2FQYA

Pnra from treponema pallidum complexed with adenosine.
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
316
structure length
316
Chain Sequence
b'GDFVVGMVTDSGDIDDKSFNQQVWEGISRFAQENNAKCKYVTASTDAEYVPSLSAFADENMGLVVACGSFLVEAVIETSARFPKQKFLVIDAVVQDRDNVVSAVFGQNEGSFLVGVAAALKAKEAGKSAVGFIVGMELGMMPLFEAGFEAGVKAVDPDIQVVVEVANTFSDPQKGQALAAKLYDSGVNVIFQVAGGTGNGVIKEARDRRLNGQDVWVIGVDRDQYMDGVYDGSKSVVLTSMVKRADVAAERISKMAYDGSFPGGQSIMFGLEDKAVGIPEENPNLSSAVMEKIRSFEEKIVSKEIVVPVRSARMMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane lipoprotein tmpC
publication title The PnrA (Tp0319; TmpC) lipoprotein represents a new family of bacterial purine nucleoside receptor encoded within an ATP-binding cassette (ABC)-like operon in Treponema pallidum
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Transport protein
total genus 122
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02608 Bmp ABC transporter substrate-binding protein PnrA-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqyA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqyA02
1ZN2A 4RXTA 4MS1B 4EVSA 1M2EA 1Z18A 1JYEA 4LX8A 4EUKA 1YS7A 2R48A 2O20A 4S05A 1JWLA 4EY3A 1VPWA 1U2PA 5JNRA 1DP4A 4G0PA 3CZ5A 4MS3B 1GUBA 1EWTA 4MS4A 3BILA 5E3JA 3Q15C 2M1ZA 3FDFA 1KGSA 5DGCA 3SNKA 1F51E 1NTRA 2HQBA 1SXGA 3GA5A 1HEYA 5KC9A 4WXMA 4F11A 4MGEA 4PEVA 3ROFA 4Z4GA 4MAAA 1L5ZA 4F3TA 1CYEA 2RJOA 3QEMA 3EQ2A 4RS3A 3IP5A 2FLKA 4ETNA 3LUFA 2PAFA 4LDAA 4MS1A 4YLEA 4DQDA 2FQXA 2WJWA 3LFTA 4MRMB 4D6YA 5FWXB 1BDIA 4KQCA 2FEWB 8ABPA 7ABPA 2E4XA 3JPWA 3LMKA 3H1EA 5IBQA 2PL9A 3DGEC 4MS3A 4RY8A 4CBVA 5DCLA 3H5LA 5JNVA 1NXWA 1Y1LA 3I45A 2PUBA 4OBBA 2GI4A 4YP9A 1ISSA 2WY2D 2A9OA 4DADA 3IPAA 1NXVA 3RVMA 1SRRA 1XHEA 3F6CA 3HS3A 5CNJA 2JRLA 4EYQA 2W42A 3I09A 1FQWA 1LJLA 3CNBA 4IILA 2I6FA 5CNIA 1RNLA 4JOQA 3DZDA 4MRMA 5FWXA 2JVIA 3E61A 2DRIA 5D2CA 2CD7A 3H6GA 4UHKA 5EWJB 3UK0A 5C5CA 3BRSA 3UUGA 1JLKA 1MVOA 1U0SY 1URPA 2H3HA 3NHMA 2J48A 3HO1A 4IMJB 3O1HB 4XARA 2L18A 3FFTA 1YVUA 2MSKA 4NQRA 4ZJPA 4XLTA 4OLAA 3JY6A 5DTEA 3A3KA 5ED4A 1B00A 3L6UA 3QLVC 1USGA 3H5WA 1FFSA 2P4UA 1JBEA 3RVLA 2FLWA 2NT4A 4O5AA 4WT7A 3OQOA 4LZLA 3EULA 1QQBA 3EAFA 2FEPA 3E3MA 2WRZA 2HQOA 4Z4CA 3QEKA 3HSYA 1GLGA 4H60A 4N0PA 5HSGA 1KRXA 4EVQA 1PNRA 4PYRA 5EWJA 5PNTA 4PE5B 2JBAB 1TM2A 1RXEA 1T34A 4KVFA 5GQSA 4W5OA 4WZZA 6CHYA 3D8UA 4G97A 3CZCA 4W5TA 1BAPA 3KTOA 4QYWA 2QXYA 3N0XA 2PUDA 5GOTA 3SY8A 4MR9A 4KK3A 2VYCA 4MQFB 4FB4A 4YCSA 2FKAA 1SXIA 3TMYA 4YGXB 3CKMA 4RY9A 3S99A 4Z9AA 1J56A 2OQRA 4XASA 1AB6A 1JFVA 2R47A 5IUKC 5KQGA 3N53A 1YTUA 3FFWA 2LIVA 4H3KB 4JB0A 5JS2A 2JBAA 2R25B 5EWLB 3TD9A 3BBLA 5TPWA 4WXEA 3H6HA 2MYTA 2GWRA 2FN9A 3H5IA 3FFXA 3RVOA 3NNNA 5KI6A 2FN8A 3N8IA 3OM0A 4N76A 2JVKA 2FEKA 2MSLA 4YS6A 4N41A 4O1HA 1GCAA 1NXOA 2NZUG 4OTZA 3IP9A 4MQFA 3LKVA 3HDGA 2HJ9A 4LRQA 1PEYA 1Z16A 2E4ZA 3I42A 3OLYA 3Q41A 1ZVVA 3ILHA 5TQ2B 1BDHA 4KFCA 1EWKA 4ML3A 1NXSA 1U8TA 5IULC 2NZVG 4EYOA 3CRNA 4Z4EA 3UKJA 3O2QB 4MR7B 4LE1A 2ID7A 4RK6A 5EWLA 4KREA 2HQRA 2NUBA 3M6MD 5EWMB 4ZMSA 2PE5A 3F73A 1A2OA 2AYXA 1QP0A 5FBKA 1FSPA 1DCFA 3C3WA 3O1IC 1PHRA 1ZESA 3RVSA 4EYKA 4RKRA 1RXIA 1DCMA 4KQ9A 3KG2A 1E6KA 1QO0A 1KMIY 4XFKA 4YV7A 3MA0A 2FTKE 4GPAA 1EAYA 1JDNA 5TQ2A 3LKBA 4N0QA 3LUCA 1MB0A 1M5UA 3CLKA 5DLEA 1D1PA 1VLZA 2QSJA 4G0OA 4HYEA 4NCAA 4LDZA 1VRVA 1JH9A 3F7NA 5EWMA 1QNLA 3H5VA 4UHJA 1ZGGA 1DCKA 1M2FA 3RH0A 2PKXA 2YHAA 2QVCA 3C97A 3H5TA 1ZH2A 2QW1A 3KYJB 1D1QA 3RVQA 4B09A 3NNDA 4WUTA 5BQ3A 3EQZA 2PUCA 2VK2A 4NICA 2F8SA 1LK0A 3OLXA 3ROTA 3C3KA 2A9PA 4XAQA 1TVMA 3GRCA 2IPAB 5DKFA 2A9QA 3HZHA 4Z0NA 3CG4A 1H9CA 1USIA 3H5OA 3OMWA 3TO5A 2PUAA 2A9RA 3LOPA 5TE9A 3VNAA 2X7XA 4G0XA 3RVPA 4KPYA 2CWDA 3T6KA 2TMYA 5T7BA 3QLUC 3OQMA 4L85A 4Q6WA 1ZGZA 5IEBA 4Q6BA 2L2QA 2BGGA 1QP4A 3LUGA 4JB2A 1M5TA 5I4CA 1K66A 2FMIA 4MPTA 1USKA 1YMUA 5F64A 1YK0A 2ZAYA 5BRJA 1QPZA 1E6LA 1GUDA 3JVIA 1I3CA 4RSMA 4M88A 3MMNA 1QKKA 1DC7A 3NHZA 2FVYA 3EDCA 2MYPA 4EGSA 4ZYLA 1UDRA 1LJUA 3C6QA 2PUFA 1APBA 2V0NA 3TB6A 1L5YA 1F4VA 5TPZA 3GYBA 3RQIA 3KKEA 1Z2EA 2PUEA 2WB4A 1S8NA 3KYIB 5JS1A 2IYNA 5JNSA 1NXTA 1A0OA 3OLZA 3O2JA 2MYNA 2FQWA 2F8TA 4F12A 4RK5A 3QLVA 4QYMA 4RK0A 4GNRA 2M98A 4IF4A 3QELB 3GBVA 3O74A 3HXMA 5B3JC 2P9HA 1DZ3A 3Q7TA 4G0MA 4HNQA 4IMIB 4Y9TA 3SQNA 3DLHA 1BDJA 2KYRA 3Q9SA 3FGZA 3OO1A 4RK1A 2IDMA 3MF4A 3O75A 3MIZA 3A10A 3CS3A 4O1IA 2JVJA 5CHYA 4MR8B 3W9SA 3A0RB 1QO0D 3GBPA 1MAVA 1BVHA 3R0JA 5KWSA 1Z26A 3SAJA 2LP4Y 2FMKA 5KQMA 3OMXA 4NV3A 4E7PA 1Z15A 1JL3A 1RZRA 4EYGA 1P8AA 4IGAA 3QELA 4TLLB 5B3JA 4QICA 1TLFA 4ETIA 1ZITA 4IRXA 2E4VA 3DGFC 3IP7A 2WJAA 2WWVD 4ZPJA 5ABPA 1Z2DA 1QQAA 3NBMA 1D4ZA 3G85A 3OLVA 3HK2A 5JNUA 3P9YA 3HEBA 1JYFA 3H1GA 1C0EA 1WETA 1MIHA 3N75A 4F8JA 5IUJC 2RJNA 1JFSA 4W5RA 3FMVA 4XXHA 3Q7RA 4KNYA 1LBIA 1SXHA 2RDMA 3KJXA 1ZHHA 2N9UA 1DG9A 5T3YA 4P1ZA 3MM4A 3O2SB 3TX6A 4PICA 4RKQA 1BA2A 4EVRA 1FFWA 3N0WA 3BRQA 2CHEA 3T8YA 1W25A 1NY5A 2CHFA 4YWHA 1TJYA 1TMYA 1YMVA 4G0ZA 1ISRA 4H3HB 3EGCA 3QLTA 4YR7A 2Q5CA 1Z25A 2RGYA 5IEJA 3CU5A 3KSMA 3KCNA 4RK7A 5FWYB 4ZMRA 1FFGA 5HQJA 3GWGA 2IPLA 3LUJA 6ABPA 1DBQA 1P2FA 2FQYA 