2FQTA

Crystal structure of b.subtilis luxs in complex with (2s)-2-amino-4-[(2r,3s)-2,3-dihydroxy-3-n-hydroxycarbamoyl-propylmercapto]butyric acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteine lyase
publication title Design and Synthesis of Substrate Analogue Inhibitors of S-Ribosylhomocysteinase (LuxS)
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 44
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 2fqtA00
1JVIA 5E68A 2FQOA 1INNA 1J98A 1VH2A 2FQTA 1VJEA 1JOEA 1JQWA 1IE0A 1J6WA 4XCHA 1J6XA 1YCLA 1VGXA 1J6VA
chains in the Genus database with same CATH superfamily
3AQOA 5JFEA 3GTGA 4KC6A 2GSNA 1O27A 1TWHA 3HOZK 3SZYA 4FZBA 4LOWA 2JA7K 1R9TK 4KB4A 1SFOA 3S17K 1EK8A 4MEYA 5TMCA 4A3FC 2E2HK 3GTMC 3GDZA 3NUHA 1I50C 1YCLA 1TWCK 4BBRK 3H3VL 4LK1A 5IYBK 1ZYRA 4O2DA 3S1RC 4GZYA 3GTJC 3JSTA 2B63C 3BP3A 4BBSC 2NVXK 2FQOA 1WIHA 4A93C 2R92K 3S2HC 3MMLB 4KMHA 4XSXA 3Q3QA 4BLBA 3CQZC 2XCRB 1WORA 4BXXK 4A3MC 5L46A 3FOEA 4Q5SA 2CFAB 4G0VA 1EI6A 2JA8C 3S16K 2PA8D 1O2BA 5IYCC 2GAGC 2NVYC 2V6SA 3S15K 1IL2A 3L4JA 2RH6A 1F93A 4KMDA 4LJZA 4PAAA 1G51A 5IP7C 3S2DC 1Y1WC 3DXJA 2A69A 3BUEA 4YG2A 1F9NA 4A3GK 4WJ3M 2WAQL 4KDDA 1AB4A 2GSOA 3HOWK 3AD9C 1VRQC 3FKIC 3H0GC 3G4AA 2YU9K 1RU0A 4KATA 1O25A 1ISEA 3RZOK 3M3YK 5JVOA 2R93C 3S14C 4KAWX 1ZBSA 1VLOA 2V6TA 3A8JA 3S1NC 1O2AA 1BDFA 5IYDK 3A8KA 5IOSA 3AH5A 4X6AC 4A3IK 1IW7A 2JA6C 1IBAA 3GEHA 4RMFA 1R9TA 4G0UA 5M3MK 2JA5C 1JQWA 3I4NC 2D6FC 2A6HA 2E2HA 3SZZA 3GTKC 1TWGC 4P5BA 1TWCA 3HOYC 1USOA 3ERED 2A68A 3GSIA 1JOEA 4A3DC 3GTMK 2R7ZC 1I50K 2P5MA 4A3BC 1VH2A 1BJTA 4YFKA 1ZVUA 4GTBA 2NVXA 4YFXA 3S1RK 1ZXOA 4KN7A 3GTJK 2R92A 1V5VA 1PJ7A 2O5IA 1XXAA 2B63K 1J6VA 4BBSK 1XZPA 4BLAA 4WJ4A 3ADAC 4LQYA 4Y52C 2PPBA 4G7HA 3QX3A 1DCOA 4A93K 3S2HK 4AYBL 3N3YA 1INNA 4P5AA 4KASA 3CQZK 5C4XC 5CJ9A 1XZPB 3S1MC 4A3MK 2WB1L 1WCMC 4GTLA 3I4MC 2JA8K 3OEPA 1TWAC 3K7AC 5IYCK 2NVYK 3HOXC 4GTAA 4XLNA 5IOTA 5IP9C 1XXBA 3T02A 5IP7K 3CAGA 3EQLA 5FLMC 3S2DK 1YNJA 1K83C 1Y1WK 