2FQQA

Crystal structure of human caspase-1 (cys285->ala, cys362->ala, cys364->ala, cys397->ala) in complex with 1-methyl-3-trifluoromethyl-1h-thieno[2,3-c]pyrazole-5-carboxylic acid (2-mercapto-ethyl)-amide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
EIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A common allosteric site and mechanism in caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-1
total genus 39
structure length 147
sequence length 147
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqqA01
1I3OA 3V4LA 4JJ8A 1I4OA 2H65A 1SC4A 2QL7A 2QLFA 3K7EA 4HQRA 4NBNA 3R7SA 4EHAA 4EHHA 4ZVOA 4EHFA 3NKFA 3P45A 4EHKA 4N6NA 1RHUA 4D3XA 3EDRA 4JQZA 5I9TA 1RHRA 5LUBA 2WDPA 3DEHA 2J30A 3DEKA 5IANA 2XZDA 3EDQA 4QU5A 2CNLA 3NS7A 2Y1LA 4D3YA 5H0IA 2C2MA 4EHLA 5JFTA 4ZVSA 4IEFB 1M72A 4QUGA 5IBPA 3D6FA 4N5DA 5IC4A 4N6GA 5LU8A 1SC3A 2XZTA 4DCJA 2CNOA 4HVAA 3H0EA 4N7JA 5IBCA 4NBLA 4QUDA 1GFWA 1RWOA 4QUIA 4FGUA 1RHKA 2QL9A 3SIRA 4EHDA 2FUNB 1KMCA 5IARA 3V4OA 1QDUA 1PYOA 2C2ZA 4N6OA 4JR0A 4NOMA 3S70A 4ZVTA 4ZVRA 1RE1A 3SIPA 5IABA 2P2CA 4ZVPA 4PS1A 3V3KA 5K20A 4FDLA 2FQQA 3S8EA 3UO8B 1PAUA 1SC1A 2XYHA 3ITNA 4PRZA 4QTYA 3R6LA 4QU0A 4AWBA 1F1JA 3E4CA 5IAKA 3R5KA 4JR1A 2CNKA 4ZVUA 3OD5A 4ZVQA 3D6HA 2K7ZA 3D6MA 2XYPA 4NOKA 2H4YA 4N7MA 4FXOA 1NMSA 1SHJA 2HBZA 2HBRA 4AWAA 2H4WA 3KJQA 3GJSA 4IYRA 4QULA 2XYGA 3KJNA 3R6GA 4JJEA 3H11B 1QTNA 2CJYA 2H5JA 4JB8A 4NOLA 4QUBA 5I9BA 5IC6A 3R7NA 4AW9A 2FP3A 1QX3A 4EJFA 3UOAB 2CNNA 4FEAA 1IBCA 4QUHA 1K88A 3R5JA 1RWVA 5IBRA 1CP3A 2QL5A 3GJTA 4QUJA 1NW9B 4PRYA 2AR9A 3BIJA 4DCPA 5IAGA 4EHNA 1NMQA 1RWKA 3DEIA 4QUAA 3IBFA 3PCXA 2C1EA 1RWXA 2J31A 1F9EA 4LSZA 4JJ7A 2DKOA 3DEJA 3H11A 4NOJA 1RWNA 3R7BA 3KJFA 2J32A 4M9RA 1RWPA 5LU9A 5IAEA 3GJRA 1RWWA 2CDRA 3IBCA 1I4EB 4QUEA 4I1PA 4D3ZA 5LUAA 4JR2A 1SHLA 2HBYA 4PS0A 3H13A 4QU9A 1RHMA 1K86A 2C2KA 3H1PA 4NBKA 2CJXA 1ICEA 1NMEA 2H54A 3P4UA 4HQ0A 3RJMA 3V55A 1I51A 2NN3C 4I1RA 1RWMA 3QNWA 2QLBA 1BMQA 2QLJA 2J33A 3NR2A 3V6MA 1JXQA 1GQFA 4QU8A 1RHJA 5IAJA 2H48A 2H51A 3PD0A 2HBQA 3GJQA 4JQYA 2Y0BA 2C2OA 1RHQA 3PD1A 4QTXA 1CVRA 5IASA 4DCOA 3V6LA 2H5IA
chains in the Genus database with same CATH superfamily
4BO6A 1DX4A 1QF9A 1PD0A 1QGED 1RRGA 1Z68A 3GIWA 4Q15A 3WWCA 2FY8A 1ZIDA 5FOVA 1HFKA 1VHJA 2NACA 1JPJA 2QT0A 1QGUB 4I4TB 3JQDA 3L6OO 4PIMA 2BMAA 1ZD5A 4XDHA 5E9QA 4AY4A 2XCLA 3WB2A 4YHHB 3NDPA 1E3QA 1RCTE 2C2WA 1E3SA 3RAPR 4H18A 4DR3B 1DMSA 4MAAA 2IVFA 4Q00A 1C7QA 1PZEA 1QVZA 4IEFB 4KQXA 3PX2A 1DCMA 1WSAA 1ZVKA 2XF2A 5K3OA 2WIAA 5KVCA 2BP7B 4RIFA 4QSHA 4XLLA 3ESQA 2RHCA 3FBTA 2E89A 1N0VC 1T6XA 2EXXA 3SK0A 4QUDA 3AHDA 1JEYA 4YCLA 4NABA 3TR0A 4FBLA 2GX6A 2CZCA 5G4KA 2QMZA 4Q1DA 5L4LA 2A0KA 2HU5A 2VKQA 5T6MA 1QC5A 1QF6A 4P0TA 3QVLA 3IELA 1ZOOA 3BVPA 4KIUA 1Z6XA 3CX6A 5IUNC 4XPIB 3U7RA 1B8PA 5E1BA 1IBLB 4UBNA 3IAM6 2ZETA 3MTDA 1PV2A 3O83A 3P5SA 3RS9A 4AF8A 3DLTA 4PSAA 3ZCRA 3S68A 4GUDA 1S6YA 1MQ8B 2BEVB 3M6IA 3FG9A 3GUCA 3W3ZB 1E4VA 1DXOA 1E4OA 1TZBA 1W4ZA 2I2WA 2XCOA 2YMLA 4AVYA 1HNWB 1SUPA 4JLDA 1BIFA 1M73E 3A2NA 3KR1A 3E1SA 4G8CA 4HX5A 3TPZA 2GTHA 4B0PA 2OWEA 1DKNA 2AG1A 3AP2A 3D02A 4JJEA 4R41A 4RH3A 3WWYA 1JIQA 3GRZA 2JLRA 4MWSA 5F5XA 2RARA 3PTAA 2ALJA 2BT4A 3TCKA 3U7GA 2FB9A 1GCOA 1QSGA 1L1QA 2PN1A 4LOIA 1H8HA 3ZE2B 4E2WA 3LQQA 5F77A 1V8DA 2WRZA 3RBVA 3EQ9A 3SSOA 4G4SO 1IM8A 1NVVQ 2I55A 1L3CA 3ZJYA 2IH5A 2HK9A 3I1FA 3KOXA 2OXTA 2V0GA 1GJRA 2Z2KA 1PV1A 3EAGA 2YOGA 4CRWB 5CM8B 5AI5A 2AWNA 2NPOA 5CEEA 3GEBA 2W58A 2C9DA 3CKYA 3OF5A 4KE8A 3RHZA 3L46A 4C0KA 4A15A 4MCHA 1DUVG 1U6JA 2D54A 2P5YA 1H3FA 1NY6A 5EXEA 5HUQA 4J0CA 2O3TA 5BUCA 5ERGB 5F12A 3U4GA 1OFVA 1E4EA 3ZDZB 3IAHA 4B6QA 4HYEA 1AF7A 2OFPA 3DVLA 1BMTA 2BFOA 2HGZA 4OMDA 4TS3A 3MUOA 4X1KA 4HATA 3FPJA 1WCIB 1Q0RA 4QWWA 2AEMA 1US8B 3AVOA 3JQ8B 5EKDA 1EG7A 1G5IA 2GN2A 2J7KA 2RB5A 5EUBA 3WGMA 1LDGA 1QCDA 4EG3A 3RSOA 1FUKA 3MTAA 3FTQA 2ST1A 3CXUA 1T4GA 3P9IA 3VSEA 4RK7A 1RJDA 4ETMA 1DWOA 4JJ8A 4C4PA 4B4OA 5CA0B 1DIAA 2QL7A 3K7EA 4LYAA 5AM1A 2C0QA 2JCBA 2RIPA 3MWLA 1PLLA 3MJTA 2OVFA 3R7SA 1Z0KA 4EKEA 3ZQ4A 1UDCA 1YC5A 1OJLA 3PQEA 3ZZTA 5J5VA 1G5TA 1Y7IA 2WKPA 3SZMA 4F4DA 4NAHA 2HWXA 4X97A 3TSOA 3U9TA 1UDXA 2WDPA 2I4MA 1L7EA 4UPVA 3EB9A 1W5BA 1WXXA 1KY2A 3BSWA 3E2MA 3OE1A 3ZJVA 3FB1A 5AI0A 4FWBA 1VJRA 3GCZA 3LLCA 2N46A 1AHNA 3QNMA 4MQ5A 3Q8LA 2IZOA 2ZJ4A 3PNKA 4HPJB 1TQ6A 2C95A 4L57A 5JZOA 1A5SB 2GVDC 3G0IA 1IUOA 5AP9A 4UU8A 4FGUA 1YE3A 1K2VN 2XB4A 4CM9D 3CZ5A 3LOQA 1E5VA 3REQA 1EP1B 1H8HD 2ADMA 1QG6A 4LQCA 1J9ZA 2JI6A 3D54D 4E14A 2ODEA 4PS1A 5C5DA 1EDDA 3EEYA 1A2QA 3PFKA 1KQNA 2F3TA 2VBCA 5HRUA 1XQ9A 3UB4A 3K0KA 2PL5A 1QZZA 1TM5E 4PYIA 2MSEB 4KKVA 1ZH4A 4RXMA 4CKZA 2X3UA 3BFJA 3PC8C 3WYDA 1ADGA 2BUAA 5HS6A 5EJEA 3UGJA 1XD8A 3F6BX 5CBPB 4Z53A 3VSDA 4EH1A 5GY7A 4DIKA 2GYYA 1C0IA 3KWFA 4PVDA 4U7TB 4BGIA 2P2LA 3DXXA 3HWX1 3JD2A 4N03A 3ESDA 1RLMA 4PWZA 4D4GA 1N34B 1BRTA 2AYYA 3KKPA 4WDQA 1GQRA 3AERB 2PZBA 4WCFC 4Z9FA 5I9NA 2D1SA 5E6UB 3RVDA 4OYLA 1DFHA 1OI2A 4BQIA 3QFRA 5EMLA 3GUYA 4ER3A 2AG8A 4FR0A 5C7IO 4JLAA 3U3MA 2JGAA 1PS9A 