QK4A 1MXHA 4LG1A 2PXHA 4UCXA 1Q95A 5DTMA 3LFTA 3TINA 5I7SA 4PR3A 2X7XA 3M9LA 2PT5A 4L8VA 3F2IA 1O0CA 2QXUA 4B75A 4RPJA 2OCLA 3H0EA 3JWIA 5KYUB 2N75A 4A5SA 1MB3A 1ETHA 3ASUA 2KLBA 3WB2A 1M0SA 3KLMX 2A4MA 3PYXA 5E0OA 5DF1A 2JVJA 4ASUA 4OQMA 5JPCA 2EARA 4Q02A 5FR2A 1KOGA 4P7FA 2R8YA 1N2JA 4MYTA 1YR6A 4YHBA 3ZQ4A 4EDFA 2FWBA 1SIUA 5K01A 2H7VA 2WFAA 8ATCA 4MUNA 4P33A 1Z0DA 2I4TA 3R24A 2XB4A 2YV2A 2HGZA 2BSAA 4AJJA 2O3RA 2SKEA 2YH2A 2ZBQA 1Q15A 2WILA 1CYDA 2IYNA 3MOSA 2J5BA 1P5HA 4M0FA 2EL7A 1RC8A 3STHA 2XNCA 5CK5A 5EY5B 1HUQA 1T1JA 3VR4H 1A5SB 2CDAA 3LJKA 1L8QA 4PIMA 1X9GA 1R6VA 4X93A 1PF7E 4JBYA 1UIMA 4UVIA 1ZKMA 1UJCA 2B0JA 2VHEA 4Z0PA 3CB2A 3GEHA 2PLFA 2YY6A 3GQVA 1XJWA 2G9RA 2QD2A 3PYLA 4R7ZA 5AVRA 3CPSA 5B4TA 5GADl 4ND1A 5ITWA 3VYWA 1P1FA 3FRJA 4UMDA 5T41A 4IKEA 4LJ4A 3R7AA 3VTZA 1I4WA 3NAZA 2YDYA 4O5AA 1JF8A 4QVKA 5KWJA 3W2IA 5CBPA 1DVRA 1Y6JA 1GYQA 1UANA 2H52A 3HR7A 3N7AA 1L5MA 1YVDA 2C4HA 2R44A 1Z5VA 3CX7A 3FFBA 5FLYA 3SDBA 1MORA 5KOYA 4M49A 2PBFA 4DZZA 2DT8A 1NVAA 5GWXA 2Z2XA 4I66A 3TRDA 5C1IA 5JNSA 4NU5A 1VOTA 1CRWG 2RBEA 1D1SA 3HNPA 5I47A 1SVUA 3QX3A 5AKJA 3ES9A 3L1UA 2I6QA 3O2NA 5CDHA 5JMWA 3QBTA 4LQ4A 2EOAA 2GI4A 1X14A 5AK0A 2NU7A 1W36D 2BFCA 2JK1A 4LK3A 4XFJA 3PQ4A 4MV5A 4GPEA 1KJIA 3LLVA 3VO8A 3DS8A 3GUYA 4R9NA 1VP9A 5IWAB 1XZAA 2XNDA 4ZN6A 3TW8B 2FGKA 1XTBA 1WXGA 2VK2A 3EPLA 2DB3A 3FUXA 3C1AA 1J1ZA 1EVIA 4FFSA 1RFGE 2CL6X 2BL4A 5A0VA 1OGYA 2B4AA 2EBFX 3LP8A 5TSDA 3EDMA 1U9ZA 4WOCA 1G5TA 1GPKA 1Z6TA 2G1KA 2YYZA 1DFIA 4QREA 3WWYA 1XT6A 4HPJB 4B4KA 4D9MA 2PANA 1OZFA 1PTJC 5AVJA 2CY0A 3QW4B 1CVIA 1YI8A 1AKEA 3B51X 3ZBPA 3VMFA 2RBGA 2WHPA 4AQ7A 2R1TB 3AY3A 3ZCQA 4A5OA 3J80A 1G8PA 1W88B 1WSWA 4ZO4A 3K6SA 1FS6A 1KP2A 1RLOA 5CK4A 4HLUC 3SIRA 3ANTA 2HX1A 3G2NA 1FTWA 5DH9A 4H31A 2RGWA 4CLDA 3D6AA 1JIKA 2FMKA 2PRSA 4OB8A 4B3JA 4AYTA 4AX8A 4AWBA 5H3HA 3WYDA 1FS5A 3H7IA 1K9VF 1NG9A 1Y4AE 2FW0A 3FZYA 5EZYB 1H0KA 1VP3A 4N40A 3LHKA 2HCBA 2MU1A 1CYEA 2M98A 3O4FA 3G9TA 1XNQB 3B1YA 4R31A 2P9BA 5IANA 3PXUA 1K68A 1W94A 4KLZA 3ZVLA 1V7QA 1UK8A 1RM0A 3BXHA 1N2GA 3IP1A 4KX5A 5CJJA 3FF1A 4ZYXA 1Q7TA 4HGOA 5BSRA 3IQZA 3PIIA 2LWIA 2G80A 1NVVR 1LDMA 3KR2A 1R10A 5G1PA 1WHTA 4AUMA 5JEEA 2Y0EA 4I4CA 5TEVA 3QW2A 4A26A 1KJNA 4MGHA 1XZBA 4QAQA 4F93B 4WZAB 3RS5A 1MMFB 1DBPA 1YBVA 3CRNA 5AM5A 2PZKA 4LSWA 3VBEA 1T3TA 3FDFA 3O8LA 5FQOA 2CD7A 5B7NA 2G9UA 2NU9A 3AIKA 5JRZA 2IE0A 3EGWA 3DBHB 3NDIA 1VPLA 1OYVA 1C1DB 3IIIA 5THKA 4B44A 2NO4A 5ARBA 1OLOA 5E4TA 4TZ0A 1KK2A 1WO8A 1FJGB 2GB4A 4CKZA 1KDVA 1KOJA 1C0EA 5IH3A 1K3TA 3LSYA 2FZVA 4FKBA 4OJNA 4Q9AA 2AFHB 4YQYA 4WINA 2X6TA 4RQBA 4H35A 1IPFA 4L5BA 1INLA 3KT8A 1P18A 1T9ZA 2H5LA 4G67A 4NCIA 4UU7A 3WY9A 1O97D 4EZEA 1OTHA 2MMGA 3E27A 2IWHA 4B7XA 5L3SA 4C20A 2H0AA 4GBGA 2CJYA 4NFHA 4QU0A 4Z8YA 3AVVA 2VF7A 3VO1A 3ANSA 1IDOA 2OFOA 1BFUA 1PGNA 4CM3A 2GPSA 3DZCA 4AY4A 2WFLB 2HF2A 1DJLA 3N7UA 1IZ0A 3JR3A 1Q7CA 3K92A 2IUFA 5JXGA 3ZDDA 1XCBA 3T61A 2PT7A 1HPLA 1SUCA 2WR8A 4KKVA 3PP8A 4PXSA 1Z6QA 3TOCA 4CEJB 3CRQA 3KWLA 1UDAA 2YIMA 1L4BA 3VGPA 3ZCUA 5D3MB 3PNBA 4D02A 4EZBA 2FLVA 2Y9PB 