5IOQA 2VUMA 1XXCA 4BY1C 5D4DA 2E2IK 1WOPA 2Y0SD 2YU9A 2CFAA 1F7UA 2O5JA 4G7OA 4A3KC 3VA7A 2KWAA 1PJ5A 2Y3PA 4J3NA 3PO3C 3FKIK 3H0GK 3A8IA 1WQFA 1USMA 3GTLA 1X31C 1WSVA 1BGWA 1J6WA 5M5XK 3G4CA 1IS1A 2R93K 3S14K 3RZDC 3M4OC 4C3HC 4A3JC 4G7ZA 1IE0A 3S1NK 4LK0A 5TJ3A 2XCOA 3HKZL 4PABA 1B4AA 4YFNA 3GTOC 4X6AK 4QIWD 2PMZL 3OPFA 2JA6K 1I3QC 4GTCA 5M5WK 5M5YK 2E2IC 1WOOA 2NVQC 3GTQA 2BE5A 2JA5K 3I4NK 2NVTC 2GAHC 3GTKK 3GTMA 1TWGK 4KN4A 4ZH4A 2ZUEA 4GTDA 4G0WA 3GTPC 3HOYK 2W7VA 3TFHA 1J98A 1Y1VC 5C44C 1TWFC 2P8TA 2ZFZA 4A3DK 3AD8C 3GTJA 2R7ZK 1I6HC 4A3CC 4A3BK 3AQPA 2B63A 3T00A 3N0CA 1WQGA 4BY7C 3H3VD 3S0XA 3V4GA 2E2JC 1IQ0A 5M3FK 4XLPA 4KARA 2JA7A 1O29A 3GTGC 3S1QC 4C3IK 1TWHC 4Y52K 4QJVA 3GIRA 2NVYA 5C4XK 3S1MK 1JVIA 1SFOC 4Y7NC 4JK1A 4Q4ZA 1WCMK 2XCQA 1HI9A 4QJVB 3I4MK 1HQMA 1TWAK 3K7AK 5C4JC 5FJ8K 1WQHA 4LLGA 1Y1WA 3HOXK 3AD7C 4LR2A 5IP9K 2Y0SL 3HXAA 2JH3A 5FLMK 1K83K 2VUMC 4ILDA 4P9SA 4C45A 1F7VA 4BY1K 3HOUC 1DCHA 3FKIA 1O2FB 3H0GA 3BP8C 2PHCB 2PA8L 4M1XA 4C3IC 3FHZA 2WAQD 4C2MK 4A3KK 4XSZA 2R93A 1WOSA 3PO3K 3TFIA 3FOFA 1B4BA 3LAJA 3RZDK 2ZUFA 3M4OK 3OREA 2JA6A 4C3HK 4A3JK 4MQ9A 4WILA 3N0BA 2JA5A 2CW0A 5EGHA 3GTOK 1TWGA 2RGRA 5C3EC 3GTKA 1XPPA 3GTQC 1I3QK 2NVQK 3GEIA 1EQRA 2NVTK 4A3LK 4C2MC 5IORA 1ZQ1C 2R7ZA 1XZQA 3GTPK 3L4KA 4C3JK 3PO2C 1Y1VK 5C44K 1TWFK 3TFJA 4OIRA 1XZQB 1I6HK 4A3CK 4A3EC 4GTFA 4BKWA 4BY7K 3HOZC 4OIPA 1EH1A 5EGEA 2E2JK 1C0AA 1L0WA 2JA7C 1R9TC 1DCPA 3GTGK 3S17C 3S1QK 1WCMA 1TWHK 4A3LC 2E2HC 5CHPA 1SMYA 1TWAA 1TWCC 4AYBD 1I50A 4KB2A 4BBRC 1SFOK 4OINA 4Y7NK 4KM8A 4C3JC 2V6UA 1VJEA 5IYBC 2WB1D 4GTEA 4DDQA 5C4JK 1K83A 1EFWA 2NVXC 1GE9A 1BS2A 4KM9A 2R92C 1I6VA 2VUMK 4GT9A 4BXXC 3CQZA 3HOUK 4MEXA 4XCHA 1O28A 3S16C 4AH6A 4OIQA 3WODA 3S15C 2EBBA 1UV7A 4KMUA 2FQTA 3GTLK 3T01A 2A6EA 3HOVK 5HL8A 3TTGA 3GTOA 3IPJA 1J6XA 1O24A 4A3GC 1VGXA 1I3QA 2E2IA 3GEEA 4GFQA 4OIOA 4KMAA 3HOWC 5C3EK 3HKZD 3GTQK 2PMZD 1DD5A 5TMFA 2YU9C 3GTPA 4NOIA 3LAPA 1Y1VA 3RZOC 3M3YC 4A3FK 1TWFA 1YNNA 3LPXA 1YX2A 1O26A 1PJ6A 2GSUA 1WSRA 3GTLC 4FM9A 3PO2K 5E68A 5IYDC 3HOVC 1KQ4A 4QIWL 4A3IC 4A3EK
