2FQXA

Pnra from treponema pallidum complexed with guanosine
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
316
structure length
316
Chain Sequence
GDFVVGMVTDSGDIDDKSFNQQVWEGISRFAQENNAKCKYVTASTDAEYVPSLSAFADENMGLVVACGSFLVEAVIETSARFPKQKFLVIDAVVQDRDNVVSAVFGQNEGSFLVGVAAALKAKEAGKSAVGFIVGMELGMMPLFEAGFEAGVKAVDPDIQVVVEVANTFSDPQKGQALAAKLYDSGVNVIFQVAGGTGNGVIKEARDRRLNGQDVWVIGVDRDQYMDGVYDGSKSVVLTSMVKRADVAAERISKMAYDGSFPGGQSIMFGLEDKAVGIPEENPNLSSAVMEKIRSFEEKIVSKEIVVPVRSARMMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PnrA (Tp0319; TmpC) lipoprotein represents a new family of bacterial purine nucleoside receptor encoded within an ATP-binding cassette (ABC)-like operon in Treponema pallidum
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Transport protein
molecule keywords Membrane lipoprotein tmpC
total genus 119
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02608 Bmp ABC transporter substrate-binding protein PnrA-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqxA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqxA02
3OM0A 1RXEA 4LE2A 3QLTA 1LBIA 1KMIY 2O20A 3IPCA 2GKGA 2A9PA 3E61A 4OTZA 2PJUA 2IKSA 2R47A 2FN9A 7ABPA 2L19A 2VK2A 4H3KB 2FVYA 2BGGA 3M9WA 4RY9A 1MB0A 5EWJA 5FWYB 3IDOA 4FB4A 3DGEC 3KKEA 1CYEA 3K4HA 4MYRA 4MS1A 2HJ9A 5KQMA 4G0YA 3UUGA 3G1WA 2PUCA 3F6PA 5TE9A 2LUOA 3R0JA 3S99A 1GUBA 3KJXA 3F6CA 2MSKA 1JYEA 3O21A 1Z13A 3RVLA 3HK2A 1BAPA 2E4WA 2FQXA 2TMYA 5HM6A 1AB5A 1M2FA 1ABEA 1EFAA 4OLAA 4PYRA 4Z4CA 3ROTA 2LIVA 2AYXA 4S05A 3QX9A 4RK0A 1DBQA 3GRCA 3EODA 4N03A 3HDVA 1VLZA 3H5OA 1EWKA 3RVRA 4QICA 4ZYLA 4XFKA 5BQ3A 1DG9A 4KVFA 2FMIA 5JNRA 2PUEA 2LPMA 2OENG 3L49A 1NTRA 3VNBA 2ZAYA 4LE0A 1NXSA 2QVGA 3D8UA 3H6HA 2QSJA 2VYCA 4P1ZA 3N0WA 3CS3A 3MA0A 3O1HB 4Z4GA 4RXMA 1OXKB 5CNMA 3LUCA 4Q6BA 3OO1A 1KGSA 1QKKA 4KMRA 4PZ0A 1A2OA 3OLVA 1PNTA 2OQRA 4P98A 1USIA 4NQRA 1NXWA 1A04A 1D1QA 4ETNA 3OQMA 5CHYA 4RKRA 4RS3A 2DRIA 2H0AA 3H75A 3NBMA 4HYEA 2FEKA 2WWVD 4D6YA 2PUGA 1JWLA 4JAVC 1ISRA 4KZKA 4TLMB 4IF4A 5IEBA 5KQLA 5EWMB 3NNSA 2I6FA 1YIOA 1Z2EA 3JTEA 1VKRA 4NICA 5FBKA 1OXBB 1JH9A 3LUAA 4N0QA 4QYWA 4YR7A 3N0RA 4MLCA 1P6QA 3FFWA 5TQ0B 5DLEA 4H60A 4MR7B 3CLKA 1XHFA 4E7OA 2JVIA 3DLBA 5FWXA 1ZGZA 5JNUA 4W5RA 3CKMA 3BREA 3O74A 1DBWA 4MQEA 1USGA 4MRMB 3LUDA 2PUDA 3FMVA 1NXTA 4PE5B 3RVNA 5BR1A 1VPWA 4Z4EA 1JDNA 1GCAA 3JS5A 1EWTA 3OLYA 5IBQA 4Z9BA 5PNTA 4YO7A 3L6UA 2FMHA 4WWHA 4G0PA 4RXUA 1Y1LA 5JNTA 3Q7RA 1GCGA 4OLBA 3LTEA 4ETMA 4W5QA 1XHEA 3GV0A 2WY2D 2V0NA 1MAVA 4F11A 4IGAA 5KQGA 2QXYA 2MYPA 4EVSA 4WUTA 1Z15A 3I09A 1YMUA 4KQ9A 5TPZA 2QU7A 4ZMRA 4IILA 4G86A 1J56A 3C97A 1RPJA 1YS7A 1PEYA 3B2NA 5BRAA 1Z12A 3ROFA 3T6KA 3GT7A 2WMYA 2PMCA 1APBA 1A0OA 2MYUA 3A3KA 3HM9A 1QQBA 2RGYA 1USKA 4Q6WA 4G0MA 1NATA 3LKBA 3GBPA 2GX6A 3N6VA 4MQFA 3C3WA 3Q15C 2HQRA 1LJUA 5KWSA 4W5NA 3O2QB 1JBEA 1SXHA 4KV7A 1ZHHA 3P9YA 5EWJB 1JFVA 3C3MA 5JNVA 2FLWA 3EQ2A 4E7PA 1SXGA 3A10A 1L5ZA 1FQWA 3EAFA 4EVQA 2JBAB 1YMVA 1VRVA 1JFTA 1U0SY 1U2QA 2R4QA 2B1JA 3IP7A 4RV5A 4NCBA 2R25B 4RU1A 2PL9A 3ILYA 1UDRA 4N41A 4RSMA 4KQCA 4LRQA 2PUAA 3G85A 1DJMA 2FQWA 2FMKA 2CD7A 4LDZA 4MRMA 3IP5A 4CBVA 3QLUA 4N47A 3LKVA 5KC9A 4YP9A 5B3JA 2QV0A 4W5OA 1TMYA 4Z4FA 3O2JA 2XDYA 3H5IA 2WJWA 2WJAA 4MQFB 4O1HA 2LBPA 4RY0A 3E3MA 2PE5A 3C3KA 1CHNA 3DBIA 1M2EA 4WXEA 1U04A 2YHAA 5IC5A 3DLHA 4JA2A 1NXPA 5FBHA 5TPZD 3T95A 1JHZA 2IPAB 3OO0A 5TQ2B 5IULC 2QZJA 4Z0NA 4G0ZA 1NXXA 2CHEA 5EWMA 1QPZA 2MYNA 3HVRA 3RVPA 5FWYA 5GOTA 1MB3A 1BDHA 4YV7A 3OMXA 4OBBA 4MR8A 3IPAA 4W5TA 4ZJPA 3EJWA 2IPLA 2PLNA 5HKOA 2FMFA 3KTOA 4D6XA 2JVJA 3H5TA 3JVIA 1MVOA 1ZH2A 1JX6A 2R48A 4MS3B 2GBPA 4Z4IA 3Q7SA 4JP1A 1JFSA 1EAYA 3SG0A 2FEWB 6ABPA 4Z9AA 3JPYA 2P9HA 1EWVA 1DP4A 1U8TA 4S04A 2J48A 4Z99A 1DCKA 5IEJA 1Z2DA 1NY5A 4XXHA 3KHTA 1BVHA 3LOPA 1YS6A 4O1IA 1HEYA 3FFTA 1M5UA 1M5TA 1YK0A 3QEKA 2FEPA 1R8JA 4KK3A 3TMYA 1ZVVA 1I3CA 3O1IC 3LUKA 4G0QA 1BDJA 3C6QA 4KPYA 2JRLA 1YVUA 5E3JA 3N53A 5JNSA 3HCWA 1RNLA 2FTKE 4TLLB 2PAFA 2B4AA 3UK0A 4ZPJA 3I5AA 4KNYA 4OG2A 1JL3A 5TQJA 4F8JA 1QNLA 3RVOA 3NHZA 4L4UA 5CNKA 4DN6A 4HNSA 1BA2A 3HS3A 5DGCA 4NV3A 1F4VA 9ABPA 3HEBA 4RK1A 3FDFA 1GLGA 4G97A 5EWLB 1NXVA 2JB9A 4ETIA 5KQPA 1DBPA 2HPHA 2PL1A 3Q41A 4RY8A 4EVRA 3RQIA 3OMWA 2QW1A 1T34A 4HNRA 4KK4A 2NZUG 1P6UA 4KFCA 4MLDA 2Q5CA 4LDAA 1DCFA 1BDIA 3CZCA 3Q7TA 4H3HB 3SY8A 2HSGA 1LJLA 3CU5A 3KYJB 3TX6A 1E6KA 4GNRA 3KYIB 3CHYA 2FW0A 3GBVA 4JOQA 4RDCA 1CEYA 4JASB 3QX8A 3KLNA 3LUHA 3SM9A 1QO0A 2A9QA 3NHMA 3HO1A 2M1ZA 3MMNA 4F3TA 1QMPA 5I4CA 4B09A 3HUUA 2NZVG 2ZWMA 1EHCA 3M9XA 1TM2A 5T7BA 1E6LA 1D1PA 3F73A 3LUGA 3TB6A 4KRFA 4QYMA 4EYGA 5TQ0A 3MYYA 4EUKA 2JBAA 5DTEA 4MS1B 3W9SA 5ABPA 3I45A 4MR8B 5JS1A 3QEMB 1TVMA 4G0OA 3H6GA 2E4ZA 5KI6A 1K66A 5CNIA 4DADA 2VUHB 4IRXA 3DZDA 5KC8A 1ZN2A 3EULA 2PUBA 1W9HA 4YLEA 2F8TA 1C0EA 2FQYA 3OLZA 2WRZA 1FSPA 1ZDMA 2LP4Y 2HQBA 2F8SA 5C5CA 4D74A 5GQSA 1XWWA 3MIZA 3JPWA 3H1FA 3CTPA 4RZSA 4IMJB 1Z26A 3HZHA 4XARA 1ZESA 1PEAA 3A0RB 1C4WA 3OQOA 3QELA 4YWHA 1DC8A 3EQZA 3VNAA 4YS6A 4UHKA 1NXOA 1DCMA 1DC7A 2HQOA 3GYBA 4DQDA 3N75A 1P2FA 1LBHA 3LMKA 2QVCA 3UKJA 2E4XA 3BBLA 3H1EA 