3QTTA 3VRHA 3I6IA 5C7OO 5CG1A 2QJFA 1QH0A 1XNJA 2C7VA 1AD2A 2PKXA 3VH3A 3ZXSA 4AP9A 4OQLA 1VXRA 1N57A 3RGGA 1ZC3A 4B3HA 5BV7A 5CDGA 3B9RA 3COJA 4PZAA 3OIYA 2ZLBA 3LNCA 2O19A 1YACA 3W5AA 4KIWA 3SZ3A 3Q40A 2ZRJA 1RZUA 4RE6A 1G7CA 5DP2A 3MRSA 3OICA 4IDOA 4FYPA 1M2GA 2ZAOA 1NLUA 1TF2A 3DMGA 4JEUA 3TOZA 2NUPB 4GZLA 1H1LB 2YV5A 1D0SA 2ZKLA 4FC7A 2PS3A 1YCDA 2A8YA 2GKSA 5IT9A 2BSXA 4DYVA 4QNMA 4LIPD 1XTKA 4GT1A 4EDHA 1ZRHA 3I1JA 2AUTA 2P6MA 1HC7A 1W1UA 2OZLA 1KDRA 1U31A 4X1IA 3W1WA 4RIEA 4X6LA 3EGDB 3HXMA 1YJAA 2ZJ5A 4O2BF 3A4MA 3DL2A 5ALUA 1KY2A 1EK0A 4EPWA 2BGTA 1WZCA 3C15C 2XB8A 1BGXT 2OKGA 1RWPA 1Z2CA 2WM8A 2Y6VA 3B78A 1L5GB 3FR8A 3KU4A 5AI8A 3KZVA 2XA2A 5AOAA 1WVIA 3A1CA 2PT9A 1CIJA 1V8PA 4ZD6A 2HMAA 1XCPA 4G56A 3RKUA 2JLSA 4AMYA 5HEKA 4OM7A 1PJCA 5K2MA 5CNJA 5CA0B 5IEJA 1L7BA 3N0WA 1AKNA 3RB8A 4K6GA 2Q1SA 5FR1A 5IJ0A 4DC1A 3WRYC 4FNGA 5C2JB 4ZO8A 3BQNB 1WMBA 5ILQA 3WSVA 4HB0A 2AZDA 1ULSA 1CP3A 1YULA 4QUJA 3QUQA 3AHGA 5DE3A 5L45A 3GLIA 4LJRA 3OFND 3T3EA 3VKUA 1CRPA 1E3QA 2PS9A 9GPBA 5IBQA 3FVTA 5A1TA 1V8OA 5DNWA 3V4LA 3V7FA 1SCKA 2R87A 3ENQA 2PU5A 3DHWC 4A1FA 3RQIA 2ZJFA 5CXUA 3PB3A 4HEA6 1U8AA 3V1YA 1FRFS 5LU9A 3DEZA 5E2IA 3DWEX 1FIUA 3MINA 3UOWA 4JBNA 3TE6A 4LQDA 5KPDA 3NH9A 2HRBA 4P1ZA 2HEIA 4U7PB 4CMIA 3UVEA 2QSZA 4BQPA 1KFCB 1CQJB 1FU8A 4JB3A 1SOAA 3FHLA 4JYBA 1CEEA 2AB0A 2XIQA 2Z1DA 1EK6A 4Z7QB 4XQGA 1ZJ5A 1ATZA 2X5NA 1JI0A 1UFKA 2ZJ4A 4W5RA 2PNFA 5CRIA 4JGGA 1NJ6A 1W47A 4D0GA 2A5LA 4KLCA 5MFPA 5I7HA 4Z2AA 1NXWA 4FN4A 5BMVF 2GN0A 5JLJA 3J81A 1BFKA 1AUPA 1JEEA 3R41A 4N0DA 5CDSA 1V47A 3HGMA 2O5VA 1H22A 1P1KA 4TKUB 1ZJWA 1QP7A 4A9AA 4CLOB 4DCCA 1FNMA 1PHRA 2CVOA 3NGXA 2F1JA 4UUMA 2HMTA 2AG6A 3D7MA 3UWDA 1PFYA 1QTRA 1USWA 2YVUA 3H8WA 1Z22A 1M0TA 1L6IA 2FPIA 2FRVA 3A10A 3HM2A 4YACA 1CF2O 1KO4A 5LQSA 2GN8A 3CIOA 1ZWLA 2P3LA 1IJFA 2YBDA 3AU9A 3ICCA 1SMKA 3LYHA 4FFDA 4IJMA 2JGLA 1K6EA 3DV2A 4LBZA 4OKNA 5T4EA 3RF6A 5JJKA 3ZK8A 1QDUA 1RXYA 1W19A 4MHSA 1H9AA 1RWMA 4DCJA 3KHKA 4DNFA 1HTWA 1U0BB 2IV7A 3ZWVA 1QE5A 3EBOA 3OP1A 1AQ6A 3QXXA 5IFKA 1KEKA 4U5QA 2P4EA 3GJ7A 5I9TA 5FTWA 1LDYA 3L1KA 4Z4CA 4CT5A 2ZAYA 3MIIA 2HEGA 2ZG6A 2WIJA 4YVFA 4EX6A 3SMQA 3W8RA 4MW0A 1DFHA 2X1HA 3G2PA 4LY3A 3MYRA 1IUNA 4GSYA 1CLUA 3E05A 2XD9A 3FBGA 4C08A 3T3NA 4C6HA 1TU0A 1GDTA 3MRXA 4JYPA 4WOPA 1YRHA 3QF4B 2NVBA 1P73A 3NKLA 3G6WA 5L3ZA 3UOGA 4BZZA 2GESA 4CLEA 1FUIA 1JR6A 1CLEA 3HG7A 4L2IA 2AN9A 4LE2A 3VU9A 3KLOA 2X22A 4FHFA 2HIAA 1QV6A 1DQRA 1EX1A 2F62A 4XWGA 1RW4A 1KOLA 1L4FA 1W48A 2XB6A 4B7AA 1VM6A 2EXXA 1LU9A 1K66A 3F5SA 3GJQA 3BIFA 1OLSA 4M98A 4BEBA 1E1RD 1DKUA 1IHYA 2FP4A 4N82A 3P9ZA 2O8EA 4TMTA 4DWVA 1OI4A 1QHFA 2XMRA 2GNOA 2P30A 3AGPA 3JQGB 4ZOQI 1MC1A 5BSMA 5HFAA 2PUBA 2BMWA 2V7BA 2ZSDA 3IS3A 4C03A 1M83A 1GNPA 3MG9A 1IN5A 4DR4B 1Y63A 2BCEA 3OPYI 1QYVA 2VH5R 2GCEA 3MWDA 2AHOA 4RY8A 5E7MA 1F38A 1U5CA 1KAEA 2JZOA 1Z13A 3BJIC 4N1AA 4OBBA 2QW0X 4UATA 5E3IA 4OXXA 3SQMA 4M3NA 2EU8A 4OL9A 4JC8A 4AMUA 2C7RA 3A1UA 2R8RA 3A6JA 3G5TA 1RMQA 4HPWA 5FYDA 5CDUA 3VNRA 3LKVA 4DR7B 3UJNA 4WCDA 1E3MA 2HA3A 5I9BA 1TJYA 1P0FA 2RIRA 2YHBA 3M3HA 