5IC5A 3JVDA 2LUOA 4RXMA 4FE4A 2GBPA 3K4HA 1GCGA 1SD5A 2R4QA 3B2NA 3CHYA 4MR7A 1W9HA 1DRKA 5FBHA 2QZJA 3H75A 3RVRA 4ETMA 1PNTA 3HVRA 3ILYA 3IDOA 4DN6A 2PL1A 2IOYA 4RZSA 5TPZD 3KLNA 4N03A 2H0AA 4MLDA 2PJUA 4QPJC 3H1FA 1Z17A 4FE7A 4JP1A 4Z4IA 4LE0A 2MYUA 4TMYA 2QV0A 2MSWA 3O21A 2XDYA 3RVNA 1D2AA 1ABFA 1JHZA 1JDPA 5KC8A 4HNRA 5FWYA 3EODA 2B4AA 1EHCA 2ID9A 3JPYA 1YS6A 1EFAA 1IIBA 3DLBA 4P98A 2LBPA 2ZWMA 4D74A 4N47A 9ABPA 1MB3A 3L49A 2YHBA 4KK4A 4OLBA 1ZH4A 3QX9A 3VNBA 4RY0A 4RXUA 2QU7A 1ZAYA 2PMCA 1C4WA 2OENG 3LUHA 4L4UA 4E7OA 1NATA 5JNWA 1YIOA 5BRAA 2FW0A 3C3MA 3JTEA 3SG0A 1E6MA 3CFYA 1RZRD 1CEYA 3K9CA 1Z13A 1E2BA 1P6QA 1RPJA 1DJMA 2B1JA 3A0UA 1DC8A 2GKGA 4JASB 4KZKA 3QLUA 2JB9A 2WMYA 2E4YA 1QMPA 3URMA 3QK7A 4G86A 4YO7A 3IP6A 1OXBB 4MR9B 3OQNA 3LUDA 3HJFA 2FXIA 3CG0A 3G1WA 4MQEB 3CTPA 3N6VA 2HSGA 3GV0A 4RU1A 1OXKB 2FMHA 3RVKA 4Z4HA 4KMRA 4OATA 3IPCA 4JA2A 4YRZA 1LBHA 3OLWA 1VKRA 4MYRA 3SM9A 1XWWA 1D5WA 1JX6A 1PUXA 3GL9A 4OG2A 2FMFA 1A04A 4Q7EA 3DBIA 3JS5A 4JAVC 3BREA 3HV2A 4PZ0A 4NCBA 1K68A 4KRFA 4G0YA 3OM1A 4MLCA 5KQLA 1XHFA 3I5AA 2PUGA 5CNMA 2QVGA 3HUUA 3KS9A 4HNSA 4LE2A 1P6UA 2GX6A 5TPWB 4W5QA 1JF8A 4RWEA 2LPMA 1DRJA 2VUHB 2JK1A 3HUTA 3LUKA 4TLMB 5TQJA 3M9WA 1QP7A 4W5NA 5TQ0B 1U2QA 3LUAA 1PEAA 3MQ4A 2E4WA 2IKSA 2L17A 2VUIB 4RK4A 5KQPA 3HM9A 5C5EA 3EJWA 4MQEA 1JFTA 3O1JC 1Z12A 4D6XA 1EWVA 3N0RA 2PLNA 3NNSA 5JNTA 1AB5A 1NXXA 1CHNA 3QX8A 2FSPA 3RVJA 1DBPA 1ABEA 3D02A 2E4UA 3HDVA 3OO0A 4S04A 1DBWA 4G0QA 5HM6A 4F06A 1U04A 2QR3A 5BR1A 4MS4B 1ZY2A 4Z4FA 2JCGA 5CNKA 2L19A 2AYZA 3M9XA 4KV7A 5IX8A 4TN5A 4RDCA 4MR8A 1YK1A 3Q7SA 1NXPA 2IPNA 3LTEA 4Z99A 5HKOA 2IPMA 3HCWA 4Z9BA 5IUNC 1ZDMA 3GT7A 5TQ0A 4WWHA 3F6PA 3T95A 1KRWA 1R8JA 3KLOA 3QEMB 2HPHA 2NT3A 3T38A 3KHTA 4RV5A 3MYYA
chains in the Genus database with same CATH superfamily
3HBFA 3JQCA 4EVSA 2GN4A 5K6AA 1JPUA 1ETUA 1M2EA 1JYEA 1X1RA 1RKQA 1XMIA 3AG6A 3TLMA 4S05A 4PSAA 4WK6A 4JL5A 2CXHA 4YECA 1QRRA 3L6EA 3GC6A 3U3XA 2I7TA 4E1VA 4YRKA 1Q91A 5A5GA 1JU4A 4G5HA 5C2JB 3QU9A 3HFSA 2EC5A 4KQ1A 2R6GA 4OOFA 2LGJA 5LXTB 1PJBA 2O4UX 1BTOA 1WHSA 2OZLA 2CSUA 2RG1A 3BILA 3DBLB 3I4CA 2XXJA 3M8KA 4NR0A 1ZOLA 5J2TF 2QRPA 5IU6A 1TT7A 2O2SA 2CVHA 5KQRA 2HQBA 2F00A 3CF4G 1VE5A 1TIKA 4H7EA 5B58C 2FR0A 4LNUB 3K20A 2BL4A 4OQPA 3VPXA 2CZGA 1A7AA 4PZCA 2ACWA 4RFSB 3QEMA 2Z56A 3EQ2A 1QHXA 4BIMA 2CJPA 2D5LA 3WHKA 1L5RA 3FH0A 4IXTA 5TIIA 1KWGA 3KPYA 1JJIA 1O95D 4WNYA 1VG9B 1EK6A 2VDUE 1NZDA 2F2TA 2BTEA 4JC0A 3H1BA 1PR1A 4MKIA 4G5FA 1VKNA 4MGZR 4D7AA 4BC0A 4NARA 3CCFA 2HK9A 3DSRA 4KUGA 4WPGA 5TR9A 4KTTE 4L3OA 2GN9A 2JAWA 3U7EB 1JNXX 1R0WA 2GJ9A 4ZAXA 4YGYA 3V80A 4F6RA 3ROXA 4L0QA 5FV7A 1Z4QA 2VDMB 3KPJA 1TK3A 1O03A 4CEIB 3R6WA 1AJEA 4DR3B 3QKSB 5DO9A 1GARA 1TECE 3BMCA 3UJNA 2ZWVA 4IWYA 4LWOA 3OEHA 4J1QA 2Y9MB 4AJPA 4AY5A 3QVMA 1SULA 3T9BA 2HPVA 2W42A 3UWKA 4Z4QA 2LRHA 2HK6A 3RTAA 1JSXA 1O58A 1U5AA 1IXRC 3CW9A 5HJEA 3DOFA 1N5JA 4KCGA 5JJ5A 2E4AA 4O2BA 3RWMB 1Q20A 1NMEA 4OBXA 3L41A 3JQPA 4UBOA 5D2CA 1L9XA 3DE2X 3C15C 4NBSA 3SX2A 1BVUA 3FWZA 3QM1A 2OT3B 1LFDB 4MI9A 3CKKA 3AYXB 3DQPA 1V5WA 3EY9A 3QUAA 5KZMB 3KEMA 5A4KA 1P5ZB 2QM7A 4XLTA 4OLAA 5GM1A 2X2EA 4CKEB 4P92A 2D13A 4BDSA 4OXIA 4DWJA 4AQYB 3N0TA 1KJ8A 3NHWA 2LZ0A 4IMPA 4MUXA 3E5NA 4M9CA 1UEXC 2IYXA 4AT1A 4BCDA 4KQWA 3TIXB 1TM4E 1V43A 1AA9A 1XTPA 1ONNA 3AY3A 4IJUA 2QTCA 4PX2A 4R0VA 3GHHA 1LBEA 4G01B 4MA5A 4REQA 5DXJA 1UPBA 1AUPA 5JU6A 4KYVA 1FLVA 2B3TA 2C98A 2EFGA 2OL4A 2FK7A 1V0JA 2W0MA 3ECAA 4FJ2A 3TLAA 3VISA 4Z4CA 4H60A 4WCFB 4ZCPA 1QK5A 2YZ2A 2NNWB 2ZR7A 1VMDA 3ELDA 3L8CA 4XSHA 1JRLA 3QFTA 3U4CA 2F59A 1DKNA 1H1TA 1RADA 3ZV6A 5A1TA 1AUOA 2HLHA 4GEKA 1OI2A 1QYIA 3B2EA 4RTQA 1T3SA 4W5TA 3B6KA 1N36B 5SYAA 1U7TA 5BN4B 1XNQB 1PS8A 2VHXA 2OCDA 4DQ0A 3ADBA 4R8KA 2D1FA 2DBYA 2FNAA 2NSJA 2WR8A 4YCSA 4OQMA 3SBOA 1R5OA 2RH5A 1X92A 3ND5A 4QDXA 4IDOA 1T91A 4Q4CA 3EFEA 1YQDA 5EKDA 4JI5B 2CSXA 5KNBH 1WVGA 1OPXA 1XSEA 3KE9A 4JP8A 1UFQA 1MXFA 2X4DA 2DPYA 3HYNA 5IAOA 2JCBA 1MR3F 3M6VA 4JB0A 1HKUA 2A84A 2VNJA 3ESZA 1CWUA 3IEKA 5IJ0A 2ZSFA 4WXEA 4C2UA 4LDJA 5A3VA 4J0QA 1RR6A 4FLEA 1QUFA 1SCDA 3VBEA 4QVIA 3PBKA 1ZRMA 1QANA 1P1IA 4U7DA 1OI3A 2PX6A 4YBRA 3MWDA 1LPNA 3CKYA 1WPXA 2OGWA 2NVUB 3JYQA 4KIFA 3S2SA 4IVPA 4RYLA 4NDNE 5ETJA 4GVPA 1IN4A 1H9AA 1UBOS 2IXGA 5HZMA 3GT4A 3NM4A 3R24A 3B7PA 5F3DA 2YV3A 4M9SA 1FX1A 4JH0A 3ILHA 3AERB 4LMBA 3ZLJA 4X3PA 1EQ2A 3OEHD 4X44A 5IULC 3DZJA 4EYOA 2R85A 3M82A 4ZYUA 5IMSA 1AQNA 3VNSA 1G66A 1E2KA 2CKDA 3NTRA 1US8A 5H68A 3WNQA 4RIHA 5JCXA 5I9NA 4XPZA 5L40A 1CQZA 2HQRA 4JQOA 4O4JA 5G0TA 1YRQA 4I6EA 2O2GA 2PDAA 3WSWA 3C3YA 2QPLA 3KAQA 1OZFA 4R1QA 1U4OA 1RYNA 3RVSA 1NU6A 1UWCA 3TTXA 1ZRHA 4F3CA 2XEXA 3TTWA 3IIMA 1KNXA 2PR2A 2IU6A 1RWNA 1W4AA 3R09A 3V34A 3WDKA 3EQ8A 3UPUA 3AHJA 1W76A 3LPDA 4HX5A 5K2MA 4ZZ3A 3KX2A 5BVHB 2QE7A 5BR8B 2UDPA 3DZIA 3P2OA 2BFBA 2YJ4A 4BVKA 2OGUA 3ZK7A 1QR6A 4BB9A 2FUG1 5LQUA 3FDJA 3KUDA 1IB0A 5E7JA 1J5PA 2QLJA 3AJDA 4CMHA 1PVVA 1NI3A 1EB9A 4IFEA 4LDZA 4F97A 5C80A 3EDQA 3JQ8B 1FS5A 3KQOA 4CCSA 3N2EA 3EXHB 4D4HA 3FNQA 4UTRA 1CF4A 1IJKA 1QNLA 4KYUA 2VBIA 2CDBA 4J7CA 1LKZA 1DC6A 3BZBA 3SLKA 