2FQYA

Pnra from treponema pallidum complexed with adenosine.
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
316
structure length
316
Chain Sequence
GDFVVGMVTDSGDIDDKSFNQQVWEGISRFAQENNAKCKYVTASTDAEYVPSLSAFADENMGLVVACGSFLVEAVIETSARFPKQKFLVIDAVVQDRDNVVSAVFGQNEGSFLVGVAAALKAKEAGKSAVGFIVGMELGMMPLFEAGFEAGVKAVDPDIQVVVEVANTFSDPQKGQALAAKLYDSGVNVIFQVAGGTGNGVIKEARDRRLNGQDVWVIGVDRDQYMDGVYDGSKSVVLTSMVKRADVAAERISKMAYDGSFPGGQSIMFGLEDKAVGIPEENPNLSSAVMEKIRSFEEKIVSKEIVVPVRSARMMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PnrA (Tp0319; TmpC) lipoprotein represents a new family of bacterial purine nucleoside receptor encoded within an ATP-binding cassette (ABC)-like operon in Treponema pallidum
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Transport protein
molecule keywords Membrane lipoprotein tmpC
total genus 122
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02608 Bmp ABC transporter substrate-binding protein PnrA-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqyA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqyA02
1P6UA 2HJ9A 3CU5A 5BRAA 3M6MD 4LX8A 3M9XA 3BRQA 3JPYA 4F11A 1YS6A 1LJUA 2WMYA 3NHZA 1YMVA 4QPJC 4WXMA 1LJLA 3MA0A 3UK0A 2FMFA 3LUKA 4LDAA 1RPJA 1NXXA 1URPA 3RVMA 1LBIA 1A04A 2FLWA 2QZJA 4NICA 3I5AA 4Z4FA 2P9HA 4CBVA 2IPLA 2E4XA 4PYRA 1W25A 4F06A 5HSGA 4RDCA 4RU1A 1F51E 3N0WA 2P4UA 3C3KA 4YRZA 4KVFA 3F6CA 4RWEA 3OM0A 3E3MA 4RY0A 2X7XA 3OMXA 1TJYA 2E4WA 4MYRA 1QO0D 3IP7A 3GBVA 5EWLA 5TQJA 3M9WA 4EGSA 4XFKA 5DGCA 4IF4A 3CZCA 1D5WA 2NZVG 3FFWA 1I3CA 3QLUC 1RZRA 2FTKE 1VPWA 1QQBA 2ID9A 1PHRA 1JF8A 1C0EA 2IPAB 3N0XA 4TN5A 3SM9A 3RVPA 4XLTA 4S04A 4D6YA 5CNMA 4B09A 2AYXA 2Q5CA 3CHYA 3O21A 1EWKA 3TD9A 