2FW1A 3LX4A 4LJAA 4YBRA 1DAPA 2FFHA 2JFHA 2DR3A 2PD4A 2QAGB 3OIUA 1G291 1PFUA 2ASVA 5DISB 621PA 5IKOA 1RLJA 1SUDA 1WXDA 2R5FA 4V0MA 1YVUA 4O2AF 2XRMA 4OF4A 1W0JD 4OMDA 3OJEA 4BU0A 1BDMA 1E89A 1X8LA 3OE5A 2GJSA 4IV8A 4DABA 2DJ5A 2KHZA 1HV8A 1UEXC 3C7CB 4HAIA 4UMVA 5TPWA 1CHDA 1Y6QA 2Z2KA 5DPMA 4F2GA 5K99A 3ER8A 3RS3A 3L7CA 4KLAA 3F96A 4RTNA 2PHZA 3Q7QA 1IZZA 2XUOA 2QB5A 2EZ4A 3LQ4A 3WX0A 2GCOB 3DO6A 3MCUA 5CTAA 1E7WA 2EYQA 3UB2A 3VNSA 1HOTA 1P9RA 1S2DA 2CHEA 1BG6A 1L5YA 2SCUA 4JR1A 4A73A 4AF8A 3D3EA 4Y9TA 1RS0A 4Q3BA 3DCIA 1SPBS 4D99A 2UVDA 2VSXA 3IP6A 4J3NA 4DB2A 5ER9A 2E82A 3LZCA 1YZYA 3RT1A 4ME6A 2GJAA 1YMUA 2DX7A 4LN1A 4BUCA 5A2QA 2XHZA 3TIGA 1V9CA 2AYYA 2A78A 2QBYA 5E7JA 4OQDA 1DO8A 3QX7A 4CFZA 1XHEA 4FR0A 4PXAA 3MRVA 2CFIA 4IXTA 4YJHA 1ODLA 2LPMA 2VJYA 3H75A 2FPWA 5DVZA 4MV9A 5HNKA 3CJQA 3GRKA 3OEHD 1WR8A 1ECCA 3TLKA 1T1RA 3WRYA 1UJMA 4YUVA 1NNUA 3CEAA 2MJLA 3ORHA 2MSEB 1GCAA 4AJPA 2NUAA 4DA7A 2EKLA 5EVCA 3FCEA 3HCAA 4CIAA 2H4WA 3CUEF 4EEKA 4IHJA 3C85A 4D9EA 1GQFA 4MWCA 3U7QA 2X2FA 1R50A 3JD3A 3R77A 3ETJA 1N7GA 1NLFA 1DUSA 3MMPA 3VAYA 2YJNA 5K4GA 1AKRA 2F3TA 3D0KA 3DZGA 4IG4A 4JMLA 4QRIA 1O8BA 5JH7B 1SKYB 3E5RA 3V8RA 4EO7A 4HKTA 1ESZA 3O4VA 1E4OA 1RD4A 4HK4A 5JMTA 3M1LA 4RD4A 4QJ5A 4L22A 1MFPA 1LPOA 3HPRA 4GOND 4DTIA 3DVRX 1NRJB 3A9VA 1DG1G 3LCUA 4LXYA 5CX4A 2G71A 1YD7A 5FBZA 4XQ9A 3DEHA 4J4HA 2UKDA 3L8CA 5BQ5A 2QX6A 2VR1A 4H15A 3KZXA 5AW5A 2D5IA 2Z1MA 1KPIA 1Y5NA 1XVVA 3AUXA 5JAZA 3I0MA 3OZXA 4AKTA 4B8ZA 5GONB 2XDQB 3E58A 3GJXC 1D8TA 1LV8A 4CCYB 2VTBB 2GNAA 3GDHA 3RTDA 1MEJA 3C39A 3PV0A 3FPAA 1QMGA 2QQFA 4X7RA 2ZJ8A 4AIRA 1BXRB 1E2QA 5CH3A 5LP6A 1IZ9A 1HI9A 3K0SA 3R0JA 2VZEA 4RVFA 3CMCO 5M5BA 1T3SA 2CLSA 3IJRA 4WK2B 1AQLA 1KVQA 2P5UA 3S6JA 2WI8A 2BR4A 4N7RA 4WADA 5KUTA 1N3BA 1QR2A 2HLHA 5EP2A 3GMSA 4K9MA 3NDBB 3GZ4A 1RZVA 1A9QA 3AJDA 1N1GA 4WLVA 1SG0A 5CFPA 4RYLA 3FDJA 4NI5A 4ERNA 5AW2A 2RJNA 1J99A 1AHNA 3GOHA 3CZCA 4Q4HA 3TM4A 4H1WA 2IZ1A 3HY6A 2DFVA 4KH0A 1E6MA 1Q6YA 2JFWA 2CZQA 5JCZA 1TVEA 2CNBA 4HGQA 3RBZA 4A0SA 2G5TA 4D5GA 2BT4A 5KSOA 1LQUA 1O6BA 1UDRA 3HZHA 5DK4A 2FSFA 2UVPB 2HREA 2UYYA 2UUPA 4XVHA 2NU8B 3UC9A 1Y8QB 1YO6A 2B2NA 1E2UA 4WPGA 1LTHR 2R62A 2Q7DA 2V98A 2ERYA 2GCIA 2NAPA 1KK0A 4TXNA 1RSZA 4B7UA 4YRDA 1ZD8A 3UFXA 4CM9A 1E2DA 4MUFA 4YAUA 4R83A 2PMDA 4FX5A 1HORA 4R2WA 4OM8A 3G8CA 1T5HX 2OUIA 3I2KA 4I8IA 2PIAA 1TVKB 4CKEB 3WR5A 1W0CA 1QC5B 1QJ4A 3A14A 4TS3A 1D09A 1XWFA 2GVNA 2HD4A 1EWVA 4QE3A 4RLFA 3T41A 5JNVA 3ADKA 1RQNA 1YBMA 3HFGA 2OHIA 5D5PA 4CL8A 3U7HB 5TQ0A 1V1MA 2H9IA 5DTQA 5KNLA 3QF7A 2C2ZA 3AZPA 4HX5A 1JNXX 2IHBA 2YYYA 3H5WA 2RGUA 3HU2A 1ZRNA 3EXIA 3BF8A 5A4JA 1FFYA 1C1YA 1XU7A 2NO1A 4AAYA 1JJBA 1SPXA 4IUCS 3PXXA 5K51A 4CCAA 1JSLA 4Q3OA 1AHIA 5HFJA 4RJIA 1MB0A 2B35A 3I6BA 3NHWA 3WK7A 3HY4A 1NW9B 3WLRA 4YR7A 4YMWA 2G8NA 3DBRA 1FDOA 2GEDA 3B2QA 4A3SA 2GS9A 1B41A 3BZWA 1NJFA 2GBCA 1QRDA 4L5YA 3GCWA 4FCWA 4P3PA 4BO9A 5FO0A 2IU0A 1C30A 1LRJA 1SCAA 5K45A 1KY4A 4ZMBA 4PLFA 4JASB 1LBIA 5HQTA 1QU2A 4L5CA 1DIAA 2O23A 4J0HA 4KDRA 1OWLA 2C0PA 2ZUBA 3CLUD 2L0XA 4ID9A 5LZ7A 1IONA 