2H48A 4EMTA 4G09A 2VSFA 1FDVA 2AV6A 1TQHA 2Q3LA 3UOGA 2QN8A 3MTIA 5BQ3A 1T5BA 3X2EA 4IDFA 1SC6A 5L7YA 4OJNA 4C1NA 2FFBA 5GGYA 4HAXA 3U62A 1Z0UA 3LQKA 4ZI3A 1MORA 1UXGA 4RTLA 5SZHB 4KYIB 2A9QA 4J6FA 5LWQA 1ATZA 1LS6A 2DQZA 4LHEA 1P4AA 4MNTA 2VQ3A 2BBOA 4EA9A 4DZRA 3PHCA 4IG4A 1G64A 2PG3A 3JQ7B 2Q6KA 4TTTS 2WHRA 3MUFA 2P0EA 2DF8A 1CUDA 1Q1AA 4B8YA 2NUPA 5EN4A 4E2XA 1TYBE 5ALNA 3Q9UA 2GA8A 1TUBB 1Y0BA 4HGNA 3K31A 3TRJA 2IU0A 5JH7A 1JS1X 3D7SA 5KQSA 1FDWA 1Z8DA 3QU5A 2FZVA 2H16A 5EXEA 1B3RA 5JSKA 4ZI2A 1BA3A 2WM2A 4M88A 3BDIA 1KJJA 1BH2A 1Z8FA 3GA7A 3ZCQA 2I6SA 1Q95A 2YWDA 3JZMA 3BTOA 3W2TA 1ZIDA 5ALYA 5TXGA 2ACEA 1XPUA 2ATXA 5KYWB 2FETA 4Q82A 2BDEA 3D54D 4MV1A 5C1DA 3QWIA 3AQIA 5L3QA 1XJ0A 3BRCA 3O4RA 2DG2A 2EW1A 1BXGB 1EFPB 5DIZA 2HMAA 4KXLA 1CDDA 1VBKA 1GVNB 1XMVA 3UAYA 3UAOA 1CDOA 1JPVA 2NYVA 4C6TA 3E2PA 4P58A 1NXTA 4PO9A 2FQWA 2WBLC 1GNQA 1KI3A 1LWNA 1R6VA 3MBKA 5KB3A 1Z36A 4US2R 5JSUA 3O9MA 4LMRA 3U7HB 3RFCA 1N5RA 2O0HA 1B8UA 3O74A 4M49A 1YI1A 4NBRA 4WVLA 2UZIR 1TAUA 2YBDA 4XFJA 3BERA 3P9RA 1JDZA 3UK2A 2F67A 4EKIA 3O9ZA 3MLEA 5BUCA 1IM2A 2AFHB 2B2CA 4LEIA 2HLPA 3INRA 4IKOA 3FGZA 5FUQA 5KTTA 1JJFA 3RSHA 4RK1A 2X4LA 4YQYA 1DG1G 1N9GA 3G1UA 5CX1B 1T9DA 4D8XA 3Q7QA 1E3QA 3T7KA 4G3XA 4M22A 3A0RB 5AKXA 4C0QC 3VR2A 3W5SA 3PUYA 4RKEA 1RHRA 4KAXA 4M21A 1BX3A 3IUSA 3Q5EA 2D5BA 3GOHA 3HWWA 4HSGA 5AR1A 4OLFA 3TW6A 4KIGA 4EENA 2QE7D 5IYZA 2FJ0A 3OMXA 1ZIYA 3FPEA 4JP2A 4LBZA 4OMUA 1U2RA 4PO3X 4C4AA 5B3JA 1RXSA 2FW6A 2EU8A 5IJAA 3EZ9A 3A1UA 3K1YA 1U7DA 1MABA 2C5BA 2O8DB 1A8PA 3KZNA 4ONEA 4DQKA 4OGWA 5EERA 1R10A 1N2JA 2D5CA 4Z7NB 3EPLA 1CUFA 5FUVA 1KYTA 2D3TA 3D1JA 3H65A 1K7XB 5E4FA 2OHOA 2ZE8A 3GLIB 5ABPA 4JSTA 1EFHA 3AF2A 1LLUA 3ZLTA 3R9XB 3UMCA 1RJWA 2WQZA 3ONWA 5HP4A 3FMFA 5AHWA 1DTSA 2FGJA 3DMTA 4RH1A 4HWPA 1EVZA 3QUCA 3AV0B 1JSRA 5FL3A 2FWMX 4B43A 5JO9A 5ADHA 1GHTA 1ZHFA 1K5GA 2Q1SA 1I3OA 1CIPA 4CL8A 4CGYA 1YBAA 2OV8A 5IYZF 3IDAA 5KSPA 3OCWA 2BBWA 1J06A 3COZA 5LR6A 4LGMA 3CH4B 3K2EA 2ZCVA 4WI1A 1RWXA 5CYOA 5AVVA 5ALKA 4RCYA 4HQFA 1MEOA 4JBLA 1XKTA 4H3HB 1QMGA 3IKVA 4OAOA 4RTRA 4HS4A 2XTNA 3ESQA 4FGJA 4XM1A 2CCJA 3ASVA 1E0SA 3H18A 4LYEA 1N2CA 4EI9A 1ECJA 3F7OA 1ODSA 5A5EA 3LLMA 4XR4A 2LUOA 5E0OA 1W87A 4Q19A 4ZOBA 5EJ7A 4FBMA 1XD2A 2PGXA 4I46A 5D5PA 4FOTA 1UJBA 2BBTA 3NUZA 4V1CA 3L6RA 3N2LA 1T13A 5CFPA 1JQAA 3ZI7A 4U9UA 2C96A 1MC5A 3L1UA 2R2GA 1AS2A 4H7IA 1SUDA 4Y9UA 3VUEA 2LV8A 1MJFA 1VKZA 1HFKA 1BEZA 4MLDA 3RT7A 1NG1A 2C82A 1QIHA 1VPLA 2FPPA 4G1EB 4HQOA 1KHTA 1CEXA 4M8LA 4PN3A 1K8QA 2YMMA 5C8XA 4NJEA 2ZU6A 4NXNB 3PTLA 1U7WA 5GINE 1UOOA 3ND7A 1E1CA 2QY6A 4FI3F 4GKAA 3WBJA 4CHGA 2H2DA 1Q0QA 2GEBA 3OESA 4ROSA 2GO1A 4ZV4A 1T36A 1Q12A 1E4EB 2G04A 2TMGA 1N3YA 1WXGA 1WW8A 4I8DA 1Y7TA 4X90A 4NEQA 4RPIA 2EV9A 1ST2A 2KLBA 4H1HA 3G0BA 2IWHA 2H4YA 2GN6A 4IL5A 2YS7A 3UH0A 1KPGA 3PX2A 4HPJB 4C0WA 3ZJVA 1C2TA 2Y93A 1IUNA 3OVMA 3U3KA 4RY0A 3VNBA 2QSUA 2WUEA 5FNVB 3VR2D 1IL0A 1XZHA 2X1MA 1ES9A 5HKBA 2COKA 3LBAA 4RKYA 2J45A 5K0LA 5T5QA 3Q7EA 5BNIA 1NDQA 2DBQA 4WJKB 3WBKA 4BB5A 5A71A 2Q3BA 5ALVA 1WUYA 3TLGA 1T6YA 4QGHA 1UKEA 1XD8A 4CETA 3AQ4A 3T1NA 1QX3A 4I3FA 2WB2A 4KE6A 1EDEA 4IJKA 4CZ2A 3QVLA 1E62A 3FMIA 3QFHA 5FOSA 2RHMA 3S1AB 3PV0A 3URKA 5KMGB 3MERA 1Z5ZA 3DAFA 1EHYA 2NU8B 3IP6A 1A9XB 2H1WA 2WJGA 4FKZA 5J40A 5D85A 1OXVA 3QITA 4FDUA 3WLIA 4NYMQ 4IHJF 1CT9A 3KLPX 5EHQA 2FMHA 2P2LA 3BORA 2WWXA 5B37A 2GPYA 3OJXA 4HXEB 1R8SA 5JHHB 1FBTA 1D5WA 4J7AA 1XTUA 1RHMA 4NG5A 4TRMA 2P5YA 4J16C 2WP8J 3DBIA 3GUHA 3BREA 3OZBA 1HYBA 1DAMA 3ONFA 3PNOA 4G0YA 3IJEB 3AVVA 2XF8A 2D7JA 1C4OA 4K6OA 1T4CA 2QX4A 4P83A 5A4JA 2F4NA 2VHQA 1SU7A 3BF8A 1GY8A 3BH6A 3J7TA 4HQRA 2XUPA 3N2YA 4BP3A 8ADHA 5TVKA 1PAUA 2H6EA 3HUTA 4DA7A 2A92A 1NYRA 1SELA 2IXDA 2F3TA 2ZSUA 3D31A 3OJEA 1CZNA 1NVVR 2PIDA 4AJLA 3I2GA 4UM7A 2BMFA 4GX2A 1OOEA 2HCJB 3TMAA 1RACA 4MQEA 1JFTA 1V7PC 2A5LA 1KTVA 1GQQA 3O1JC 4XGRA 1I3MA 3LGAA 1EWVA 2FSIA 3FGOA 4KRXA 2QTVB 4JC4A 4TLBA 1RYMA 3IUQA 4CFYA 1NWHA 1QIKA 1UK6A 1UK9A 1JHUA 2OE2A 3D02A 3DTYA 5FO1A 5CXSA 3QFRA 2YWBA 3Q3IA 3ZVRA 4CIXA 4F06A 3CUUA 4ZHQA 1JZTA 1R6TA 4YDSA 4GBJA 5KJCA 4D98A 3GNSA 1JFRA 3VU9B 5K45A 2UYGA 4GPZA 3C5WP 2DE0X 1O0SA 3OETA 3TQHA 2QIOA 4LYGA 5T8KC 4DBLC 2I3DA 2XCRB 1QQ6A 4LCEA 4P7JA 1JIJA 4UJ3A 4F3YA 2AD5A 2DY0A 1NRIA 3QPCA 2WT4A 4BNTA 2OHIA 4OI0A 1L5MA 1NV8A 4M76B 4TSRA 1CV2A 5LBTA 4CIWA 1V25A 4OQYA 1Y4ZA 3WIEA 2C5AA 1LVHA 1ECLA 1V47A 4DNOA 1ZWKA 2AMLA 2X8JB 3AU8A 2OCIA 3PLAE 3ROPA 3G5UA 2IS6A 4LJ9A 1A27A 3CNLA 3V2GA 4AICA 3O4GA 4LOHA 3GMTA 3VTZA 1Z5NA 3ZBUA 1VJGA 3ZS8A 1JI0A 4PZLA 1KK2A 2ODNA 3CZ5A 4D0NA 1VG0B 4TYYA 1BWSA 3TJZA 4AKIA 4DC1A 3DFZA 4K2AA 1R0RE 2P5SA 3L7OA 5AW9A 4B4KA 3UMMA 1CRWG 1UXHA 4ZHQF 1F51E 4O02B 5BQPA 1I9GA 3GOQA 5T67A 4YIHA 4F11A 1RRMA 2VCEA 4MGEA 2Q5QA 5LQRA 4FDLA 3DVAB 1C7ZA 1XDWA 1KDOA 3N2KB 4GBMA 1O4WA 4HAIA 4TYNA 3BEDA 3CIFA 1TYZA 1DPFA 1T1JA 1OX6A 2I4MA 4GM1A 1C9KA 3WR5A 4DL9A 5DWVA 4DYVA 4BEVA 3L6BA 5K0FA 2RGRA 1QR2A 3OUTA 3RYFA 1ZIOA 3LKDA 5CYPA 2CLEB 1YVDA 5A7GA 1KQGA 2E4XA 3GLGE 3L7JA 5HYVA 3RSCA 1AMOA 1OCEA 3B5EA 4GI2A 1XZEA 1ISMA 2I6TA 2HTEA 4OJMX 3DGEC 4Q15A 1PP4A 1FUIA 