3HDGA 1M2FA 3CLKA 3OLZA 5IX8A 2HQBA 3LMKA 4MS3A 3RVRA 3BREA 4IMJB 3JVIA 3O1JC 2QVCA 1NXOA 1TLFA 3CG0A 4O1IA 4WT7A 4E7PA 3IP6A 4PZ0A 2QVGA 3DGEC 3JPWA 5ED4A 1QPZA 3HJFA 3E61A 5KQGA 3S99A 3QELB 1E6KA 1ZDMA 4F12A 2FQXA 4FB4A 2QW1A 1E6LA 2IOYA 4O5AA 1NXVA 1QQAA 4Z9AA 4G0OA 3D02A 4ZYLA 4RK5A 2AYZA 2PLNA 3R0JA 2FMIA 2QXYA 4KNYA 2YHAA 3CG4A 4UHKA 2MSKA 3LUHA 4S05A 1JWLA 5FBKA 1NXSA 3JTEA 2GX6A 4WUTA 2PMCA 3UUGA 3SY8A 2A9PA 1FQWA 6ABPA 4PICA 3TMYA 4JA2A 3KSMA 2GKGA 3ROFA 2OQRA 1U8TA 5F64A 1PEYA 5C5CA 4QICA 2E4VA 1TM2A 1ZH4A 4N47A 2IPMA 4XARA 3L6UA 5JNTA 1GLGA 4IMIB 1T34A 3RVJA 3CFYA 3C3MA 4MQFA 1ZITA 4G0QA 1BA2A 4LDZA 1VRVA 4W5OA 2CD7A 4RXMA 4ETIA 1VKRA 4LRQA 1ISRA 2PUAA 2PUFA 3GRCA 4JASB 3RVKA 3ROTA 4RK4A 3EGCA 2FXIA 1ZN2A 2ID7A 2R48A 2WJWA 3BRSA 2FW0A 3KS9A 5GQSA 4G0ZA 3C6QA 3EAFA 1OXKB 2V0NA 3MM4A 5IUKC 1CHNA 5TE9A 3MF4A 4RK1A 2QSJA 1F4VA 3HZHA 4G0PA 7ABPA 1MIHA 4MRMA 2FMHA 3W9SA 3NNSA 3GA5A 2ZWMA 4YV7A 1VLZA 2LP4Y 4F3TA 1KRXA 5IUNC 2MSWA 4ZPJA 5HQJA 4MRMB 1FFSA 3GYBA 4Q7EA 3LKBA 2L19A 4KMRA 2RDMA 3GV0A 1DZ3A 4YO7A 4Z4IA 1DC7A 1NATA 1GCAA 3H1EA 2NZUG 3O1HB 2PUBA 1YK0A 4KV7A 4OATA 1P8AA 1NY5A 3LUJA 2HPHA 2J48A 3URMA 1DBQA 1DG9A 1ZGZA 1DRJA 3TB6A 4MR8B 4FE4A 4H60A 1Z17A 3JY6A 4F8JA 2RGYA 3QEMA 3KG2A 5TPWB 1LBHA 2FQWA 2NT4A 1S8NA 5ABPA 2MYUA 5FWXB 4JB2A 3CRNA 1AB6A 1FFWA 2HQRA 3N53A 3MQ4A 2E4YA 3F7NA 3QX9A 1ABFA 4YGXB 4MR8A 4OBBA 2WJAA 5TQ0A 1PUXA 1APBA 1U0SY 5IBQA 1ABEA 3RVSA 1YIOA 3Q9SA 4EYGA 5KC9A 1MB0A 1MAVA 3H5TA 1C4WA 1R8JA 4MLCA 3I45A 3N8IA 2XDYA 1SD5A 4PEVA 1JFTA 3T38A 1TVMA 3BBLA 1QNLA 5JNSA 1JX6A 4ETMA 1NXPA 1XHEA 3CKMA 5EWJB 3GL9A 3O1IC 3RH0A 4KREA 3NNNA 1M2EA 4TLLB 5IULC 1ZVVA 4TLMB 3LOPA 1MB3A 3LUCA 1BAPA 5B3JA 2LPMA 3T6KA 