4K05A 5ALHA 3RW9A 3VI3B 3I8OA 4CIYA 2PGOA 4XB1A 1CT9A 2QMHA 3BGDA 4EFKA 5KI6A 5AHKA 4XQ0A 2WWWA 5CYGA 1TM4E 1R0LA 4EL5A 2DP4E 4MUAA 2AIRA 2EHDA 1Z88A 1C4KA 2H48A 1O57A 1KYIA 2P11A 1P0MA 3PWZA 3BK1A 4JLKA 4QGBA 5AIAA 5C0OE 1UZAA 4D8UA 4F5ZA 1QFYA 2PZLA 3IPYA 3U56A 4EQZA 1GPMA 4KR3A 1RYZA 1R0KA 1FE8A 1GDDA 2BBTA 2HPVA 2FFBA 3ORQA 1QYCA 1SC3A 1A9XB 4LRQA 3OIFA 1PQYA 3AQIA 4G5RA 2Q4EA 3A7DA 1NUAA 2WPDA 3BWDD 1EFRD 2C2YA 4TS9A 5EQFA 4NZPA 1FSGA 2DULA 7ADHA 3MS2A 5BORA 1QGYA 1L3BA 2ODWA 2BRUC 3HLYA 3NCTA 3O94A 4GQAA 1EEHA 3QOFA 2GAOA 2QPLA 2Q2WA 3SX4A 4M0DA 4N8DA 4R3WA 1ODSA 1E9AA 3LKZA 4LWOA 5D51S 3H6GA 3RSOA 3ZPXA 3TW4A 4ZVTA 1BKSB 4F4FA 3FI0A 4UHCA 3N2GB 5EUCA 1U7HA 1UBJS 1Q3KA 3AFIA 4XM2A 2WIBA 3HZOA 1C0KA 4KC0A 1PR9A 1XK6A 3LP5A 4TVKA 3RM3A 3TGLA 1ZUNA 5HE9A 5A4DA 3FJYA 3KAPA 3QU9A 1OWOA 2GT1A 1PP4A 3QG5A 5D3QA 1I3OA 2BDUA 2V96A 4FGJA 1COWD 3T7IA 4WBNB 4PVDA 3FTFA 4MV0A 3AV3A 1H2WA 1YRLA 3M3PA 2A94A 3PWTA 2C31A 1E2LA 3P2OA 5EWLA 4GOLD 3JZDA 1MJGM 3UHOA 1X3LA 4H7FA 4BZWA 4YQFA 2WJAA 3M6MD 3SXUA 1ODFA 3GHYA 3KOXA 4Z86A 3Q88A 3PE4A 1K6XA 4BVBA 1S2GA 3W5CA 1GAEO 1J5XA 1KQ3A 1S2OA 3H1TA 1CQZA 3G0HA 1G3IA 3CLRD 3MNFA 1NVKA 4ZEOA 3NJ8A 4FMCB 5BSFA 1OZHA 3CVOA 1G20E 2P9JA 2FX3A 1ZAYA 2XBUA 4ZIRA 4ZRMA 2CSXA 2D1YA 1TM1E 1Y89A 3EEBA 4ARUA 1JU4A 3JYQA 2AKAB 3K96A 5L7TA 1RZRA 3HDJA 4OLAA 3R6GA 1BWPA 3EA4A 5A0TA 4U5XA 3GNSA 3M33A 5DYNA 3E1GA 3TNJA 3FUTA 2P2LA 2QJTA 2IY8A 1ZKDA 1YCFA 2VXBA 3WJAA 3OQMA 4NAUA 1V9LA 5M3BA 1OAKA 1FLNA 3AJEA 2PDAA 2ZDQA 1NI4B 1YB5A 1SH7A 1SRRA 5K6AC 2VHYA 1EP2B 4DSZA 3AR9A 1KP9A 4WIAA 2V1UA 4PNHA 4UUQA 2BFDB 4A0FA 4YP0A 1ISJA 3RSCA 4B76A 2G9ZA 1NQAO 5BYBA 4G01B 5EIHA 4EKGA 3AR5A 1SCQA 4O29A 1QGAA 2IHKA 5IF3A 5JSZB 1AO0A 3R3XA 1CZUA 3VAZA 3IL2A 3OJXA 3K1ZA 1EH5A 4WESA 1E5XA 4GP7A 3UXEA 4DG9A 4ED9A 4DHWA 1ABBA 5L4NA 4B4VA 4OG2A 1T1EA 2J85A 3N6VA 4UFOA 1R16A 1XO1A 3VU3A 4O4IB 1NJGA 1EUYA 3WGYA 3OC0A 4RORA 4ZA2A 3QE9Y 1BHJA 1DKPA 3QUSA 4MV1A 3N76A 1GXSB 4D9JA 3E81A 3WYFA 2GN1A 2REBA 2JBHA 4I9GA 4YAKA 5A0FA 5L53A 2R11A 2I7TA 3FZGA 1VBMA 2OORA 3QVVA 4MR9A 2E4AA 1AGYA 5HX7A 3TAUA 2RHOA 2ZJ0A 2HHLA 5IARA 3Q0EA 2FR8C 3LWDA 2VCYA 2VSNA 2C1EA 3AT1A 4QO8A 3W2EA 5JXJA 4R4JA 2FOLA 3NBAA 4ZOLB 4LV6A 4TRRA 1FLAA 1GU0A 2K7FA 3U61B 5CT5A 1W30A 4TYMA 4MGYR 4DYDA 4AUEA 2CNOA 3FTDA 1H2ZA 2FFRA 3CH6A 5D87A 2GJKA 1LK7A 2Q07A 3R7FA 5KSWB 1PFWA 2P3SA 4CHGA 1GGNA 1PZMA 3OWXA 1PDVA 3RU7A 4Z51A 4HX9A 4Q1DA 3CB4A 2PG3A 5EJ8A 3MUOA 4B71A 1LY1A 5CR9A 2WWVD 4DIFA 3V48A 2FVYA 2G40A 2NZVG 3BJRA 1NSYA 2M1XA 4FILA 4GPZA 4A16A 1KGSA 4E51A 1NPTO 3KZCA 5GTDA 4C2TA 4DFDA 5JNWA 2Q27A 5AO9A 1HTTA 1LS6A 1Q57A 3BIXA 1ULZA 2OO7A 3LDAA 2F3UA 1RWKA 3R3WA 2C1ZA 4HO1X 2GJ8A 4QTUB 4DDVA 5KJFA 2P9QA 5KPJA 4ZTZB 3LK7A 2W4QA 3AP1A 5EQJB 4QTYA 1VIMA 4FB4A 3UMVA 3ZWBA 2ZRPA 1JAIA 4N7JA 1M6WA 5LKRA 3VDNB 3AJAA 3C3YA 2CBXA 2A35A 3WK6A 1I51A 3PHLA 2I55A 1D2AA 1DRUA 2QRLA 5ERYA 1VJRA 3CN7A 2GF0A 1U2ZA 4YMUA 3L43A 1CE8A 1CZLA 2BBWA 4KXLA 4NNOA 4XDYA 2A5DA 3T1HB 4AY2A 4FFBB 2ZE6A 3R9KA 1JPUA 1DQSA 2LXNA 4HUJA 3SQOA 2D1TA 4P7KA 3AVUA 4HN4B 