1QZTA 4OIFA 1JA1A 1GIAA 4XKJA 4EW3A 2O1SA 4AN1A 1RYZA 4P34A 1VA5A 2CN1A 4OM7A 2CXTA 1UQUA 1NJGA 3B1XA 4C43A 3SQWA 1A4UA 4EPVA 3P2EA 1P6XA 4R2WA 2FK8A 1O4VA 1QKJA 2OG2A 4LGVA 1EP2B 3JQGB 2VNAA 2EQBA 3D3KA 1WKBA 5BSWA 1IEWA 1GNTA 3M5DA 2JA1A 5I3ZA 1JG1A 5JIBA 2VF7A 4L9AA 4GX5A 2EEZA 1GPJA 5JS6A 3I09A 4LHXA 4UUOA 2PPLA 3WQSB 4B2LA 2HDNB 3PGVA 4CIBA 5IJWA 5CLHA 1R0CA 3L4SO 2IIBA 1M34A 1LRLA 4DDVA 2P3OA 4ZYZA 1J8DA 1RWQA 4K9OA 4Y3UA 3BDAA 4KG7A 5CAEB 1NG9A 3ZGOA 3VZPA 1WIWA 2YFYA 2HREA 1GKIA 1WSDA 5EINA 1R4MB 2W2KB 3ED5A 1AX9A 1DAIA 3T5MA 2ZPTX 1MNQA 3IPRA 2XWPA 3NETA 1ONBA 4JR2A 4F5EA 3ZY2A 3S4YA 2P40A 5JMOA 3R7FA 4KJZA 3BB3A 1PWEA 2ZIWB 3MW8A 4JLJA 4X93A 5AVXA 2F3PA 2O3SA 2ZSEA 1JP7A 3JVUA 4L9WA 3AL0C 2HNAA 5E6SB 4DUPA 3GDOA 1T6NA 1WXEA 2HSJA 4URXR 3HVIA 1DRVA 5KNCH 1YIDA 1J25A 3EZNA 1LZLA 1GL3A 1AQIA 1H93A 1P0FA 2FEPA 3JZFA 2RHTA 1Y6FA 2JH8A 1MVLA 2WVAA 3LA8A 4MWSA 1NSYA 5LYJA 1UODA 2ZUBA 1CE8A 1S02A 2K5UA 2EG9A 4EVQA 3NT4A 1GSHA 5HK9A 1I1NA 1TM2A 5CLLA 3A2KA 1T34A 1EA7A 1ZJ4A 4GRDA 3I9NA 3Q8WA 4KN5A 5EE9A 3LYUA 4NKRA 5LZ5A 4ZCMA 1GR0A 1ORTA 3WOHA 1QZUA 4TZKA 5B7GA 5GMOA 3OP4A 3H2HA 3GGSA 4TMFA 3E8XA 3CT6A 3VPAA 4YPFA 1MTOA 2Z9DA 3HNPA 2CDCA 3EG5A 1F2VA 1KARA 2ZTVA 3FCEA 3Q5DA 3W4KA 2UUAB 3KWJA 4UAUA 2Q7DA 4B7XA 4MROA 3B52X 3NZEA 3VBCA 3LT5A 2EBUA 5A62A 5F7OA 1FYXA 3PFKA 4FNMA 1V3VA 1VPVA 4L9SA 5TMBA 1GEGA 1KK3A 1NYTA 4DCPA 4EL5A 4FHCA 5CLJA 4RF2A 3QXGA 5H3CA 2XUQA 4H0NA 1PQUA 3WYDA 3BDVA 3G79A 3VOAA 2NP7A 1F8FA 1NDHA 2QG6A 1Z6TA 1CJBA 4RUKA 4E3ZA 4UW9A 1Y1PA 3MZ0A 1B74A 1QU3A 1E2MA 3RJZA 4JOCA 2IXTA 1FP2A 1DO0A 2V65A 2X8BA 4KXQA 4AL4A 4GNKA 4N76A 4O1HA 3ZE0B 3D7LA 2D74A 3EXG2 4Y1FA 3UUFA 4QT0A 5SZKB 3AM3A 1N2OA 3RANA 5EYPA 3WOVA 4CW7A 2ZIVB 4LRQA 3NTOA 4B2IA 2R1ZA 3EEIA 5LU9A 2YHIA 2GHIA 4UM8B 2EP8A 4P3KA 3E3AA 4MDYA 3R0QA 3LV8A 1MP0A 2AJDA 1HT3A 4I9UA 5TGZA 2NZVG 2W7TA 2J5KA 1D2RA 1FOEB 3EHEA 4F4DA 2AX3A 2EX4A 1L4HA 2WSLA 1WU8A 4HQ6A 4WN9A 4XEUA 5DHAA 4RVGA 3ROZA 3VKWA 3VTAA 3OCYA 4B76A 3B9RA 5HIAA 2FVXA 4YJDA 1QYWA 1R3DA 1SZPA 4M0LA 4PSDA 1KVQA 4CLEA 3EXG1 5IXJA 1YV9A 4N3NA 5F35A 4IRMA 1X15A 2IU4A 1NP6A 1OREA 3FRHA 1OI4A 4KRYA 4M9QA 4BX3A 5SZIA 3AVYA 1NSFA 4KL8S 4NPAA 5HUJA 5AD1A 1B73A 1RXCA 2Z6AA 1DCMA 5J1SB 4G26A 1C7QA 1V95A 1SFRA 1UBTS 4C0LA 1Z06A 3U4QA 2ZVQX 4M0UA 1HRKA 2DFKB 5CB6A 1E1QA 5IN5A 1HOTA 1ODTC 2XT0A 3HVKA 3KPWA 3PCTA 3RU2A 2G76A 1Z8NA 5GONA 3N7AA 1CEEA 2C7GA 1ZN8A 3MAJA 1TTTA 2ZTSA 2P6UA 2TS1A 2Z04A 1BCSA 1NFFA 3Q8KA 3WBFA 1Z2CA 1ESMA 4LZAA 2IHYA 1VDZA 1YXMA 4D3DA 2HNBA 3FB1A 4Q3BA 2VPIA 4C3ZA 2XRZA 3U2QA 3H5VA 4FWTA 1XRMA 3RU3A 2VP9A 2DSTA 1NIPA 1F17A 3K9HA 3RVQA 3WAGA 1P4JA 4TMWA 4B09A 4RGBA 4UEOA 3VA7A 3AJAA 1E6WA 3F1LA 5EMLA 4CN9A 1YQXA 4L76A 5FWAA 4N12A 2VK2A 5IKEA 3GD5A 1U90A 3GVHA 3OLXA 4QJBA 3WDSA 3TGLA 3NUQA 4EQ6B 2IHJA 3OQHA 2R96A 4N5IX 4TQGA 4E4TA 3DAPA 4UVGA 5AK6A 1EG7A 1R8XA 2BISA 1B4DA 3WK6A 3CG4A 2WSMA 4DDKA 2ZJ7A 3H5OA 4ZI7B 2CNDA 1ZOPA 2BM1A 3B51X 1FEZA 1OBVA 3R3VA 1KI8A 2X7XA 4EHDA 4G36A 1PL8A 5GONF 2O7QA 2TMYA 4LJSA 1Z6ZA 3RUPA 3T9FA 4Q4LA 3ZXSA 2V97A 3SMVA 1RVDA 2ILVA 2BSQA 2HZ7A 3ODGA 1UMCB 1C30A 1QP4A 1DIOB 1GPUA 1KJNA 2XB9A 3E27A 3L7CA 5GZ1A 4I66A 1DV2A 1PR0A 2VPQA 2A30A 1SWWA 2WZBA 2JLUA 2IKQA 5FKJA 2NVWA 4QLBA 4F93B 3UH1A 4PO1A 3EXIB 3KTFA 1O6GA 3NT5A 1UMBB 3GO4A 4P4UA 1ML3A 3LBHA 3SYLA 2MYPA 3VAAA 2GM4A 1G38A 5FJJA 3V4ZA 1H2WA 5KTSA 1VPDA 3RRJA 3SWWA 4X84A 3OY7A 5JRZA 3NH6A 3KZOA 5IZCA 1V16B 1QS0A 1Z2EA 3GUCA 1YRBA 2BEVB 3KYIB 2YC2C 3WV4A 2Q45A 1PR6A 1V8DA 1NV9A 4LYJA 5ALDA 1O7JA 2P30A 4XE5A 3SNHA 1UEIA 4RK0A 2NUAA 4B46A 4P0TA 3PDJA 3W77A 2XWSA 3GBVA 4GFDA 4I36A 1SC3A 5AKGA 1YQGA 2FFRA 5LM3A 3HXMA 1LNZA 2XCTB 2REBA 1YZLA 1GPMA 3KTAB 4FFSA 5AXBA 3U0VA 1RRPA 1PGNA 4HVTA 1T5DX 1QFXA 2XUHA 3V6LA 4R7GA 3LQYA 1DTEA 4K9LA 1K3UB 1GZ7A 1RC0A 3WKAA 2RI0A 4J7UA 5C18A 4BUZA 1CQPA 1Q1ZA 3ZHZA 1JMVA 2WM3A 4EIWA 3FY4A 4NY1A 1UDCA 2XRYA 3W9SA 3TN7A 4EBBA 1T0UA 3ESRA 3UC5A 1MAVA 2H2WA 3WYCA 4EX7A 2FOLA 4HUTA 1JKJA 1IG3A 1E1QD 5COBA 2ZREA 5CTJA 1EP1B 2J3KA 5BMVB 3OF5A 2W4QA 2UUCB 5JZVA 1GQOA 3G2OA 2GPWA 3V3TA 5JHGB 2G5GX 5FUMA 1A1SA 1L4KA 3WA7A 1NW8A 5JAQA 5A9TA 2YY7A 4C78A 4H3VA 1S1CA 3TE7A 1KMNA 3RODA 2FV8A 3TSZA 1SOUA 2J9FA 3FE2A 2JIMA 3ZQJA 5GIPE 1SK8A 3EHDA 4ZPJA 4W1PA 1XZQA 5IF3A 3EN0A 2YFHA 3OQBA 1YZFA 1OA0A 4OATA 1T9GR 4C01A 5CH3A 4NXMB 1F60A 1S8FA 1YI8A 4AM8A 1W4LA 1SHUX 4K28A 5JCPA 3WGYA 3H11B 2YVAA 1JFSA 2H9IA 4UBNA 2PJRA 2TYSB 4OHKA 1CR0A 1U3DA 3CX8A 1NTOA 4URHA 3SHQA 3VR4H 2PWBA 1M2VA 4G4SO 1XROA 3U40A 4DLYA 3IALA 2FX5A 1MEJA 3Q7IA 4JEIA 4P1ZA 2ZROA 2ONYA 3I6ZA 3A37A 3AKZA 3S7TA 1DOHA 1CETA 1W25A 1P4HA 4FFWA 4YWHA 2C03A 4DFDA 4PFSA 4G0ZA 1X38A 3DE6X 3N8HA 5AOBA 3DMYA 1KO7A 1HLDA 3KKMA 2RHRA 1THGA 1EXDA 3ABIA 3TZCA 1RKXA 1U8CB 2YQ4A 3ULKA 4DWVA 4L28A 1YTLA 4B5LA 1W36C 2VZ9A 2QUAA 3S6JA 5CR9A 5ES4B 4UD6A 1C0PA 1KYWA 3KLBA 4CLHA 3VPCA 4U3JA 1W59A 5CYGA 3FTCA 1Z75A 5FBHA 3TIGA 4TL7A 5HFNA 1CUHA 2CUZA 3AB7A 3NYRA 1II9A 1SMKA 5KDDA 2Q3MA 4F9EA 1D4AA 3DO8A 2CNOA 1J9EA 4IPTA 1OWOA 3MSCA 2BFDB 2WICA 1QHGA 2G0NA 3T34A 4F96A 1L8LA 2QD4A 4QPPA 4IYJA 4C7JA 1RM5A 