4MR9B 1UDRA 5FWYB 4ZMSA 2I6FA 4LE2A 5EWJA 2O20A 4MS3B 4N0PA 1SXIA 2TMYA 1KRWA 1EWVA 4NQRA 3EJWA 3GT7A 2H0AA 1FFGA 2WWVD 5CNIA 4OLAA 3O75A 2A9QA 1P6QA 4EYQA 1JFSA 5EWMB 3FFXA 2L18A 5DCLA 1EFAA 4JAVC 1KMIY 1QO0A 3HUTA 3N75A 5TQ0B 2E4ZA 2FMKA 2RJNA 4MS1A 2JK1A 3F6PA 3RQIA 2FVYA 3KLOA 1DP4A 3HS3A 1EWTA 2PUCA 1B00A 3EQ2A 3JVDA 2IYNA 2KYRA 1H9CA 1JHZA 1Z13A 3GBPA 3KTOA 3QEMB 1W9HA 5JNWA 5I4CA 1ZH2A 1JDPA 4RSMA 2RJOA 3H5LA 5IC5A 1DJMA 5BR1A 4MR7B 1P2FA 1PEAA 4KFCA 1ISSA 5IEJA 1K66A 2FN8A 2YHBA 3FFTA 3OO0A 3SG0A 3Q7TA 3QLUA 2PE5A 3I42A 4MQEB 4MQEA 3LKVA 2PUEA 4MPTA 4RXUA 4Z99A 1Z18A 5IUJC 4ZJPA 5DTEA 3H6GA 3FDFA 4YLEA 3DZDA 3B2NA 1L5YA 3HVRA 3TX6A 4D6XA 3IP5A 4W5NA 2M98A 1Z25A 5KQLA 4Q6WA 2PJUA 4HNQA 1PNRA 4NCAA 2HQOA 2B4AA 4EYOA 3QELA 3K4HA 2H3HA 5HM6A 3KKEA 2FSPA 3NNDA 2NUBA 2ZAYA 3OQOA 1YVUA 4XASA 2CHEA 2JCGA 4MGEA 1QP0A 3HSYA 1CEYA 1ZGGA 1A2OA 2JVJA 2R47A 4MS1B 2IPNA 4EUKA 2JBAA 1FSPA 4KK3A 3H5VA 2LBPA 9ABPA 3CNBA 3HUUA 3LFTA 4MS4A 4O1HA 3Q7SA 2N9UA 2BGGA 3QK7A 5EWMA 5T3YA 3EQZA 2VUIB 1A0OA 5EWLB 4OLBA 2PL9A 3FMVA 4YP9A 3A0RB 3G85A 3H5OA 1Z26A 3HEBA 3LUAA 4MS4B 1QKKA 2JBAB 4Z4CA 1SXHA 2FEWB 4UHJA 5C5EA 4KQCA 1JYEA 1YS7A 3O2QB 3KCNA 5PNTA 4Y9TA 4EY3A 2MYPA 5KQMA 4NV3A 1JDNA 1DBPA 5DLEA 3Q15C 1GCGA 1XWWA 3H1FA 4OTZA 4L85A 1Z15A 4PE5B 2FEPA 4MAAA 1Y1LA 1DC8A 5E3JA 4RXTA 1DCMA 2WB4A 5JNRA 8ABPA 4EVSA 3HDVA 4G0MA 2FEKA 3N6VA 1U04A 5TPZD 4Q6BA 1RNLA 3Q41A 4LE1A 3Q7RA 2L17A 4YR7A 1DBWA 6CHYA 4DADA 1XHFA 1AB5A 2HSGA 1J56A 3C97A 4KK4A 4ML3A 5TPZA 3MIZA 1HEYA 4GNRA 3IDOA 1YMUA 4OG2A 5JNVA 2R25B 2PUGA 1RZRD 1EAYA 3C3WA 3LUFA 4RK6A 3EODA 5BRJA 1DRKA 3EDCA 2OENG 3IPAA 4RZSA 2JRLA 2JVKA 1D4ZA 3I09A 1OXBB 1BDIA 1YK1A 5B3JC 5TPWA 5T7BA 3H5IA 1DCKA 