1D2AA 1SRRA 2P4UA 3QLUC 3GL9A 5HQJA 4N0PA 4WZZA 4FE7A 3CFYA 1U2PA 3BILA 3EDCA 4MS4B 1ZGGA 1E6MA 3KS9A 5DKFA 5DCLA 3T38A 4FE4A 2FXIA 3HSYA 4UHJA 5IUNC 1RZRD 4MQEB 3CZ5A 4RK6A 1DRKA 1D4ZA 4MR7A 4XAQA 4L85A 1QP0A 4KREA 1ISSA 3CRNA 3H5WA 3N8IA 1S8NA 3CG0A 2WB4A 4MPTA 3M6MD 5TPWA 4RK5A 2KYRA 3MQ4A 3BRQA 2A9RA 1Z17A 1PUXA 3SNKA 4JB0A 4Q7EA 1ZY2A 3TD9A 4RK4A 4MR9B 2VUIB 2N9UA 1W25A 3GWGA 2M98A 6CHYA 2A9OA 3RVJA 4TMYA 4Y9TA 4EYOA 4NCAA 3NNNA 3HV2A 3FGZA 2NUBA 1DRJA 4M88A 2PKXA 2RJNA 4MR9A 4F06A 3EGCA 2L18A 2AYZA 3H1GA 1PHRA 4XLTA 3H5LA 1YK1A 2FN8A 2NT3A 1URPA 3JY6A 3KLOA 3O1JC 5EWLA 4IMIB 1FFWA 4XASA 4LX8A 3SQNA 4EYKA 2FSPA 3RH0A 5ED4A 2CWDA 3IP9A 2MSWA 1P8AA 5JNWA 3H5VA 1LK0A 1JLKA 3DGFC 3KCNA 3URMA 3OLWA 4Z4HA 3I42A 2QR3A 3SAJA 3K9CA 5FWXB 2RJOA 4YGXB 2JVKA 3HDGA 1Z25A 5CNJA 1AB6A 2IPNA 4MS4A 3CG4A 1SD5A 3ILHA 3LFTA 4EY3A 3BRSA 1QQAA 3RVQA 2X7XA 1F51E 4G0XA 2E4UA 5D2CA 4YCSA 1GUDA 1TLFA 1K68A 4WXMA 4RXTA 1QP4A 3MM4A 1IIBA 3KSMA 2JCGA 5T3YA 3OM1A 1ZH4A 4RKQA 2GI4A 5IUKC 4OATA 1QP7A 2CHFA 1WETA 3T8YA 3RVMA 4PICA 8ABPA 5IUJC 3FFXA 3O75A 3LUFA 3QLVA 4WT7A 2PUFA 3QLVC 2GWRA 4EYQA 2YHBA 1KRXA 1ABFA 3N0XA 1FFSA 5JS2A 5BRJA 2IOYA 2IYNA 4GPAA 4TN5A 1H9CA 5TPWB 1FFGA 3HXMA 4MS3A 1JDPA 4PEVA 3GA5A 3JVDA 2IPMA 4LE1A 4O5AA 3NNDA 3OQNA 4RWEA 1RZRA 4LZLA 3F7NA 3OLXA 1MIHA 3A0UA 1PNRA 4ZMSA 3RVKA 3RVSA 1B00A 5B3JC 3D02A 1RXIA 2E4VA 2W42A 1JF8A 4YRZA 1L5YA 5HSGA 3QEMA 2ID9A 1TJYA 4ML3A 4MGEA 1E2BA 3HJFA 5C5EA 4EGSA 4MAAA 2L2QA 3Q9SA 2IDMA 5TQ2A 3KG2A 3MF4A 4HNQA 5IX8A 2MYTA 2E4YA 1Z16A 4N76A 1JYFA 1SXIA 2L17A 5F64A 1ZITA 2RDMA 3QK7A 3QELB 1Z18A 1YTUA 2FKAA 2ID7A 2H3HA 2JK1A 4F12A 4RK7A 4JB2A 4QPJC 1QO0D 3LUJA 3TO5A 3CNBA 2NT4A 1DZ3A 3O2SB 2FLKA 3IP6A 1KRWA 1ZAYA 1D5WA 3HUTA 2MSLA
chains in the Genus database with same CATH superfamily
4V0NA 1J1UA 1UZUA 5J23A 1JKXA 4MRRA 5A4KA 5CB8A 1LBIA 4Z7OB 5KYUA 2R65A 2C3MA 1L5VA 3HYTA 5H59A 5KTSA 3K94A 5LZ8A 3AETA 3SFTA 3QFHA 4NARA 5EQFA 2GD6A 1BJTA 3CEHA 1PLLA 3AI2A 1E9SA 3PYXA 4MB2A 2WAXA 2H5EA 2ZM6B 3I4FA 1WSAA 3VTKA 1UMCA 2F64A 1FNSA 3NHRA 1E5VA 1NVEA 1VLHA 2C5EA 2DJIA 1NR7A 2ZUUA 4XEHA 3RVLA 1UP6A 5BSFA 2XYQA 5CLGA 4G5RA 1M2FA 1AUOA 1EFAA 4HSGA 3ROTA 1EBBA 3SZUA 3THWB 3DMTC 2GBCA 3NIDB 3K5IA 1JAHA 4LWQA 2M1XA 3GRCA 3IKLA 1NMXA 4N7JA 4ZICA 2HHCA 4C4SA 5BWBA 4TTRA 5L4SA 1O58A 3OKAA 3H5OA 2CJWA 4Q3KA 2HRCA 2QTRA 3O38A 3ABQB 2PT6A 3KSUA 3WV5A 4TSRA 1NBMD 1VSVA 1N2EA 3D0KA 3FTQA 3FNBA 4E6PA 3S29A 2XUPA 3SQLA 1FFBA 3M6LA 1KJWA 5CVEA 4V1CI 1A5AB 3CUUA 4G8BA 3HO8A 3JAWB 5AW4A 3AX6A 4D8VA 1IG3A 1PJ4A 2FPIA 4WW0A 3T94A 4MKZA 1ZH0A 4K6FA 1EG2A 2R96A 1Z39A 3R9IA 3W8NA 4E11A 3P71T 1IVNA 2FF7A 3AO0B 4JXJA 1V37A 2Q0HA 1JQEA 1LC3A 2QAJA 4TSKA 5HM8A 2O3QA 4XWOA 1E0AA 2VC2B 1C14A 3JW8A 4Q3NA 4NQRA 1Q92A 1Y4UA 2D1TA 3FBWA 2ZYAA 2C78A 3T35A 2HLDD 2PZEA 1VJCA 4AY2A 1QVZA 3DFFA 1JPNA 4U2CA 4DIMA 4YPFA 5K0EA 4LYGA 4YFVA 2ONYA 2AD1A 1M8KA 1SUEA 2EIHA 3MGCA 2CXNA 3UANA 1XIVA 1BMDA 1QUFA 4CF3A 3M83A 2GN6A 1VKRA 5AVXA 2MR5A 4J16A 3P4XA 3R3UA 3AKZA 3V4SA 2V7QD 4XIGS 4WCVA 4H60A 1N5KA 4IDDA 4N18A 5JLAA 3VR6H 2ROQA 3DLBA 4QGAA 4F0JA 3GNTA 2PHZA 2ZYGA 4LHXA 4ENRA 4W5RA 3LOQA 1GNQA 2VQ6A 2O6HA 1BNCA 1EB9A 1USGA 2YXLA 3F98A 3L4EA 4DWWA 4ZHSA 1L5GB 3A1NA 2EG5A 1VPWA 4PHGA 8GPBA 1RSZA 4YQFA 1WOYA 1EUDA 1AUQA 4TVBA 2I3DA 1G63A 3GFVA 1C7ZA 3SVZA 2DTEA 4P4NA 1NUQA 1PR9A 4YO7A 4G5YA 2DPHA 4JVSB 3AB7A 3ZW9A 1A50B 4LECA 4YCNA 1L7MA 2DQ4A 1GNSA 4JI6B 3VHQA 4AS3A 4RXUA 3ICQB 2R8EA 3LECA 5EC8A 3EGEA 2GJSA 3ORHA 3ZVNA 1A3CA 4YK7A 1LDGA 3NIGB 1RQXA 1Z45A 3L79A 3KUUA 4B3JA 4BE4A 2PG3A 4L0QA 4H6XA 2DFLA 4LRUA 2E18A 5IWAB 4GYKA 4BRUA 1FMCA 4RAQA 1BJRE 2WT4A 5B58C 3EUAA 3L43A 1N2HA 2Y1GA 4F2WA 4UM7A 1P5JA 4KXLA 1WXQA 1VE1A 3LDHA 3MCTA 5ES4B 2CXTA 4BVKA 5LOVF 1USVA 1NKTA 2VAWA 2PMCA 3FB4A 1A0OA 4IL5A 5G41A 3WVNA 3BIOA 1W2GA 4G24A 2QRUA 7MDHA 2WPNA 2BGMA 5B1HA 1T0UA 1O77A 2O2JA 3H2BA 3TRHA 2HX1A 4D8YA 3RTEA 5B30A 1KXJA 1MPXA 2WUEA 4HYQA 4XCXA 1UOOA 2QN6A 5IDVA 3STVA 2GASA 3BMNA 1NLFA 3ZY4A 5IT5A 1H69A 2CJFA 1LX6A 4IV0A 3GUUA 3UGJA 2FLWA 1N1GA 2LDXA 3KXKA 1FYEA 1VMIA 3A11A 1QAOA 1L5ZA 4MUGA 1JRLA 3EAFA 1QGAA 2J41A 1TMOA 1HC7A 4R5MA 3IOEA 1CR1A 3MLEA 4IO1A 5JSQA 5JD6A 2HNKA 1K0UA 3IQEA 1UMKA 4H15A 5D1HA 4B45A 1ZH8A 2Q1WA 3AIMA 2SNIE 5AI8A 4F86A 1U1IA 4Y2YA 1HTBA 2AE1A 2EP8A 2VSOA 4UCFA 4LDZA 1W1WA 1DJMA 3IP5A 2QRQA 3LCCA 3VYTB 5GP1A 2J0SA 3WYNA 5DNWA 3CUEF 3WXMA 4Q18A 2JBHA 2WKWA 2OBMA 2IY9A 4PQFA 1Z4NA 2NWQA 1IOLA 1U3WA 3EA0A 2FU5C 3MAJA 4IO0A 2OXEA 3C8DA 4TYPA 2PXHA 1YA6A 4KIGA 5FXMA 1ZJ4A 1X80B 1OYWA 2PGAA 2AL7A 4ZODA 5GVRA 4BKQA 3RVPA 3MPUA 3OY7A 4FNOA 4X1YA 1EVJA 4FTWA 4I1IA 1I24A 3ZQJA 2Y1WA 3EGXB 2XOEA 2V9PA 4EJSC 621PA 1NQUA 2D1RA 5IKEA 2RHJA 1JE0A 3KOUA 1GTG1 4Q9LA 4YLYA 4IHJA 1NP6A 2A35A 1GO2A 4K0RA 4KTTE 5E0KB 5IKOA 3OVMA 3VC7A 2QTCA 5MN4A 1PNQA 5ALVA 1C9KA 2LNDA 1VL1A 1JH8A 4IICA 5JNLA 3LPAA 1BU5A 1Y1KE 4PZZA 4CQLA 2J0UB 1A8UA 1XTBA 3FCOA 3L8HA 5ITZA 1M7BA 3GQBB 4XJTA 3IA2A 1UKVY 1E3TA 1M74A 2IL1A 2NPIA 1VXRA 4O63O 3OIGA 3AFMA 3QXCA 5AUQA 5D00A 1MVLA 3RE1A 4HX2A 3ROGA 1E2KA 4LZJA 5I9MA 2KQUA 5DV9A 1AZLA 1Y1QA 