4BTEA 3P1JA 3WK4A 3W2IA 5J1SB 1IQ0A 3EVEA 1E8NA 4DREA 4XFKA 3SQMA 2FHSA 2EJVA 4Y6OA 4L07A 1V3UA 4YRBA 2G04A 2JANA 5IAGA 4Q4JA 3TSAA 3L7JA 4F1JA 1CEQA 4RNDB 3DZFA 4CMEC 2BYTA 3VPBA 2X19A 2PZKA 2DKFA 4RA6A 1T36B 3L1IA 3DBRB 4WACA 4XIYA 5KNCA 5HJ7A 2HQRA 5LNK1 4TLEA 1G3QA 3JALA 5GAJA 3TDMA 3OTOB 1TA0A 1QIHA 2OCKA 3WL3A 2CDRA 4HC4A 1G9TA 1ZH0A 1ZWKA 2JLXA 2FSUA 4ZOAA 5KYVA 1QQBA 4WCFB 1XDWA 3CNHA 4TGLA 4EP1A 3K2QA 3TQQA 3VMFA 4L7VA 2X22A 2WU0A 4QOHA 4KRXA 4Z8XA 4UTNA 3UA4A 4PCUA 1SN7A 4CU2A 1P60A 1Z2CA 1QYCA 4GSKA 3KJGA 2HSEA 2O2CA 1ZD3A 2WBLC 5JIBA 2H00A 3PHHA 2G25A 2OBNA 3F2VA 5CLFA 1Q0ZA 4X92A 2IYFA 3VZCA 3IX7A 3PD0A 4JT2A 3A58B 1WP9A 3R5XA 2A78A 3IAAA 1ODTC 1JQDA 3ABZA 3DF7A 4YALA 5G41A 2PZLA 3EEFA 3MMNA 4ZO7A 4HQRA 2YJ3A 1CVLA 3KLNA 4JROA 1AKEA 1RI1A 2G0AA 5ALDA 1ZHFA 2H11A 1O94A 3AB8A 1HXHA 4RNCA 3RVRA 4JYMA 3AJDA 4MX8A 5CUQA 1Z5NA 3SVZA 4UNPA 1VBMA 4M98A 5F3DA 3Q87B 4R2KA 4RH1A 4S0XA 2Y1WA 1HYHA 2V8BA 3RRXA 2JDIA 4P3OA 2AEEA 3NIFB 4PXSA 3AC0A 3ZWPA 2ODAA 4KK3A 3H05A 4RTKA 1RAFA 2W43A 1ZCAA 1UAAA 2EW8A 1NUUA 1ZM9A 1A7JA 1KK1A 4Z7OB 5EYPA 4UEJA 3WLJA 3NX4A 1FXWA 1B8VA 4IQ8A 5FTNA 1NV8A 4ZAGA 2OCLA 3CZCA 2QP3A 3GRUA 3OZRA 3H5OA 2V6IA 3PLRA 1Y4DE 2FGKA 2VP4A 2DLCX 2IU3A 2X6QA 3LWBA 2I4LA 3NORA 5E3IA 1PJRA 3UH1A 2NTEA 3UBMA 4Q47A 2EKBA 1C1XA 4LZJA 1CHDA 1GGJA 5L4NA 1LCIA 1RYHA 1C8BA 4KDEA 5CIYA 3IAEA 5B7GA 3PFNA 5EZ6B 2EKLA 4P2BA 4RZXA 5COQA 4ZCQA 5GTDA 3TRJA 4ZN6A 2H4YA 1Q16A 2AZ4A 1U8FO 5H8WA 3OT4A 5CURA 4MPPA 4R8SA 1YVUA 4FUQA 2XYGA 1A1SA 2AJBA 4KXXA 2BFMA 4UTOA 1EJ2A 4TOIA 2LP4Y 1KZHA 1NF2A 4PZPA 3RRZA 3EZ7A 1IHUA 2FLKA 3QFHA 3ND5A 1K8QA 4JC4A 3VU0A 2C4MA 3VO1A 5JAIA 4M9QA 3BCHA 4PAMA 1SD1A 4G86A 4UJ5A 4WKGA 2J9RA 5JCOC 1I33A 2PYIA 4UCWA 5FOUA 2BH2A 1ISSA 2VC2B 3CX4A 4YVFA 3K1AA 1N0IA 3CZAA 3QKSB 4L9RA 5AWFC 1QP7A 2WKRA 4M1WA 3SVLA 4GOMD 5J5AA 1QZXA 1YJ5A 1R7RA 2L19A 1RJ9A 3O1HB 3U62A 1XTJA 1BKYA 3B6IA 1TM1E 3E27A 1N2SA 3P0JA 4GC5A 4ZMSA 1UXKA 1B26A 5KKAA 4GI7A 4Z4EA 1WMFA 3AY7A 5BR1A 2R79A 3AUUA 2NADA 5IUKC 4DJDC 1BE8A 1QIDA 8ABPA 1MR3F 4MINA 1C7IA 5JWRA 3MK31 2PX5A 1X7YA 3JAKB 1G42A 3IBCA 4WTOA 2O3SA 2PU5A 3M6WA 4IICA 4X8MA 2O6HA 4PLFA 4UNNA 1FYDA 1AKNA 2C4WA 4OHFA 1OLOA 3CO0S 4YP0A 3UWDA 2G9ZA 1CRWG 1YCGA 1TRKA 2G3YA 1BGVA 1X39A 2JL1A 2JLSA 3B9BA 4O4LB 3MJFA 5E95A 3VGPA 2IHUA 4U2FA 3GLIB 2WJJA 3M4JA 1EDOA 1PVVA 1W5AA 3PZBA 3ZEAA 4C08A 5LMUB 2KWIA 3PL1A 5GONA 4GL2A 1P7YA 1SVMA 2Z1MA 3K1ZA 3FXAA 3A6GA 4OGWA 4X24A 4GZ5A 4MQFB 1WMDA 5BWLA 3ZGOA 3LCUA 2VJNA 3KT0A 3CR8A 4KLCA 4B4KA 3F6CA 1ETHA 2XYVA 3ZXYA 5H16A 4JI2B 2Y0BA 1QVVA 2R6AA 3C98A 4AULA 4W1SA 1J0AA 2FMXA 3R8CA 1G55A 1I2DA 1PEAA 4QTXA 4OHBA 2ZRJA 3FDFA 5FUBA 3PTLA 2BRUA 4BDTA 4KPEC 2A0UA 3AGQA 4JNCA 3ETDA 3H2HA 5TGZA 3ILYA 3WLHA 4EHHA 4ESOA 4YFYA 4F38A 1F2UB 3G8BA 5IU6A 3DLAA 3BSSA 2GN1A 1QQ7A 1GPKA 1XL0A 5FUVA 1I24A 2QTVA 3EVDA 1GRVA 1M0TA 1YR9A 1Z8FA 2FWIA 2J3EA 4RLHA 2GVNA 4W7IA 2EEPA 4A0RA 3WX0A 3L0IB 3ZW8A 1AXGA 4BMDA 3SJAA 1D9XA 4U4AA 2O0MA 5KKCA 3K70D 3LUHA 1PWYE 1QE3A 3G0GA 1O7JA 2PPLA 2WNSA 3C7AA 1UQRA 2DUNA 4R05A 4XEHA 4X71A 4UNQA 2Q5JA 4YMSA 1NVGA 3VSCA 4XRRA 3ZK7A 2D2EA 3GBSA 2BN4A 1R5JA 4D25A 1MEEA 4RKYA 5ILOA 1REQA 4MYTA 4F2PA 1YJCA 3GCGA 5A4DA 1UIRA 3LPCA 1OZGA 2KPOA 3A6LA 4QJIA 2FW1A 1IYZA 5E8JA 5JAZA 2WTBA 1L3BA 3R6LA 4GEGA 4YAWA 4Y8VA 2ZR7A 5BWCA 1N2CA 4NV0A 4CDGA 4JR1A 1Q1ZA 2NYVA 4LXYA 1PYDA 5TSDA 4E0BA 3Q15C 1QV9A 5LD2C 4HWKA 1ZJZA 2WIGA 4OQPA 5CX1B 3IT1A 3FOEC 3PP8A 1EX9A 3ZEIA 1Y89A 4TZ6A 3GBPA 1BVHA 1SWWA 3CPSA 2E3JA 4TZ0A 4HXYA 1Z0ZA 2YZ2A 1P2SA 1BCRA 1CJTC 3FGNA 3NTOA 1RXSA 4MUAA 5EE0A 4EI8A 2F48A 4M60A 5FUYA 3IQDB 5G0WA 3A9CA 4HVTA 3BE4A 1UXHA 2YFHA 3GDHA 5EJIA 2HLDD 3LDUA 1JHRA 3TI9A 3UG6A 3EEBA 5H83A 5JJIA 421PA 1L4HA 1LRKA 2I80A 2P2ZA 4TX1A 1G6KA 2QX4A 3WGLA 3DDSA 3NHFA 3W6OA 5KOJA 1NRJB 1YHNA 3KJIA 4JEMA 4I5DA 4REMA 2YTZA 3WK7A 3TGWA 1I7LA 2QTFA 2PQ2A 2B83A 2CJWA 4GMFA 1TO1E 3DE5X 3R3HA 2P3SA 4PPFA 3DKVA 2JC3A 4P81A 4NNJA 4TMFA 4YP1A 1OTHA 3AOGA 1P0QA 4B3TB 3B6KA 3N2LA 2HA3A 4PQRA 3OI7A 4A0FA 2HRZA 2VQSA 4L9AA 4ASUD 4B82A 2GMWA 3D1JA 3R23A 2W70A 2ORED 4Q05A 5ESXA 1XP8A 3W78A 5DNUA 3TLGB 1ZKDA 3DOUA 2PO7A 4GOJA 2RI6A 2WDZA 4PTYA 1SIBE 1X80B 1AQYA 1FDWA 1TRHA 1GZHB 3S1SA 2Y3IA 4BZXA 3JAWA 4W1RA 4WZAE 5ICSA 3NM6B 4Z7JA 3FNFA 4PYKA 2YDYA 4KMRA 3OX1A 1E2PA 3QLVA 1ESMA 1AB6A 2EC5A 1C7JA 1F9AA 3EZ9A 5HF5A 1ZA1A 3PQCA 4A8JA 1LS1A 4U7DA 1E3JA 1YS1X 2VCEA 4MB6A 1GGVA 2HDHA 3FFXA 4J7UA 3RV3A 4JITA 5AJHA 2VWHA 1YS9A 2MTBA 2ZYTX 4XD7A 5IYZA 2Q4TA 5EGNA 1Q0LA 2XA9A 4A4DA 4C4OA 4AZ3B 1UINA 3Q2IA 1GG5A 2MSDB 4RKQA 2ZYWX 1RJ9B 3NUZA 2XUPA 1COZA 3HVUA 1LV8A 4DV2B 1L4YA 1DADA 4L6CA 4CG0A 4L0MA 2IDKA 2V7QD 2VUUA 2XDQB 3IJEB 3U13A 1AV6A 5BV8A 2CW5A 3EDRA 2BUCA 3I1YA 4JB0A 1TK2A 4UBLA 4UDXX 3ZHOA 1HR0B 2H2FA 3JYHA 1H23A 3QVMA 4JQOA 4NDAA 3P9NA 1KO4A 2PJUA 2XZDA 2HXYA 3UC5A 3ROKA 1ZGCA 2VZ8A 3IA7A 3H1TA 4DUZB 5IC4A 1VG1A 1MX9A 1SCDA 5KTSA 3D81A 4DEYA 1UBHS 4OHKA 4V1CB 2JAQA 1PP4A 1CY1A 5JTUA 1CQWA 1N2GA 2VNSA 4HEA1 4PFJA 2BLNA 3KXKA 1WCYA 3B89A 4TWJA 3V4RA 1Y8QB 4ITVA 2VYVD 4JA2A 