2W90A 1TKAA 4HLUA 1EG2A 3A1TA 4K3VA 4BQOA 3LC7O 4OL0A 1TFUA 2QV0A 1P3Y1 2DWQA 3H0EA 3PFWO 4KWIA 4RJKA 2J6CA 2P0YA 3QBVA 3WQHA 5BN5A 5GVSA 1JHZA 4IIBA 5DISB 1K86A 4DIMA 1QHHA 3G3EA 3BJZA 3AF3A 4FDVA 4L27A 3RC2A 1PWXA 2GS9A 3PX3A 2O07A 3QHPA 1CZUA 1SQFA 4LMPA 1GNRA 3NCHA 3CONA 3L0PA 4E2WA 4U7HA 1Z39A 2VAVA 1KE2A 1QOPB 1KZHA 4XWOA 3S40A 2J3JA 3QX9A 2XF2A 2LXNA 3UT0A 1I7LA 2QU7A 4OKSA 2OY0A 5CDSA 2DUMA 2NP6A 1SUCA 1Y5MA 2F43B 4M1EA 5FRDA 2AJTA 1UPUA 5D3MB 5ANRB 3RVBA 1YQWA 3W6UA 3ZV7A 2YH2A 3GUVA 3EVEA 1N5IA 3IUBA 4NYJR 4R9RA 4PLFA 3OEEA 2C07A 1KGDA 1FPMA 3UY4A 3QPUA 1P5HA 2AQKA 3FGNA 3M4ZA 4DC0A 4TS9A 1EZ4A 1IHDA 2ZYRA 1WXQA 1Q77A 2QD2A 1VL0A 1E5VA 3KWLA 2VP5A 3VH2A 1IQ0A 4JL6A 1KSJA 1FLDA 1YT5A 1QFZA 2DX7A 1DC8A 2NNLD 5GJVC 1RE0A 2YJ5A 3D6FA 3DOHA 3C3PA 1L8OA 1OFTA 1C3OA 5ALEA 4IDCA 4ZGBA 4RTJA 3USCS 4ZQHA 3RT9A 3QK7A 4BUJA 3NFRA 2OGSA 4QDKA 2COEA 2YHSA 4GZ6A 5FPTA 2DHRA 3BXZA 4HATA 3HKBB 3GG2A 4ZCQA 3ETDA 4XM0A 4ZQFA 2A9VA 2WJ6A 4I55A 3HJFA 1RKBA 3GIDA 5JLAA 2OPHA 4PC2A 1JB9A 2OCKA 1T3LA 5I7VA 4NJMA 3IPCA 1II8B 2WKWA 2YS6A 1FY2A 2YWGA 5EA2A 1GQSA 3BGOS 5AO9A 1R4ZA 2PXAA 3OUUA 3R3HA 2XXAA 3OT5A 2VUUA 3LHFA 3LRTA 1YH3A 2XMPA 4PCLA 3JQ9C 3A6EA 4X62B 4B40A 2G7MC 1AQUA 3OM1A 4EFKA 1XLWA 4GM0A 1DXQA 2RI1A 4FC7A 3E9NA 3KETA 1EGAA 2RK4A 1E2QA 2C9YA 4TKZA 4RWEA 1RI3A 1VMAA 4AN0A 4PXAA 4GXQA 1ZNXA 4JFRA 4Z7OB 1MAWA 4PAOA 3QMMA 1J00A 2I54A 5CFMA 5AKEA 3TD2A 3KC2A 1M2NA 2J46A 3E0XA 4OXYA 2DGDA 4GHWA 1YU6A 2OHHA 4N18A 2Y1CA 4EHJA 3EJWA 4XIYA 2PQ6A 1NMYA 5M3BA 2PV7A 4D6XA 3QWAA 2ETXA 4CU5A 3EFBA 4RX1A 1Y8AA 3S2FA 1QGOA 1IY1A 1UP4A 1ABEA 3EVFA 3ZGXA 4B81A 1QRAA 3K3PA 3RBAA 3WYGA 1L4GA 2QR3A 5BR1A 2OZLB 3KWMA 3U7GA 3HFGA 1UOPA 3W2HA 1T9HA 3CLHA 5LDDC 1O0CA 1YK1A 2OFOA 4AMGA 4D4LA 4CUZA 4MYHA 3BCSA 4MB0A 1DV1A 3KUUA 1CFJA 1JR3A 3A3NA 5DWQA 3TLXA 5IDWA 1EEXB 2WJYA 4F8EA 4JLDA 1TLTA 2C2XA 3KVOA 3LBYA 3QEMB 1UJMA 1VCMA 2VAPA 1GLNA 4GWLA 3ZW7A 4GBGA 1DL5A 2DH5A 3S5JA 1TYAE 1WCYA 5GADl 1A7UA 3T41A 4G4JA 2IYVA 3I9V1 1NMSA 1KVRA 3MS2A 4GOKA 2W98A 1GOTA 3ISJA 1C3XA 2J67A 1OAOC 4JP5A 2ZI6A 1G4UR 2QUHA 5L4LA 2PWPA 4YP7A 1UBJS 4JBWA 4C88A 1EUDA 4ENUA 2C0CA 1CJSA 2JLXA 3FDFA 1E77A 1FP1D 1PTJC 5AM1A 3BRWA 1R3UA 3N8NA 2PFGA 3OZSA 4WNAA 5ARDA 3T5BA 4F6RB 2VQSA 3IURA 3OEED 3ZH2A 5KYNA 3K2QA 4IJQA 4RPLA 1BEEA 3BMCB 4KGZA 1RABA 3ONNA 1QGYA 1V39A 4OQZA 1RIFA 4PCUA 1KP2A 2JIOA 2Q5JA 3RHTA 1R9JA 4BQSA 3AF6A 4MS1A 4YLEA 2WHQA 4OI2A 4R4JA 3B6MA 4DQUA 4O2BB 1HG1A 2ZWIA 5JS8A 3JW8A 4KLCA 1WXWA 3TLYA 3BJMA 3FTPA 3SKYA 4DSAA 5FD8A 4CHTA 3AVUA 5B6PA 2J0EA 4IP0A 3NOXA 3QKRA 4LXGA 4RY8A 5EGSA 4PR3A 1R0SA 2PYIA 2UYQA 3LX6A 4O4LF 2OCLA 4AYXA 5JNVA 4M1YA 1QV7A 3I45A 5AJVB 3VZRA 1ADGA 4XB6B 1X9IA 5HG0A 1W2GA 3UTCA 2D3WA 2IZZA 3BWEA 3CCCA 2O23A 5F2EA 2IEGA 4DYHA 1EIWA 2IC5A 1EH5A 4DCUA 1PK8A 1WHTA 3FPJA 3GFQA 3RR2A 3L8ZA 4TS4A 2PO5A 1FQWA 3EEOA 4REQB 2OXIA 2IUYA 1A96A 3FOBA 1NBIA 1G3MA 4C0AC 2FPOA 3FI9A 2DKNA 3UWDA 4D0RA 3K53A 2WG2A 4C2BA 4XB2A 2CDNA 3IHTA 3O3CA 3ZHUA 2HFKA 4A6PA 2FRDC 3H3FA 3MIIA 5GGXA 1LW7A 2IXAA 3C1AA 4INJA 5DM1A 4NDAA 1W9MA 1YB4A 3ND9A 4KODA 4X6XA 4QXQA 3TQTA 4YCLA 4DKJA 2V3CC 3H2IA 1CRQA 3G6KA 5DMHA 3VSEA 4JX9A 1Q1GA 4ZKEA 3AO0B 3H7AA 1CK4A 3RKRA 4GO1A 5C5IA 4LCJA 4L4YA 1O87A 2FLWA 2O05A 4R1UA 4O5AA 5FFFA 3T7AA 3D6JA 2I80A 5K8TA 1C0LA 1UCFA 4ILKA 2G9VA 3E3OA 1BOFA 4J2TA 4PLCA 4R41A 3TYXA 4C3OB 4NTZA 1JR3D 2Y0DA 1MH1A 4FHEA 3B9BA 4M9ZA 1B6TA 2CE2X 1JG6A 5HTKA 4BLUA 3U7FB 3T3OA 1MO5A 2ATCA 4FEGA 1GDTA 3PTZA 4G5OA 3GD7A 1JUDA 3GEBA 3GRAA 2W11A 3K0AB 2XKKA 4UTPA 1Q0UA 1N4AA 1AMUA 4TTRA 3TOVA 1LS1A 5CA1A 5KNBA 3H2YA 3K6SA 1SBYA 2O2EA 3WQBA 2PUGA 2RH8A 3NATA 3PVSA 5KYXB 3PE6A 5DGIA 4QXPA 4MWTA 5D00A 3C8UA 3SSOA 3WP0A 4EY4A 3MWDB 4RVNA 3G0DA 3WV5A 2I34A 2ZAGA 1T2DA 1E8NA 1Q7GA 3DOIA 4BFSA 2VTEA 3P94A 3BRWD 4E07A 2IEIA 1XCPA 1ZVQA 3R7AA 3HCAA 1Z0DA 4EJFA 1Y37A 2CF5A 3I72A 1QFSA 2CFRA 3K2IA 1TMKA 4C4TA 4FDMA 1F9AA 4RPGA 1SXQA 4N3AA 4UUPA 1A8UA 1L4BA 3D0RA 4ND7A 1EM8A 1P3DA 1WVMA 4HVAA 4O4JB 4OHZA 4B7CA 4OM8A 3U1BA 3FOFC 5IM4A 4OVKA 1VIAA 4NPCA 4RF5A 4BEWA 1GP2A 3M5WA 3QYJA 4XRRA 3QVKA 3N7TA 1G9TA 3IAM1 1OU4A 1AKRA 2DC1A 2FEKA 3KYCA 5KYUA 2IBSA 5C7IO 1HTBA 2VWPA 3JR3A 1NJFA 5DB4A 1MBZA 4ECEA 2CNLA 1E9RA 3MT7A 1NI4A 5ILOA 1TOAA 1PEYA 4GPTA 1NW6A 3FIUA 5A7FA 3G8YA 2C99A 5TS2A 1Y7PA 2BAGA 4DOMA 4GECA 1AN9A 1QZ3A 1SA0A 1NLUA 2BFBB 2ZE7A 5AXCA 2C2YA 4R9VA 4XJTA 1LI7A 3IVRA 4I5DA 1QG4A 2X58A 4DPMA 2QUIA 3KP1A 1XZIA 2XX3A 1BS2A 5A03A 1W0KA 3GNLA 3AIOA 5EP1A 1MO4A 1Z0KA 2F55A 5C4IA 3OE7A 2EWVA 3ZGNA 2OCGA 1BROA 3NXKA 2I8AA 1V8ZA 5IM4F 4LJKA 1JTVA 3R4CA 1NBOA 1W4ZA 4TVKA 3WGMA 2QB5A 3G13A 1M73E 1M66A 4N9WA 2RBGA 1BE1A 1HE1C 3NCTA 3ZCPA 2YN2A 3X1KA 3F71A 2F48A 1P19A 4PIVA 4XFKA 4Z53A 1M0EA 5DF1A 1GSAA 1JG7A 3LKBA 4NEHB 3BA1A 1QG2A 2XYRA 4IHQA 3BWBA 3CLKA 2WVGA 4R2MA 1DXHA 1I32A 1KPHA 2WAXA 4HMQA 1XK7A 4KO2S 3ZZUA 1JV2B 4RGVA 4V1CB 4GGMX 2VHVA 1QAQA 2NUPB 5D6NA 4POOA 3A3YA 4WBXC 5FDFA 5JH7B 1LC0A 3PFHA 3VVLA 4BWGA 4JHXA 3EA4A 3IA7A 4NH4A 1TEHA 4Z49A 4N7JA 4N8EA 1H3FA 5JCOC 3BMOA 1S1MA 1T8TA 3OZ7A 5DX1A 5KNBD 2D00A 4HDOB 4L8VA 1DG3A 5ARBA 2FMUA 