2AOVA 3CF2A 2VEOA 1XZEA 4JJZA 3VSEA 5EHGA 2ZPAA 5BRNA 4JJ7A 2AF4C 1F2UA 2IEZA 3KUCA 1PT5A 3N8NA 1EA7A 3FCCA 4HJXA 4OHOA 4ZI7B 1O03A 2H92A 3P0IA 3ZY5A 3RU9A 4NXMB 4M9CA 2J3LA 4PQFA 2CCKA 2R5NA 2R1VA 2V0NA 2VL7A 4KTTE 5P21A 1H2FA 1ZA1A 1I30A 3W9BA 1UFRA 4CQNA 4P3XA 1Z9BA 4MMZB 1D2CA 1MT0A 2H29A 2XAUA 5ADUS 3DTNA 3ONFA 4XJVA 1Y3DE 1QHEA 2ABWA 3QPBA 3WWZA 4JP3A 2JAXA 4CZ2A 2MSNA 4GXRA 1YSCA 3HUEA 1JPNA 2HF7A 3QOWA 2J0UB 5ETJA 5FPSA 1XD2B 3QVSA 1OH5A 1DAOA 5E95A 1FFXA 3LT0A 1NUTA 1WMSA 3A4TA 3LPMA 5IU6A 3O4RA 3G2LA 4HRYA 1CJSA 1NBAA 2D3WA 2H1HA 4PZYA 4ZCIA 4L9WA 3F6CA 1Z7GA 1Q20A 2KI5A 1CRZA 3BBLA 2JJ2A 4LNUA 1J8VA 1QYWA 3FFWA 4N5IX 2IDMA 1URPA 2W6IA 3TZEA 3KJGA 1II9A 2X23A 3O31A 3QEMB 4MAAA 3PGJA 2HSEA 2J6IA 3I9V6 2CGEA 3BMNB 1ZJZA 2IRWA 3ELYA 1VHQA 3SZLA 2HQRA 5JVDF 3RU2A 3GH3A 2O57A 1ADCA 1Q0UA 4KXFB 4X63A 4KFUA 2IYFA 3KCQA 4YJFA 1YR3A 1N7JA 3GLRA 4FT2A 4NESA 5DXAA 4ENVA 4CEHA 3DAHA 4YLEA 5AIBA 2H3EA 2Y4NA 3CRRA 1PS0A 1J97A 3NDPA 4REQA 5CM2Z 5FHQA 1YKGA 1WTCA 5REQA 1R66A 3WLAA 1F9AA 1OYWA 3EUEA 2R8PA 3LX8A 3VUEA 4BAGA 1F3OA 4DZTA 4E70A 3S81A 1KA9H 2C84A 2JEYA 2JI8A 4YRLA 5HGJA 5HTKA 4Y2YA 3O3NB 1DIGA 1FP1D 5IVIA 1E61A 4OI2A 1E18A 3HMKA 1KARA 1I32A 1QGZA 1X7WA 4UM8B 4UW9A 3TQIA 4ECEA 3G5LA 4ARZB 3E6AA 1UFVA 4BB6A 4EGQA 2WD7B 1WBJB 3HDVA 3QYJA 3WDLA 1L6RA 4BC0A 2CD9A 3QA9A 3VC7A 2W6JD 3LBAA 4G07A 1FMLA 2B7CA 1EGAA 1ZU4A 1DEOA 1C8VB 2DFLA 1FX0A 1TM5E 3GFOA 4MHOA 4HWRA 2Q99A 3A6FA 4O0LA 1DX4A 2VSYA 3V1TC 3E4DA 3LA8A 4GOKA 4GUDA 4C4YA 5K6AA 3UW3A 3M9XA 3LLSA 4TL7A 1YASA 3R3HA 4EVSA 4ZVOA 2NO0A 4X62B 5AUOB 2N46A 4BVEA 5J5VA 4MS1B 3I83A 3N28A 4EW1A 5EIOA 5KWEA 2EGGA 1JT2A 5TXGA 4JB8A 4F8EA 5BNFA 5BPFA 1WQ4A 2JCGA 3OIDA 5I5EA 3HCDA 1QP8A 2WZDA 3EHEA 4ZWNA 1PJ8A 1NOJA 1ZN8A 4IMRA 4Q6BA 1SEPA 4Y3UA 3A3OA 2GA9A 4MP3A 4QLBA 2IIPA 5LMUB 5FWDA 1K7XB 2JH8A 4KAXA 2AD1A 2QM3A 1T8SA 2YQ5A 3EC2A 4PLHA 5GP1A 1O1YA 1GA1A 1U04A 3TIIA 1YR1A 3E8MA 2IXFA 3GCGA 1U0NA 1OIXA 4UC0A 4BMCA 5A5FA 3A6GA 2HO5A 3NTVA 4Y1RA 4CG0A 4TLCA 3ZY6A 3L7YA 4IZHA 1MIOA 4H0CA 3HM9A 2FUG6 1IEVA 1Z07A 2HT6A 3DL7A 3NYQA 1FSZA 5CVEA 4W5TA 1HFWA 1R0YA 4UAGA 3SBEA 1XF9A 2QTRA 1CPYA 1QZTA 4QOGA 1XGKA 4LC0A 2EATA 3A4LA 4EI7A 3MXTA 3M49A 4ND3A 4RH0A 4O4LA 4F85A 2PKEA 1MH1A 3RYIA 5HRCA 4PX9A 2N42A 2WUGA 4TWZA 2ONYA 4CKBA 5FJJA 2QX9A 3AERA 5CB8A 1MB2A 4J0KA 2CVPA 4PYMA 1SNYA 2GHTA 3DONA 2WB4A 3NQ41 4CR8A 5JV5A 4WLUA 1CSEE 1P0PA 2BF7A 3E70C 3VNAA 3AVTA 3H2BA 5FUVA 4G0UA 1RXUA 1ZH4A 3VSCA 3L46A 2PSFA 2B5OA 2PX6A 1QVZA 1P7PA 3MQ4A 2CLIB 3TD9A 2BTQA 1K8RA 4F3TA 4Q1EA 2XLCA 2CHQA 4WFIA 4DXAA 4ZJYA 4HDSA 2IE8A 4HZUA 3RC3A 1GA4A 3L8ZA 3TNLA 3V4PB 4PQEA 3D6JA 1Y1RA 4JJ4A 4JI1B 4FFWA 1PWYE 1WSBA 4YUWA 3EFBA 3HEAA 4INZA 1XTJA 1KVSA 1XXHA 1GSOA 1ZK1A 2BOVA 2WWHA 3D8UA 3AI1A 1UC8A 5HHTA 2ZJ2A 1Y5LA 2IEIA 1JBKA 2BFOA 3I58A 4ZZ2A 3VA7A 1OJ7A 2ZXUA 4YK7A 4I2VA 2JI9A 5KNBH 5EE9A 1QV7A 2P4QA 2R68A 1L5OA 3A32A 3BFPA 4RETA 1JSZA 1LPPA 1GKLA 3FWKA 4G5OA 3QUBA 4X97A 5D1NA 2FQQA 4ZT3A 2W4IA 2WQZA 3B7WA 4BNNA 1QIDA 1QO0D 3GZNA 1FYXA 4GRDA 2ZBRA 4GVXA 1DS6A 1U2SA 3CUYA 4GSLA 4E5YA 