3I1IA 2O4CA 3ZW7A 2Z9DA 1HH4A 3MWYW 1Y7PA 2AJLI 4PHGA 5D3MB 1F8FA 5DM0A 1OU4A 2FFBA 4JZKA 2QY6A 4GO1A 1L4NA 2IE0A 4JLJA 3UO8B 1HY3A 3PXBA 4J76A 4L15A 4J16C 2FSHA 1SMKA 5J63A 3SF0A 4ZDIA 2JHAA 3MHPA 4PLPA 1VKNA 2X8LA 1JSZA 2GN8A 1SXIA 3OIUA 4PHHA 3IE0A 4ZVUA 3MAJA 3OPQA 4I4IA 5HIAA 1QG0A 2QD1A 3KKKA 3VOBA 5ALEA 5KYWA 2A7XA 1VKZA 2RCYA 4BNZA 3GHYA 1VECA 1KK2A 4OMUA 1G8AA 1XQ6A 3CNEA 4TV9B 3VPHA 4HV4A 2JHGA 3IJRA 3FA2A 3G8CA 3NIGB 2WVGA 3CW2A 2W22A 4ZKDA 3DMTC 3RTBA 3D7NA 1NZJA 4QUBA 4RX1A 3JR3A 4YAFA 1NSFA 2VJDA 1ECCA 4QICA 1KOLA 2A5JA 4DPLA 2IPLA 1N2JA 4G4JA 2O8EA 4WKNA 4L3WA 4Z4FA 4JJFA 4LJ6A 3VR5H 4LCBA 4HHEA 1IE3A 1RZUA 2E1RA 1HF3A 2CXSA 3GDFA 2DHRA 1YS6A 3RODA 3GVIA 1T1JA 4TVOA 5KNBA 1RJEA 1IPFA 3QF4B 2VJMA 4ZAYA 2CUNA 3SIXA 3UQYS 4RMGA 3U61B 1AKRA 1RFLA 2XTJA 2NNLD 2EU8A 2DHEA 1U4OA 1A8PA 1G6OA 5KTOA 1T0JB 4TKVA 2ZJ2A 1WDTA 3NNDA 1UWKA 4CKWA 3AT1A 4ALKA 3O8DA 1O77A 4XRGA 3UMSA 1PR5A 4ATNA 3ROTA 3K8OE 5TPZD 4ZAZA 2VP3A 2FPGB 5ITVA 2H7VA 3ADBA 2CDAA 1FPQA 4CFYA 2W83A 1M7GA 3FRJA 1HEIA 3I8XA 2OGZA 5BPHA 4C6HA 5HWSA 5A3QA 1V1RA 3TNDA 1ESNA 2GPAA 3QKSA 4B6RA 3STTA 3I23A 2ID4A 1ID8A 4DC0A 1DEHA 3QNWA 4Y7DA 3NZEA 1JFFA 2PKEA 4AKSA 4EECA 4YDHB 4UQLA 5KREA 2IRWA 3ENWA 3A0RB 3DEFA 3VR2A 1U04A 3QX8A 4JXKA 2OO5C 2C8JA 2OC9A 3NJ4A 1EK0A 3GJQA 3UPTA 3R76A 5IFLA 3ELWA 4L74A 1Q0PA 1TYDE 3LP5A 1CD5A 1ML3A 1JDBC 4H3VA 1FX0A 2WMNB 2ZJAA 5KTKA 4FYIA 3V7YA 1EWTA 3LZCA 2R1VA 2QN2A 4QXMA 2J9FA 5EKUA 1ESZA 5AK4A 5EIEA 4BMVA 2O5RA 2QAGB 5AJUA 3D6VA 3HDGA 1BROA 2QD4A 3NT4A 5CT6A 2CLIB 1TLFA 3LVRE 3TQOA 4DYHA 4Z9AA 2H85A 1GD1O 5DBEX 1N5OX 3QH4A 3SXPA 3WL8A 3WXBA 2XYRA 2DFPA 2ORYA 3N05A 4QDKA 4RAOA 4EYSA 5A2GA 2O2IA 3I5XA 1KDOA 1Q1EA 1XXHB 4KV9A 3N6XA 1RDFA 4H1HA 3HHPA 5KVQA 2A0YA 4FFBA 2I54A 5IK2D 2IA5A 4PNPA 1CQJB 2YQ5A 1UPAA 2DWQA 4TZTA 2QUKA 4RMHA 2YHAA 2F7SA 3OLYA 3G2IA 2GAOA 4PC7A 4F5EA 1UMDB 4MQFA 5IABA 2WFZA 1K3UB 1W87A 3BCRA 5BRNA 4CF5A 2VHUA 5BPFA 3KM0A 2UYOA 3KUXA 3M9LA 4OHCA 5AUPB 2FRVA 2NP7A 2RB4A 5FDFA 4QHTA 1TC1A 2GDZA 2XXAA 5C7OO 1XMVA 4NZNA 1WULS 3U19A 1C9JA 5JAUA 4C7OB 5AHOA 3C3YA 3JQQA 2GF9A 3CBQA 3HJCA 4L7QA 2YBDA 4I5GA 5JV5A 1HORA 3UEOA 3W5SA 4BVBA 1NRXA 4MUMA 4AG3A 3HN2A 4X00A 1XT6A 5JDIC 1OI4A 2W6CX 3MFQA 5K4HA 2O3RA 2QMOA 5DJ5A 4IHJB 4RVHA 2BFFA 2XTNA 3KYIB 4K9PA 3ZTTA 2V6GA 4YO7A 4NAUA 3ESXA 1JNXX 4CLOA 3PE6A 2EGHA 1S8NA 1YKFA 1Z18A 2B4KA 3FPSA 3AMVA 1IZYA 1FDUA 1O6CA 2WM3A 5KTPA 3T4PA 3VKWA 1T0IA 1W30A 4O3MA 1K88A 2KLBA 3H1GA 3EXFA 1V9CA 3ZV5A 4WKOA 4QG3A 1M6NA 2XMGA 1HKHA 1DCFA 3QLUA 4RGQA 1P18A 1ADCA 1R37A 1SHZA 1GRRA 3U3DA 5EHQA 1W48A 1UBJS 2DFVA 3WNQA 5SICE 3NUQA 3ZUGA 2GRAA 1EK1A 4EVRA 1ACJA 4AQ7A 3Q8KA 3BXFA 1Q7EA 2KB0A 1P5ZB 5EPUA 3TZBA 3UCFA 2QEQA 5EC8A 1Y6FA 1R6TA 1FRZA 2JIRA 1V7PC 1PJLA 4M53A 1OE0A 4KSBA 4TXHA 1KEUA 1DQNA 1DSSG 2W2QA 2YY5A 2B21A 2PRSA 4KAJA 1M8JA 2OD7A 4P36A 1Q1QA 2IZZA 4QQKA 1S3SA 4C0BA 1NN5A 1Q44A 2QDKA 1EIWA 4MLCA 3TRFA 2X3FA 4NF2A 3ZQKA 2HZ7A 2NO5A 3GU3A 3GJ5A 1NQAO 3NT5A 2EBHX 2D4HA 4KQCA 4K9RA 4OQMA 1X86B 2BFWA 2NX2A 2HGSA 4M7WA 3BG5A 3O1LA 2H57A 2WSMA 4FD3A 4YQFA 5I4CA 1W36B 4N39A 1LZKA 4Q7LA 2YHBA 3QBTA 4Q3EA 4XB1A 4MS1B 4JP8A 1C0EA 3B6ZA 3H86A 1XZIA 2VNAA 2IKSA 1CZUA 4MJ3A 2A9QA 2BJWA 3B5EA 4OI2A 1L1RA 4NECA 2DWCA 3A6ZA 3D6FA 2WP0A 4V0ME 3TRIA 1O5OA 4KDCA 2D8AA 3GH3A 3HKCB 4OQLA 1L9XA 4EHKA 4GNRA 4LRYA 1OKKD 2I99A 2D3WA 3T7IA 3VDQA 3W7AA 2FWRA 3ZE6A 5HQJA 5G1PA 2AIRA 1ORWA 5F2KA 2H1OA 4QODA 1XUOA 3OC0A 4IEEA 5B7NA 2O2GA 3WMWA 3HLTA 4NFLA 5IANA 4DLZA 3BX1A 4MS1A 4ETIA 3DFMA 5IPFA 1XD2B 1C3VA 4Y1FA 1DI0A 2WJZB 3E0QA 3ZCVA 4RJTA 2JK1A 4NCJA 2ZB4A 4XYMA 2PL9A 5I7RA 3DHEA 1CRPA 3UJ3X 3U56A 5KTTA 2J09A 3RK4A 3EFHA 3EZNA 3UMRA 2QQ5A 3OQ1A 4GF5A 5DLDA 2WY2D 4BUCA 2DULA 3I2YX 4WJZA 4DLLA 2NXJA 3CWZA 3SXUB 5LQRA 3D0OA 1KA9H 2OKCA 4H3HB 3RFCA 4XSHA 1O6ZA 3OA2A 2VJLA 2YYSA 1IUKA 4KYVA 4LBYA 1JTFA 1YS4A 5K01A 1H94A 4BFYA 1G8FA 2NZUG 3K5HA 4HDMB 4UNIA 1A95A 4G09A 2IV7A 3ZK9A 3EF1A 1BDJA 3JZIA 4WXEA 3ITEA 2P2NA 5KCMA 1NONA 1UAYA 3JVDA 5DBOA 1Z5VA 2BHLA 5EUQB 4C0HA 2ZVDA 3H2JA 3URKA 4GOXA 3OEHD 2O2EA 3TW4A 2VK1A 5LCXA 2QR5A 1EK6A 3N28A 4M87A 1O6GA 2VT2A 3UAWA 2FFAA 2ZJOA 3AUYA 3JVIA 3NYRA 5KVAA 4FCCA 2XUOA 1TGVA 5TMBA 2L42A 4FYWA 1QWSA 5CT5A 3TOSA 2XLCA 3U9LA 1M8KA 2HCFA 2X5XA 1PR3A 1TTPB 4DANA 3TSZA 3BIOA 4HDSA 2FZWA 1Z6YA 3HEMA 4FILA 3IQZA 4MK4A 9ATCA 3LW8A 4AJNA 1Z82A 2PUGA 4PO3X 3A14A 4GWGA 1HDZA 3CF2A 3ZW9A 2AR0A 2JGKA 2GN0A 3FSGA 3L5KA 1Z56C 3SDBA 1Q20A 5LWQA 3OZXA 5JPIA 4Q9HA 3H75A 3T7KA 3FWHA 4KAAA 4ND8A 4RK4A 1Z4MA 2C84A 3R8XA 3ZE9A 4ZO9A 2CLSA 3GGDA 3L43A 1VIVA 3DMDA 4WXHA 5LP6A 1A4UA 2IY9A 2NVWA 2PGXA 3NG1A 3LGXA 5LB4A 3QY0A 2V7QA 3GPIA 3ORRA 4QPNA 4BXOB 3MJDA 2RHTA 1CUXA 4PZDA 3BMNA 3K6SA 3DZDA 1HNNA 2RK6A 4P32A 3BS4A 3MSXA 3DWIA 4F71A 1NVVR 2XA1A 2E5FA 4MV8A 5CRIA 4MHTA 1A3CA 1NP6A 2ZAGA 2QVLA 3LKDA 4A7PA 3UWMA 3BFPA 3DDUA 4JIGA 1Y3HA 3G68A 1EFHA 2JIPA 3KTAB 3M5DA 4DLUA 4YO8A 4ZK6A 3ZGZA 1WDLA 2Y92A 3PQDA 2P2GA 4H7KA 1LSJA 3RSZA 3H5NA 4G23A 2AOWA 2PMEA 3PYLA 4HB0A 4AG5A 3H2YA 1UT8A 3NFYA 4TQUS 2OFOA 1I3CA 