chains in the Genus database with same CATH topology
1JVIA 5E68A 2FQOA 1INNA 1J98A 1VH2A 2FQTA 1VJEA 1JOEA 1JQWA 1IE0A 1J6WA 4XCHA 1J6XA 1YCLA 1VGXA 1J6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVI A;  5E68 A;  2FQO A;  1INN A;  1J98 A;  1VH2 A;  2FQT A;  1VJE A;  1JOE A;  1JQW A;  1IE0 A;  1J6W A;  4XCH A;  1J6X A;  1YCL A;  1VGX A;  1J6V A; 
#chains in the Genus database with same CATH topology
 3AQO A;  5JFE A;  3GTG A;  4KC6 A;  2GSN A;  1O27 A;  1TWH A;  3HOZ K;  3SZY A;  4FZB A;  4LOW A;  2JA7 K;  1R9T K;  4KB4 A;  1SFO A;  3S17 K;  1EK8 A;  4MEY A;  5TMC A;  4A3F C;  2E2H K;  3GTM C;  3GDZ A;  3NUH A;  1I50 C;  1YCL A;  1TWC K;  4BBR K;  3H3V L;  4LK1 A;  5IYB K;  1ZYR A;  4O2D A;  3S1R C;  4GZY A;  3GTJ C;  3JST A;  2B63 C;  3BP3 A;  4BBS C;  2NVX K;  2FQO A;  1WIH A;  4A93 C;  2R92 K;  3S2H C;  3MML B;  4KMH A;  4XSX A;  3Q3Q A;  4BLB A;  3CQZ C;  2XCR B;  1WOR A;  4BXX K;  4A3M C;  5L46 A;  3FOE A;  4Q5S A;  2CFA B;  4G0V A;  1EI6 A;  2JA8 C;  3S16 K;  2PA8 D;  1O2B A;  5IYC C;  2GAG C;  2NVY C;  2V6S A;  3S15 K;  1IL2 A;  3L4J A;  2RH6 A;  1F93 A;  4KMD A;  4LJZ A;  4PAA A;  1G51 A;  5IP7 C;  3S2D C;  1Y1W C;  3DXJ A;  2A69 A;  3BUE A;  4YG2 A;  1F9N A;  4A3G K;  4WJ3 M;  2WAQ L;  4KDD A;  1AB4 A;  2GSO A;  3HOW K;  3AD9 C;  1VRQ C;  3FKI C;  3H0G C;  3G4A A;  2YU9 K;  1RU0 A;  4KAT A;  1O25 A;  1ISE A;  3RZO K;  3M3Y K;  5JVO A;  2R93 C;  3S14 C;  4KAW X;  1ZBS A;  1VLO A;  2V6T A;  3A8J A;  3S1N C;  1O2A A;  1BDF A;  5IYD K;  3A8K A;  5IOS A;  3AH5 A;  4X6A C;  4A3I K;  1IW7 A;  2JA6 C;  1IBA A;  3GEH A;  4RMF A;  1R9T A;  4G0U A;  5M3M K;  2JA5 C;  1JQW A;  3I4N C;  2D6F C;  2A6H A;  2E2H A;  3SZZ A;  3GTK C;  1TWG C;  4P5B A;  1TWC A;  3HOY C;  1USO A;  3ERE D;  2A68 A;  3GSI A;  1JOE A;  4A3D C;  3GTM K;  2R7Z C;  1I50 K;  2P5M A;  4A3B C;  1VH2 A;  1BJT A;  4YFK A;  1ZVU