3IT2A 5KVCA 4TWBA 4AZ0B 5KWVA 3DSRA 1JAZA 3OLXA 5B12A 2C5FA 1TQDA 2Q5FA 2WM9B 3NIDB 2NSJA 1K4YA 1YS1X 4B87A 1KYVA 5F77A 1G6OA 3ZZTA 4ZARA 5K0NA 2R0QC 3DNFA 1FMJA 3LU1A 3VKWA 3ETGA 3T7CA 5ALFA 3SQNA 1NXVA 2ZT6A 1AY0A 3L5KA 3WG9A 4DMGA 2C92A 4DILA 2C54A 5JSHA 1IRXA 1D0VA 2J45A 2AG1A 3ZIDA 5E3JA 4RK7A 2O3QA 2W2LA 5H02A 1F6WA 1UBSB 1ZNWA 2I03A 3G85A 1QH1B 4YYZA 4FT4A 1Y8CA 3VPGA 4PG6A 1ZZEA 4NYJQ 4R5MA 3UMFA 3PX7A 2V3WA 3M5PA 1GU7A 1LS1A 1GVHA 1W0KD 2F1RA 2W2QA 4OYRA 3MN1A 3G2IA 5DB4A 3L7DA 1SUIA 5DWQA 4IJVA 3O26A 1X70A 3JQ8B 1RZ3A 1J56A 3PL1A 1MQ8B 5HKAA 3NNNA 3P96A 2RGAA 1BA3A 1ZIDA 1JEYA 2CDBA 4ND8B 1Q83A 2NQ8A 2UVQA 4ZPXA 5AOVA 4ZQFA 1DE0A 4LZLA 1NVTA 5G0UA 4BBPA 4XRRA 4X90A 4JC0A 2HV8A 4NARA 4E5KA 1E4EA 3K72B 5JPIA 3J81k 4TZ6A 3GFTA 2O8DA 3W7BA 2RGXA 3AVPA 2VPXA 3CEHA 1M75A 1NVFA 5D8DA 2XE7A 3WICA 1VJCA 1ZN9A 4LRXA 5ED0A 3JARB 2YZGA 4F45A 4JP2A 1CCWA 4CODB 2X4GA 1TTHA 1RM5A 3Q72A 3SNKA 4H3VA 2DHEA 4DAEA 2YXLA 1QWSA 1KZGB 5IDXA 2Z2ZA 3FIJA 5EHQA 4DIDA 5AXBA 5JZ9A 2ECOA 4I4TA 3SHVA 1HH4A 1H69A 3EC7A 4EJSC 1H0SA 4V38A 5FULA 4TTTS 3HA3A 2Z5VA 2V54A 2YXNA 1M1ZA 2XMCA 4MW9A 1R00A 1RRMA 1NSFA 4FINA 1FNBA 4INAA 3EAGA 4ND7A 1VHLA 1O5IA 2J30A 4ITUA 1MEEA 4B85A 4G81A 3NT4A 1EP1B 1R5BA 1T5SA 5HDQA 5TS2A 1PR4A 1TAGA 4F1KA 4Q4CA 3E22B 1I3LA 3LUCA 4YJ2B 3CLSD 2WDZA 3D7SA 2UUBB 3I92A 3REOA 2VP5A 1Q1ZA 3JQ6A 2FPUA 4IO0A 1G20A 2PE5A 4R1PA 4RHYA 1X8JA 1UXIA 4L73A 4I1OA 2NT4A 3DDOA 1WP4A 3U44A 1DADA 2D7CA 2XTAA 3FROA 5BYJA 4OB7A 2HJRA 3KE8A 2NVWA 2GR9A 3LQRA 1NMQA 3NBUA 1KE1A 2BM9A 3K2EA 3KYDB 5LWQA 1XRJA 1OB2A 3MWEB 2V6GA 1OZAA 1Q0PA 2CDNA 1Y34E 2IFTA 2Q21A 4GPTA 4I36A 5IUJC 4OFBA 3GN2A 3FMIA 4BN5A 4YV1A 1U5AA 1AXRA 3VZCA 2XQKA 1ZNZA 5DI3A 1E6KA 4LISA 8ABPA 2JLRA 2BY4A 1UPCA 1CZRA 4KQWA 3RHSA 3WK9A 1FFWA 1EB8A 1JVSA 3Q7SA 1PGQA 4W7IA 4MVJF 1EJBA 4RTRA 3N2KA 2IEDA 2Q3JA 5CFQA 5LUAA 3EN0A 4XSHA 7GPBA 2BE9A 3E8SA 5DNEA 4WMLA 3PXBA 4EPVA 1DKNA 1A9OA 4QASA 3FDIA 4JEIA 3L4EA 2RGNC 3BM5A 3BE5A 3LCVB 4OMCA 3R20A 4LVOA 2FQXA 1QX3A 4YRCA 4C3ZA 2KW5A 5K6RA 4HGPA 2QRPA 4YALA 2H11A 4B4OA 1FNCA 5CAEB 1DAHA 1O94D 1UMDB 2B3DA 1SY7A 1ZLYA 1VZ2A 4ATNA 1L1RA 4N0PA 3OHMA 4HATA 3NFRA 3IKJA 3O8RA 3HKEB 3IIMA 1J7KA 1YJCA 3OM0A 4JLVA 1T0HB 4FJ1A 2ZJ7A 3IR5A 3H9JA 5I9SA 1PZHA 1YB1A 3BG5A 4KPFC 4K87A 1OX6A 3JRNA 3SLKA 5BVHA 5E2AA 1I3KA 2IHTA 3K4PA 1GKUB 1Q16A 3DBLA 4X7PA 1EUDB 1HYHA 2AZMA 3PX2A 3Q9LA 3K0AB 3QKTA 4HBZA 3FGNA 5FWYB 1TT5B 2HRDA 2L19A 1SHZA 1VJTA 2EERA 1ZJ4A 1UWVA 3RAGA 1GTRA 2Y3IA 4X1KB 2OO5C 1SUSA 1UKZA 1U8YA 2OMEA 2NXCA 2QDKA 2RDMA 3DCNA 3EIFA 3I73A 2K87A 3KHUA 2B2XA 2A0WA 3AEKA 3NHJA 5LQKA 2OO3A 3CE9A 4OBWA 1J8DA 2YFYA 2HC9A 3UYLA 1C7FA 2HFKA 3VNBA 2GYWA 2B25A 4OGWA 1T1GA 4UHDA 3OOHA 4M9UA 3C7KA 3T5GA 2O2DA 4GSKA 3MWLA 3VR5D 2QTLA 5CEJA 1KI6A 2IDJA 3A11A 2VJQA 1Y9EA 4YJDA 1DRVA 1HDOA 3JVDA 4NE2A 3ZIAD 2QN8A 2XTJA 3CUSA 3IFSA 4XEUA 4Q01A 4EVQA 1NGSA 1G60A 2ZETA 1G2OA 3ORRA 3OQNA 2VYND 4GOJA 1OFUA 2AFIB 4CDRA 3K09A 1LSUA 3DPSA 4BMYA 1T5BA 2A14A 1Y1LA 2GUGA 4E1AA 2IPOA 4WN9B 4XI9A 4YP1A 4YDHB 3S99A 1WF6A 2ZM5A 1NE2A 2J6CA 