2Q1XA 3GRCA 3K72B 1TCCA 4A5OA 4B3JA 1NJ6A 5DKFA 1TMGE 3FDXA 2VLIA 5L3QB 4CKZA 3ET5A 3FPKA 3A6JA 2ODPA 3ESDA 2VYQA 2H2HA 4MH0R 4C6TB 4DV0B 1ZZGA 4D9MA 4RQTA 3QLUC 1JR3E 2OWEA 3HDTA 3RC9A 4OGFA 2WUWE 4JUBA 5CMLA 4Q6BA 3UJPA 4R83A 5K3FA 3LY9A 3PWKA 1KOGA 5B6JA 1U94A 3BH0A 1IDN1 4O2AF 3T0FA 3BSWA 4ASUD 4DJJA 5JC1A 4C0JA 2DLCX 3FYCA 3F6RA 1UK7A 1LRJA 3KK0A 5KCMA 2BGKA 2R00A 3LYAA 4R1OA 4WH0A 5AXAA 2RGCA 3BGIA 3K1ZA 4QWWA 5GJCA 5A0TA 1NQVA 3SJZA 4RIFA 2O2CA 5EGNA 4ZXPA 5A06A 5JISA 4C7VA 1N9GB 2PUFA 5TNXA 2X7JA 3E22A 1KL7A 2G0TA 3ZTWA 1CY2A 1DX6A 3ET4A 1QOQB 1J2UA 2W6IA 3KQQA 3ZWWA 1VFNA 1T0BA 2GJSA 4DJDC 2AT1A 2ZSHA 5ALTA 5C53B 4AJIA 3USZA 2ZITA 5K4AA 5BUQA 4XX0A 3O2JA 1AQLA 3UAGA 1W49A 5K3CA 3SC2B 2HXYA 4C0XA 2W8BA 3GN1A 4Y7CA 2FJPA 3WA6A 3U44A 4YPOA 1RI1A 3BD9A 4OJTA 4QXOA 2HSEA 3CRQA 5JWRA 4LHYA 1A5TA 1MABB 2AEMA 3MJFA 3N74A 1GG5A 1W0KD 2QTWB 2DVMA 4LK2A 4MPRA 4QYIA 3A7EA 1E3TA 3DLHA 1KEEB 2E48A 2O5VA 1ILWA 1EVJA 3OE7D 3Q3EA 1LD3A 2QL7A 3A2NA 2VXYA 4PRLA 1KBQA 1U0OC 2BGTA 5TRTA 1XD9A 1CULC 4DV6B 1T10A 2QQ0A 2P9JA 1GAXA 2IZOA 2PRYA 4XVCA 2OORA 4Q01A 4XGNA 1IUPA 1X1CA 4LVOA 4JXXA 1XYGA 3TZ6A 4DS3A 3UWOA 1LPPA 1Z88A 1DJQA 4UEJA 4HDKA 2JGKA 1V1RB 2QI9F 1IOVA 3JATA 5L6MB 2X0DA 4S0ZA 2RAPA 4J0HA 2VEOA 4JUIA 2WPDA 1JEDA 3FOCA 4KMSA 5CUQA 1HEUA 4P33A 5KU1A 1ZR4A 2PMEA 1RD4A 3VV3A 3WK9A 1Z7EA 2DFVA 4KI7A 1GA1A 1E3JA 3D3EA 3MWKA 4WRRA 3U1TA 4AKSA 2FSGA 2BGRA 4EJSC 1KKLA 4AY3A 4TZ0A 2YQZA 1ZCJA 4X8OA 1DC3A 3KXPA 16PKA 1WD5A 2KJQA 3IXLA 2VTVA 3X1DA 5JNUA 2D4AA 4CEJA 1KJ9A 1PJAA 2YIVX 1FMCA 1XD2B 2ZIXA 2MINA 2O3UA 3O3OB 3VZCA 4KE7A 1SVUA 4LBYA 1GTRA 2D1RA 4KIUA 3W05A 1RWVA 3L84A 3DDWA 2E9SA 4UHHA 4YAKA 1W96A 5K0SA 3ETLA 4L6IA 2GZRA 4Z3DA 1ZGBA 2JIRA 2R8PA 1DG9A 3H4MA 1L5VA 4N01A 1S7GA 3DHYA 3AI3A 4BPRA 1CY0A 1GYPA 1BA2A 1QHSA 4RZIA 2YXEA 3OICA 1T8RA 5FPPA 3TLBA 3FVTA 2IIVA 3GH1A 5KOJB 4NJEB 3QUTA 5CK5A 3VAYA 2ZT5A 1W29A 1ORVA 1QVVA 1E1CB 3K6JA 4R2JA 5HQ3B 3DKIA 2OD7A 1A9OA 2PBZA 2JJQA 3G8CA 3QYPA 3VJLA 1YRLA 2I6UA 1TZCA 3F2VA 2X6RA 1NYLA 3AFMA 3GWGA 2PX4A 5LSAA 2FP4A 2FQYA 1FU8A 4BGUA 5H59A 3HABA 3UMFA 1NF2A 1RYFA 5DT9A 2ANBA 3JALA 4JC8A 1TCVA 3CR3C 4TROA 3RVRA 3PDUA 1PNTA 3LQ2A 4DLLA 1C0IA 2D54A 3Q2OA 4BFCA 4RZSA 3PYLA 4N03A 4UXIA 3RB8A 5CB0A 3IUEA 5EKTA 2E21A 3HCPA 2BV3A 1DKMA 3CPHA 1Z73A 3MRTA 1K63A 3QVXA 4JQZA 4N5LA 4OL9A 1FBNA 1NNI1 4BZQA 4Z4IA 3QIVA 4I5GA 1J8FA 5LP6F 2GH1A 3D3WA 3CPEA 5MGNA 1L5SA 4DHWA 5HZGA 2FHPA 2C2HA 2O0JA 1ORIA 3EMBA 2F9FA 3IPYA 3DZHA 3R0IA 5GY7A 3VMMA 3ZWNA 5IJXA 4EG8A 3G9TA 1VJDA 5AIBA 1TE2A 2AOWA 1U6IA 2JASA 2XOXA 3PC7A 3SYMA 4RULA 3G2NA 4ZVKA 4R2XA 1X77A 1GTVA 4BNVA 1RCUA 4CV3A 4RVSA 2B34A 3TSWA 3PQ3A 5J43A 1TRKA 4U2EA 4D25A 1X2EA 2FWAA 3G8DA 4XUCA 1ZH4A 1J7KA 4OIMA 2P2GA 3PXCX 1YQ9A 2IHKA 2X1HA 2ZQZA 1DEXA 4NWIA 3L8DA 1BVRA 3UW1A 3IV6A 3OTQA 1QUEA 3NRJA 4P7FA 5FQOA 5JWOA 4MWZA 4QD3A 3C1OA 4DSNA 3LNTA 4NV1A 3GBSA 4JLWA 4DLXA 3L8YA 2XRMA 4Q3CA 5C31A 4KXWA 4AZWA 1ZHOA 3QTTA 1XA0A 1RTKA 3QU2A 4UXHA 5LLSA 2AGVA 1PDWA 5EIHA 4AUNA 3FOWA 2G1KA 2XGMA 3O9VA 3RD5A 3AEKA 4TMTA 4U2CA 1B8OA 1PW5A 1WPQA 2O7VA 2JJ1A 4RL6A 3OQNA 2H29A 3AWIA 2UYOA 4MQEB 5K4GA 4YCMA 3F6BX 3GV0A 3B5JA 1PV2A 1UAAA 4HGPA 2NUTA 4C2TA 2LDBA 2W2LD 1P4SA 2IHTA 3G9ZA 3AY7A 4LTNA 1WMEA 1A82A 3SM9A 3OM9A 2BM0A 4JGIA 4OG2A 4IDPA 4JAVC 5HW0A 3CVYA 3A26A 4GOLD 2AG8A 1A2KC 3F3SA 4AMBA 4NYJQ 2P68A 2Q0SA 4YT8A 1KEPA 3OPNA 4EELA 2QVGA 4BJ3A 4G4IA 5F1YA 2JIDA 4L0MA 3IL2A 2CKMA 2VAWA 3M4XA 3RJ9A 1QP7A 2CD9A 2C9CA 4HWOA 2B2NA 3G2PA 1U2QA 3KBBA 5CJ2A 4ZDIA 5DNYB 1OW3B 3KT3A 3OKAA 4P08A 2JGAA 5E7QA 2V7QA 3I04A 1UPFA 3C2QA 5CFRA 1FTWA 5C5EA 1WDLA 4IIVA 2JI8A 4WK0B 1XVUA 3LQFA 5SICE 1JILA 2PX2A 3CUWA 3R5TA 5FI1B 4DCNA 4PNHA 2GD6A 4C1BA 3NAGA 5DHPA 2W2MA 4YXFA 5B55A 3DKRA 4I4TB 3HDVA 3UWSA 2OB2A 3JTMA 1HE8B 4UUMA 3SYRA 5HPYB 4S04A 5JYDA 4HUQA 3F73A 1UDAA 2IOFK 3MMZA 3TIIA 4BMXA 1G21A 5ILQA 5CNKA 5K8VA 1WMBA 3LSYA 4HFMA 4K7JA 1ORHA 2V3VA 4LBVA 3RM3A 4G24A 1KJQA 1S8OA 4M1QA 4EPXA 2BI4A 1AN0A 1KYXA 2IPNA 3LTEA 4G56A 2ZRCA 2IPMA 3IVAA 2LD4A 1AF7A 3T95A 2OLJA 1TZKA 3BN3A 1OLSA 3L9WA 1XL1A 5BSTA 3KHTA 3ROGA 4ZDKA 4QBGB 4AUKA 1X7XA 5ESWA 1FZTA 3UJ8A 1UBHS 4R7ZA 2Z5GA 1U5BA 3BC1A 4DCTA 3J81k 1TIBA 1Z18A 3HMKA 3IVGA 3RYFB 2WUFA 1LEHA 2R48A 3R41A 5FV4A 1AM4D 3LL7A 1H0SA 1ID8A 1GUBA 4D2IA 5E3JA 2APJA 1T9AA 2PQMA 1CIVA 1E61A 3EIOA 4B74A 2WABA 4G1CA 1GGEA 2YICA 5BSKA 1VKOA 3BIFA 3TNDA 1SXGA 4NU5A 3NHSA 2XH8A 1B93A 1OYVA 4MVJA 4RZ2A 4WEOA 3LPNA 4JDUA 3PB3A 1CYEA 1Z38A 1FNBA 2QMQA 4Q3DA 4AROA 2VHEA 4AJ2A 2WTBA 1ZGJA 1Y63A 5KU7A 1OC4A 2BFOA 3CW8X 1D0IA 5L3RA 4CTMA 5DM70 1Q0TA 4L73A 3BSSA 2J9XB 3FUVA 4YRFA 3RV3A 1SUWA 3HBAA 3H7IA 2CE7A 2HI0A 4KR7A 3DMFA 1NVTA 2I2BA 5D5HA 4V0LA 4FUTA 1XEXB 2DQ4A 4TKUB 4NYIR 1SJ9A 4U7TB 4BMNA 3CWCA 1PD0A 2I76A 4RMJA 3T35A 1YFJA 1I7NA 2AF3C 5F73A 3KAKA 3ZDDA 2PUBA 2A7XA 3IP3A 1IQUA 2GI4A 1ISSA 4JWKA 1ZUNA 1F6DA 1UKCA 2YFQA 4PZ9A 5HRUA 5DLQC 2FUNB 1KQNA 2IUFA 1G19A 1PQ4A 1T4BA 1XVVA 3A9SA 5EZSA 1JR2A 3HU2A 1Z6PA 5C8VA 1OYYA 4RE5A 4EO9A 4BY9E 1KHHA 1M0SA 4HDMA 2WFZA 3S2UA 1MMFB 5MFPA 4JOQA 1CQXA 1PFGA 5LYJB 5BW6B 1DBVO 