4KN5A 4PS1A 1F14A 1MG0A 1VGQA 3AZQA 3QEKA 4EBBA 1KWKA 5H3HA 5A4IS 4K87A 2BEWB 1LVUA 1OV4A 1QVWA 3SJUA 4C04A 5IJWA 3E3LA 2VJAA 2H5LA 4A6DA 5KAPA 3OAAA 1D8AA 4NZOA 3TS1A 1XU7A 2F3TA 5K0GA 1T2AA 3PXBA 3RJ9A 1TQHA 4CPDA 3AVTA 1XP8A 2QPLA 2IHUA 3EXG1 4MTCA 4R9SA 4RHUA 5ALIA 3PUXA 2VJYA 3PJFA 3FHCB 3RIYA 2CJPA 3VHRA 3AHDA 1MB4A 2O7QA 4I9HA 2O8VA 2P9BA 4LS3A 4RTJA 3IAS6 5KCZA 4DN6A 4P5EA 1BCSA 4C7OA 4PTZA 3U1BA 2F2TA 4KYVA 2XQIA 5A0FA 3KAQA 4WCFB 1LZKA 2R6ZA 2W48A 2IYFA 3PI7A 5IHXA 1KMHA 2FSVC 4AJHA 1FRNA 2HV8A 2AN4A 5BUQA 1E32A 4WJLA 2E48A 2EZ9A 3ICVA 4HQKA 3QYFA 2OBNA 4U63A 1T34A 1KVTA 3D4LA 2PR2A 2B94A 1J0DA 3CZQA 4TYNA 1HLGA 5EJAA 3CZCA 1UBUS 3U3RA 2ZYWX 5F12A 2R8ZA 4K6GA 3WGJA 2P9GA 2PX5A 1NM5A 3BCUA 4RENA 5F1KA 4BVBA 3A1TA 2XY4A 1M2JA 3IKJA 1ZONA 2VTBA 1D1TA 4CDGA 4QUHA 4B7ZA 5LZ9A 1TADA 3G5TA 1JE1A 2WVJA 3DCYA 3R7DA 2FPIB 2XGJA 1DZIA 1NFQA 1IRXA 3P4UA 4ALIA 4D02A 3RUCA 3E23A 3KK0A 1JLLB 1T8RA 4IIVA 3TTTA 1R4NA 2FP4B 2QMQA 4GAEA 1E6LA 2CNWD 1BVUA 5DYYA 3F73A 1GG2A 4RVHA 4JC8A 1RWQA 2EARA 4Y2XA 1Q74A 4A2PA 2HWWA 3R44A 1KO8A 3QLJA 4WY8A 4DJTA 4F5DA 4KDFA 4EUKA 1E99A 4DBZA 1YHZA 1FSFA 3EVTA 5GONF 4YJKA 4MIOA 4OGKA 1OWMA 3BYZA 2ZCJA 1EWYA 1TVMA 1TZJA 1PTJA 3CSUA 3D8RA 2J9FB 3H6GA 4I55A 4BRSA 5LQCA 1JEYA 1HE3A 2PPVA 2VJMB 4TKUA 3I2HA 2JIQA 2J3DA 1BEZA 1ZR4A 4D0SA 2A6PA 2ZUBA 4LMAA 3N6XA 5AKJA 4MHOA 3O4IA 1EJ2A 3G02A 1Q6YA 2GCIA 4A2CA 1SQFA 3S3TA 4HG2A 4Z1MD 3STUA 4Z7JA 3LLSA 2AXNA 1O6BA 1SURA 2OY0A 3MIZA 1RIIA 1Q0ZA 3K9NA 1OHHA 1X87A 5C81A 4L27A 4JYAB 3EDMA 4MKHA 4MVJG 3PUZA 3BXEA 5EP2A 1Z6YA 1SNYA 3COPA 4CFYA 4KQ1A 2AN5A 3QELA 4MW9A 4FFWA 1PX0A 4S3MA 2NN3C 1C1DA 3TMKA 4GMDA 1U1FA 2P11A 1D4FA 1ZOPA 4UEKA 3IAM1 3VC3A 1F2TB 1EINA 2AJTA 3LMKA 4AZ0B 4RF5A 4DQVA 4KMOA 5FFNA 5CVUA 3RU7A 4C29A 2PMEA 1US8A 3U44A 5BXYA 3GL9A 3GW8A 3Q6NA 1BMTA 2JKZA 3HSSA 2EQBA 4C7BA 3LHFA 3ODPA 1YCGA 5TIIA 3L18A 3TECE 1IBLB 4QDKA 2JH3A 2DBQA 2E5FA 2I6GA 5IUNC 3WGHA 1ENPA 2D4AA 1T3LA 5TJHA 2VHUA 4D56A 1GR1A 3NANA 2JFQA 3RSOA 1VL5A 3I3SR 3HNOA 4LDPA 1VJRA 4PHCA 4TRNA 2XRMA 3ZVMA 1RXUA 2IZ5A 3B1YA 3OJ0A 1NMEA 3V8MA 1T0BA 3EHDA 3UBTA 1SBTA 2WB4A 3MHPA 3U7RA 2ODBA 3UCEA 4ARSA 5HKKA 2QJOA 1UDBA 3F6SA 3JSXA 3OPVA 4KLCA 1T6YA 3FWNA 3ZY5A 1OFUX 3T3NA 1RXCA 4TKVA 2EZTA 1A8IA 1ZIXA 4DWOA 1YAHA 2YUTA 1T1IA 2G83A 3LXXA 1ONPA 4MRAA 1Q7CA 3ZD7A 1DWQA 2I9KA 2RGEA 1BROA 1U7HA 1XN4A 2EOAA 3H1TA 4GLLA 4YASA 4YJ3A 1L3IA 1RKVA 4PXSA 7ADHA 4ZFNA 4LCBA 2J6IA 5BORA 3ANMA 2V74B 1R0KA 3F7TA 4WNYA 3IO3A 5F23A 1JEQB 3TRIA 2A9VA 2GLTA 4XASA 1TU0A 1JJ7A 3A4IA 5ESRA 3E7XA 1T4CA 3FWPA 3WBJA 4EF6A 1GGMA 1SQ0A 1UWVA 2MSWA 4P34A 3H5VA 5FD8A 2DUWA 3FF4A 1PT5A 1YZ3A 2QR3A 2AFIB 3S81A 4DUYB 4QBKA 4JD5A 3NYWA 3ER9A 4AKHA 4YGXB 1RPTA 3TZCA 4E2WA 1QUEA 2QWXA 4B84A 4B3SB 4QT0A 5CB4A 2YV1A 1KQOA 3AZPA 3SM3A 3NC4A 4EH1A 1QG4A 5KTTA 4KHPB 2BCGY 4IG9A 3KYCA 3L77A 5DGXA 5K1ZA 5GADl 3ZNNA 4P4SB 2OCPA 5KUTA 1U2EA 1NJ5A 3JARB 1SCBA 2WG1A 3LE8A 2HAEA 2ZT6A 3E9EA 2ST1A 2C92A 2XDWA 5CVVA 2WD9A 5J40A 4BCCA 1I8TA 4L5YA 2M2IA 2PBLA 1TCVA 1NMYA 2ZYRA 2IY7A 2ABWA 3RVMA 3S55A 5IUJC 1R10A 2BVNA 5KNBA 3PD7A 1JDBC 1UJNA 3QU7A 1GZ4A 1KBZA 3W8DA 5EP4A 4C6TA 3O47A 4G0WA 2FPGB 1C30A 2QTAA 1COWA 4XJVA 2BDTA 1FFSA 1OE0A 1X1QA 3N6RA 3UG7A 4E03A 5D5PA 2EBFX 1YMQA 4OV6B 4EYSA 1J7JA 3EBPA 4L4ZA 3G23A 3ECAA 5EVJA 5J4KA 4FJ0A 4XDYA 3NNDA 1T36B 4NYIR 1JAIA 2J7PD 3CCCA 4Z0PA 1CBUA 3TZLA 5LDHA 5CFZA 3E5RA 3ESQA 1T0HB 2C9BA 2FUNB 2XF2A 1P1BA 2O3UA 4RZ3A 2OAP1 1QOPB 1PU2A 1B00A 1AUPA 3BD7A 1CIVA 4FT4A 4PZCA 4RABA 3RIMA 3VYWA 3S5UA 4O4HB 2PD3A 1IWPB 2CHGA 3GEMA 1EVIA 1C8VB 16PKA 2PXCA 2VAPA 3OE5A 1FMJA 5HIKA 2VRNA 1JR3A 3CMCO 4M2LA 1XTJA 4IQ4A 1A2BA 1TK2A 4L0DA 5DWVA 4MAAA 3GJTA 5IVIA 3IQDB 4BUCA 1O2DA 2IEIA 1JHPA 1RS0A 4YACA 2EF0A 2V7GA 2VRBA 3KQVA 1OZFA 5AM2A 1ZITA 4UM9B 2D1SA 4DZZA 4E5DA 5BSWA 4QU8A 4XH9B 4EHIA 1UFRA 1QG0A 4PSUA 1ODIA 4AMYA 1I1HA 3BVPA 1E1CA 3GT4A 4RPKA 4BVGA 2VDOB 5LQJA 1TDJA 1EVYA 4XVQA 3CVOA 4E1BA 5D5HA 1AKWA 3PUWA 1U9YA 1ZD1A 5ED0A 1GFWA 3EG9A 4LAFA 5ENZA 4ZRNA 3HUTA 4G09A 2Y99A 3KKEA 4OQZA 4HAWA 3KEGA 3IURA 4KJXA 4QSMA 1M6HA 3I8SA 4JKIA 5LWQA 4GVPA 3WJAA 3ORFA 4I4CA 4WECA 5FPSA 1ECLA 1FVOA 2RH4A 3WK6A 4IV8A 2D2VA 1MR3F 1LD3A 2F4NA 2A0FA 2BEKA 2FPPB 2FVYA 5FFFA 3ZTYA 4KQIA 3GRFA 2AUNA 1MUUA 3R3SA 1DS6A 4EF4A 4DW8A 1QX3A 1G0NA 1UJ6A 3AI7A 4UVDA 5AMXA 1G3MA 3MCWA 1GITA 4OY3A 4ZV7A 4AJ2A 5IJAA 3I2YX 2IX9A 2W00A 3K8QA 2Y66A 3B5EA 3UF0A 3GCXA 3DZKA 2WM9B 2IXGA 2PUCA 1Z3CA 2BFCA 2RBEA 2YMLA 2HA4A 3CWCA 3REFA 2BHNA 3LO8A 2QGFA 1XTQA 3EAGA 4PCLA 5DYTA 3ZD8A 1RRMA 4LRWA 2BHRA 1Y5NA 1IU9A 5HM6A 2YCBA 2HSZA 3PFKA 1U9IC 1O94C 4ETWA 4GZ5A 5M04A 5JW6A 2AYXA 3RM3A 3N58A 4Q0MA 4LC9A 3F90A 2C97A 4P3YA 1JDZA 5BYAA 1QJCA 2EFJA 3BZBA 4FK8A 4BGEA 4G0UA 4OFBA 4ZYLA 4ZVNA 3FKSD 3ORQA 1RD4A 3CNLA 5KTNA 4PZAA 1OUMA 3JQBC 3E3NA 4ZCTA 3SEAA 3IYLW 4ZI7A 3CNQS 5DGTA 1NTRA 1QVAA 4RMJA 4WZ6A 4LE0A 1QP8A 5AVQA 1IM5A 1BCRA 2QVGA 4JBNA 4DA8A 2HHHB 4COOA 2BFNA 1BVYF 3U61B 4LYAA 4DZRA 3GCDA 2O3SA 2VYCA 1XCPA 3RYCB 3OZXA 3F9RA 3IE1A 3NHYA 5AI5A 3I1IA 1ZA2A 3BGDA 2XF8A 4K46A 2VJKA 5LMUB 4D3ZA 4JJGA 4BX9A 2OSVA 