3F78A 4DQUA 1D7AA 4AY3A 2RONA 4Z9BA 4LUCA 4DM3A 5DGXA 4CEIB 2XGSA 2JGDB 2WSSD 3OTWA 3WLMA 4QBGB 4BN4A 2A9OA 1PNTA 3R9WA 4JQYA 5K0ZA 2B69A 1IZYA 1UWLA 5B57C 3QEJA 1I6KA 2CXTA 1KEWA 2IODA 4UKDA 2XQVA 2F3RA 1KI8A 1SK9A 3GEPA 1HDZA 3C97A 3CLTD 4R9SA 4MRSA 3OQ6A 2YY7A 1XC7A 2WTBA 3DVAA 4N12A 4P98A 4WZZA 5FP0A 4JJ6A 5CFOA 4U2BA 4FTWA 3COSA 4YLYA 3OPYB 4QUKA 4KP7A 1VKHA 2VPWA 4ZJPA 1RJEA 4YRTA 3IEMA 3S1AA 4JSTA 4HUTA 5A71A 2QTGA 5BW4A 1G0NA 4WZBB 4BCDA 2HJGA 3GGSA 4F6RA 1SXQA 3GZTB 3I2IA 3TZHA 2D4AA 3HA2A 5KYKA 1PEYA 1WB5A 2D1SA 4PYQA 2ZIAA 3AYZB 2TYSB 3HUDA 2UYOA 4YJ3F 2VTEA 3U19A 4E6EA 3ECAA 3LDHA 3MA0A 5T4BA 2QLBA 2VJBA 1XVTA 2GZ2A 4MQMA 3A6EA 5LCXA 4WOJA 3TTSA 5BW5A 5JW6A 2H4FA 2QW8A 1AMUA 1H1DA 1L4KA 3T35A 4YJGB 3PQEA 5H80A 5JECA 2JVIA 4FMBB 4KPGA 1IK4A 1HGXA 3HYRA 5HF5A 4YTEA 5DN6D 3C3JA 1T5OA 1ZONA 4KBFA 1G2PA 2FE4A 4FDTA 1ORIA 3RFFA 4AJLA 3ZW8A 4EHIA 4YV7A 3G79A 4M1ZA 2H4XA 3S0JA 4RPKA 4F86A 4ZQEA 2P35A 5BQPA 5K20A 2E3JA 2J4CA 5AJWA 4KYIB 1HL3A 1OILA 1UF9A 3TIXB 3UG7A 4CIVA 1G7RA 1XV5A 5A4AA 1YR7A 1JLLA 1E69A 3O9MA 2J9GA 4ARSA 3C6YA 4JJ8A 3FTEA 1C3EA 3AFHA 4A6EA 4DYHA 4EJSA 1YMVA 3UK0A 1PJRA 5AKZA 1K8YB 4YUZA 1UBLS 3L1HA 3TEMA 2YYSA 1J1IA 4V02A 1XZLA 4A8TA 3IUPA 3FHTA 2ONCA 5FPQA 3O91A 3SP1A 1ZL0A 2Y1OA 2IBMA 4Q16A 4PX3A 1UKAA 2R6GA 3DT6A 5E4FA 2X0DA 2AE2A 3F6BX 4IXWA 2XB9A 4NMMA 4D92A 3R0QA 1D4OA 3U3ZA 3U3RA 3MLEA 4C7BA 2A6PA 1GL9B 1JVBA 2OECA 3DFZA 1Z35A 1KIMA 2YVLA 1AX9A 1ZWKA 3B5IA 3ILVA 4D4LA 1UKBA 4QPZA 3AM1A 1E3JA 1JGTA 1OV6A 2VEDA 2XVAA 1MOPA 2C07A 3JTMA 1DSSG 1R37A 1VJ1A 1WBBA 4QELA 3L7NA 2NU6B 4RKQA 2B5WA 3ZZUA 2C7BA 3Q5DA 3FWPA 3SR4A 5JJBA 3H4VA 2R6R1 3TR5A 1SVOA 3HB7A 4Z9YA 2X8LA 5FPYA 4AXBA 1B8OA 2HLPA 2GTIA 4NC9A 2CVHA 2FRDC 1KXJA 1E9VA 2EJUA 3ZV7A 4BGIA 2VAWA 5JS6A 4TKZA 2Y77A 4BNIA 3BB3A 5G53C 5IKPA 4GMKA 2IDZA 4I1IA 4UUAA 1XD8A 4TV8A 2Z83A 4QUBA 3STUA 1SIWA 4RC9A 4WXYB 5DTJA 1W76A 4WN3A 2V74B 2YFKA 1EDEA 2VQ6A 3ZXUB 1LSSA 1JG3A 1ZM3A 2Z9BA 3HJRA 3PDHA 4EP1A 5EXEA 1ZMOA 2ZIXA 4LSMA 4D9IA 2QR3A 1SBNE 1D0IA 4L0MA 5IFLA 1M7HA 4ER5A 3CR3C 4IHAA 3TW6A 2CXPA 2XJ4A 2MSWA 2DKFA 1G21A 1KMQA 4AQDA 1U11A 3EEOA 4EVRA 4P31A 2PSJA 4C5AA 4GVLA 3GG9A 1AKMA 3BL8A 4NMHA 1D2NA 4TMVA 1QHHA 1LGYA 2E1PA 4Z0HO 3U16A 2BP7B 3COYA 1D4AA 5FOTA 4L4UA 5IBCA 2REXB 5FA6A 1O95C 1MPTA 4OSEA 4X45A 3I2FA 3N87A 3G8BA 3TXAA 1IM5A 4JN6B 3VHXA 1E5TA 3ZOZA 3ZV6A 1LTKA 5F78A 2AEFA 5ALQA 2EW8A 1F51E 1TFUA 4HWOA 2DYKA 3QXJA 3KU1A 4IDGA 3FSJX 3MTAA 2E4XA 3B7PA 2ODPA 3L3BA 3ZJ4A 5EHZA 2P62A 3UCXA 3VYTB 1R74A 5DNDA 1JG1A 4M9ZA 2OYRA 4QKQA 4OO3A 3EVFA 2AMYA 4RF3A 5EKSA 1MIHA 4DNOA 2QNBA 4XW2A 5DMXA 3FVWA 3LIPA 3JQAB 2MHCA 3R23A 4RPIA 2OG1A 3H1EA 1UXGA 1MHTA 1OSNA 4D80A 4G4GA 2YC2C 2YS7A 2GPBA 3A31A 5EUQB 4OGLA 5HG0A 5A3VA 4BLPA 4A10A 1CY7A 1GFIA 1F2VA 1VZ3A 1Y42X 2HTEA 3IBCA 1KJYA 2B1IA 2CMDA 2IPMA 1FU4A 3A0UA 4GI2A 3TECE 4L3OA 2IS6A 4LKRA 3WKCA 4H7EA 1VHWA 2QT0A 4GGPA 1A5AB 2TECE 3ZDZB 3CMMA 3GEBA 4JUIA 3RWOA 3IX7A 2ZRMA 1J6UA 2IK8A 3SSMA 4EHAA 5CM8B 3U60B 3AL3A 4B3XA 4EG3A 2VHUA 2JLXA 2V5AA 1BQ4A 2HK6A 1DTSA 2ZI6A 1GEEA 