2OORC 2XAUA 2W98A 3E9RA 5JSHA 1Z47A 2LGJA 2JGDB 3GAZA 2PT5A 4Z1MA 4D8VA 1GTSA 4RF4A 4CN8A 3LWDA 5GZ6A 3AZQA 3V6LA 1BHSA 1KEVA 4XWKA 4JYBA 4Q39A 2FW6A 5A1TA 5HF8A 2FJ0A 1G1MA 5JS6A 2P6MA 3QPUA 2IHVA 1SVIA 2PLNA 3JQPA 1FLVA 1V8FA 3LUAA 2YIJA 2ZYHA 1CFJA 1C50A 3FUTA 4MWCA 1HBJA 3KVYA 4XSVA 2Q3BA 4UW9A 4YACA 4Q1BA 521PA 4YCCA 1VL5A 4YXFA 4ZZ1A 9GPBA 2QN1A 3OQIB 3QXSA 3CH5A 4J90A 3PHGA 5BW4A 4QU5A 1KARA 3SBOA 3BPSA 3I04M 2ZROA 4ER5A 3E2PA 4OYYA 1K7EB 5KNCH 1L5LA 2Z4TA 3UC9A 3L0YA 2G5TA 4YS6A 4WNIA 3PQ8A 2FR8C 2NG1A 4HZUB 3UJ6A 3E3LA 4IUCS 1UEIA 1I2BA 5BNFA 3CIFA 4BOYA 4DIFA 4B6GA 2YJZA 3F3SA 5AYVA 3DFKA 1BTOA 1N4AA 1PW5A 3JQCA 4QFMA 1K98A 5I51A 4CG2A 2O1XA 3E84A 4ZVTA 4Q19A 5JOQA 5C51B 1SQSA 1HYGA 1LRJA 1ZUHA 2WMOB 3PT5A 4NFSA 5CYFA 3ZQJA 4IGFA 1WS6A 1E98A 1OIVA 4KUEA 1AS3A 1KHTA 4V0SA 1EXDA 1PT8A 5TIIA 2J6IA 1R66A 5K3AA 1H0HA 1PR1A 3E70C 4HFMA 1H9AA 4LBZA 4KACA 4RYLA 4TT8A 4ESHA 1E5LA 5BN1A 4TVSA 3SJ7A 3AR4A 2NTJA 4GPEA 4JJ4A 4XIIA 1X19A 1E3EA 1NPTO 4GW3A 4IYRA 3NNSA 1WHSA 4NBVA 5K3SA 3IULA 4Z4GA 1RYDA 1JQKA 2W4MA 4U2KA 5CFZA 2QX6A 2XE7A 2YZGA 2G83A 2DQSA 2YQ4A 4XJTA 3H99A 3PDJA 2IBSA 1NU6A 1HC7A 3B9QA 2ACKA 3EDOA 3UAVA 4UUNA 2DFTA 2IUEA 3EH1A 1ZD9A 3KQTA 3NB0A 1PVDA 2BEUB 2WUVA 2E4YA 4GMGA 3C7CB 3E03A 1M66A 2DT5A 4ENTA 5B3LA 2F4VB 4DL9A 3A1EA 3M49A 3O8NA 3QK7A 4QBTA 1XPJA 5BWMA 3AONB 3FNGA 3HB1A 4LC0A 2W2LA 5FH9A 3V2GA 1XMSA 1K66A 4MQEA 2WD7A 3NHMA 3BZUA 1E9FA 1LVHA 2WILA 3AF2A 1GL9B 3IEIA 3GEPA 3NJRA 3ES9A 4TLBA 2OR3A 5EA2A 2V4MA 3GFGA 3LKBA 4IKOA 4HI0E 4XYGA 4IRUB 4WBNB 1Y7LA 4M8KA 2CJXA 3HLYA 3LXRA 3H97A 3S2EA 3VV3A 1FS5A 4YXWD 1ADYA 4F91B 4MGKR 1MVNA 2A14A 2DY1A 2P41A 3RG2A 4MIOA 2W6MA 4LGYA 3O75A 3ZTYA 1NLZA 5L40A 2Z56A 5ITSA 1ONBA 2B4AA 4G2NA 5IS2A 2P6RA 1QC5B 3WMRA 1R9GA 2AB0A 1WMEA 1LDEA 3EOZA 2VTDA 2JI4A 2XTZA 2E6KA 1H69A 2I2BA 4J1QA 3RYIA 4A3SA 1D2EA 1V8PA 2R6R1 3OOYA 1RRPA 4MUHA 4PZLA 4QXOA 4DCOA 2F4NA 1X14A 4R8RA 4QZVA 1NUSA 2AFHA 1I2ZA 4A1FA 1I4OA 2W6IA 5EKXA 3D7LA 3HM2A 5JANA 3LZ6A 1CZRA 3RJ5A 7MDHA 3AIOA 4CLHA 5B6IA 5IEBA 2GYWA 4FDVA 2ZIUB 1QP8A 2EKPA 2HF7A 1W0CA 2G5CA 3DVQX 4I0WB 5T64A 3UHJA 1GPUA 2QW1A 2IIBA 5JDIA 3EGVA 3NHSA 5AW8A 3SU8A 3ND6A 3PWZA 3RVPA 4D79A 5KI6A 1HDEA 2C5AA 2O3JA 1P3DA 2PXHA 3MT0A 1CK4A 3EE6A 4R6XA 5K7SA 3RC9A 4HLCA 1NE2A 1S0UA 1X80A 1P9LA 1XG5A 1KDVA 2A33A 5EWJA 2IYAA 4B4WA 2PQMA 2IP1A 2QPAA 5FTWA 1EDBA 1W46A 5ELXA 2EGUA 2IXDA 2OENG 2GEDA 3HO8A 1B4DA 3O84A 3OZBA 2OZVA 4RZIA 5G3YA 3NCHA 5EWJB 3AESA 2AEJA 2ZVJA 3GC6A 3IIEA 3NC0C 3JY6A 4C6RA 1KAQA 1LC0A 3DDOA 3RRNA 3S8EA 3IE1A 3CVUA 2H2IA 2J3DA 4I08A 4QT0A 4BNLA 3RK0A 1RFGE 3FMVA 4U5QA 5EY5B 3ZIDA 4AL4A 1G7CA 1YFZA 1FUUA 1J7JA 1N0HA 3ZHRA 3I1JA 4IXNA 2SHKA 3H8WA 5IW8A 1F4LA 1QPBA 1OVGA 2Q5IA 2DCUA 3A37A 4Q3DA 4XX0A 3SS8A 2EJWA 4BFWA 3HFRA 4ESEA 2HPZA 4RJLA 3OAAD 3IR5A 5TF4A 2OBFA 4BYMA 2PL3A 5JPCA 1C81A 1RYZA 4TVKA 1IB6A 4DAOA 5CDFE 4F93B 3HYRA 3WWEA 3ZK8A 4IJWA 3C87A 4MXDA 4KCGA 4OD0A 2GCGA 4I5IA 1KBOA 4MGYR 5I9BA 4A73A 4I5EA 1SXHA 2ECQA 4G4SP 3LY9A 4NG4A 3FVRA 1WD5A 5LMCA 1MRZA 2QN9A 1MKYA 3DMGA 2ICAA 4G56A 3WGVA 4XM2A 4MUXA 5DGIA 1OX4A 4EG8A 2G9QA 4Y2UA 3ZOKA 2ATXA 4U0KA 2GN9A 1N1DA 2FFHA 3NUGA 3OTWA 2ZYUX 1YZLA 2NW6A 1JWBB 1SURA 3VR4A 1MVOA 2PVSA 4KJXA 2YASA 4JJ7A 1BA2A 4DA9A 1M2VB 3BTSA 2CV1A 1L7OA 3TOZA 2RHHA 1AY0A 2QY9A 4F6CA 3FR7A 3OY7A 1NYQA 5MF6A 5ANRB 1JG7A 4WCFA 2ZB2A 2ZXEA 1BAPA 1T6NA 3ISTA 3ZBTA 4MDEA 3G8DA 4RD6A 3HFSA 1E7MA 3W6UA 1IJEA 2G5PA 2WJ6A 5LQKA 2NIPA 2WU8A 4G07A 3ZXSA 2RGRA 3W9UA 1I7QB 3K2IA 1BVYF 3ZS8A 4W5OA 4CI0B 2N47A 3Q8MA 4UE3S 4YFVA 2PRKA 1WF3A 2W8ZA 3C3KA 4UM7A 1PJSA 4NESA 1KYVA 2OBYA 1NXPA 1QZTA 1B8UA 2H06A 3H0KA 4OJYA 1BEUB 4R54A 1YE8A 5LB2A 2V7PA 4X54A 1KYWA 1HRKA 4BGUA 1U02A 1YU9A 1ZM3A 2H51A 4RQBA 4IMRA 2PLWA 4IOLA 4HH1A 2R11A 4U2EA 1S2IA 2X9LA 4WRRA 3V34A 3IAFA 4V1CI 1UT6A 2PH3A 1Z7EA 4GZLA 1UUFA 2BGMA 4G24A 2BM9A 1Z88A 4N5LA 4HXEB 2Q0QA 5EHGA 5J9FA 3TLAA 3UPUA 1FJGB 5LDGA 3LC7O 5D6NA 3W79A 1Z5ZA 3A1DA 3A6FA 1E6UA 3BORA 3IV6A 4ZEMA 4I4LA 4FVTA 1DKQA 4IDGA 4U7PB 4U7FA 2XI4A 1TK3A 3NHPA 3QW2A 3L0ZA 2GK4A 3JZFA 2D7CA 3MWGA 2VPYA 4AF7A 3S2FA 1PX2A 3JTMA 3EDQA 4OA5A 5TQ0A 5AVXA 5I47A 1WU8A 2FHPA 3TCXB 4IMJB 2P9QA 1WAMA 2ZYAA 3HP4A 3UXYA 1EXWA 5DULA 1JSXA 4QUGA 4B76A 1ECBA 3E5NA 4RHEA 1CR6A 5E6RB 4U63A 3IOYA 4CR7A 1ZONA 4AJPA 3RU3A 5AD1A 3G2KA 3HP7A 5BWOA 4ZT4A 3N7UA 2OESA 3DL2A 2GD2A 4IS3A 5M34A 4OQXA 1FQWA 2QRVA 3OLWA 2C61A 1RE1A 2YV1A 1V7QA 2PH1A 2C78A 3MCZA 4FDTA 3TLZA 2B30A 4B83A 1E1DA 1QK4A 4CM9A 1D04A 1Y1KE 4G0PA 5CT4A 1M5RA 3R3SA 4X66B 2C9OA 5B6PA 2C7QA 4YCNA 1W34A 5M04A 2I4TA 1QS0B 3GLFA 3L6DA 1BMDA 4DA8A 3RRFA 3UK7A 1XKXA 3PD7A 2JKZA 2X6TA 4YWHA 4B6PA 2RK4A 1U1CA 1EP3B 1KQPA 1IXKA 3S5UA 3BJRA 3USES 1OYVA 3B6EA 9LDTA 1YI8A 3P9SA 5INTA 2XGGA 2H2HA 4ERNA 1SBZA 2WI8A 4MWTA 1SG6A 5FWXB 3L6BA 1FS4A 1L1FA 4RADA 5IN5A 3RHSA 2WHPB 1REQB 3WYAA 4FW9A 2B4YA 1SJ9A 2DQZA 1E2DA 1M10A 3ISJA 2XVXA 1ZC4A 5JVDB 6YASA 1OXXK 4NSNA 5A5GA 2HW8A 2BHTA 1ITZA 1JDNA 1WW2A 1ZI8A 4OATA 3RC3A 4IJUA 4RTQA 2C54A 3E5RA 2O4UX 3QJGA 4KO8A 5EMKA 3ROQA 