4JCCA 2E21A 1A88A 1Y5LA 4YI3A 3IESA 5C1OA 2OQRA 3BJZA 4QQ8A 2ZYVX 5FR2A 5F73A 2UVDA 4X71A 3I12A 5FPPA 3IBCA 1F1JA 1PJBA 4FOLA 1CE8B 3I58A 3PUHA 3RKRA 4RULA 3SX2A 4R8LA 2YJ5A 3FUXA 5H83A 4BFLA 2GNPA 1YDFA 5CDUA 4MW2A 2GZ2A 4BB6A 1CQPA 2H1LA 2NTEA 1UODA 4Q03A 1CUZA 1JDTA 1H8HD 1KH2A 3PNVA 3ASUA 4GP9A 3ZDRA 3DONA 1QQTA 1RADA 4RETA 1KDYA 1YIOA 3THRA 5HBRA 5KPJA 2QSUA 3SQMA 4BEWA 3LRTA 3G9XA 3DZ8A 5BUZA 4BP8A 5HGJA 4EECA 3DVAB 4WKCA 1DPFA 5LFAA 1HQKA 2FG7C 3D6AA 4D2IA 3BSWA 2KHZA 1UZLA 3GEEA 3UPDA 3UV6A 4HQ6A 1KU0A 1ZGZA 2ACKA 1FFDA 2FZ5A 3B9RA 2QRVB 3GOHA 4FILA 4TM7A 2FSGA 2JLVA 2E6UX 4NEHB 1EVKA 4BU1A 1JNYA 1QDLB 3GNSA 3I1JA 4ZT6A 4F6RB 1SJ9A 3WC4A 3IDSA 3PQ6A 1T0PA 5JASA 3DDUA 1PI3A 1M34E 3OLYA 1VE9A 4Z9BA 1DB3A 1G4AE 4Z3DA 4YN3A 1HDZA 2WSLA 2P6NA 3O4FA 3EA5A 1WHTB 1BD4A 4G0PA 1Y1LA 4CMIA 4IS3A 4PLWA 2NVUB 2VNJA 1QHXA 4EKIA 4FN5A 1EUCB 4M0KA 3GJ0A 5A4FS 3V4PB 1JU4A 2YBEA 1SEVA 4HNAB 4RV4A 3D81A 1BG6A 4RNDB 3IAAA 2QN2A 1XTSA 4X1IA 1YMUA 1QV6A 5T4FA 2CBGA 2A3NA 3WKBA 4WKGA 4ZMRA 3GH1A 5LUAA 3TQIA 3PIRA 2R9VA 2HBQA 4PANA 2GYUA 3MJTA 5E9AA 3FJOA 4TPKA 5E4JA 3T06B 3AF3A 3PGVA 1LBSA 1QIJA 3HNPA 1BFDA 5A5GA 3BCHA 1Q17A 2VYND 1XYYA 3BWMA 1BE6A 1HT3A 2ENWA 2R60A 3GLHB 3OX3A 4GRAA 1NJGA 1QLJA 5B2FA 5CFMA 3SP1A 4MDEA 4OYLA 4X1OA 4QZVA 2GX6A 4NIMA 1GADO 2GJAA 1KI6B 1U90A 2OCAA 4FCTA 2V7PA 3AUJB 4EW6A 2GPTA 1TW3A 2DHEA 2QTHA 1L4BA 4KE9A 4O4JF 3HTXA 5L8VA 4Z7QB 4DPLA 2EZUA 3OEYA 1V95A 1D03A 1DBRA 4RZHA 3T1OA 4E7PA 2P4SA 1KZGB 4MITA 1FU8A 2X9GA 3PF9A 4WXHA 5BUCA 2YZKA 1WUYA 1Y8QB 4Q39A 3UC5A 4G8CA 3B8EA 4MUJA 3Q1KA 4GOLD 2VNHA 1F9EA 2HA0A 2FX2A 4FXOA 4TXNA 1U2RA 4YX9A 2C57A 4Z54A 3KJHA 3O93A 1U9CA 1KDOA 5C37A 3V4OA 4KQCA 1AQLA 1EXWA 2QZZA 1Q44A 1LPMA 2C5GA 2FMKA 2QX7A 2ZP1A 3G85A 1LDEA 4NCKA 2M6LA 1DKRA 5BN5A 3PEWA 5FBQB 1DAEA 3DOFA 3WR5A 4D9MA 4JT8A 4Y1RA 2X7HA 1KBOA 1UOPA 3KRTA 1CCWA 2G88A 2QUKA 2R86A 2WP8J 1P2VA 3NBQA 4LGVA 5IC5A 4XQ0A 3A2NA 3R8XA 3TEJA 3HFRA 4UKDA 1BYIA 4GQIA 1I51A 2IYAA 3HN7A 4GR5A 5IULC 2HI0A 1KYXA 1OR8A 3AF5A 5EWMA 4UUPA 1V16A 4BC1A 2CLDX 3FRIA 3O7MA 2HZ7A 4J0DA 1P72A 3RSFA 4M86A 4AYXA 4QXOA 2QTNA 5C7YA 3SKYA 2TMDA 1Y0BA 1D07A 4CLEA 2Z5VA 1XRJA 3BIJA 3N7AA 4Q5IA 3WWEA 5LIPA 4W5TA 3OKFA 2IBMA 1CEXA 2MINB 2CVHA 5D51S 2PRIA 1AZWA 4C4AA 5TGDA 1EXVA 4QXMA 3OJCA 2OHVA 4PX3A 3PNPA 3H42B 1QFMA 1SMKA 4CM4A 1PL6A 2VHWA 4OJKA 3S0JA 4GM1A 4MS3B 1NE2A 1CETA 4HDSA 4RVFA 4Z4IA 1IY1A 1XLVA 4QRIA 4LXGA 4RHYA 2QI9C 1N2JA 4GD3Q 3SN6A 3TLMA 1IEXA 4Z99A 1L7XA 2IZ6A 5G1OA 2J1LA 3CYFA 2RGNA 3H84A 3URKA 5FPTA 1CPYA 1V4NA 3ZGNA 4DCSA 3IV6A 4LRTB 1N2CE 3I23A 2ID4A 1BKSB 1ESNA 3Q3CA 4PLHA 3STXA 4EY6A 1EFPB 5DHTA 1Z0KA 3FX2A 2DBYA 1ND6A 3L8GA 3NDPA 1SN7A 2WPDD 1Q6ZA 1M72A 4FHFA 1BW9B 2VP4A 1GFIA 1BDJA 2GD2A 3EUEA 1H5UA 4GI5A 4DCTA 5CDSA 4NAVA 1N6IA 1B6RA 1JFFA 2PT5A 1UPUA 3TSAA 1J5XA 3G2JA 2PQ2A 3KVNA 4DXAA 3L1KA 4MKGA 5C8ZA 3L4JA 1T8TA 5GZ3A 3V00A 4FI3F 3MJVA 4Y2RA 4OG2A 4RMGA 3EEQA 1X8KA 1UMCB 1K9VF 5IPFA 4XD7D 3R76A 4CNBA 2RIPA 4DMFA 2COKA 1T5HX 4AS1A 4DG9A 2WWGA 3QU5A 1YRYE 4KQEA 5KNDH 2P4HX 4JUBA 1ZXLA 4KBFA 4GHWA 1XTPA 3CO5A 3AG5A 4F8YA 4KIWA 5LP6A 1P2GA 3C4VA 1R37A 4CL8A 4AO8A 3J80A 5JYBA 2FNAA 2ZSBA 3OMWA 5F4ZA 2GPNA 3NIFB 5AHKA 3I64A 2WFAA 4RIIA 1S2OA 1V8PA 1RXYA 1LJLA 2OFWA 2V8BA 2W6PA 3BIWA 1UC5B 3HB4X 3SK0A 5JD3A 3TSYA 4FUQA 4PGAA 3OPQA 3VR0A 2YOFA 1JB1A 3SBXA 1E61A 5DE3A 1JQDA 1CNMA 4EFMA 4FYPA 1ZD4A 2VDWA 1TEVA 2W2VA 3G88A 4UDXX 1RCFA 1TB4A 3TCXB 5EFZA 5K6AC 3WKEA 1DXOA 4HFMA 3T3IA 5FDFA 3WB2A 1CR2A 3VAZA 1NC1A 3W6PA 3QBDA 3PHBE 3UJ8A 2VCEA 3WLEA 1TYEB 5EHXA 2CMGA 4R9RA 3A3PA 4IIFA 4QYMA 1O0BA 4E51A 3QUBA 2OVBA 2B8TA 3R5XA 4H0NA 1LDNA 1Y9DA 4YUXA 5DI3B 5AW3A 1ORTA 3D6FA 4GZLA 4M0MA 3WL6A 4RORA 1CW2B 3TB4A 1UDCA 3GLFB 2WHQA 2IEZA 2Z9DA 4JNCA 2GYWA 2V45A 4JYMA 1ZHOA 4OA5A 2AJCA 4GKJB 4D4IA 4RTMA 1SHJA 2ZOSA 3EGDB 4JX9A 2PCLA 3BWBA 5AI4A 3S1AA 5CJPA 3TW8B 3G2NA 3ZNPA 1G7SA 1YGYA 2A0KA 2H7YA 4JYBA 4ODIA 2OYCA 1H2WA 5ER9A 1Z82A 3ROKA 1LS6A 1XD9A 3CC8A 3BS4A 1P7WA 4MNTA 4ROSA 5D84A 1ZK3A 2ZIEA 4LYDA 1L7DA 2LW7A 3M1YA 2NZYA 5H82A 4B5KA 2JGKA 3Q3VA 4YAFA 3Q9LA 2Z5GA 2KS6A 3H2GA 4LJ7A 4GYJA 5HNKA 1DAHA 1FYDA 1HDOA 1IUKA 2Z08A 1J8YF 2P0YA 3JASB 2A0YA 3KFLA 4F9EA 1AE1A 3A2MA 4EMSA 2ZR0A 4JJKA 4OHBA 4LJSA 3VNAA 1L0BA 3FKJA 3HMQA 2ODNA 4RM3A 4LSGA 3G2LA 2HQOA 5L6MB 4AKIA 2R66A 2VTVA 3MCZA 4XOUA 4MQBA 3ENQA 3UATA 1I6KA 3K1TA 3PGA1 4HTFA 4RS4A 5IN5A 3OHMA 4N0PA 4PX9A 3LY7A 1P4RA 4TRJA 4ASUA 1M7GA 1T9DA 4MS4B 5EZYA 1WQ3A 5DKFA 3T38A 3JQ6A 2VN8A 5DOZA 3GMDA 2VSFA 2P5YA 1SG0A 4CV0A 3EIWA 1ZICA 1DRKA 1DOHA 3AFOA 5IN4A 1O1YA 2NUPA 4M9UA 1J5EB 1ZI6A 4IXMA 1QP0A 3A1SA 1G5TA 2X8AA 1P74A 3AGPA 4GOKA 5FOTA 5K3EA 2E6KA 1OXXK 2D4HA 3RV4A 3H83A 2IF0A 5TPWA 1W581 4C22A 1NAIA 3BICA 1MX3A 1AKRA 3JQAD 1A95A 4G36A 1T4MA 3NTUA 5BN3B 5M29A 3V1LA 2BFFA 2R8PA 2JBWA 3GAAA 1V7PC 1N3LA 4G5HA 4IDBA 3ZDZB 4WKBA 3E35A 4XX0B 4P7BA 1UZNA 5IVKA 4NCAA 1VYUA 1ZK2A 1ISFA 2HUPA 3G3EA 3AM3A 2BZ1A 4KACA 3CLHA 1VGRA 1W7AA 2FZWA 1MHTA 3G0IA 4NDNE 4XLTA 1X74A 5CITA 5JBIA 3P9RA 4UCXA 1GPYA 2X3UA 4G8DA 4ZCMA 1JEJA 3T5BA 3Q6IA 1MIOA 3PVZA 3EXEB 3QUCA 1HKUA 