A;  4GTB A;  2NVX A;  4YFX A;  3S1R K;  1ZXO A;  4KN7 A;  3GTJ K;  2R92 A;  1V5V A;  1PJ7 A;  2O5I A;  1XXA A;  2B63 K;  1J6V A;  4BBS K;  1XZP A;  4BLA A;  4WJ4 A;  3ADA C;  4LQY A;  4Y52 C;  2PPB A;  4G7H A;  3QX3 A;  1DCO A;  4A93 K;  3S2H K;  4AYB L;  3N3Y A;  1INN A;  4P5A A;  4KAS A;  3CQZ K;  5C4X C;  5CJ9 A;  1XZP B;  3S1M C;  4A3M K;  2WB1 L;  1WCM C;  4GTL A;  3I4M C;  2JA8 K;  3OEP A;  1TWA C;  3K7A C;  5IYC K;  2NVY K;  3HOX C;  4GTA A;  4XLN A;  5IOT A;  5IP9 C;  1XXB A;  3T02 A;  5IP7 K;  3CAG A;  3EQL A;  5FLM C;  3S2D K;  1YNJ A;  1K83 C;  1Y1W K;  5IOQ A;  2VUM A;  1XXC A;  4BY1 C;  5D4D A;  2E2I K;  1WOP A;  2Y0S D;  2YU9 A;  2CFA A;  1F7U A;  2O5J A;  4G7O A;  4A3K C;  3VA7 A;  2KWA A;  1PJ5 A;  2Y3P A;  4J3N A;  3PO3 C;  3FKI K;  3H0G K;  3A8I A;  1WQF A;  1USM A;  3GTL A;  1X31 C;  1WSV A;  1BGW A;  1J6W A;  5M5X K;  3G4C A;  1IS1 A;  2R93 K;  3S14 K;  3RZD C;  3M4O C;  4C3H C;  4A3J C;  4G7Z A;  1IE0 A;  3S1N K;  4LK0 A;  5TJ3 A;  2XCO A;  3HKZ L;  4PAB A;  1B4A A;  4YFN A;  3GTO C;  4X6A K;  4QIW D;  2PMZ L;  3OPF A;  2JA6 K;  1I3Q C;  4GTC A;  5M5W K;  5M5Y K;  2E2I C;  1WOO A;  2NVQ C;  3GTQ A;  2BE5 A;  2JA5 K;  3I4N K;  2NVT C;  2GAH C;  3GTK K;  3GTM A;  1TWG K;  4KN4 A;  4ZH4 A;  2ZUE A;  4GTD A;  4G0W A;  3GTP C;  3HOY K;  2W7V A;  3TFH A;  1J98 A;  1Y1V C;  5C44 C;  1TWF C;  2P8T A;  2ZFZ A;  4A3D K;  3AD8 C;  3GTJ A;  2R7Z K;  1I6H C;  4A3C C;  4A3B K;  3AQP A;  2B63 A;  3T00 A;  3N0C A;  1WQG A;  4BY7 C;  3H3V D;  3S0X A;  3V4G A;  2E2J C;  1IQ0 A;  5M3F K;  4XLP A;  4KAR A;  2JA7 A;  1O29 A;  3GTG C;  3S1Q C;  4C3I K;  1TWH C;  4Y52 K;  4QJV A;  3GIR A;  2NVY A;  5C4X K;  3S1M K;  1JVI A;  1SFO C;  4Y7N C;  4JK1 A;  4Q4Z A;  1WCM K;  2XCQ A;  1HI9 A;  4QJV B;  3I4M K;  1HQM A;  1TWA K;  3K7A K;  5C4J C;  5FJ8 K;  1WQH A;  4LLG A;  1Y1W A;  3HOX K;  3AD7 C;  4LR2 A;  5IP9 K;  2Y0S L;  3HXA A;  2JH3 A;  5FLM K;  1K83 K;  2VUM C;  4ILD A;  4P9S A;  4C45 