1SZDA 1U0FA 3OEYA 2J5RA 3NHBA 1HG1A 2RGNA 1XLTA 2RI1A 2O8VA 2FP4B 1T24A 1V1MA 2GJSA 2Y1FA 3A70A 3OM9A 4HZIA 3TRHA 3ZTWA 3BZBA 4DMMA 4C07A 2I7VA 1Y7HA 3IALA 1CNFA 4FYHA 4M38A 3VNBA 5BVHB 1AN0A 1KAOA 2CJFA 3ELUA 3HUEA 3I4LA 1M2FA 4HBZA 1U6KA 3GJRA 4G3XA 2C3MA 3UKJA 3I37X 1GPAA 3QLUC 3U16A 1VC2A 3TJRA 2NO6A 1V3TA 4ZPXA 3DJFA 2GT1A 1JH8A 5CYGA 1N25A 3H18A 4TMXA 3ZY6A 4Q3CA 5E7MA 1M2KA 5A3SA 2NVBA 3SSAA 1NMYA 1WCWA 4K6CA 1MA3A 3DDCA 1U0LA 3LUBA 1N0WA 1CZHA 3RGWS 2OFWA 5AW9A 2QUHA 2HJRA 1A50B 3MCUA 4I4NA 2FX2A 2PSSA 3DLIA 2ZATA 4BFXA 4TTIA 4ZDKA 4HQFA 5FXMA 4XI9A 4QAJA 1EXVA 5D5HA 3CNNA 1IHOA 3L3BA 4RXUA 5E9AA 4KB5A 4BASA 3QMWA 3K9HA 2JFUA 3OA0A 2YJ5A 2P78A 1QWOA 3N53A 3TCNA 1FBTA 1I1NA 2ISCA 4J2TA 1F8XA 3BQNB 5DNVA 2HR1A 4LF9B 3RAGA 3G3EA 3QE9Y 2GO1A 1EE2A 1M67A 1SRQA 2Z58A 3JWPA 2I6TA 4R83A 2JAUA 3K9CA 3CVXA 3T5DA 5KYGA 2CDCA 1OXKB 1IHDA 2CF5A 3M89A 3SX4A 1YA6A 4U3JA 1O89A 1N4DA 1O9HA 2PWBA 2SICE 3C5VA 4D0NA 2ZUBA 4IIXA 4RVCA 1AKMA 5BSGA 1T2AA 4QG7A 5IYZB 2XADA 4NICA 4M7OA 4L5CA 4CT5A 4TYPA 1NWHA 3LKZA 1QP4A 3OZEA 2C2ZA 1C9NA 1G41A 4IHJF 4BCBA 2K6GA 2JCGA 3AP3A 3GT0A 4ALLA 4UEQA 5JS2A 1KORA 1K7YA 4AMBA 3JQFA 4X85A 4B35A 4EA8A 4AJ9A 2EKDA 3MJ4A 4GVPA 3FLAA 1L7AA 3HJRA 2QRJA 3CISA 1HSZA 5ITZA 4GP7A 5AI9A 4F72A 1TKCA 4OK3A 1GUBA 2GLXA 3OD5A 4WK4B 3ZYCA 1H6AA 3Q7IA 4MV0A 2FPRA 2NWQA 5KHLB 3QYFA 4DCCA 1NVDA 3BE8A 2BEUA 3RSQA 5G1NA 1Z7BA 4CQLB 5LC1A 4HVCA 2REQA 4KODA 1HPLA 5TE9A 3C4JA 3CNQS 3I32A 3WBKA 5BOVA 4C0JA 3ZWNA 1XZFA 2H63A 3AWIA 1VJ5A 1AOXA 3GH1A 1JMYA 1Z26A 1GNTA 1ZNZA 3DWFA 1KKMA 3NH9A 4BNTA 3A2KA 3QU4A 5C5CA 1FU8A 1KVUA 4M0DA 2P79A 2XUZA 3CW9A 1M76A 3GXBA 1Y3DE 2ZU0C 3NH6A 3OOHA 4FR5A 5T3UA 3K09C 2I7CA 3T35A 4JX8A 1GKYA 5LZ4A 1EE1A 3O4FA 2CNWD 2VP9A 1Y1LA 2R4QA 3QVGB 5BSUA 3W5CA 1PV4A 2HSDA 1C7EA 2VHJA 2YR0A 3IBFA 3L1VA 3N76A 5HE8A 1GR1A 3QEMA 3V42A 1J2EA 1L5WA 4BX2A 1BXZA 4MQ4A 1Z4OA 3CLTC 4ZC1A 3L6RA 4FX5A 4E08A 1DAEA 3RWBA 5ECGC 1R8XA 2EYQA 1LTHR 1UJ4A 3EXAA 3VNAA 4C78A 4AKIA 4JP5A 1CUHA 3WKDA 4F6LA 1GRCA 2BTOA 2PS1A 2HRRA 2CVOA 5IBCA 2VZ0A 4CV1A 5DOVA 5JD3A 3OZAA 4NAVA 4RETA 3DQPA 3AI3A 1NDQA 2C4TA 2FMHA 3ROFA 4YQYA 1H2ZA 3N2ZB 4IWXA 1QKJA 3STUA 1IN4A 5FP0A 2AX3A 4CUJA 1Z5GA 3CVVA 4P86A 1F8UA 3BH6A 2AE2A 4X63A 1RI3A 5IDYA 1JFFB 1NKVA 2BFNA 1P72A 3D4BA 1AQ6A 1UEXC 1DBQA 1CY4A 3L1KA 1NFRA 2CL5A 4S3MA 4CLRA 2BFBB 1ORRA 4DZTA 5K3DA 4AKHA 1TYEB 2ZRHA 3QX9A 2VA8A 2VVTA 2ZBPA 3TMAA 4F5ZA 4N49A 1EXMA 2XT0A 2PIDA 2IY8A 5FQNA 3L9WA 3K1JA 1D1QA 4PU0A 5FYQA 2Y76A 1CQXA 4JQSA 3MTIA 3F7NA 4IL5A 1ZDMA 4FEYA 3WYGA 2JGIA 3JQFC 4KR6A 4JQZA 1U3VA 2WP8J 1LSSA 3TAUA 1F8GA 1MJGM 4RPKA 3KEGA 4WVFA 1CQIA 3MUNA 4MR7B 4QLAA 1PQUA 1I2AA 4UHEA 2CWWA 5C81A 1U99A 4YT5A 1KJ9A 3OLQA 1XRJA 3ZE8A 4A8JC 3I3OA 3M5PA 1QKKA 3SKYA 1I0LA 2DFDA 2FWAA 2HSJA 4G0VA 1BJTA 2AUTA 4B3XA 1DTWA 3FOAA 4UE2A 5AW2A 1DRVA 1Z34A 1NOIA 4BC1A 4W6ZA 1ZZEA 4UTVA 3KSAC 3KB8A 5AXAA 2I65A 2FZEA 2ZWMA 2IU0A 4J0DA 2JKYA 2PUWA 1GZ7A 3E5MA 4UFOA 1Y6GA 4HH4A 2P0EA 1SPXA 1UK8A 2CYAA 2J87A 3EEQA 4MLDA 4X7BA 1DKOA 1E5DA 3SIPA 4EG0A 2O0LA 3D2CA 2PZFA 4GD3Q 4DMUB 1KF0A 2P68A 4YDSA 1URPA 1NJ2A 3UOGA 1SVUA 1M33A 4G5RA 3TTUA 4C9BA 3OD1A 3C43A 2JBHA 3G2LA 4LJRA 3K3PA 2JJ8A 1RBMA 3HU1A 1E2MA 1GTG1 1O03A 1U5BB 4KUHA 5FOTA 2FW0A 1Y1SA 3QTLA 4D3FA 1NRWA 2P30A 5DMXA 2QWXA 4XTRA 1EVZA 1YR7A 5FR1A 3UJCA 4HDKA 3QHPA 4DLPA 4DAEA 2ZWPA 2X8BA 4IIUA 4NYJQ 4OHUA 1JTEA 2H9AA 3GZJA 3FYUC 4BHTA 5AVRA 3WGIA 1YZGA 2IEIA 2JFQA 1Y82A 3PFBA 1ATZA 3TLXA 1PL7A 2HA2A 2YNMD 3PUKA 1VCMA 4G1MB 4GAEA 3QIVA 1EX6A 1OXMA 2VRWA 4FLMA 1ISGA 3FPLA 1MGOA 1EZ1A 1RM3A 3BWYA 4REQB 1K7CA 3TIIA 2EKZA 3EVGA 1TMYA 3G7UA 4JCOA 1U8YA 4IXDA 1JG6A 3WL5A 4CUZA 3K4PA 3K94A 3SICE 2OXFA 2BF4A 1G7RA 3U7EB 4DLBA 1YCDA 1CULC 2IH4A 2IUFA 3L6CA 3VJMA 4OFXA 2YWBA 2WM8A 1F20A 5JBNA 3CUSA 4E2YA 5E9WA 1X7ZB 5B5SA 2O2ZA 3WAJA 4XUEA 3AF6A 4LDJA 2QRUA 2ZIXA 3VR6H 821PA 3UM9A 3GA0A 3ZQUA 2XNSA 1H1LA 3E9DA 4ANFA 4BV9A 2XKKA 3PX3A 3JALB 3QUTA 1WSBA 1DJOA 2Q2NA 3QJYA 3EMVA 1CEYA 5FJIA 1J21A 4NMWA 3T1HB 4C06A 4IQ0A 5GGXA 3BGIA 3HCPA 4GEKA 4OH1A 4A26A 1DG3A 3KSDO 4G97A 3X1XA 4FDAA 1I30A 1OLXB 2A1TR 2QN6A 1SQ0A 4MZDA 4Z1MD 2CHVA 4ZU1X 4M8SA 1EFLA 5FNVB 2GEBA 5A4FS 5EJ9A 1DO0A 1Q7RA 3EIOA 1TIBA 1KQ3A 3A25A 3DYVA 4WNAA 3S8YA 3ZDDA 1ZH8A 1KP3A 3DTNA 3HV2A 2ZJ8A 1F0KA 3BSYA 2HMAA 2QQFA 3GXOA 3DONA 2RK3A 3NWJA 5FCDA 3ZIAD 1QHSA 3H2KA 3EHDA 4BN5A 1ZD8A 5LOVB 3T3HA 3DFUA 3WTBA 3WGUA 6PFKA 1KS2A 4GH5A 4DE5A 4DLSA 1ABBA 5KEIA 3ZHUA 5CGZA 1LPOA 1CU1A 4YMIA 3MS2A 3X43A 4BQFA 3ITDA 1KO5A 2GXUA 2P91A 1DC7A 3WIDA 2Q3CA 4XDZA 4R8VA 2J48A 1G8KA 1V41E 5FBZA 1HOXA 1HQYE 3VJKA 1NE7A 1P2VA 3HJAA 2A57A 2VYNA 3AGPA 3DT8A 3DYBA 1N8SA 1UBUS 2JASA 3KD2A 1RHUA 3BUSA 1YQ9A 4MVXA 3D5TA 3COVA 4NBRA 4S35A 3FGPA 5HM6A 3CX8A 4OXQA 1NQVA 2E5LB 1KFBB 4S1NA 3FCEA 1KSFX 2ONYA 1L9KA 3QGMA 3WB0A 4CMIB 2HADA 4P4TA 3X3HA 3HXOA 4LJ4A 3V8RA 1N2BA 3P2KA 4XUGB 3RQIA 4D8UA 2R86A 3ILSA 2ZSAA 2KW5A 3FLBA 4UHFA 4YTEA 3VR0A 4BB6A 3CMMA 4BEJA 2TSYB 3VR4H 3CEAA 3VISA 4KXYA 2G1UA 3BL5A 5FUQA 2VOEA 2RGAA 2ZYSA 1G2OA 2I0FA 4G37A 