1QAQA 1F2UB 1ZUWA 2XTZA 3KDAA 1JSCA 4I4TA 2HCTA 2VQFB 3EZLA 1TD9A 1WJGA 2R2AA 1RLJA 4DWVA 3G89A 5JAZA 1G8JA 4C07A 2RJOA 3ET4A 5I9SA 3HKDB 2JVKA 1NFRA 1XP5A 4EHDA 3ANTA 3HDGA 3LYUA 1KFKB 4PC2A 4YRIA 3GYGA 3UA4A 2WIBA 4NNJA 3PFHA 2J8ZA 3LFTA 2YTZA 5LP6C 1GL9B 3QG1A 2JDID 1ISJA 2A94A 2H18A 3A4YA 3DAOA 3H0KA 4NOKA 2X0IA 1N6LA 3DH0A 5I7OA 5T3YA 1M2HA 4BATA 4M1ZA 3T7CA 2D8MA 4D99A 1HQCA 4KKXB 3EDYA 4BMCA 3K8OE 2VF7A 2NG1A 1PW7A 4DEVA 2EWVA 3QLVA 4LZNA 3A04A 2FWIA 1I80A 4RAOA 1G2IA 2VZ8A 4IF6A 1AN9A 1N2IA 2WWXA 3D8SA 5JS2A 3C3CA 2J9GA 3RQSA 4C87A 2IYNA 5FNVB 1U0BB 3IOCA 3PR1A 4CIAA 1GM5A 1DAFA 4LJ8A 5IVPA 1L8XA 2O2YA 1R0YA 1Z4QA 3GD7A 3NTLA 1J7KA 1QF9A 1ULZA 4RPJA 4WESB 2XKJE 2FN3A 3N2NA 5H3CA 3RJMA 4D3YA 3OQNA 3KQUA 3THYB 2PZKA 1TMKA 4D1YA 2Y0CA 4AJPA 4MJXA 5T6BA 1QPGA 5BPFA 2UZ3A 4CMBA 3L1VA 3AJ9A 3RHTA 1MTOA 4PZEA 3ZIAD 5IU6A 2W11A 1FJ2A 5B3LA 1EU1A 5BW8A 3G2QA 1UJ2A 3LA8A 3ODGA 3SU8A 4FGJA 3KYDA 2O0KA 1G20E 4FW9A 4QVGA 5CH3A 4DNPA 1F48A 3TZKA 1B8PA 5D87A 1XCGB 4A23A 3L06A 4IX9A 1E60A 4N6GA 2VQDA 3T3HA 5DHRA 5F64A 3UMYA 1CJSA 1SBNE 3W4JA 1E79D 1U3FA 5L7TA 1W5FA 1KMQA 2GZ1A 2WSMA 2OHFA 1WCXA 4EGJA 3R5TA 4TSFD 1NW7A 1TUIA 4LV8B 3HBFA 4AQ7A 4DAOA 2AG6A 2DUNA 2BTQB 2V7UA 3MJSA 1E4EB 5CT6A 2VYFA 4CUJA 3MXOA 4BQNA 1PK9A 5A6SB 3OH8A 3DLIA 1ST3A 4KLNA 1ZI8A 3KUKA 1E3IA 4LXQA 3WNQA 5COAA 4BRWA 1CJMA 2OBYA 3GG9A 1IAVA 3PE3A 5A1JA 2Y1FA 2VJCA 5DSTA 3CT4A 4P35A 2IJGX 2ODPA 1LPPA 5BNIA 4JLJA 1W2HA 4BCDA 3WZ2A 4EGFA 5EWJA 2QNBA 3KEQA 2D7DA 1JLSA 1Z7GA 1ZJZA 2W4IA 1E64A 2REBA 4Q3CA 5FA6A 5U9CA 3A7DA 3DEZA 1TECE 2IXAA 3ESRA 3VZBA 5KAMA 3BTOA 5KJEA 2AT1A 3VPGA 1G9XA 3ENKA 5HZKA 2O8FA 2CCGA 1NDQA 3F6CA 4MVJM 4CM9A 4X6LA 3UNXA 4F60A 1PL0A 4RHXA 2FQXA 5DMHA 1JG3A 2HA2A 4MROA 3NKLA 2HT1A 1BXGA 2Q21A 5DHSA 1YOVB 5KDLA 4PYRA 3GQVA 4JZYA 4M3NA 1WU8A 2AXEA 4RK0A 1JHOA 3SDBA 4WBNF 1SKYB 2FMXA 3PSAA 1JFLA 5D1NA 4BNHA 1OAOA 5IJ9B 1RMYA 1C8KA 5AM1A 5L45A 2FMIA 1RLMA 2QRGA 1BTOA 2LPMA 3VNRA 4BYGA 4IJVA 1JMKC 4NH0A 3VNBA 3O8BA 4KPFC 3UA3A 3DSRA 2I34A 3PC8C 3AU9A 3WIDA 3DE0X 3D8UA 4RJKA 4B43A 1MKYA 1EDEA 2HA7A 1J22A 1YJ8A 2M6RA 3PX3A 1UM9A 2AW5A 3KAKA 3H9CA 5JQWA 1KGSA 3ZE1B 2FG5A 3AESB 4U6QA 4YBRA 4COKA 3AKYA 3PDUA 1USIA 1A5SB 4L3OA 4A27A 1SG6A 1D1QA 1T8WA 2BKEA 2F59A 2ZREA 4EDHA 1N36B 4GXNA 2IH4A 4FQ7A 1M8PA 3HSKA 5LJLA 4AF8A 1X70A 2PUHA 4RLFA 2NO7A 1M1NB 4G4GA 4W9MC 2GRAA 4QQRA 1WMEA 4DARA 1AKNA 4DLAA 2JGDA 4YVFA 4L6AA 3IOBA 4LQDA 3CR7A 4IVQA 4X92A 1G1AA 3E3OA 1UF9A 2VBIA 3NNSA 4U00A 2HJGA 4B3GA 1DKUA 2HCRA 2R7MA 1UPBA 2XTJA 3G7SA 4ZQBA 3VR6D 3SXUB 3AHEA 1RZVA 5DI9A 3EIEA 4OU5A 5H5JA 3ROQA 1W93A 2F17A 4YMWA 1XHFA 4FFBA 1SA0A 3WSVA 4YV2A 4S2UA 4NPAA 3ZN2A 3AWDA 3R7LA 3UJ3X 1WE2A 3ZX5A 3OCUA 1E9AA 3NCTA 4BEVA 4L0CA 3JWJA 5KDDA 2Q9BA 2W93A 3I9FA 3W2GA 4OP1A 1AGXA 2O4UX 2LKCA 2Q1TA 4LF9B 3HCAA 2ZVPX 4C0JA 2ZS7A 1YQQA 4HYTA 4JSYA 3AKDA 4M4SA 3CLRD 5DVZA 4BBAA 3WLPA 4JDPA 2AOTA 5JNTA 1NNEA 2IS6A 3G6WA 2ZUEA 4N7MA 2ZRJA 2DERA 3OF2A 3V80A 1FDRA 4GMHA 4ZO9A 2QD5A 2OHXA 2RAUA 4F11A 2H2DA 4YJFB 1YBFA 3QKUA 3UWOA 4BWGA 1RJWA 1LPAB 4OXYA 3L5OA 4NCNA 3ZLUA 2Z6QA 3INYA 2HRRA 4Z7NB 2AV6A 1IG0A 3HPRA 3I6QA 2H48A 2OCBA 2O2DA 1GFSA 2VJPA 1UP7A 3OOHA 4ZVSA 5J2UF 3HI6A 2UZ1B 1GQOA 1L4NA 1P39A 1G17A 4YDSA 1Q2XA 3A3KA 4BE7B 1QQBA 1YCDA 1TKRA 1Z33A 3D3JA 4R31A 1ZCAA 1AV7A 1V8BA 1XPRA 3I9V1 3MT8A 2O2CA 1F0PA 3I9OA 1ZGCA 1VL8A 2AVDA 2OG2A 4UZEA 3DE6X 2CLEB 2FZGA 3FLBA 4UU8A 3ZGYA 1XGKA 1RI5A 2GTIA 2H4HA 2X5JO 3OUTA 5IJ0A 3DYIA 5T4HA 3RYFA 2JLYA 2P6OA 4F4HA 5L3SB 1C3EA 1NP7A 3ETJA 1Y6FA 1N6RA 2OR3A 3PE6A 4S24A 3SF8B 2X3FA 4MDHA 3RSGA 2PFKA 3FVWA 5CDTA 2XT9A 4HDMB 5BV2P 3ED1A 4V2UA 4BMNA 1N3BA 1TIKA 2CXQA 3B48A 1MRNA 2PZMA 3HBMA 3RRZA 3VR4H 4A2WA 2X40A 5JYDA 4GLJA 1W59A 2O7SA 5HK9A 1TA0A 1U7OA 3NDRA 4AJOA 3TPCA 3E9QA 3MZ0A 2JJ1A 4IWXA 2H3EA 5HE8A 4N4AA 4JC0A 3K70C 221PA 3D7RA 1YZFA 5LUBA 2NLOA 1VBKA 2C4UA 2K2QB 4O8CA 4PW0A 3S70A 4DA7A 5B4TA 5F4BA 3GLUA 3RWMB 4C0WA 1QHYA 1GWNA 1GUYA 3O8LA 2Q4TA 421PA 1T5LA 2R3SA 4Y9SA 1XQ6A 5TY0A 1IUPA 1KDTA 3C3JA 1OI3A 1L4MA 2Y1XA 3TTWA 1ENOA 2EJWA 1T13A 2B3DA 4N49A 4GXTA 3ZWWA 2Q0SA 1D9XA 1R2QA 2NXEA 1ESZA 1CUBA 1HYGA 2QW0X 4GX5A 3RJZA 5CCDA 1B7GO 4GPTA 3MD0A 4S12A 1U7UA 3OQJA 1O95A 2XGMA 3CONA 3QI2A 4IH9A 1U0TA 5IG2A 4YCDA 4ZYXA 4BV9A 2ZIUB 2OL4A 1G6OA 3V6LA 1UDWA 3NIWA 4I99A 4ZQHA 3D8NA 1R18A 2H2HA 4BCBA 4EG7A 1XZBA 3GELA 1YDGA 2QNIA 1NRXA 4MA4A 1SKUA 3BQMB 4NYMQ 3N7UA 4DCGA 2YL2A 1Z4PX 1UBLS 2JFNA 4EHJA 3PDHA 4S04A 2YXEA 1I4LD 4AKSA 5DSXA 4KGZA 4NAHA 4CTMA 3H4TA 3ZHOA 3CX3A 1SCAA 1YZQA 1RYMA 5EHQA 3JZMA 3MWEB 1FS5A 1UBOS 2Z4SA 1QU2A 3GPLA 2AOTB 2Z1NA 1I3CA 2OV6A 3FCUB 3WLIA 2EL7A 4M1MA 4EX7A 1WXWA 2PH7A 3DJFA 1X14A 3FBGA 4JJZA 2IT1A 2VJDA 1UBCA 5JNSA 4RA6A 3C98A 3W2TA 2IEGA 2FTKE 2ZG6A 1T3SA 3UK0A 3VR2A 3VJRA 4RADA 2ALJA 1G3IA 2O3JA 3P5SA 3HKDA 2GDZA 2HSWA 2RGDA 3D5EA 3HZOA 4JS0A 4EW2A 5K6RA 3NHZA 4RZQA 2YIDA 5L51A 4N0DA 1R16A 3DQPA 1C3OB 3FMOB 3HY3A 5MN6A 5IAEA 2PWAA 3K32A 3NIBA 1L3BA 2Z09A 5EUMA 1U5BA 4RCYA 1TZCA 4LYJA 4QU9A 3JWEA 2WHPA 2P8SA 3ADPA 2VSXA 5J2UB 3Q41A 3LPNA 4FP9A 1QIEA 3I72A 5HMMA 5J5CA 2NVBA 