3NHMA 4KRFA 4G86A 2LIVA 5GOTA 3CZ5A 3GWGA 4D74A 3D8UA 4RY9A 1NXWA 3OM1A 1TMYA 1Z12A 4E7OA 4MLDA 1L5ZA 5KWSA 1E2BA 2PL1A 2LUOA 4KPYA 4KQ9A 4RK7A 4RKQA 1ZAYA 3DLHA 1YTUA 1JFVA 2FQYA 4W5QA 1ZHHA 2PUDA 1GUDA 5KQPA 4KZKA 5DKFA 3SAJA 3HM9A 1WETA 1U2QA 2JVIA 3ILYA 2CHFA 4LZLA 4G0XA 4L4UA 1BDHA 4N41A 3H6HA 4MR9A 5FWYA 4Z9BA 3HXMA 5KC8A 4P98A 5TQ2B 1JH9A 1JBEA 3OLWA 1QMPA 3P9YA 3OQMA 2A9RA 5JS1A 4N0QA 1M5UA 3QEKA 3LUGA 4G0YA 1IIBA 3H1GA 1ZY2A 2CWDA 1JL3A 3OLXA 4MR7A 3HCWA 1D2AA 4JP1A 3IP9A 3OO1A 3EULA 5IEBA 2PKXA 1RXIA 4QYWA 2GI4A 1NTRA 4HNSA 1RXEA 3KHTA 2GWRA 4JOQA 1EHCA 1GUBA 1K68A 3JS5A 2WY2D 1JLKA 1QP4A 4EVRA 3F73A 3G1WA 3T95A 4H3HB 4Z0NA 4Z4GA 2QU7A 2MYTA 1JYFA 4LE0A 2MYNA 3KYIB 4EYKA 1LK0A 2MSLA 1D1QA 3RVNA 3KYJB 2FN9A 3TO5A 4RV5A 1KGSA 5FWXA 3MMNA 2WRZA 4N03A 2JB9A 5CNKA 3SQNA 3O2SB 5HKOA 4ZMRA 2QR3A 4RKRA 5D2CA 5JNUA 4WXEA 3LUDA 2F8SA 4DN6A 2DRIA 4HNRA 2B1JA 3RVLA 3NBMA 3RVOA 4YWHA 3MYYA 1BDJA 1QP7A 2QV0A 3H75A 5BQ3A 2IKSA 5CHYA 4EVQA 4YS6A 3OLYA 4W5RA 3VNAA 4W5TA 2M1ZA 2FLKA 1M5TA 3QX8A 3BILA 4TMYA 3A0UA 3CTPA 3DLBA 5TQ2A 5FBHA 3A3KA 3FGZA 1NXTA 4G97A 3QLVC 3UKJA 3CS3A 4XAQA 3ILHA 3KLNA 1PNTA 4GPAA 1USGA 2NT3A 3T8YA 3LTEA 2R4QA 3IPCA 1SRRA 1ZESA 2A9OA 3A10A 2W42A 4N76A 4IILA 2GBPA 1USKA 3K9CA 4IRXA 2IDMA 4ETNA 4M88A 1CYEA 3OQNA 3HO1A 4FE7A 4WWHA 3HV2A 3RVQA 1SXGA 3DGFC 5KI6A 4Z4EA 4DQDA 1USIA 2E4UA 4NCBA 4P1ZA 3QLVA 1D1PA 2VUHB 4RY8A 4RS3A 3DBIA 4QYMA 2F8TA 4MQFB 1E6MA 1U2PA 2PAFA 2VYCA 3L49A 3O2JA 3QLTA 4XXHA 5JS2A 3KJXA 4HYEA 2VK2A 3H5WA 3OLVA 4RK0A 1Z2EA 4YCSA 3VNBA 4JB0A 1DCFA 4WZZA 1Z2DA 2L2QA 3SNKA 5CNJA 1BVHA 2FKAA 3HK2A 3OMWA 4H3KB 1Z16A 1MVOA 4IGAA 4Z4HA 3O74A 3N0RA
chains in the Genus database with same CATH superfamily