2VP0A 4PVCA 3THOA 2XVMA 1E8DA 2FQXA 4JB3A 3PRKE 5HCNA 1J2YA 1GPDG 1CZLA 1XTBA 4RPHA 2P2CA 1Z3IX 1EZZA 1H8EA 1B16A 1N6NA 2RGNC 3PA6A 3UQZA 4JIMA 3GJ0A 4ZARA 3MJCA 1VSBA 3FCOA 5JNVA 1J49A 5EZYB 4JGGA 2JFHA 5H02A 4QYXA 3LXMA 3ED5A 4ZVQA 3LFUA 1X3LA 4KOEC 1JHXA 4PSDA 4CDNA 3D4OA 1Z6TA 5AK0A 1LX7A 1NQXA 2Q0SA 1OWMA 3WQBA 2PMKA 3RJTA 4NDNE 2WAYA 1GYRA 3PJEA 4JJ6A 2ZM5A 3H11B 1MC1A 2Q1YA 3A0UA 3GFRA 3NGMA 4M1ZA 5DBIA 4M0FA 3LFHA 1YUMA 5JQGB 1RIIA 4JKYA 1SELA 3F1LA 3B13B 1US8A 1W35A 3IAUA 3IIJA 3W1WA 4CHGA 3F7TA 1HEYA 1JJBA 3BHJA 3PG5A 4UDOA 1YRYE 3AI7A 1B15A 4RMIA 2ZZKA 4FK8A 4J1SA 1XLTC 2NT4A 4L4YA 4B5KA 4PX9A 3RF6A 4CMGA 2IXEA 1QV6A 2IY7A 2BP7A 3HA2A 3OJWA 4RLFA 3VX3A 1J9EA 5ADWA 1UMBB 4LHWA 4ZGBA 2QROA 1R8JA 4CT0A 4IX1A 3CEHA 3EODA 4DDWA 4TPKA 2ZBUA 3GUZA 5EI5A 3D4IA 4FFWA 4B74A 4ZAWA 3AUXA 1P8JA 2EG9A 2HMWA 5M3BA 1GYPA 1V39A 3COSA 1YQXA 4QRIA 4RGYA 1C30A 1G21E 2OVBA 5JW6A 5CFQA 1NLYA 4AMZA 3PGLA 2ASEA 4MI1A 1VBNA 3BREA 2BEKA 2X58A 5L7TA 4NU0A 1B0AA 1YDMA 4OP1A 4EW1A 1RAHA 2GXAA 2CFCA 1U2GA 3FWPA 3A1FA 4TMKA 1PGQA 4W9NA 3BBPA 5FA5A 1TMGE 4ZVVA 1B6GA 2NZVG 4KI7A 5BUQA 1KJYA 2JGLA 2B8TA 1QVRA 1U2EA 4XPZA 1UDRA 2XDWA 4MMYB 4OQZA 2F3PA 1DBSA 4GSLA 4PN7A 4A10A 3KOOA 2DR2A 1ZGHA 4EB6B 1QUFA 3PDWA 2GZMA 1ORTA 2GCIA 3A27A 3O1IC 2JRLA 1F38A 1CVRA 4TN1A 1XRSB 3TIFA 1VPWA 3NLLA 1PHPA 1BDIA 4KHPB 4Z5XA 1HT0A 2YC4C 1Z16A 2Z8YA 2R44A 3EYWA 1IAQA 3PDIA 4M7PA 4PZ0A 4RENA 4B3MB 1UC5B 5IM5A 2ZRDA 4HD8A 5JLAA 4NJEA 1JU4A 5A6SB 1EG2A 3DT9A 1EBFA 3KVOA 1BWRA 4LTMA 5DN6A 5I9TA 5LL6P 3EPLA 1NVXQ 1XALA 3O2JA 1RP1A 2IZ7A 5JEDA 1LLCA 1O5TA 2PAAA 3H42B 4WNYA 5AJYA 4BB5A 5JDCA 4G8BA 3DEZA 2VDQB 3H65A 3MTQA 5T8KA 5E7QA 2IDZA 2FNAA 1Y81A 3KSUA 4QHSA 4Z4CA 5TNXA 2X42A 4MJLA 2OHGA 4DIBA 1Y4AE 4MYUA 2Z9CA 4WJKB 1W1UA 1AUPA 2WF6A 3KR9A 4INAA 3D5EA 3NVMB 4ITRC 4V0LA 1Y3IA 2AN3A 3HSSA 1SEVA 4JEUA 5CMLA 4D80A 4KQJA 2I3ZA 5EJAA 5CVEA 4EHDA 1FY2A 4LVCA 3QOWA 4NOMA 2JPDA 1Y3BE 1TYAE 1WR8A 1J5EB 1PZMA 4MUBA 3ONDA 4JVLA 1X15A 4YRRA 5EMJA 1JS1X 3SZGA 2FZLA 2IPMA 5TX7A 2GAAA 1ZOPA 4MUIA 1U8UA 4ZI3A 3OTHA 2IYQA 1M75A 5FKJA 1BQEA 4AQDA 4OH7A 4UVDA 2FRXA 3A7DA 1V25A 4NP6A 4R16A 1SG0A 4ZQFA 1XRNA 1UMBA 1P45A 3HRIA 3KLBA 1FMTA 3KHUA 5AKLA 5LYJF 2V7BA 4I1YA 4R1QA 1WNTA 3KNZA 3C6KA 3L41A 4JP2A 4BMPB 1G17A 4N5NA 1G19A 2W2TA 1YMVA 4EY4A 4DMGA 3AR9A 1WVMA 4DW8A 5K0NA 5JMOA 1TLTA 4F4IA 3OSUA 2Y27A 2IQ5A 1OC2A 4BLVA 3ZLTA 1O6BA 2A67A 2CHGA 2IOFA 4M76B 2KBEA 3L0SA 4TTTS 1P7VA 3OT5A 3JQGA 1QRDA 1FXUA 3QQPA 4FIZA 3I5AA 3EDYA 5EVCA 5KSWB 3A28A 4RL4A 3MD9A 3TPFA 4TV9A 4JBNA 2ZSJA 4AJJA 4GUAA 1VBKA 1UXOA 2V4ZA 3VKUA 3VUFA 1GEGA 3IT2A 3ZVMA 4QOSA 3HU5A 4OLBA 5B37A 3IVGA 3NOOA 3DV0B 1OI7A 1ZAKA 3OZVA 3TEFA 10MHA 4PPNA 2R7NA 3DBHB 1A9XA 1PS0A 1U0OC 2HQ1A 2NO4A 2VDMB 4AMGA 1N6RA 4LYDA 7AT1A 2HDNB 4BNHA 1QAQA 3AU9A 5IXJA 2CBGA 2WFLB 4O0LA 3KQVA 2V6BA 2G0TA 3ZGVA 3ZU3A 1RTKA 4MW6A 3OQNA 2AVNA 2QKYA 2FPWA 1DXYA 4KQHA 3RI3A 1Y8QA 4HDQB 5EZSA 4MH0R 2R87A 1K63A 3QLVC 1SXJE 2OLJA 4YJ2B 1LI5A 2YJ6A 4DNQA 2RHDA 5DWQA 2UYCA 4FXPA 1MJNA 3KL2A 2QLJA 4A2WA 1E69A 3G6KA 4P84A 4DJJA 4L6IA 1E3TA 1G7TA 1GZDA 2H48A 4JD5A 5C34B 3D7SA 4HLUA 4AX8A 2UXDB 5F7JA 1V6CA 5FBQB 4ENRA 2QORA 1ZNXA 5E7IA 1VG0B 5CJJA 1J23A 4FFDA 4NBWA 5AK3A 3VR3A 2B8JA 2OCGA 1NPYA 1TF5A 3EEOA 4B2PA 2IP2A 5L3SA 3DMRA 1UBTS 3OQIA 4QPDA 4Z4IA 1A9SA 1Z25A 4MVJI 3RVKA 1RYYA 1W5EA 4OBEA 3T0IA 1FTQA 2C5HA 2CKDA 3LC2O 3DEKA 1S7CA 3WNVA 3OJFA 2GXSA 3IAXA 2P2DA 3F5DA 2ZW9A 4RXTA 2JJQA 4U1RA 4UTXA 3ZDYB 1T8RA 4LTDA 1KVSA 3QEOA 2XMZA 4L9WA 2FR8A 3BMQA 1VE9A 3P94A 4RAQA 5DGHA 5B64A 1SC3A 16PKA 3Q5EA 4LJYA 4NZMA 1AKTA 3QXCA 3H6KA 4H4DA 3S1AA 1YI0A 1AC5A 3KB1A 4YRQA 1JLRA 2DSTA 3AB7A 1JG3A 5B1YA 1ZBDA 1R6VA 1DEXA 1V95A 3PNVA 3UJPA 4DIOA 2QAGC 4G5GA 5DM60 5LQDA 2VP6A 1FNBA 3HBFA 4X1KB 5T4EA 3LQRA 4BZQA 3U5ZB 4HSEA 4N5MA 1SC6A 3VC7A 1AQNA 1ZC3A 3DA8A 2HA5A 3ZWOA 5LQJA 1SOWA 4W63A 3AJ9A 5AM4A 4QTYA 3KJZA 4YMWA 4Y2SA 1T5DX 3ZWVA 5K3FA 3MWFA 5DP1A 4DA0A 2QPTA 4RF5A 3FJOA 1GAQA 1W2GA 2BONA 4FFMA 5AH0A 4CL2A 2QTCA 1DXQA 2XE4A 2GJAA 1R6BX 1W0JA 1ZG3A 4HDRA 4D9KA 4TTSA 1Z6QA 4TSRA 4UULA 5DEOA 4OXNA 1RAGA 2OO7A 3BJIC 4P80A 3Q7TA 4J29A 3ZCPA 5DASA 4TXLA 5I7UA 5K0BA 2XCIA 3U1BA 1Y8RB 3T15A 1DRJA 2Z3VA 2AC2A 4KR2A 3TEJA 3LPDA 3DE2X 2HF9A 3AEQA 4AMUA 1G4UR 2QS9A 4Q1CA 4WY5A 3TSYA 3U4CA 4P2GA 3E61A 4GKVA 4RESA 5T4HA 1JAXA 3T5PA 5FFFA 4DPKA 2BFFB 1GA1A 3A4IA 4PG5A 2HHHB 2YIMA 5LZ7A 3X2SA 1JDJA 1YRBA 2ZRBA 2UKDA 3R9IA 1V37A 4TT3A 2O54A 4X20B 4V0MA 2OOKA 2NMVA 5K3BA 3PUZA 4OSPA 9LDBA 2OV6A 1Y9AA 3LF1A 4OYRA 1U3DA 4PIVA 4MPJA 3KO8A 2HD4A 2RBEA 5BSHA 3QEJA 4DFDA 2HK8A 2II6A 3MUEA 2N75A 1FLDA 3UUWA 2DKOA 3KTOA 3LBAA 4NYJR 4DXHA 2AQIA 1DAMA 4LDNA 3RASA 5FQOA 4IJKA 4RK6A 3KQOA 1J9GA 4RVFA 5K0TA 5FPQA 1VBFA 2C5FA 2GCEA 5KINB 4Y6LA 1KAHA 5ELMA 2QOEA 3WLTA 4URHA 5TC4A 4AT1A 3LCMA 3M7IA 1H05A 1XJCA 1Z4QA 2GPJA 2CLHB 4CWAA 1NOKA 1NQOA 2QPOA 2BLLA 3CG0A 2FQYA 4YUXA 4KI0A 1H5QA 1D4ZA 2P35A 2QTZA 2BGIA 1UL1X 3H8JA 3NC4A 4NH4A 1H85A 1V11B 4ICIA 1DQSA 2ZRFA 4NVRA 4NL4H 3FWNA 3V80A 4Y0NA 1T2VA 3BC1A 4FNOA 