2FW7A 2G0AA 3E61A 4DXAA 3N6RA 2H0QA 3AESA 1C14A 2V7QD 3C7KA 2ORWA 2C94A 1P61B 2XVAA 3OKFA 2BMAA 4ISBA 4BZWA 1SNYA 1TAQA 3N86A 1URPA 3PK0A 1E1RA 1Y9DA 2H3HA 1UBLS 3N5CA 2HJRA 2VN8A 3AY0A 1CB0A 3DVQX 3X1MA 2QZSA 5AVZA 2WIAA 2FDRA 5FBRB 5JBIA 2CUTA 2PZ8A 5HFAA 2CL5A 2O48X 1G55A 2GK6A 2WF9A 4P7KA 1L8XA 4CUJA 3ADPA 1XXHA 4BBZA 2D8AA 4G0UA 4BS9A 2R7LA 3LZCA 2WMDA 4WLNA 1KK0A 3RVLA 4DR1B 3TFQA 2X5KO 3AR2A 3C3DA 4I8XA 2FEAA 1IWBB 4HYTA 3DLAA 1JU3A 1I6KA 2H8GA 4M1WA 3OC0A 3ENWA 2HFJA 5BP7A 4DVGA 1YGPA 4JJFA 5G4KA 3H97A 2QTAA 2XKAA 3L77A 4PGFA 5A9SA 4V1CI 5EPEA 1G291 4I1PA 1TYEB 1KI1A 1JHVA 2OLEA 3B7GA 4MPPA 3EVTA 2AC2A 3V7NA 1ZVMA 3H4IA 4BMSA 1RRGA 1VXRA 3KJGA 3KT0A 3KRTA 1U81A 3QG1A 4L78A 4JUCA 4JITA 5ER9A 5IDYA 4Y2TA 4K9PA 1NVWQ 4BXOB 1KAQA 3Q9NA 4RMNA 2C57A 3LC2O 5G2OA 2XVXA 3O4FA 4N8SA 2ZUCA 1K6EA 5CTAA 2H7YA 2Q9BA 1E89A 4RD0A 1MW8X 4MR9A 1HLFA 1VQ1A 3K9LA 1GZ3A 2DAPA 2BDTA 2FKAA 5EYPB 1H23A 4AZ0A 3K09A 1NJ8A 1OFIA 1ZOSA 3NJ4A 4L7VA 2YHIB 3S99A 2A3RA 4QGFA 5CU7A 4CIDA 4RM2A 3NEYA 2C8VA 3N05A 2QXUA 4LYYA 1XKXA 1ZUIA 4KDRA 5KQGA 3AG5A 1XDGA 6REQA 1PVDA 1KSGA 4YRSA 1L7MA 3A9VA 4KKVA 3AF5A 1S3GA 1VHDA 4HAVA 4IOKA 4Z9YA 2ZM6B 3OE1A 1Q6YA 3JRNA 4EGAA 3KVRA 4FMBB 1F3LA 2DEUA 2J0UA 1EVKA 4LVCA 2O3TA 4AW9A 3FJ1A 2ZLBA 1XI2A 3GP3A 5ES3A 3TGPA 4RHUA 2ROQA 4JI3B 5LMCA 3IP9A 4D96A 2QD3A 3NM5A 3OHPA 1NNEA 5JLJA 3U4QB 2PGOA 1QIJA 1ZINA 2YYAA 3Q41A 4XM2A 1EZZA 2GPTA 2QMEA 2GF0A 3N2GA 4LZJA 4UBMA 3VZDA 2Q3DA 4IQ4A 2YJNA 4IFIA 1LBTA 4K46A 4QOEA 4OB6A 4UBLA 4YIKA 3FPAA 4LWQA 4JVMA 2YFKA 1R8YA 2QRVA 1CVRA 3B13B 3BD7A 3ZOKA 4F4CA 4CR8A 4TTJA 1FUEA 3F4KA 2WTUA 2QZ9A 5BURA 1FXWA 1RQPA 3B38A 5CGQB 3LI2A 1I7SB 5H80A 5EIXA 5DW0A 2YYZA 2IBTA 1HH4A 4AJ1A 3R74A 4OXNA 2X6QA 3WKCA 5IK2D 4QELA 4OHRA 5KNCD 3CZMA 3RRYA 5HOEA 3LVBA 3R5XA 1QCZA 1E1RD 1SO8A 3PR3A 3FLAA 2HK7A 2IL1A 4DIKA 4AMUA 1PL6A 1TJNA 3CUEF 3I9FA 3R7BA 1T5HX 4OQNA 4WGFA 4M7RA 3MCVA 2ZBPA 3P0HA 4J7XA 5IT4A 1JDNA 2Z3VA 2O4CA 5AI5A 4CMCA 4KDEA 1KAOA 1GNSA 3ASYA 4M9XA 4MV7A 2A4MA 1E6CA 4XI9A 5A7HA 3WRYC 4PPGA 4H7FA 2PN1A 1BCRB 4R7TA 4TYWA 5FNZA 1C30B 5JNWA 4QASA 4WUVA 2EL9A 1AXRA 2WWIA 4O29A 3ZE8A 4ZTBA 3V1LA 4DEXA 3LS2A 3C97A 1ZH2A 3LBFA 2HA6A 2ZJ2A 4PS1A 2B6NA 5DJ5A 4IICA 1CVIA 1UM9A 2GETA 3K6KA 3PI7A 4C7BA 3ZQ4A 1BFKA 1DO2A 4AAYA 4WEQA 4FU0A 1R64A 5F7ZA 3BFJA 3GXBA 4XAQA 2Q9CA 3HU5A 2VVTA 3HQ4O 5COAA 3RAFC 4ZDWA 1G21E 1R0KA 4WTOA 4DNQA 2WQ7A 3E3LA 4BNKA 1QS0B 3P5SA 3LOPA 1VE1A 2H1CA 4HYQA 2YQ5A 4CN8A 3Q98A 4B3RB 1U3FA 2ZUUA 1ZA2A 3LGSA 621PA 3IHKA 4J43A 4MX8A 2FAXA 4U9HS 2Z43A 3ZY6A 4TS1A 1H85A 2VH5R 5BT9A 2NUAB 4B35A 4FTWA 4CM9A 3D6HA 2BUCA 4C06A 5GV7A 1XKLA 3Q8MA 1N6LA 3IT3A 4QUJA 3WBBA 5AMXA 2RGBA 1RHKA 1XMXA 4YP5A 1XCMA 2YC4C 3QKTA 4XQEA 1QKKA 4BJHB 1DC7A 4RBNA 2ZSBA 2FZKA 3DUWA 1HNWB 1GU7A 5HJ5A 2XJ4A 1WMFA 1RAGA 2P2NA 3EDCA 3M6UA 1JPJA 1OA1A 2FDCA 4MQBA 5FOTA 3BM5A 2JFGA 3HXPA 3HCEA 5LOVF 4MW6A 4HAZA 4EF5A 1K6MA 4LTDA 5BYAA 1QM5A 2V0NA 4JJAA 1EFVA 4RE6A 4Y2YA 3HH8A 4AD8A 5AVYA 3ENVA 1T0JB 3DE4X 1F4LA 4EVIA 4YP1A 2Q99A 1VYUA 4MVJE 3F49S 4C76A 4F4IA 1ZH0A 4HV4A 1R9GA 1V5IA 4YNBA 1VHJA 3K73O 1B23P 1T2FA 3L1VA 1EVQA 3SSNA 4C4YA 3BQNB 2P4QA 4HQLA 1VI2A 4FIZA 1KC3A 4PQRA 2H17A 3HR8A 2IEZA 2C7OA 3SYKA 3G1TA 2YZNA 1S4MA 4I81A 2J9FB 2IPOA 2R751 4HNQA 1GKYA 2Q27A 3PNPA 1MOSA 1HT2E 4WZ6A 4ZN6A 4AQ7A 2WKPA 5LZ8A 2AFIA 5L3SA 3TSYA 1AHHA 1C1YA 3CX4A 1QXSA 3MIZA 4TRJA 1IZZA 1N2HA 3QA9A 2WTXA 3WNBA 2Y2VA 4IIHA 4MO2A 1ECGA 2CB0A 5K3OA 2JIBA 1KDYA 4AECA 4RVHA 1PGPA 4WLOA 2ZJBA 4JV5B 2QX8A 1Z26A 4Z3OA 3FMPB 2X13A 1M2VB 1Y8RA 2WIJA 3IVCA 4YO8A 1PLLA 2G6TA 2QL9A 1JL3A 1KOJA 3SPXA 3T0GA 3G2KA 1TZJA 2QXTA 4BNLA 3R8CA 2O8EA 3A6PC 2ZVJA 1FDSA 3S70A 1MAHA 2PD6A 3LT2A 1VHWA 1W46A 3D5TA 4FEAA 5CLIA 5KVCA 3S81A 4PXSA 4MV0A 1TF5A 3BJIC 3MWGA 1DAPA 3VYUB 3RK0A 4F5DA 2QRQA 2D1SA 5FPSA 5K1ZA 5BSFA 3H1GA 2UU9B 4K86A 3N75A 3AEUB 3GFOA 4R8SA 4U3JB 1UOQA 3OIUA 1R9MA 1LDYA 1GZVA 2CXQA 5IBCA 4R3WA 2GZSA 3CLRC 3ZDAA 1XXHE 4GR5A 3ZN2A 1TJ3A 3L0DA 4A0SA 1PDVA 1GZHB 4F7WA 1E9CA 3D2BA 1PZGA 4BMPB 5KHAA 3OC6A 4R3NA 3T8YA 2QM3A 2XUKA 3ZHXA 1ODKA 1E3MA 4OKIA 3UK7A 4CM9D 3QIAA 4QEZA 1XP5A 4Y2VA 3KSMA 4ZVNA 2EJTA 2VJKA 4JT8A 3HBLA 2WHPB 4LSGA 2HH9A 1LDNA 1NUUA 1QHHB 4L4ZA 2V4ZA 3TH5A 5KSOA 1ECFA 4JJKA 2YMQA 3HYSA 1FS4A 3AFIA 3DDSA 2Z08A 1J20A 2HHCA 2PLWA 2MSEB 5U4XA 3I53A 2ISQA 2NXCA 1Y1SA 4UE6A 2WTEA 3V8PA 4IINA 1IBCA 1BGXT 2DU8A 3A8TA 1CP2A 5IDXA 3DBHA 2PGAA 1DRUA 1VG8A 1PSZA 2QNIA 2H0AA 1Z7BA 3ROQA 5BWNA 2BBSA 1XQWA 2VUTA 1NUHA 3KOUA 3UB2A 1IBKB 2H51A 5KHOC 2O7SA 3PITA 4BAUA 4DGSA 1Z17A 1N7GA 1ZAKA 2PGLA 4QREA 4M1KA 5ILGA 3SQMA 3U81A 3R3YA 1QIGA 2FWRA 1ISIA 3P20A 1YOVB 2KS6A 1OMOA 3J81A 4RCVA 2AL7A 2WUVA 3QBDA 1PJ4A 3PC6A 1CJKC 2R6CA 2AMFA 2IELA 3OTHA 1C3OB 2O06A 9LDBA 3EVZA 3WI7A 5CDTA 1H2AS 4WLVA 2EFHB 4V0OA 3K35A 4R5MA 3DF7A 3ZOZA 2RGNC 4NOKA 3RBXA 1UDWA 3OEYA 1WCXA 2V5UA 4I55B 4ZC8A 3B48A 3BYZA 1PK9A 2N3ZA 4TLEA 5CFOA 4DA6A 3CLVA 3IOYA 4BE4A 5AVRA 4RY2A 3OF3A 5JAOA 3P97A 4E7OA 1BHJA 1OLXA 4TLCA 4ZC1A 2QOEA 5BSHA 2XXAB 1TZBA 1V48A 2ATIA 5ICFA 2VZ0A 4BVLA 1MC1A 2VNIA 3FKJA 3F3KA 3ZTTA 5BW4A 3GI1A 