1W0JA 5H0IA 1FPMA 4TLCA 3SLRA 2BUBA 1J2UA 2OA0A 1PR3A 3I9KA 3SZ3A 3WLQA 4XM0A 1P9RA 4K05A 3X0DA 1H6DA 2HTFA 3GDFA 4XX0A 2Q5LA 1IK6A 2CZGA 4HR7A 4QBTA 4BZQA 5J58A 4J0QA 1CB7A 2QLLA 4EZEA 2JD0A 1JQJC 3U7IA 2PKCA 2CNOA 3N2GB 5DCYA 3K0EA 3L0DA 2WQ6A 1DG3A 3QXSA 4HH4A 3IIEA 2CDAA 3U6KA 2ZRPA 3JQEA 1E18A 2H9AA 3PHIA 2ET6A 1RU3A 2VPPA 2ZWMA 1NN3A 3A6HA 4II2A 2BTOA 3C5HA 4NOJA 5JC8A 5KVVA 1BE1A 1OIWA 3AJ8A 2FZKA 3QY9A 4CDNA 2PFSA 1U1GA 5KNCA 5CPFA 2G0AA 5ARBA 4NU5A 5TQ0A 4LDJA 3EYWA 1EVEA 3N8NA 4UUNA 1BE0A 2AR7A 2E4AA 1AS0A 4Q7JB 3STHA 1N0UA 2J9YB 1GL6A 2F90A 5FX2A 4BB9A 4TX1A 3QUAA 1EZ4A 1OY1A 1RHQA 2BMFA 4F4IA 1I7NA 1NYQA 3OJEA 4E5NA 3N0TA 3K70B 2AJLI 2JCYA 5IASA 3AVYA 1PSZA 4DMHA 4G5SA 1LI7A 4EUNA 4JP5A 2EV9A 2CB9A 3TOSA 5EE1A 1NN0A 4EJSA 4X8HA 2AC7A 3LT4A 2J5QA 1NVUQ 3Q7IA 4TKVB 3QTBA 3HGQA 4UMVA 5AH0A 5A6SA 3ELUA 1IN4A 3H1FA 5H02A 3A1VA 4QUBA 2PWYA 3EPJA 2BR5A 4IMJB 3VKGA 2WYOA 1GFZA 5FPQA 3R0ZA 4HNGA 2GCEA 1TZKA 1Z8HA 5FWAA 1GTJ1 3SC4A 3VR2D 4XM2A 1UWLA 1UK8A 1DDOA 1UFQA 3ZWAA 4DYVA 1JEDA 3FI0A 1LTKA 2WDPA 1LCIA 4HO1X 4V0QA 3BL8A 5EYPA 1TPZA 4RHFA 3H1EA 2FW9A 3T54A 1ZJJA 4RDHA 7YASA 3MS4A 2YWHA 5CEFA 1D0VA 2ZCUA 5BR7A 1MH9A 2GBLC 4FE7A 1RCTE 1AD2A 1S3FA 5AI6A 2AG8A 5JARA 2WD7B 1E4EA 4KXYA 4GU5A 4C3ZA 1JPJA 3FYUB 4JBWA 2Q0XA 4UU7A 4G89A 4QQFA 3T4EA 6ADHA 4AUKA 2OOKA 1EDDA 5CEEA 1IY0A 4QAQA 4TWBA 3MJHA 2FRVA 2GPAA 4JQZA 4KVAA 1ZWLA 3UJBA 3ONFA 3DDHA 3MD9A 3IERA 3EXIA 4FFLA 3KC2A 4CL2A 3MQ4A 1XMSA 3JZDA 1RRPA 4IIXA 2HF8A 1A7UA 3SNKA 3IA7A 1LPBB 1ONSA 1ZY2A 3B3JA 3FOBA 4MR9B 2VUIB 2VXCA 3IAS1 1GAXA 2B1RA 4DV4B 4NULA 1YO6A 2JJ2A 3O0DA 4TWJA 4F97A 4AUMA 1SR8A 5EJ7A 5I9TA 3SBOA 2FOLA 3DE3X 3HKEB 5A9TA 5L4LA 2PKXA 3QI7A 1KRHA 1MEJA 4UAGA 4ZRMA 3IMCA 7REQB 4DDMA 4B4KA 4ALNA 1XLTA 4BPRA 3OZTA 4DF3A 7MHTA 2HM7A 5LXTA 2IW1A 1ONNA 4RNCA 3RAJA 3UK6A 5EUCA 3WQSB 3RRYA 2ZVJA 3UFXB 1FS4A 4I2VA 2H6EA 3DFIA 4L8LA 5IC4A 4YGYA 4G65A 2F48A 4XVRA 1OFHA 2H11A 3BMQA 4F93B 2YJZA 5SYAA 3OD1A 1X1CA 4Z4HA 5KJ1A 3P9QA 4UQPA 4LWPA 2ZB8A 4JHLA 1L8QA 2BZ0A 2EL9A 3PWSA 1FX0A 4DFDA 2WMDA 2AOUA 3IR5A 4DM4A 1UT5A 3OIWA 3SR4A 2JGNA 4MV6A 1EFRD 4LTDA 1PFYA 3FYSA 6YASA 4JUAA 5KTRA 3HWSA 4HXEB 4MA5A 3AERA 1JR3D 2WWFA 2YXPX 3CW2A 1OH5A 4PG6A 2B9EA 5F2OA 1O89A 5G0VA 1K68A 4Q16A 5F9HA 1GY8A 3VU0A 4JJ7A 3L40A 2IS2A 2Z0MA 2BH9A 1F6DA 3EBOA 3T8YA 1WETA 1WMFA 1NSTA 4RGQA 5JCPA 2AH5A 2A1UB 2CXSA 2H2IA 2I03A 2P90A 4W9NC 1LV8A 1DV2A 1K92A 3PVSA 1VPLA 4DC1A 4L4SA 2ILVA 3IJRA 4MI6A 2AWNA 5FEUA 1Z7BA 1R00A 4RTQA 3CUYA 4GPAA 2AMFA 2BFEA 2H54A 1T2VA 3KL4A 1E8DA 5ENVA 3SCZA 3UVEA 3VOTA 2UVPB 4NCXA 2GRJA 2YC2C 1JDPA 1PJSA 3ZKWA 5A5FA 2IE8A 2PFGA 4KGXA 4YJ2F 3GLGB 1QYXA 1Y8RB 3PL1A 3WYEA 3HLKA 3WMRA 4F3KA 4JQCA 1N2GA 1MIHA 5JXHA 5KYKA 4RLQA 5EJ6A 2WTXA 3BGIA 1E0KA 3D6NB 5FA5A 3RVKA 5HX7A 3NBAA 5GV7A 1VCMA 2H31A 2REXB 1DKNA 1HLPA 3H0CA 3R9KA 3P96A 4IDEA 4INAA 3SDSA 3TQHA 1G5RA 4LVUA 3U4HA 4L50A 4ZYYA 2RKBA 4ANFA 3HJFA 4FMCF 4Q82A 2IH2A 4IXTA 2IXTA 3IS3A 2HMUA 1N57A 1N8NA 4R9VA 4V2IA 1N7HA 5ELMA 4MIYA 2F67A 4FFMA 3P0JA 2V59A 4G4JA 2Q5FA 2VCYA 1JYFA 1CSEE 2QPOA 3JVVA 5FWDA 2CJXA 4CI0B 5T8KA 4KI0A 3VHXA 2CVOA 1MNAA 4ZC8A 1YVDA 1R6DA 3WA6A 4AC9A 4QECA 2A88A 2XYRA 3ZIUA 5I7WA 2WIGA 1Y34E 2WTAA 4JLBA 2PKQO 2BV3A 2R4TA 3THOA 2I9PA 1DTSA 2RI6A 4RL4A 3U62A 3NT2A 3FCYA 2XNDA 4ZJUA 1TQ4A 4JJEA 5CT8A 3KEOA 3EHEA 2ZTSA 3VR1A 4GQBA 3ZCQA 3AUSA 1KRWA 3UUWA 4B5LA 3QX7A 4WKNA 2CHQA 5C34B 2K6GA 1CRLA 4BMYA 5DLYA 1FDUA 3LYHA 1MC8A 4QLOA 3QLTA 2IF2A 4A26A 3F78A 1DIAA 4PS0A 1DBIA 2QXUA 3YASA 2Y1LA 2WA1A 2Z8ZA 1N75A 3GC6A 4MV4A 4B40A 4DRXB 2C2WA 4G3XA 1MZPA 4RY9A 3H9JA 5DYGA 2ZYTX 2GSDA 4TKZA 3AVXA 1QIFA 3SDZA 3SZRA 1PWHA 5EE0A 2GZ3A 3GMIA 2ILTA 3C87A 4QPPA 1L5LA 5HYVA 5G4KB 1XE3A 5J2TA 4INZA 1XRNA 1J42A 4MCJA 4OXNA 4Q01A 3RJ5A 4BMZA 4JVOA 4C05A 4KBYA 3NVKI 1QB7A 1QFJA 2UV8A 4NKRA 1KOJA 2OOSA 4GE3A 4PBSA 5AFSA 2NSHA 3AL0C 1ZNQO 3WK9A 1GTZA 2Q5QA 1RMQA 3ICCA 2PSHA 3O21A 1XEXA 5FTMA 2LRHA 3AKEA 2ZSDA 4Q4LA 4LFCB 1GAJA 4H7JA 4DMMA 1MO4A 1GARA 4GOXA 4ZVPA 2WIKA 3DMHA 1F38A 3MWLA 3D6VA 1FNDA 2TSYB 3WV4A 3IOMA 4X1IB 2FWMX 2WINI 3E4DA 4ND3A 4C76A 2EIXA 3GLTA 3EW9A 2IOFA 2X2PA 3V48A 1SVLA 2D1YA 2YFQA 4IIEA 3TO5A 5BWNA 2GZAA 1DNPA 1P73A 2A5YB 4XFKA 5LSAA 5DULA 4IUBS 2WJVA 2G04A 3HKCA 3LVRE 2Z9CA 4NATA 4P92A 5E6RB 4PLCA 2OORC 4C2AA 2IA5A 1B73A 2BCEA 1QHFA 1RWBA 1U9ZA 2QYSA 4EATA 1U7DA 2FWBA 1C80A 3QJ5A 3H6HA 1TJ4A 2OCXA 4N5IX 4TL6A 3IUNA 5AKGA 3T7KA 3R5KA 2HMWA 2W6IA 1ZUNB 3B6IA 4UFNA 3ZTWA 2PH5A 1OXKB 4D3SA 5IAAA 1XF9A 4DLUA 2IHNA 1JVBA 1ZEMA 4EFLA 2BD0A 5G0SA 1NNUA 1MN6A 4D9GA 5HK8A 2B92A 4BQIA 3VR5A 5LXTB 1UT6A 3BXGA 5SZJA 2YWGA 3PFWO 3O4JA 2W2KA 1JXAA 1NLMA 4RKRA 4QDUA 2R84A 4M8SA 4GZ6A 3EGVA 2UYCA 4DVJA 4GKVA 1I7SB 4HYEA 2JEYA 2EF1A 2Z2KA 1YR1A 2FLVA 1Y8ZA 2FWNA 5CFLA 4X62B 1TTQB 1NVDA 1KYWA 1U28C 2CVQA 1NP3A 3DVRX 1ESMA 5C18A 1XKTA 3HXQA 1LPNA 1Z34A 4OD0A 4Z9XA 5KOHA 4KPEC 1JT9A 4XWTA 1ZW1A 1ST2A 2CNWA 4JP3A 1FP4B 1G4UR 5E4FA 3A4MA 3NH6A 3B13B 2RC5A 1TVCA 3HY4A 4UHHA 4BGUA 1WDWB 3FN4A 3QV1A 3KD2A 1GGFA 4FKMA 1PNOA 2V98A 1A8QA 4P7GA 2V9ZA 1JDNA 3EE6A 4CJXA 2GBLA 1G55A 1U9IA 4FR5A 