4B5LA 4LHZA 1FYFA 3UV3A 3OAAA 1H4TA 1CQIB 4MR7A 4DWJA 1EDZA 2VPQA 1N2CE 3WSTA 3OPYB 4EHIA 1SOUA 2IW1A 2R00C 3PC4A 2HWWA 1CJUC 4ENSA 2PQ0A 1WPXA 4W8GA 1I5EA 5AM0A 4A6DA 2CMGA 1JQLB 3BHMA 1ZCZA 2HPAA 3EPPA 2PXXA 4XYBA 5TARA 2QG6A 2D1YA 1M6VB 4N65A 2B98A 4WINA 4BGDA 2Z5FA 1KJJA 3JD1A 1D0IA 3SP1A 2G40A 2A0XA 3IQFA 3B1JA 1PJ8A 1PR0A 1QANA 3LDHA 4EHBA 2AXNA 3TR5A 2PCJA 5LZ2A 4D4IA 2IUUA 2J30A 3TTSA 2E37A 3LY8A 4BV8A 1RABA 2A5DA 4D3YA 1OXSC 4JFRA 3K35A 1EZ4A 1XQYA 2CE2X 3P4XA 4N5DA 3UICA 4N6GA 2F9FA 3GFOA 5F1KA 3ILVA 3RT1A 1U7WA 3VBCA 4EX7A 1RPZA 5G1OA 1NLUA 3TDKA 3B60A 1NVWQ 3HG7A 1QGDA 2Z8ZA 1EESA 3EXG2 1TGYA 2CLKB 4Y98A 5CLQA 3GO4A 3X2FA 1KRHA 3BD9A 2HAEA 1KZ6A 3EHEA 3O4RA 3QUBA 5K0LA 5EAIA 2GZ2A 5JHGB 2KE5A 2RGEA 3Q1KA 1X1TA 1WB9A 4F2GA 1SOVA 3ILHA 2DE0X 4BFUA 2ZRKA 3ED1A 4PQEA 4M0CA 1MQ9A 2FPSA 4C43A 5FPKA 2BD0A 1Z6ZA 3EGXA 4JI3B 1KQGA 1Q7TA 1HZZC 3J80A 3D2BA 2UYGA 1XAJA 5L3QB 2EX1A 4M0LA 2BSQA 4BAZA 5I7WA 2R7AA 2J8ZA 3TUJC 4MRMA 3ZJ4A 5KNDD 2Z6UA 4C5CA 2ONJA 3V33A 1K0FA 1KBQA 4EDFA 1XZHA 1TF7A 3B48A 2M32A 2MR6A 2ABWA 3P97A 1HQCA 1PEDA 2GFHA 3G2MA 1E1QA 4LS3A 5A7FA 4BFTA 3MMSA 1JHAA 3O4VA 4K6MA 3RM3A 2CF6A 3QBEA 3FYDA 3TXYA 2WJGA 3GUHA 2CVPA 3RTAA 5A7GA 1FP6A 4P8RA 4GMKA 1IIRA 4YX9A 1F1BA 1OIWA 1TU3A 1OA0A 3WI7A 3RS2A 1HLFA 5LXTA 1CRLA 1KC1A 3SR0A 2XMPA 4YIHA 2J5KA 3CSUA 3VNQA 1H3NA 3R7AA 5AVOA 4AZ0B 3UK2A 1XWFA 5CB4A 1KFJB 3PDIB 4Q7EA 4HAYA 3KV1A 4XKJA 2GD6A 4BO9A 1BW9A 1QE5A 3DEJA 3HCBA 2BI8A 1K4KA 2Y1OA 3O95A 3OUZA 3I42A 1JKXA 3INNA 3CRW1 4I36A 5F3WB 1ZD4A 3OE7A 1GKLA 3WGGA 1GVHA 2FZ5A 4GR9A 4DY6A 5EJMA 4F6RB 4P0QB 2A88A 3NHLA 1U0EA 3AETA 4W6QA 2PGDA 3HUFA 2DTXA 2WF8A 3QKIA 4FMBB 5JAQA 1E1RD 3CIOA 3RH0A 4LISA 4R2XA 1AT1A 2RMKA 4H7HA 1ZPDA 2W0SA 3BHNA 4D5GA 3H9JA 1W0KD 3OZWA 4AM8A 4BBPA 5CFNA 8ADHA 1Z62A 1M0EA 1UMDA 3MT9A 1LSOA 1DWQA 1HQDA 5L9AA 4TWRA 3KQMA 1V8ZA 1N7HA 2I71A 4D98A 4MITA 1L6IA 1HFEL 1U9IA 1ZI6A 2QNBA 2XGOA 3JRXA 4NR0A 4QTZA 4TM8A 2DBYA 2X8AA 3AKYA 3BULA 5IKPA 5HGJA 1IVYA 3TL6A 1R0XA 5NULA 2HJHA 3PVZA 4NEHB 2V9ZA 1LBEA 2YWJA 4DARA 2AI1A 3Q11A 3WJAA 4EUNA 3IERA 1KH2A 3EOBI 1XZQA 5AVJA 1J4AA 4G8DA 3QMMA 2XOKD 1WL8A 8MHTA 4H7PA 5D3QA 1KIMA 5IT9A 5KNDA 3K1TA 3KWJA 5AUNB 1QOPB 3KKNA 4LQDA 4RFSB 1P9RA 2XTAA 1RPTA 4XWYA 5AUOB 1V71A 2CLCX 4ACBA 4EGSA 4F86A 1VPVA 4LPKA 1QIKA 2Y0PA 3EEIA 1ZMXA 2DH5A 2SKCA 3BMCA 3OJLA 1IOWA 3N0XA 3QKTA 1RWOA 1I8TA 3WIEA 2O3QA 2ZQ5A 3C24A 3D1VA 1SQ5A 4NCIA 1W49A 1EQUA 4BTVA 5IBQA 3AVTA 2W9XA 4LDQA 4WLFA 3NOQA 3R40A 4BJ6A 3F46A 3IEUA 4HNSA 5HHTA 4QYIA 1WUKS 5DNYB 2I1VB 4ZC8A 4G26A 4L0CA 4PAQA 3FRHA 1YQQA 2FU5C 3PUYA 3GP8A 1LJ8A 2R5WA 5FWYB 1C3OB 2GTPA 1ISJA 1N6LA 1GU0A 4MWDA 4JLWA 2BI7A 3PT9A 4B45A 4EZEA 3CV3A 5M2QA 1QK5A 2ZSFA 2CUKA 3UKOA 2J0QA 1KMHB 1O1YA 1MQSA 1SU8A 3B5IA 2W2KB 3AUTA 4FYMA 4G5HA 1ACMA 2WWFA 4ZHQF 1DAFA 3SLKA 1PU2A 2QD2A 3TRDA 3M1AA 1IQUA 1JJFA 4I81A 4DR7B 1C41A 1II8B 3CLVA 3WOVA 1Z74A 5KTMA 1C2TA 2WLTA 1BCRB 1KKUA 2Y2VA 4GLLA 4M86A 5AVQA 2D2IA 4G85A 2PJRA 5B6JA 1V3QE 3G23A 4FDUA 4U7WA 4BVLA 3U39A 2GFQA 3NYIA 2J3QA 3CMCO 3FSRA 1TKAA 4FYVA 3UV6A 4L2IB 4AJKA 4OX9B 3K6KA 3WG9A 1U11A 1Z28A 3V1MA 2RGDA 3FUXA 1U7ZA 5DYYA 1N5LA 5D5QA 4EY8A 3SDSA 3KQNA 1T29A 3EJ6A 3WLAA 3V9PA 3C5HA 4QYTA 2DPXA 1TD1A 5CA1B 1ILEA 3SQXA 3EGEA 1GPLA 2GAIA 1JI0A 3F4BA 1ZW6A 4TRNA 3I12A 3L7AA 3RC2A 3WIUA 3AOEC 4JK3A 3B6MA 4RH0A 5BSEA 5L6LB 2XKBA 2R5NA 4PGFA 4FYJA 2GF2A 5JADA 1UPBA 5GZ1A 2Q50A 4Y2QA 4NBKA 1EWKA 5K0FA 4MAMA 5EHNA 1BYUA 1QH9A 3WQSB 3FTNA 4IDDA 3G13A 2XOEA 1W6RA 3F5MA 1UT5A 3BKXA 2MYNA 1N32B 4EG1A 4CMHA 3R7LA 3SQOA 2NQTA 2JJMA 3TFWA 2BGGA 4LRWA 1QNFA 2ZYRA 2CV2A 3FETA 3LIPA 4RQUA 4BU0A 2DAPA 3I4FA 4BX8A 3WZLA 3AHIA 2IOHA 2GJ4A 3GAMA 4W7SA 4FFSA 3EPRA 3VYVA 3HSYA 4PONA 4ARZA 4LMPA 1CRZA 3OY2A 2J0UA 5JYDA 3GOQA 1OAOC 3T52A 4UMEA 2ORWA 1PIWA 2X8JB 2PKXA 1J5XA 2EW2A 4HWSA 3FPAA 4HH0A 4MV3A 2WU1A 5HMLA 3EUFA 3QIAA 4AQYB 2P27A 2KM1A 1XX6A 5BQPA 4ALIA 5TQJA 4DNOA 5LNK6 2VRCA 4CR6A 3THRA 1ST2A 3IPYA 5FL7A 4RA9B 1NW4A 4U3JB 5DHUA 4NKRA 5EMNA 4PBSA 4RTPA 4U9UA 3A3OA 4UFNA 2JFBA 5LJIA 3A1UA 2LTAA 4YCJA 5K9ZA 1LQUA 2HTEA 2H6EA 2R6GA 2RGBA 4ZOLA 5JD4A 3GHHA 3RWMB 4B3JA 4U7JA 1QR2A 1THTA 2AA3A 3BXHA 3OZUA 3LI2A 4ZQIA 4RANA 1O4WA 3LRPA 2PH5A 4LW8A 4DHWA 2X0JA 2BVNA 1VMKA 3D2LA 3U0VA 4GYWA 3RU7A 3ITNA 4LGMA 4RJ2A 1ZUNA 5MFZA 3PHBE 4LNUB 1DAKA 2WFAA 1R6UA 2YRXA 1RM0A 3N8GA 1W73A 2DBVO 2MHCA 1U90A 4ZYTA 5BYBA 5BUSA 1R5NA 1PLJA 2TECE 4M9ZA 3CLRC 1CFZA 1CDDA 1IEQA 1JSLA 1SHUX 1TPYA 2WOOA 3BZWA 3FMFA 4O1IA 3TLMA 4YHBA 1ODLA 5BYAA 3V9AA 1SB9A 4HTFB 1LBTA 2KX7A 4RM3A 1IXRC 1P39A 4DQLA 2OMKA 3KYCA 2DKNA 2XT6A 4Q4AB 3VNRA 3FM9A 3PYMA 3EW9A 4PGAA 1DPFA 4FINA 2NTVA 4FB4A 3MMPA 3PUWA 1BWSA 3T9FA 1XMXA 3A2MA 3AL2A 1DBVO 1QX3A 4GM1A 4QTTB 1J1ZA 5IEJA 2MT9A 3RVOA 2JA2A 3QVXA 1DZIA 3RS4A 2QL5A 2NU8A 5F9HA 6REQA 5HE9A 2ZKLA 5TEVA 2HYIC 1JYEA 4NWIA 3T41A 4U0JA 1AQLA 2WVAA 1G66A 2BMWA 1HFWA 1L8QA 4ND4A 4UM5A 4D8TA 4HAXA 4F7DA 4DT1A 1AK1A 1PWZA 3ZPXA 5KHAA 2JGNA 3E9YA 1W0JD 2HUPA 4L02A 2CKMA 1R0SA 2ZOSA 3R5HA 3AESB 3S6JA 1JYSA 2VHTA 2LE0A 