1WIWA 1X6VA 3LK6A 5AW1A 4R84A 4LHYA 5L7WA 3QMWA 1VJDA 2HA5A 3JAWB 1XZHA 2BMDA 4ZCSA 1QRRA 3CVXA 5ECDA 2FG5A 4FX2A 4ZTUB 1U6KA 4KQKA 1CULC 2O3UA 5H5JA 2OR3A 3VR2A 3OLCX 4EB6A 3IXQA 1RMYA 2OWDA 1ZNQO 4KX3A 1M2JA 2QTWB 3D2LA 5TQ2B 2QQ5A 1W52X 3WBBA 5AKGA 4DJAA 3E7XA 5C3UA 1F4PA 1SVNA 2P78A 4G0VA 1IUPA 5EWMB 4I4NA 2ETVA 3LLUA 4IEEA 4ACAA 1WBDA 4GHWA 4MUYA 3NXSA 5KS2A 5K3CA 4LGYA 3ZHVA 1AS0A 3VTFA 3DZHA 4GWLA 2W42A 2IEYA 5JZOA 1EFPB 3K8ZA 2OVFA 1T8WA 4B6JA 3ADCA 3WRVA 3NETA 1D07A 1P91A 3G88A 3GBSA 3BHNA 1QIIA 1S7CA 2PRYA 4M6WB 4TL9A 3T3IA 2Z4RA 4JGBA 4JJFA 4ZVVA 4UEWA 3CVVA 1XU9A 1P7YA 2J5RA 4LOKA 5I9MA 4O4HA 2ZSJA 1JJFA 1NZFA 4R2HA 1EESA 2XIJA 2VRNA 2IS4A 2HBRA 2KMLA 3ISTA 1G64A 2F59A 2DLDA 2R6FA 4KODA 3KJQA 4Q4LA 4QQRA 3UGTA 2J3IA 3F9IA 5ENVA 3JYHA 3ZV3A 1W75A 4JOQA 5GMOA 5AXDA 1M2EA 1YOVB 2VF8A 5DLDA 3WZMA 2AR7A 5FPTA 1AQIA 2XZPA 4KIUA 1GTL1 1HDCA 1YL6A 4M1MA 2BKLA 4ZRDA 5ESXA 5F51A 2GF9A 4MSUA 3BOSA 1IXKA 5C51B 2FPMA 2CJXA 3TGPA 1P29A 2BKVA 4PAGA 3SHOA 4DE5A 3Q8KA 4PYIA 2JFBA 1AUQA 4Y2JA 2NYVA 4OAPA 1R6XA 5A6SA 4AZVA 4FYKA 4EUFA 1BCRB 2WTNA 1GUBA 2BYTA 4EG0A 4D8XA 3VH1A 1HG1A 4N9WA 4U2EA 1HE4A 4JEMA 3SLRA 1BH2A 3GYGA 1JU9A 3LLCA 3PZBA 4PRYA 5LA6F 4B45A 2LZ0A 4FOLA 3T1QA 2A9PA 3ZWKA 3S2UA 4IKOA 4BB9A 3H1BA 1YZQA 3GY0A 1NC1A 4HFJA 1XIVA 3RS8A 3U5ZB 3QVJA 2VN8A 3R4VA 4YGXB 1DHRA 3MC1A 3Q6NA 4D4KA 2ANCA 5KDOA 5TMDA 1NPYA 5COBA 2JBAB 3M6UA 2O9JA 2V1XA 3IO3A 4NDAA 1VB3A 4H7HA 3ZHOA 4KBYA 4CBVA 1KEEB 3HYNA 2QRUA 3WS7A 1EI9A 2VYVD 3T1YB 1UJ6A 4O2BB 3FGPA 4J0FA 2IZ0A 2GPAA 3IR7A 2E2WA 4DGSA 1F06A 5IM5A 2YY5A 5DRYA 5C80A 1HZJA 4YWJA 1JE1A 3RAEC 1W2GA 2XMSA 4IP0A 3CLKA 1IUOA 4HBGA 1U2QA 3K6RA 2H5EA 3FJOA 1E7SA 1CUCA 3KALA 4MCJA 5FFNA 1BMFD 1BU5A 3DJFA 1IZ8A 2EIHA 2I3BA 1T4MA 5KX5F 3L05A 3HDGA 4UEQA 5SY9A 1NJ2A 2ZDGA 2ZFUA 3PSAA 2R2AA 4NV0A 1XFDA 3E15A 3WYAA 4MR8A 3DCYA 3FUUA 3FWHA 2P40A 1ST3A 4WY2A 3U3OA 3R3UA 3WL4A 3CH5A 2O8CA 5AOCA 2C7OA 1YH3A 1C3OA 4GC5A 4MS3B 4WUTA 2DCUA 3LX5A 4K9PA 5KAMA 4DWWA 2ZU0C 1NMSA 5AHRA 1QQ5A 2BELA 1NVEA 1WMFA 4E4YA 5IEBA 1IMJA 4YRAA 5ARCA 1FDRA 4Q1CA 4M46A 3MMSA 3GFVA 3OZAA 3N5KA 3HEMA 4OXNA 4ER0A 1CUSA 2QR5A 1M2NA 4GBMA 5AHXA 4RNDB 3VR3D 2WJGA 3MTEA 4GXQA 1DWUA 2X7JA 3AETB 4TVOA 4AKSA 2P6OA 2YWBA 4PSVA 4CLXA 1XTVA 4B4WA 3JWPA 1M1YE 1GNSA 2ODAA 2Q5CA 5DLQC 5F4ZA 1CW2B 3R8CA 2XRFA 5GJCA 1KY5A 1VI2A 3U13A 2BTOA 2CXUA 2Q3CA 4MVJI 1GL3A 3GJYA 3TCKA 4BEWA 4PLPA 3N2YA 1PHPA 2EJBA 4F84A 2Q0XA 4CN9A 4LOIA 4G09A 1JJ7A 2IYVA 3FKSD 1SUAA 5FKJA 1ID8A 3E2PA 1NUHA 4FR2A 3KV3O 3NOQA 1Z7BA 1PWZA 4ZVPA 2BAGA 2BGWA 3RROA 1R8JA 1U8FO 2FPXA 1RP7A 3T3MB 2DGDA 1JILA 4OLHA 1QKKA 1V2GA 2BWJA 1N25A 5IX8A 3BL6A 1MAHA 3I05A 3I09A 1L8XA 1EVKA 3T94A 4INOA 5KTNA 1X7XA 3CG4A 3PJGA 4AFNA 4J4TA 1SBIA 4ENWA 5KSYA 2GDZA 2J46A 3ZUGA 4AKHA 4V2UA 2CF5A 4U2FA 4WVFA 5TMBA 2OHVA 3AM4A 3WBFA 2EJWA 5JAHA 1TYZA 4ROSA 4YONB 4GWGA 4M21A 5AT1A 3INTA 1H2XA 3FSGD 1C50A 1FC0A 4FR5A 4HNRA 4Z3DA 3TZKA 4P34A 1E5DA 1E6LA 2VG8A 4XKJA 2ZSFA 3R4CA 4ZXFA 4ESEA 1RE1A 4YAIA 5DYGA 4M55A 1T91A 4OHPA 1G9SA 2G82A 3GLHB 3OM8A 2AUNA 2DSTA 2Z6QA