4FD3A 5F1PA 4NCKA 2V7PA 1RRFA 1IJBA 3ILXA 1WM1A 2MCFA 4EGFA 2OP1A 3FUCA 3I6YA 1JHYA 1DQRA 3WL3A 4EJMA 3VR4D 1U3WA 5DTJA 2QTNA 3I2KA 1Z37A 4ZO6A 1VDMA 1A8SA 4J07A 1AS0A 4A73A 1OH6A 2WNSA 3DULA 1IBSA 1D1SA 3KJFA 1LVGA 1T2VA 1MVNA 3DXYA 2H4WA 3EXEB 3H1AA 3I8SA 3JAWB 5ENDA 2AJCA 3MXTA 3TUZC 5ITVA 2J5XA 3PC4A 3V4OA 1SD1A 4AJJA 4H7JA 2X0RA 3N6VA 2HSGA 4HNGA 4J1SA 3WL6A 1TAHA 1DMSA 3NKFA 3Q3CA 4QQRA 4Z5XA 1K3FA 3MB8A 2PX8A 5TARA 4ZREA 4CE6A 3BT7A 4E2FA 1SD2A 1TEVA 4EK9A 1JX6A 1E58A 4N54A 3MS7A 1SKBA 1UKZA 1QTNA 2Z1NA 5TGDA 3TOZA 3VUFA 5NULA 4A23A 1V8FA 4UXJA 4WKGA 1N0WA 5P8WA 4PYLA 3A3OA 2P6MA 4LF9B 5EMNA 5IS2A 1LC3A 1Z0ZA 4BQRA 2J3DA 3AILA 5F9FA 3MS4A 3RFVA 2B25A 2O1WA 2Y0EA 4NK4A 2VUHB 3I61A 4GYWA 4LGYA 1CQIA 3FCYA 5T57A 9MHTA 2GUGA 3LUAA 4HP8A 5DV9A 4F84A 5EFZA 4ZAGA 3HUDA 3DD5A 1ZK1A 2VXCA 5EVCA 3ZY5A 4YJ2A 5KYWA 3GY0A 1V41E 2BGMA 3OZTA 2ZTUA 1Y7LA 4UUBA 1Y3AA 2XA1A 1N2XA 2GVNA 4X6YA 1FZQA 1FMLA 2AR7A 4P0PB 4J0CA 4LECA 2O2ZA 4MRVA 2AC7A 1YDHA 2NAPA 3I8OA 1HX7A 1KQ3A 3B3JA 3H8JA 1V5FA 2OK7A 3AXSA 3DMGA 4NATA 3SFVA 1NP3A 2Y67A 1EUDB 4KTVE 1Z07A 2FX2A 3I52A 4HGRA 5D1HA 2G63A 4N40A 4WNAB 1WY7A 1KJYA 1OXTA 1PT5A 2V6MA 4LNHA 3SC3A 3W2FA 3AKYA 4FOSA 4IEFB 5E6RA 2GEJA 3FLEA 1O08A 4G1UC 2HXSA 1P7WA 4S2UA 3UJ9A 3B8HA 3CF0A 1BEUB 3TBFA 3GAFA 1A7JA 3D6NB 1TLLA 3PDWA 4MS1B 2F7SA 2W6CX 2WD9A 2R5NA 2WM9B 3AUKA 3GRVA 4MUFA 4PG6A 3LT4A 2IYOA 1M7BA 4FN5A 5FP0A 1ZU5A 2O20A 4PGMA 4BVEA 4OOEA 1JWLA 2J5QA 4RQAA 1WX1A 2R65A 3NB0A 1SCBA 4JYBA 5HXAA 3BGSA 2JI4A 1XVLA 1XKQA 1CCWA 3G0OA 3IR7A 1XEWY 3ZBPA 4PNPA 3MUNA 3PUXA 3EVAA 2PS1A 2I3GA 3P0FA 1Z08A 3QF4A 4PIMA 5DP2A 5LA6A 2I1LA 3QG5A 3VDNB 4LJ4A 2YX1A 4NBNA 1QU2A 4RLQA 4RSRA 3SP1A 4QOGA 4Z4GA 3CY6A 3PU6A 4HWGA 3THSA 1WHTB 3TLEA 4KMOA 1I2CA 3DMHA 1NW9B 3TSOA 6AT1A 2YJGA 4ADSG 2FOIA 3RAPR 4FR5A 3OQJA 4UZEA 1N2ZA 4O3FA 3TZLA 5HM6A 5LJIA 1M33A 4DQDA 1VCHA 2WJWA 1WW3A 1ZMRA 2I2AA 1WB9A 4D9JA 3PR2B 3WJAA 4URWR 2IRWA 2VLBA 1QCDA 2SKCA 1WS6A 4UU7A 2C92A 1QV6A 2AS0A 4CG1A 1ZXLA 3PQ6A 1ZH8A 4GLFA 1KFCB 3U4IA 1GKUB 4QDTA 5EQTA 3VNRA 1F06A 1UBRS 1MV8A 1WDWB 4QU5A 2CCKA 3GFBA 2B99A 2Y1OA 1EGQA 2JIQA 3EPRA 3H0KA 1IEVA 1ZEMA 4TTPA 3UHPA 4BASA 4B7ZA 4DNFA 1SXJD 2ZM5A 1H42A 3PWTA 4TV8F 1RBQA 3ETJA 2ZBDA 1EBFA 3NHJA 1WTCA 4KU4A 4OYLA 4S1OA 4UUAA 3RJTA 3ZWBA 4DV4B 4EUHA 2YVUA 1I1HA 4N0DA 2P11A 2ASEA 3CX6A 3ND6A 2CYAA 4L4RA 1XQYA 4F46A 4JUDX 4QDUA 4ZT3A 3RC7A 3EGIA 2V6IA 3I1FA 1U99A 5CG1A 4Q00A 2JGLA 3A9TA 4H1TA 3T5CA 5H9WA 3W0LB 4I3HA 4BTVA 4XDZA 2Z58A 2AZDA 1UBGA 1IPFA 5BSUA 1OWPA 3ANMA 4M98A 1QV9A 2GXUA 2D0OB 2QW8A 1XB2A 2RKBA 3D8BA 3GXOA 4NYIQ 2Z2IA 4QQFA 5CA1B 4EARA 3HGTA 1I3LA 2PMFA 3PA6A 2I7VA 3R2JA 3WWDA 2A7QA 3NHUA 3T9AA 4FYPA 5CEFA 3I5MA 1T4MA 2GNOA 4XJVA 3S3TA 4RDHA 2EFEB 4ZO4A 4L15A 2JFFA 1P5RA 1BX0A 3ZDFA 2A0YA 1W0CA 2EIXA 3VR1A 1JBEA 3EYWA 3WIUA 2OYSA 5IASA 1QIDA 1QE5A 4G1BA 2BH2A 3S1SA 3KTDA 3PKJA 2IYRA 2GNAA 4OFZA 1GTZA 1QO9A 4W9NC 1T3ZA 1Y81A 2GA9A 2OXCA 3CTMA 3EVCA 2ZRQA 1JLSA 3OOHA 4N0PA 1W0JD 3TPCA 4KQIA 2P2ZA 3LX4A 2P9YA 1PNRA 1U11A 3IT1A 5JOQA 1KZ9A 1Y42X 3I34X 4RHYA 2EWWA 3GAMA 4WCFC 1EM8B 2RH9B 2CMHA 4KVFA 4DCVA 1IWPB 4PZDA 4AI6A 2QRLA 4LXUA 1RM3A 4DSZA 3QZUA 5ALXA 3S7ZA 3BA6A 3ZU5A 3Q10A 4DILA 1U4SA 2ADMA 3KTOA 4KX5A 3KYCB 3STXA 4BNDB 1D6SA 5BQFA 1XRPA 3V7YA 4DC9A 2FPRA 3PEFA 4KK3A 3HCCA 5D8DA 3EW7A 1E5XA 2BFEA 1Y1TA 2I4LA 1NI4B 1OLUA 4W8GA 1C9EA 2OQVA 4BLWA 7GPBA 3DBVO 1KETA 4DUYB 1FNMA 2D59A 4J16A 1SA0B 1NP7A 3E9ZA 5F5LA 1N7HA 3KSUA 3K1JA 4C14A 4J2HA 4C7XA 4Z7QB 2YMLA 4P5PA 3SICE 4DXDA 3U5TA 4DLZA 5CD1A 1YTUA 3BCUA 4M6WA 5IKPA 2X5XA 4D9GA 4H3KB 5B12A 4FE3A 4CLOA 1SVMA 3IDSA 1X9HA 4G4SP 4MCJA 2P9QA 2MYTA 1V9LA 3L9XA 2H5LA 3M2TA 4LCBA 3CWQA 4LYFA 4P54A 2Y9PB 4WKNA 5FPHA 4DRXA 3CURA 1PZHA 1ZGCA 2FN8A 2ZB7A 1D3AA 3PQEA 1Y80A 4BGDA 2C7PA 1KJWA 2VP4A 1FFEA 2JAPA 2HJHA 2E2WA 1GAEO 3BXFA 1UBNA 3E15A 5ICMA 2NO5A 1WOMA 3AWDA 3M1YA 4B9AA 1ZVVA 2BZGA 3RTBA 1T1GA 3B1ZA 4JBIA 3DZCA 1CS0B 3UIEA 4IWXA 1MB2A 5HGJA 4MR7B 5DK6A 1GNLA 2PWYA 3ORSA 1DINA 5T8KA 2ZANA 5IDQA 3NBUA 2JFXA 3HBMA 1R18A 1JTEA 3L05A 4FMPA 3RFFA 1XE3A 3RIGA 2NUBA 3ADKA 4JB8A 4RZUA 2X5NA 1GQYA 4FCVA 1EE1A 1MN6A 2AYYA 4EY5A 4JXKA 4XR9A 4QZVA 2O59A 2YASA 4IDAA 4M89A 1AKWA 1NQXA 1XC7A 3BMOB 3DWEX 4ID9A 1FVXA 5L51A 3SU8A 4MGIR 1F7UA 5EJ5A 3T1VA 3DCIA 2R79A 1U0HC 2XMRA 3KG2A 3WICA 1E6KA 1JIVA 4Q24A 2OFWA 2YN4A 4AX4A 4I9HA 3T7DA 4IIJF 3L07A 4JT4A 2CY0A 1R5BA 3CMMA 4OQDA 3RHSA 2Q4RA 1U0TA 1H2EA 2ACKA 2MOKA 2UAGA 2QAGC 4A15A 4M0PA 4QLOA 4UAVA 2ZPAA 3IERA 4L0CA 1L5QA 1K92A 1OGIA 1PL0A 1NAIA 3TRDA 1VRVA 4B85A 4EG6A 4D0SA 2VDVE 3F7NA 3Q8LA 1L1EA 4AKTA 4RAOA 2UXBB 1L7PA 5K3FB 4IO1A 3TQIA 4RDXA 3EXHC 1DQSA 3R6GA 1TJPB 4XW2A 3RYTC 5DSXA 2VPZA 4V39A 1AHIA 2DCMA 2PX0A 1XP8A 4FFPA 1J7JA 1J8VA 4MV3A 3DAGA 1E3DA 4HAYA 3WK8A 3MPOA 4ZCRA 2J3IA 2CBGA 1OXUA 1UBFA 4C08A 2WWHA 4RV4A 2JGIA 4V0NA 3U39A 2PH1A 3OMWA 2H52A 4TYPA 2O2JA 4DABA 2YWFA 4JI1B 1HETA 3HCNA 4Q9KA 1BE6A 1QYCA 3RVPA 2JD1A 2W37A 1VP9A 4L85A 4KQ2A 4XX0B 4ZV7A 4BWVA 2W8BB 5C1OA 1BJTA 4JB2A 2C2ZA 1G3IA 3JQBC 4F4FA 1BQEA 3O95A 1FVHA 1ZI8A 3NHFA 3AKEA 1R9NA 2AJ8A 3MMNA 2HMYB