3SNHA 4XQCA 5HA5A 5AKZA 3EVNA 3CINA 4E5NA 1WPQA 1G2IA 4GZ6A 2F1HA 5FOSA 3COPA 3N2KB 5BN4B 1POWA 2WHQA 3RKRA 3G9UA 5CFRA 3P4UA 4KREA 3W2TA 4HDNA 2WA1A 3CLHA 3H2ZA 1TU4A 3T06B 4GPAA 2PXCA 2FW7A 2GPNA 4FYYA 2ZTSA 4D26A 4HSGA 4AZSA 3ADCA 4BQRA 1P2GA 3LCVB 3O73A 3UT5A 1NC1A 3T7RA 1I2CA 2R6JA 5DISB 5IJ9B 2JH8A 5C46F 5JPDA 1XC7A 1T5HX 1U0RA 2VWGA 3SR3A 4JQYA 1IWPB 1YAHA 2XYQA 1XNHA 2FE1A 3IMGA 3QBJA 2WAAA 4M1SA 5G0SA 3SKXA 1NHWA 2VDOB 2ZRPA 4GX1A 4HEJA 4MQ6A 3PNBA 1L5RA 1DKPA 1L7XA 4L27A 4DUGD 2L82A 2R85A 3T8YA 2YW2A 1P7WA 3MMZA 3L4BC 4UNRA 1E1MA 1P2DA 1QR6A 4EW2A 3NAQA 1B0UA 1TEHA 2RKOA 1DE0A 1HYBA 2PJDA 4ONEA 4Q0MA 1OZ0A 5AIAA 2Z30A 1DHRA 1NF8A 1XTRA 1SBHA 4RIIA 2Q5QA 5DFAA 5JRJA 2E4WA 4CKCA 2A8YA 4P31A 2YFKA 3HCAA 4AJ1A 4BEVA 3VYTB 3VDMA 5A3JA 2VATA 5L95A 4Q3AA 1VSUA 1USGA 2R6CA 1IUNA 1L4FA 4KXFB 4PX2A 3D0RA 5EYPB 5TQ0B 2IIVA 1Y9JA 5TRTA 1IXZA 1U3TA 1NVTA 1O57A 4MNTA 3OZ7A 3O7MA 4RHCA 2ACWA 1VL2A 2QRQA 1U3GA 2XKJE 2SECE 2GHQA 3ER9A 2AFHE 4ZCLA 3DEYX 1JE1A 3PGXA 4JLSA 4BAUA 3SQWA 4RY8A 2BY4A 1ZSNA 4ZQHA 3UK0A 4OXIA 4MRSA 5CA1F 2QN8A 2ZTUA 1V5IA 4JVOA 3DAOA 1JAIA 4ZQCB 5IAKA 1ZMRA 2UZIR 2J9XB 3ACDA 3KAPA 3NTQA 1M7HA 1X1QA 2A5LA 2ZRMA 1CPYA 3BK2A 3T12A 5F23A 4NE7A 3BXGA 5ARBA 2VRCD 2QMHA 2W4QA 4BKMA 2BM8A 2WPNA 3PFCA 3EWNA 5EPEA 3S2SA 3SFTA 4YRFA 3TNLA 1JL3A 1N8TA 3N6RA 4GOLD 2GOYA 1XN1A 3VBEA 1EK5A 4BKQA 3ZKAA 4FFNA 2PR7A 3A1NA 3T5BA 3TJMA 1GLNA 2DUJA 1EJ0A 1IFXA 2ORVA 2EF0A 4DQ0A 2ANCA 4BMZA 4HZGA 5JZMA 1NT4A 4ZQGA 4MCIA 4ND3A 3D8NA 2DP4E 2WB4A 3VX4A 2IS1A 1X9HA 4FFOA 2NU9A 5CIQA 1O96A 5EJ4A 2Q5EA 2CNBA 5DLPA 3K0CA 4XM1A 4HNGA 5C8ZA 4YYEA 4OAPA 1PTJA 3FGZA 3OFND 3GNQA 4BVJA 4DCPA 5BR8B 3QU5A 1VJ1A 1YOVA 1NMQA 2GH1A 5KSZA 5KYYA 5ILQA 3ZWDA 2JH9A 2YVUA 4G4GA 3UTDA 4D4KA 2YXLA 5FTJA 2ATCA 2Q8NA 2AMYA 2WMYA 3EQ7A 3AO0B 1FLNA 3CBGA 4S04A 1OPRA 2YFYA 1U7XA 1XJ5A 1ZJWA 1ZJ5A 4IFIA 3PQ2A 5CB6A 5FV4A 3KFXA 4X6LA 2XUGA 1PSZA 1D6SA 5IKEA 2W6JA 3JZDA 1USVA 4L4ZA 4P3KA 3WNZA 1JLLA 2B94A 3KE9A 3QXGA 3A11A 3LY5A 4KO3S 1NNI1 1Y8RA 2VN8A 3ULKA 1AHPA 3TZLA 3R3UA 5LKAA 4YP6A 1LEHA 1VGVA 1J8FA 2REBA 3QEAZ 1QFZA 3R3VA 4QNMA 1I0ZA 5A9RA 2P9CA 3N58A 4L8VA 4G2TA 3OFSA 1ZK3A 5E6UA 4AZ0A 5KZMB 3EDCA 3OIGA 1YC2A 1DFIA 2JFGA 4Q9IA 2OCAA 1U1FA 3PEVA 4LA4A 3NTXA 4YDQA 4OP3A 3GRCA 4KG7A 1SNYA 2X0RA 3RSSA 3PE4A 2XUKA 3RTEA 1V45E 3K0BA 3AG6A 3UAGA 1ZJJA 2XR1A 2OHHA 3QLEA 3A6KA 2B20A 3QPDA 4ENWA 5IDXA 3ZC3A 5EUCA 1E9SA 3R4CA 2AS0A 2XUAA 3RIGA 1ANKA 3E7WA 2ADOA 2CDNA 4W82A 1PG5A 1KI8A 3A3KA 2X7XA 2J46A 5DW3A 1AA9A 1C5KA 4I3GA 4R84A 5DBHX 2H5EA 1HE2A 1OT3A 4CLOB 4KJZA 1T5BA 1W44A 1WCIA 2GEJA 4N5IX 5EP2A 3U80A 1YJXA 4YJ3F 3MA0A 1KK0A 3HB7A 5EESA 1KQFA 1TT7A 1VL1A 1J8YF 4K9KA 1YL7A 4F9FA 5AHRA 2VJKA 4IFEA 4R40A 4XD2A 5BSMA 2FE4A 2Q27A 1GNSA 1RXEA 2HNAA 3UUEA 3AM5A 4ZRNA 1ZIPA 4UBKA 3F49S 3NIBA 3EW7A 3PKJA 4X61A 3D8BA 1X9GA 1U0GA 2V55B 3OBBA 2O07A 3V3KA 4P6VF 3IT3A 4EZIA 1N57A 1OMOA 3O1JC 5DO9A 3H7AA 3TZCA 3TVDA 5BMVA 3G6WA 4FQ5A 2JBAB 2PBFA 1RAAA 1BHJA 2QQEA 3RUHA 3ENVA 3VDNB 1BC5A 1NBEA 5CH3A 3ZU6A 4GRDA 2Q46A 4PYQA 2OXIA 5ALTA 1GRNA 4M9XA 4XVRA 3LLMA 3SY8A 2XMQA 1NP7A 4I6JA 2ZWVA 5PGMA 3GLSA 4LXTA 3RFXA 1HDRA 1NFQA 3PSHA 5KNLA 2EBWA 2QE7D 3BN3A 1SUCA 4WZBB 4I2NA 5EWMA 4GR5A 2J1LA 3EPJA 3E15A 1CB0A 1U0BB 4FW8A 1AHHA 4NFHA 1T5SA 4Q34A 5A06A 1DJMA 3STWA 1JAHA 1PTKA 4A92A 1D2HA 1YMUA 5GADl 4IGEA 4WD3A 3WBJA 4Z51A 3VVLA 4B3RB 5CB4F 1GPWB 2NZ8A 4IDCA 3ME5A 3U3XA 4PPQA 2YHUA 3DAYA 4XCQA 2QQ0A 4BJHB 3DBOB 3FNRA 5JZVA 2FUEA 1VGQA 2H1RA 1WEKA 5B57C 1P80A 1MDBA 2I67A 3QZUA 1CERA 1R5BA 1IZ9A 2H52A 1NQTA 2YL2A 3M4YA 2BHSA 4KNWA 1CE8B 3VU3A 3ZV7A 4Z3OA 3TIVA 3CZ9A 2WHEA 2X2EA 5H70A 3OPXA 5FT9A 5DLEA 1QLJA 3SHVA 3WDKA 4POOA 4KPGA 4M2LA 3FMGA 5D7BA 4NCBA 5EIXA 1N3YA 3JQGB 2BPOA 2FSSA 2DF8A 2I62A 3K4HA 3KZOA 3R24A 2AN4A 5ALNA 5J4KA 1A2KC 1G8YA 3H1PA 3ZH9B 3C48A 2R47A 3FUUA 4AXBA 1GEEA 2WYHA 1ZI9A 1EA5A 1U28C 4ZGGA 4XB2A 3VR6A 2BDTA 3Q3VA 3DXFA 2BW0A 3SYMA 4L9SA 3W06A 5JJKA 5IAAA 4JJKA 3VU9A 2P69A 5FYDA 5JCPA 1C4WA 2P1RA 3DEAA 3NR2A 4KRFA 2JGEA 2E4AA 1WRBA 1C14A 2I3BA 2PLFA 2RAFA 3EZLA 2NT3A 3QHQA 1NUAA 1CIPA 2C8VA 5EMHA 3HWWA 4UASA 5EJ8A 5FUMA 1U65A 3BK7A 5CT8A 4WMLA 2EATA 4NDZA 5FFNA 1D4OA 3JQ7A 3MXTA 4M99A 4DG5A 4RTRA 1CYDA 4DEVA 1E1YA 3GVCA 721PA 5JI3E 3MLAA 3VZQA 1VSVA 5E2IA 4BDSA 5CIWA 5ESWA 3CZQA 1YXMA 1ULUA 2NO0A 3HS3A 1YL6A 1Z8NA 2WQZA 3UJHA 2VYVA 5FTLA 4ZT7A 3T9CA 1QO0D 1GN9A 1NIPA 3H3FA 3VH1A 3WADA 2FH5B 3DXYA 4CM6A 2QP9X 3PGVA 3IVXA 3MBOA 2FMFA 4OGGA 4TL8A 4CBVA 1NFFA 4E5YA 1R9MA 5DHRA 4IIGA 3I4CA 4JU8A 3DV2A 4UZSA 4MP8A 1GSAA 3WKCA 4CQNA 4TTAA 2VK4A 1FRVA 3JX9A 4NFYA 4BNDA 2VHQA 3DUWA 2FETA 3MRVA 2ZI3A 3OHSX 2XF8A 2PT7A 4J0EA 3CRZA 3PNYA 3T3MB 3WQHA 1F7VA 4QO8A 4QEZA 1HDCA 1N5DA 2B5OA 4IJ5A 1AGXA 4ND7A 3NEJA 1XLUA 4L22A 1LBSA 4XH9B 2Z3ZA 1N6HA 1D1SA 4TN5A 5CVCA 2M98A 4FT4A 5CA0F 4MDFA 3LT5A 2DJ5A 2OM2A 3PKIA 4CIBA 5GVSA 3H7IA 1D07A 1JALA 1WU7A 5ES4B 1Q6YA 4BVGA 1CY8A 1VLQA 4NLLA 2ROQA 1MH1A 1RQGA 4NU8X 1AK9A 3R0VA 4KHZA 4YONB 3UHOA 1O4VA 2A9KA 3QY9A 5F76A 3CPEA 3GJSA 4PLWA 3DS8A 3SQDA 4J1T