3TE7A 2AQ8A 2QRMA 2WLSA 4EKDA 3FKQA 3NHPA 1I4TD 2ZXUA 4KIJA 2FSVA 3U4QA 5I51A 1T2CA 1DMSA 1SEPA 3R3ZA 1KS2A 3SF8A 1GGJA 2UKDA 2XMSA 4MVJD 2V6FA 3EJ6A 1HL7A 1RDFA 3X43A 4RKWA 2SICE 2ZIVB 3WGMA 3LX6A 5DCWA 5JAQA 1JAZA 4M9RA 3VDRA 4DHWA 3BQ9A 4EHAA 5CXUA 1JG1A 5EP1A 2QLBA 2QXYA 4DBLE 3GIDA 1Z15A 3X1DA 1FFCA 3UUEA 3UCFA 2XE6A 1LQUA 2Y71A 4IDPA 4KQ9A 1J8VA 1HBJA 1XDWA 3VPDA 4MW4A 4TYMA 2G8LA 1K3FA 1JZTA 3T6KA 4F1KA 1CEQA 4IHJF 3RRBA 1U0FA 2HHJA 2PK3A 2ZDQA 4OHWA 3WO1A 5DEOA 3TG8A 1NATA 4GIBA 4FKBA 4KDEA 3EY4A 2VP6A 2EBWA 1LA2A 1KP3A 4G07A 3WFIA 1DWPA 4C7OB 4FCVA 4Z9FA 4GMXA 3TLXA 5KWSA 3CVWA 4ZTBA 2EX4A 1RPNA 2GJ4A 3HDYA 3IR7A 5DHFA 3ZHZA 3OEED 3HXKA 2X15A 5F2KA 5F1OA 5BN1A 1L5RA 3PLAE 5FI3A 1MAAA 1SVIA 1EK6A 2BMJA 2CVFA 3F2VA 4QXQA 2FN4A 2P91A 2W2NA 5TARA 1SK9A 4ZQGA 3FSJX 1T2DA 2GERA 1ZLYA 4OHUA 4O0LA 1EE2A 2V7TA 1OIXA 2CL6X 1UDRA 1ZMRA 2V1XA 3A1UA 1T1RA 2ZRCA 3MRSA 4OBXA 3SYLA 2IS4A 4M7WA 4KXQA 5KWEA 3AJDA 5B6IA 2ZRIA 4YV0A 5AKKA 4FDMA 4B3CA 1HYQA 5JZ9A 1NBOA 1SA0B 1GKLA 2QV0A 3O2JA 1HXHA 4I81A 3DKKA 4B3DA 4IDOA 2LBPA 5AVSA 3E3MA 10MHA 3LPCA 2J0QA 4EX6A 4M60A 3OT4A 1N2OA 1LV7A 2Y05A 3E8XA 4WXEA 1I6WA 3A14A 1ZBDA 2OO5C 2DFTA 4FOPA 3I92A 4K81B 4LDRA 4TVSA 2GARA 4E70A 3OKPA 5KSYA 1TAGA 2QGNA 3H05A 4W4TA 5MGNA 1CQWA 2D59A 4W8OA 5JCXA 2NPFA 3TW0A 1QC5A 5FOVA 3ZV4A 4B4UA 1EIWA 1EFCA 4MZXA 5LL6P 1P8JA 3WYAA 2BGRA 4AP5A 1EA5A 3ESBA 1GXSA 1NNLA 4Q4CA 4PPYA 4RH3A 5EGSA 1ULBA 3QTLA 2VYQA 5BQPA 2AZXA 4ZJPA 1XZPA 2PLNA 3HUDA 2F1RA 5AICA 2FMFA 3ZPXA 1S5PA 1GR0A 1QIIA 2B5WA 2I7VA 3VDXA 1NNI1 1T5IA 4YUWA 3JVIA 4P84A 3SI7A 3L7IA 4OXQA 4ZCQA 3WAKA 5GJVC 2NTNA 3G2PA 2GBPA 3GUVA 4TTTS 4R16A 3OIDA 1U3GA 5LB4A 4BX3A 1H1TA 4TZ0A 1IZ8A 1AGPA 1AGNA 3AY3A 1YVEI 1EWVA 1DP4A 2A7QA 4AS2A 4PQEA 4ALLA 5CLHA 3UYKA 2DTDA 2RSLA 2B82A 2ZI4A 5IEJA 2ZUFA 4P32A 1D2CA 3KHTA 1I14A 2X86A 3BZUA 4Q00A 3O03A 3IGFA 5EJ2A 3RUPA 2ZKLA 2RARA 3IEMA 3REQA 3ZWMA 3LBAA 3ZBPA 5JXWA 2P9EA 4L6IA 4YCCA 3KPUA 4ND2A 4PPGA 4UHCA 3TNFA 1JDJA 1XJ0A 1GA4A 3IBTA 3JARA 4JP8A 4TOIA 5AVWA 1OROA 4RDIA 1P4GA 3UWMA 5FBVB 4YY3B 2BAGA 2B36A 1V7QA 4ID9A 2RK4A 3V97A 3NWBA 2B4AA 1VMKA 2WTEA 1PJ3A 3AR6A 2I6SA 3DEIA 3IVAA 3QVOA 5HMLA 1QH0A 1M1UA 1U4SA 1DHTA 2JIOA 2GKOA 3C15C 4HDRA 5J5VA 1FLDA 5H7XA 1FQKA 2B61A 4O2BA 2X9VA 1FFYA 5JO0A 1X15A 1I1NA 1OW3B 5A5VA 2IIVA 2E85A 3LBFA 1PZGA 1CUWA 1OIVA 1U2GC 1VFPA 5DNDA 3EOAI 2IUUA 4GX2A 5A6VA 2IXBA 1Z06A 4C6RA 3S2EA 5CEJA 2YYSA 4OF4A 2VP3A 4LW8A 4L75A 3FDFA 1PDVA 4G63A 4QELA 2Q7XA 5DWDA 5IYZF 1NQ5A 3TDNA 1UT8A 2HPHA 1VCIA 2FPRA 3O26A 1XZAA 1GG5A 5DLDA 3I0ZA 2XYVA 1YQUA 4I3FA 3HJHA 3QQ5A 5A7GA 3RQIA 4A3SA 4IGEA 1JFFB 4CKEA 5EXPA 1O9GA 5IXSA 3JAKA 3KALA 1K8YB 1DOZA 4N01A 3ZR4B 1MQSA 1LNSA 3I32A 1IHDA 1ZR2A 1FW8A 2DU8A 3B89A 3AV3A 1L4YA 1FVFA 2LE0A 4QEZA 4RVGA 4YRCA 4QLAA 2EX1A 1HFKA 1ZFNA 3VO8A 2IYPA 1ATIA 1HE1C 4OPMA 2GWHA 3LXUX 3GP3A 2RB4A 3VZCA 3VR3A 4A0HA 1N5OX 1L1EA 2IUYA 3NAZA 1WS6A 2QKYA 4UTNA 3CSDA 3EEBA 3PT9A 4MIKA 4NZNA 4ZV9A 2EC5A 2QDXA 2Q4BA 4JROA 4AY5A 6GPBA 2XSZD 1QRUA 3L8FA 4X6YA 4CEHB 2NZVG 4D6PA 4EUSA 3IUQA 3ZJ4A 3Q9NA 2RJ3A 4LZOA 2VQEB 1NZDA 2P9YA 3LUGA 3SLKA 4KWIA 1JDBB 1ZGAA 5TT0A 3RANA 4DR3B 4H3SA 2PUJA 2YJ3A 1IZ9A 1N6HA 1P5FA 3FDXA 3MYYA 2BHSA 3AUTA 2H4JA 2BGUA 4IDHA 1Y1RA 2YMPA 4NC9A 4BVFA 4MS1B 5L3SA 5AK0A 1OLOA 4JLMA 2C2OA 5DM0A 5GPBA 3WQQA 5JMTA 3JQFC 4F7WA 4FFVA 1Y6ZA 1KR5A 2JFZA 3LXMA 4LGMA 4GZMA 5KC8A 1KY4A 5JAOA 1HG1A 1HYHA 2P65A 2NTJA 4GBED 3O0TA 1MV5A 1P7YA 4J7AA 4KYTA 4RD1A 5ALRA 1O87A 4BLRA 5BSTA 2DPMA 2IIPA 4ZD6A 1T43A 2HBZA 4MULA 4M46A 3CTMA 4JOCA 4KR2A 4WIAA 3V3KA 3AHGA 4LMBA 3WDSA 4D92A 3HVUA 2WJ6A 3UT0A 2UUOA 2QN3A 4RVCA 4DB4A 3OBIA 4XD7A 3ZBQA 3VC1A 2AEFA 1THZA 2O1XA 3FUWA 1OB2A 2QQEA 4BJ1A 2G3YA 1YL6A 1WY5A 1DFIA 4MP6A 4PONA 3Q0IA 4LF6B 1I4WA 4OHZA 3WK7A 3HBLA 3AVVA 3GUCA 3KAJA 4PIVA 3ZCSA 2ZRFA 1W6UA 1AURA 1NBMA 3KJGA 4LVNA 3WGIA 4TQUS 1DOAA 5DX8A 4BWVA 1P2FA 2CDNA 2IYWA 1N9GB 3T12A 3T0GA 4BZWA 4QOGA 4X1KB 4C4XA 1WXFA 3RYHB 4B44A 2OECA 5FUQA 5JVDF 1R6BX 4C3OB 3BAFA 4Q4AB 3A6PC 2ISSD 2I0FA 3HCEA 3WLAA 3SOZA 2BT4A 2MOKA 1L5MA 4IV5A 1ZGGA 4OM7A 1A5TA 3RFTA 4G5XA 2EJCA 2QJTA 3ZGXA 1XXLA 4CM3A 4PYNA 3GLKA 1GCIA 2C88A 1TCCA 2DUMA 1PEKE 2VPZA 3TMAA 1G2QA 1CX9B 1SKQA 2K7FA 5LZ7A 3BXXA 2HC9A 3U16A 3SC2A 1G8GA 4P2GA 1GPDG 4N54A 3COVA 4FR2A 1TFUA 5TMEA 4CZ2A 3QKRA 1SIOA 4BGDA 5K0NA 1KZ4A 2CYBA 4UHBA 2WSBA 3CF2A 4C14A 3LTNC 2XWSA 4YFYA 5BV8A 2V96A 1MO6A 4E07A 4YPVA 2O8BB 1PUXA 1PTKA 1P9NA 2XGGA 4Q7EA 1ESCA 1WPRA 4O3MA 3VXKA 2O8DB 5JCOA 1PGPA 2N9UA 3FROA 1MW8X 2OQ2A 4CG1A 1M1NA 2COUA 2GRUA 2Q9UA 3GFSA 2EKLA 5KWJA 1NJ8A 2G9RA 2AJBA 2NUBA 1RYNA 2BFBB 2I3BA 3KT6A 4M88A 2Q5IA 4XGNA 5THKA 1MABA 2PS0A 3EGCA 1PP4A 4RLHA 5K0BA 2EBHX 1PS0A 1XZQA 4XVUA 1W8IA 5DN9A 2HMAA 1URPA 3NXKA 5EWLA 4OLJA 2GAIA 4ZAWA 5C5IA 5K5EA 4DV2B 2XWBF 1G20B 2D6FA 4BU0A 4BJ5A 1CUAA 1EVQA 2YZ7A 3HHPA 3URMA 1KQNA 3DGFC 1AS2A 4CUKA 1F0KA 3I42A 3SEQA 4AT1A 4QGSA 1PE0A 3CLVA 1QG2A 3HJAA 4Q24A 3QLEA 1IPEA 2YINC 4CMJA 1TJNA 2AZTA 1M2KA 1L7RA 2G5PA 1CQIB 1QV7A 1YR2A 3BFXA 1AB6A 1KYZA 2HK8A 2RKWA 1BN7A 3CLUC 3HBJA 4L57A 4BVEA 3ILHA 1NMZA 