3PDJA 2CF5A 1GYPA 2E0IA 3FVVA 2RE8A 2C2XA 4UEKA 3L4SO 2V9ZA 4B6QA 1U4NA 4HPWA 2XGGA 3TSZA 3NX4A 3ZY5A 5M2QA 1YRYE 1L5HB 1YB5A 1Z4LA 1HL3A 2JDID 2EKQA 2WSIA 3IKMB 2IE8A 3N8DA 4G4SO 4B3JA 2FRVA 4DAEA 4YMHA 5KNBA 4LDAA 3AUSA 2PJRA 2O2CA 1CETA 1JG1A 3GVPA 1ZKMA 2C7PA 4R68A 2XUAA 3CX3A 2VK1A 3A05A 1EK6A 1WZIA 2E4XA 2NSJA 2ACVA 4YQZA 3O0DA 1ZMBA 4RFSB 1K2WA 4IDCA 4RU1A 3WHIA 1T5HX 1ZRHA 3FAKA 3GB9A 1SOUA 1YBHA 2Q5QA 3AWDA 3F6CA 3OEYA 3ZXUB 3G23A 1XVUA 3H99A 1WBDA 3OMXA 3D3QA 2RK3A 4WKNA 3R8CA 5E9WA 3UANA 4Y6PA 4IF4A 1V5WA 2AV6A 2HMSA 3DULA 1Q84A 2R8RA 1U2RA 3BHMA 3MWEB 4WQMA 5FHRA 2YFYA 2PJZA 4LHWA 2FEOA 4PO9A 2WJVA 5HIJA 3OJLA 3O4FA 3ENKA 3M6AA 3GGSA 3PR1A 5CUQA 3V1YA 4GRAA 3E05A 2LW7A 2I76A 3IRUA 3MG9A 4C4SA 1YZQA 5J1SB 3SM9A 5LLSA 1JMKC 2EU8A 4I50B 3BFPA 4WPGA 1W75A 3A2MA 4H08A 2PPLA 4D6YA 5LYJF 2V7BA 1BHJA 5BSHA 1YIDA 2Z95A 2P9QA 3BWDD 3MJFA 4KR0A 4M1YA 4OK3A 5FAXA 2Q21A 4BNXA 4COKA 2R6GA 4MS3A 5FNVB 4OGKA 1KQGA 3JVIA 1CDZA 1SU6A 1FDOA 3UQYS 1QF6A 1WQ4A 1FCJA 2R6JA 3LRTA 4INZA 2A2ZA 3WK4A 2VJCA 4MA4A 1HT2E 1T4MA 3BHNA 3NONA 4RH1A 4CPDA 1KDRA 3NETA 1UP7A 3HJFA 1Q7RA 4IOKA 1KY4A 1GP2A 5AYVA 5EJ4A 4NAUA 1SA0A 1TTQB 3G8YA 3M6IA 5ALSA 5EIBD 1RT9A 2QNIA 3USZA 1IEWA 4XVCA 1RD4A 3KK0A 4JMLA 4EELA 5B3LA 3BQNB 1GAWA 1G8HA 3WL4A 3L7AA 1HDYA 1T1IA 4PPNA 1AS3A 4F1KA 2X19A 7YASA 3K5WA 4FGZA 4YRMA 2RGXA 3G49A 1Q0LA 2IZ1A 1XLVA 4RLFA 3WDLA 4Z1OA 1ES9A 4M1EA 3NEPX 1SVOA 4WX2B 4KSYA 3FB4A 3EG9B 1RM4A 4FT2A 5EGNA 2XVMA 1SQFA 1TM2A 3CH4B 4ND2A 2WF8A 1GSOA 5B1YA 2JRCA 4TZTA 1NL3A 2CZCA 2ORWA 4XWGA 4P32A 2RHWA 1VYUA 4MV8A 3OFVA 1V8PA 2J67A 2JKZA 5I4KA 2Y0PA 2FZ5A 5EI5A 2VPTA 1YACA 2IHKA 1TVCA 2IQIA 2PUAA 1AKNA 1N0HA 2NUTB 2G40A 4WZBE 4LTDA 3VSDA 