A;  1F7V A;  4BY1 K;  3HOU C;  1DCH A;  3FKI A;  1O2F B;  3H0G A;  3BP8 C;  2PHC B;  2PA8 L;  4M1X A;  4C3I C;  3FHZ A;  2WAQ D;  4C2M K;  4A3K K;  4XSZ A;  2R93 A;  1WOS A;  3PO3 K;  3TFI A;  3FOF A;  1B4B A;  3LAJ A;  3RZD K;  2ZUF A;  3M4O K;  3ORE A;  2JA6 A;  4C3H K;  4A3J K;  4MQ9 A;  4WIL A;  3N0B A;  2JA5 A;  2CW0 A;  5EGH A;  3GTO K;  1TWG A;  2RGR A;  5C3E C;  3GTK A;  1XPP A;  3GTQ C;  1I3Q K;  2NVQ K;  3GEI A;  1EQR A;  2NVT K;  4A3L K;  4C2M C;  5IOR A;  1ZQ1 C;  2R7Z A;  1XZQ A;  3GTP K;  3L4K A;  4C3J K;  3PO2 C;  1Y1V K;  5C44 K;  1TWF K;  3TFJ A;  4OIR A;  1XZQ B;  1I6H K;  4A3C K;  4A3E C;  4GTF A;  4BKW A;  4BY7 K;  3HOZ C;  4OIP A;  1EH1 A;  5EGE A;  2E2J K;  1C0A A;  1L0W A;  2JA7 C;  1R9T C;  1DCP A;  3GTG K;  3S17 C;  3S1Q K;  1WCM A;  1TWH K;  4A3L C;  2E2H C;  5CHP A;  1SMY A;  1TWA A;  1TWC C;  4AYB D;  1I50 A;  4KB2 A;  4BBR C;  1SFO K;  4OIN A;  4Y7N K;  4KM8 A;  4C3J C;  2V6U A;  1VJE A;  5IYB C;  2WB1 D;  4GTE A;  4DDQ A;  5C4J K;  1K83 A;  1EFW A;  2NVX C;  1GE9 A;  1BS2 A;  4KM9 A;  2R92 C;  1I6V A;  2VUM K;  4GT9 A;  4BXX C;  3CQZ A;  3HOU K;  4MEX A;  4XCH A;  1O28 A;  3S16 C;  4AH6 A;  4OIQ A;  3WOD A;  3S15 C;  2EBB A;  1UV7 A;  4KMU A;  2FQT A;  3GTL K;  3T01 A;  2A6E A;  3HOV K;  5HL8 A;  3TTG A;  3GTO A;  3IPJ A;  1J6X A;  1O24 A;  4A3G C;  1VGX A;  1I3Q A;  2E2I A;  3GEE A;  4GFQ A;  4OIO A;  4KMA A;  3HOW C;  5C3E K;  3HKZ D;  3GTQ K;  2PMZ D;  1DD5 A;  5TMF A;  2YU9 C;  3GTP A;  4NOI A;  3LAP A;  1Y1V A;  3RZO C;  3M3Y C;  4A3F K;  1TWF A;  1YNN A;  3LPX A;  1YX2 A;  1O26 A;  1PJ6 A;  2GSU A;  1WSR A;  3GTL C;  4FM9 A;  3PO2 K;  5E68 A;  5IYD C;  3HOV C;  1KQ4 A;  4QIW L;  4A3I C;  4A3E K; 
#chains in the Genus database with same CATH homology
 1JVI A;  5E68 A;  2FQO A;  1INN A;  1J98 A;  1VH2 A;  2FQT A;  1VJE A;  1JOE A;  1JQW A;  1IE0 A;  1J6W A;  4XCH A;  1J6X A;  1YCL A;  1VGX A;  1J6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...