3RUHA 4WNAB 1F51E 3OHPA 1CD5A 3Q10A 4I1RA 4I4TF 1NI3A 4MLZA 4CCAA 2V9CA 1XMVA 2VBFA 1Q57A 1R5JA 3OM1A 5ALMA 1KSJA 2ONJA 1K8ZB 1ORDA 1WPQA 2ZIXA 1HYBA 4HI0E 4EL5A 4YRSA 2WUGA 1I1QB 1I3KA 3OQBA 4DCPA 5A2GA 2C59A 5AJVB 4OMDA 1G5IA 1PZNA 5F3DA 1P1JA 3TM4A 4DILA 3A06A 4BTVA 2VK8A 4YC7A 5GTDA 4TT3D 3FYHA 1JEEA 2MIIA 1S8AA 4TZTA 1WLSA 3JVDA 2O7RA 2NW6A 4QYSA 3SQXA 1PR6A 2OZLA 2Q6VA 3C85A 1U3TA 1RHMA 1YBVA 3F6RA 4C4YA 4TMFA 3DUFB 1ACMA 1S1CA 4TV8A 2ZJ5A 3O4VA 1V3UA 5DXAA 5JEDA 4WD3A 1P33A 3AUAA 5E9WA 1V11A 3X2SA 3KELA 3PICA 3W5BA 1GRNA 5HSGA 4BC0A 3BGSA 1YQDA 1OH8A 3PGLA 5DXFA 1KR2A 4AD8A 2RIRA 3HBAA 5FYQA 5KQRA 3B7WA 1CKEA 1C7IA 1GKYA 4F3RA 2J85A 3MSCA 4XSVA 1H8ED 1YR8A 3PFCA 1JHUA 3DKPA 3UMMA 5EZYF 1FNCA 4RTOA 3X1WA 3N7TA 4XJXA 3TQTA 1YS2X 1YQEA 4CKWB 1A9TA 2QLNA 5SICE 1Z16A 4KE6A 4FYMA 3ZXXA 5L3QA 5A4AA 4OJNA 4Q4HA 3WADA 5JSFA 3QNWA 2FKAA 1OFVA 3OLCX 4UCWA 2GPWA 4L4YA 1PV1A 4XYGA 3AKCA 4F12A 4TUYF 3BWDD 3C3BA 2OBLA 1J8QA 2WE7A 1Y4AE 1YKGA 4RA9A 4U4AA 4D9EA 1BX3A 1XFDA 2ZJFA 3N86A 2HDHA 1QZ3A 4DIFA 2P40A 2HIHA 2FEOA 4ER6A 4ZEMA 2PGLA 1T26A 4E4YA 3P2JA 2FR8C 3BJIC 3KL2A 3OJWA 1IZ0A 2F1OA 4IHQA 4TMXA 2OV4A 4Y9UA 4U7FA 4FZRA 2X8WA 1FQJA 2GCOA 3PS9A 3WRXC 5AM3A 1M6YA 4JGIA 3EOBI 2WWYA 3IRVA 1UL1X 3BB4A 3E61A 1LQTA 2J3IA 1QTRA 2IKSA 3C8UA 3K6KA 2G5TA 3OE7D 1MJ5A 2FHPA 4NNOA 2JJ8A 4UBNA 3PXGA 2MR6A 1SRQA 1NVVQ 3IDOA 4C5CA 3OEEA 3Q2OA 4PO9A 5M7EA 4EB6B 1U99A 5GVSA 3MOGA 3ILSA 1IK4A 2DY1A 1TF7A 5EEGA 4PZUA 2JL1A 5KCMA 5KVAA 3FOFC 4I7EA 4H0CA 3SJBA 2EKZA 2GBIA 2YZMA 2PR7A 3KJXA 4FJ2A 1U31A 1H93A 1VG1A 1AQ6A 4R2MA 1CJUC 2QOEA 2QD4A 3NVDA 3NT4A 4D79A 3QE0A 5I3ZA 4S05A 3GROA 4UUBA 1OLUB 4M98A 4WLNA 1U7TA 2AEMA 1YQ9A 1B0AA 2VP0A 2WQZA 3WMGA 3TXAA 4BTLA 4DA0A 4ER7A 2ATIA 2C7BA 1AMOA 3WNCA 4HWKA 1VLZA 2G36A 3M5DA 5AHWA 3TVTA 4XGQA 3ELDA 4D57A 3AR2A 1O5OA 1Z6AA 4X1KA 2PUEA 1WF6A 3LHSA 3BTUA 3GGCA 3RAFC 4RM2A 1XQVA 2JFHA 2PT9A 1VPDA 4U7JA 2J45A 1OX5A 3PQCA 5ARCA 3V1TC 4OKSA 2D5AA 3OPYI 1UZMA 9MHTA 2VTDA 5TMBA 4M38A 2H0RA 3W2FA 3AFHA 3RK1A 1U2DC 3BGOS 3MA0A 4C2UA 2GSWA 4LRSB 2INGX 4HVLA 1KKLA 3JQFA 3OO1A 4Q6BA 2IW3A 5FI1B 3UHAA 3O95A 4A1OA 3L41A 1F60A 4WVFA 5JECA 1AT1A 4JEMA 4YMHA 1UADA 4ZOCA 5TEVA 4Z53A 1B8OA 3T7IA 2FFAA 1XMQB 3LU1A 1QVRA 4H1UA 3N76A 6Q21A 2DETA 4DABA 5CHYA 5D5QA 2JAOA 3CVJA 1EX6A 3DG9A 3PDIB 3FH0A 4YAOA 1QG6A 1V6AA 4H31A 3TQOA 2H00A 2DMRA 2Z57A 3RAEC 2O57A 1N7GA 3AB3A 2HD4A 1EA7A 1PV2A 2XKBA 1E5LA 1DDIA 1XMPA 4N0EA 3FOAA 1P19A 2BMAA 1XA3A 2Y3IA 4X7RA 1FFXB 4DJJA 4DV5B 2EQ5A 2D7JA 3JTEA 4OHMA 3PDIA 4WASA 3SX0A 5A03A 3CE6A 3CNNA 3G9QA 4JXXA 1ODCA 2OFXA 3HVJA 4UTOA 5CDYA 2YJGA 5BQ5A 1YL5A 4EELA 5I01A 1HYEA 3RR2A 3QITA 2PA3A 3D6TB 4CMHA 3N2IA 1NN5A 4O2AB 5AI0A 1ZNXA 3E84A 3O74A 4JKYA 2JK0A 2Y76A 4PGGA 4ZALA 1XKXA 4ZRDA 4CIVA 4AZ3B 5ER6A 3QF7A 1X7ZB 5D8DA 1S4QA 2JLQA 1Z6ZA 1A4IA 2JAWA 4HTFB 5PNTA 2H2FA 4WTOA 4ROTA 2X2FA 3F9IA 3ITKA 4B3BA 1YXMA 4AW9A 3UH0A 5TQVA 3H2KA 2W6NA 5F35A 3ANLA 3TQQA 2OLJA 5KOIA 1QFSA 1K6EA 1PT7A 1RLOA 2DFDA 3PLRA 4HB3A 3ITDA 1UC9A 4HMPA 4EJMA 4CI9A 2PZAA 3I09A 4LRQA 4AUNA 3THWA 1XAGA 3R9WA 4YH1A 4DNXA 3ZJVA 4R7GA 5B3AA 4P4UA 5T41A 3ZUPA 3DDNA 3PITA 4OMFG 3PCRB 5K8JB 3WLJA 2BDUA 3OBBA 1X38A 2II6A 4IRMA 1F7VA 5LVAA 4BO3A 1OTXA 3L9XA 1U02A 3FXAA 3R4VA 1FYFA 4FGZA 4UZSA 5AXDA 1Q2UA 1O4WA 1RWWA 1V45E 3GBPA 3U1TA 1R6AA 1WABA 2I22A 2H7XA 4E46A 5J4LA 5IARA 4F2HA 3M6IA 1XQWA 1JBEA 1SXHA 2P78A 2WYIA 521PA 3NKFA 1ZUNA 4XJSA 5JWRA 3ASZA 3WZLA 4FPXA 1JT2A 4KXXA 2ECPA 4MEAA 2V0CA 3ACBA 2O3TA 1V2GA 1X80A 2DF8A 2GHIA 1ZCFA 1XNGA 1D2NA 2HF2A 3LBHA 2ECKA 1FRFS 4I3GA 4OHCA 4X8MA 5TDHA 1F8UA 1NVKA 1XK7A 2VJLA 5JQGF 5ES3A 3EFOA 5I9BA 1FSSA 2XJ9A 3F3KA 3OI7A 2JANA 4X6UA 5FO0A 3ZWNA 1OZHA 1WW8A 1Y9ZA 1PBNA 2JCSA 5UKDA 3I2IA 1FYXA 3B85A 1ISIA 3S27A 3UAVA 3ZW7A 2R7KA 4LJKA 3V6MA 3ZZUA 2JHAA 1YJBA 3PL5A 4QHTA 1P5HA 1LEHA 3DYVA 4J4HA 1HR0B 3LKVA 1NL3A 2OUIA 2VOJA 4OQXA 1OPRA 2J33A 3G2IA 2CFRA 2VYVA 4YP9A 4F5YA 2VT6A 4D6XA 2XDYA 5CFQA 1QGOA 4MQFB 3REGA 3RABA 4A0SA 1N2XA 2BBWA 3SZGA 3EMVA 4E4RA 1ISHA 2IUFA 4RD4A 721PA 1U04A 5JEEA 3GB9A 3DJYA 3MMPA 1FDOA 4CKWA 3HH8A 5TQ2B 2C9OA 2PSDA 3B7PA 2OEPA 4Z0NA 2DPLA 2VZ9A 3ID6C 3D8TA 4CT4B 2AOXA 1Z88A 4YRQA 3BDVA 4MEBA 3TL6A 2I4MA 4R51A 1E0SA 3TLJA 5BSVA 4UD6A 1MB3A 4Y2QA 1KETA 4OBBA 4YV1A 4CMGA 3EMBA 5HHTA 4B17A 2YN4A 2J3EA 2X1HA 3EH1A 1CXZA 2WJJA 1VLMA 1DIHA 2GZRA 1UPCA 2QL5A 3EJWA 4W8GA 3VU9A 3BXFA 4A15A 1ZOOA 5F7ZA 1ZOSA 1H2HA 5SZHB 3UKOA 1I2DA 1KZYC 3VOAA 4MRNA 2IOQA 2WF8A 1R4NB 3RBVA 3CX6A 1AQJA 3DHNA 3T4PA 4CEIB 3RYCA 1AKVA 3ZI0A 1AC5A 1D7AA 4FHZA 3QG5A 3HACA 5KPDA 2NU7B 3QU2A 4MW1A 4WI1A 4QULA 1E9VA 3G6KA 3UH1A 5EIAA 1JTEA 3IJPA 1BMFA 1U0HC 3ONNA 2EATA 4RMHA 1U5CA 3DP9A 3LOPA 3LZDA 1KOGA 3ZCTA 1FDVA 1V5EA 3FFTA 4PLTA 4ASUD 3H5AA 3MJEA 3MCUA 4CETA 1ZVVA 3TK1A 3NALA 3G0GA 1EEXB 1VB5A 3RPEA 1OFGA 4J2OA 5HF8A 3O73A 3VTFA 2D1QA 1X3SA 1WTAA 2YW2A 4DR4B 2AS0A 2QP9X 2GN1A 4QLBA 2V7XA 1CG6A 1FDWA 2ZUVA 3HCWA 4CIYA 3DXFA 1JW9B 4YMIA 1NA5A 4PN7A 4B3HA 3PWZA 3VVCA 4EBFA 4B3TB 1RXWA 2B0JA 3K5WA 3I6YA 2K87A 3RVOA 2RBGA 2Y77A 1NONA 2RGBA 1SC3A 1U98A 1XLUA 1O97D 2BM8A 2LGJA