1QAMA 4RK4A 1WSWA 1XV5A 1YDFA 5FPSA 1DOHA 2ID7A 3OJWA 1G20B 4A8JB 5KPJA 3F4LA 4H35A 4EM6A 4O4LF 3PYLA 5LB2A 5JDIC 3WIEA 1M67A 2CNKA 2UZIR 2ZRDA 2ISQA 2FSHA 1MIHA 3U3JA 4Z7JA 1BFKA 4WTOA 3ZHBA 1G7CA 2GERA 3FZQA 3ZD9A 4LV5B 1C3JA 5IXSA 1J8FA 2H2WA 4DA8A 5H9WA 5KMGA 2A92A 4KQKA 1YO6A 3OTGA 3DYVA 3L7YA 5EIHA 5EUBA 4NF2A 3T41A 4BEBA 1G5IA 2RONA 1KVSA 2QUBA 3GARA 4MMXB 5LB4A 3MRTA 4ADSG 2PQMA 1ZVMA 1SKAA 4HWGA 2FQ1A 2H51A 1HXHA 3AXSA 4IDNA 1OBVA 3QE0A 3TZHA 1JXMA 1Z0UA 2YX1A 3PPXA 4KN9S 1P60A 4YDSA 5BN4B 3D6AA 5ESDA 4DSTA 2OKGA 3DD1A 4P2GA 4V03A 4BLPA 5KU7A 2Q0SA 4LJYA 3EQ7A 2HPHA 2J48A 3PFHA 2BCGY 5AI6A 5I7FA 1KZ1A 2B8EA 2NU8B 3HUEA 4BIIA 2NVUB 2Q5LA 2RGYA 1F2UB 3KG2A 4Q9HA 1MKYA 4B5LA 4CZ2A 5IVHA 3G9QA 4D0RA 4BECA 2VLBA 4FSDA 4UD6A 4W5JA 1T0IA 3TEMA 3ZXYA 1Y1KE 2ZYUX 3V4SA 2JCSA 1Y4ZA 1FYXA 3MQ4A 4YK7A 3QX9A 4MDFA 2QROA 2ZBFA 1V0JA 3G88A 3N7UA 4R9NA 1K5GA 3B1ZA 2DYKA 2HWYA 3U31A 4UDOA 3L8DA 2B4RO 3AP1A 1GTMA 1MC4A 1NPYA 4TYMA 1APBA 3G6KA 4FFWA 5IG2A 4XSGA 3I05A 1PL8A 1N0UA 3DEJA 3FVTA 4IO0A 4PFKA 1DQNA 4GIBA 2FMTA 2VNAA 4GR4A 4P93A 3VOTA 5TGZA 2E89A 3G9UA 3I39X 4DNQA 3HYLA 1U1GA 2QAIA 3ON5A 4LNUB 1KZGB 4ID3A 5DK4A 2IXAA 4FYMA 2ZSBA 2B1QA 2VHVA 5TVGA 1CUEA 2WSYB 4LJAA 1GKIA 3C2QA 1SXJE 4MW2A 3S2SA 4MV3A 1ULZA 4LRYA 2VL7A 3VSCA 1FP4B 3HPRA 2ZTLA 4NE2A 4FFMA 2FX5A 1BGWA 1CQZA 3BMNA 1GPYA 3LOPA 1SCDA 4EI8A 4YXWD 4ESHA 1KAEA 5HZGA 3ZG6A 1Y0BA 2FQQA 4YJHA 1JU3A 3BH0A 3EAGA 1TU4A 3TRDA 2C9ZA 3TGPA 5WRFA 1GPDG 4HAZA 1ZRSA 4UE6A 1TMOA 4ZYTA 3SJUA 4Q0MA 2D2VA 2A88A 1JAZA 4HWTA 1WPGA 4IKEA 4JI8B 3ZOKA 1WXHA 1KDYA 4DLWA 5DBHX 2ODTX 5KDDA 5L95A 2YY6A 2DFLA 1X7XB 3RC1A 3JATA 4YUXA 1SVLA 4WHMA 3W5CA 4DV3B 1M1NA 1E99A 1EJ6A 1N57A 2FEAA 3HB5X 2XMCA 4RF3A 1OQAA 1DQYA 1P0CA 2F62A 3PI7A 3RAJA 5M04A 1COZA 1J23A 1V7QA 3ZV7A 1R4ZA 2UYHA 1E0DA 2OFFA 2I6XA 4BNDA 2R7LA 4DCCA 2GAJA 2HBRA 1JKFA 5TGTA 3ZE9A 4PIVA 1NP6A 4H7EA 3EQ2A 4JGBA 1SIOA 2A6PA 2YRXA 4F2WA 5JJIA 2VAVA 1XQ9A 4AJ4A 4FNMA 3W2TA 3GFFA 4KE8A 4FEGA 5LYJA 1L1FA 4R3UC 1E4OA 4JL8A 1ZH2A 1FTYA 2RJOA 1EGAA 1SIUA 2C78A 5LU8A 5BR1A 1B8OA 1FDWA 3MNFA 4J9VA 1N33B 4I6JA 2PNFA 3BE6A 3NHAA 1Y1SA 3OO0A 3GIDA 3KVOA 5ADHA 3CMCO 3RGGA 3QSGA 5KSOA 3DL4A 2AEJA 4K6OA 4IDQA 3AJ8A 3UXYA 4D9IA 4XRRA 3LWBA 4CM4A 1NASA 2F67A 1SHTX 1WM1A 2WSMA 1VL1A 4RF5A 4TWJA 1R8XA 3OQHA 3RSLA 4G1FA 1T2EA 3QV1A 5ECGC 4D3DA 4IOJA 2M98A 3GEEA 1T8TA 1G6OA 2V7UA 1M5RA 4GI5A 1UOOA 5C1IA 2HQOA 4TRJA 1Z4MA 2QMYA 4F5YA 4IX1A 4RTKA 4HVAA 1MO3A 2AR9A 3RRMA 4RULA 2F7SA 1IWPB 2J9XB 2NUBA 3A26A 4YACA 5BQPA 2ZSHA 5E3IA 2CSXA 5F2KA 1JPNA 4JB8A 4Y6QA 5LQMA 1ZIPA 4NS1A 2OTCA 2EIXA 4C07A 3F49S 3U3KA 3MS2A 2GF9A 4R1TA 2A3NA 3KKNA 2CBGA 1M7GA 2JGJA 4NE9A 1T8WA 2W0SA 5KYXB 3N2ZB 2NZXA 3KSDO 3UA3A 3FWKA 4ASUA 2OB1A 3L0BA 2FN3A 1EEXB 4DIDA 2GD1O 3FJ1A 4OFXA 5DCUA 3DL2A 4WY5A 4YP1A 4YV1A 3EQZA 3KB6A 2IX3A 1O87A 1EFUA 2W2LD 3OCUA 4A2QA 3JASA 3O95A 4CLHA 4C7VA 1SCKA 1IXZA 4NHOA 1XZBA 4Q3OA 4R2LA 2WKWA 1JEOA 2WD7B 2ZW9A 4TL7A 1QZXA 3NEJA 1LI4A 3DVRX 1QDUA 5K3FA 2ZGVA 1Q3TA 1TCUA 2FEWB 2AFIA 5HDQA 2HK8A 3O8OB 5DI3A 1JQJC 2I78A 4JC5A 1F6BA 2B2XA 3LXRA 3O2QB 4HNUA 1GA6A 3U4AA 3LLSA 4JJ7A 3R7BA 3VYUB 1N75A 5IAOA 5KTYA 5EIBC 2AC7A 3EDQA 1EG7A 1L7OA 2W6IA 3E1KA 3F46A 3PXEA 4EHHA 5HKBA 3IPXA 3O82A 2OM6A 2ZRBA 2RK6A 3F6BX 4ECAA 1M2VB 1Z15A 1Q15A 5ALFA 3BEOA 5DNEA 2UUBB 3SNHA 3UC9A 2GK6A 1VI5A 1E9CA 2IUTA 3GRUA 4LWPA 3WGZA 4B44A 4F86A 3MC1A 4YJFB 4I8IA 4D41A 4ZI7B 1IEQA 2ZATA 3M5CA 1UXJA 4X7RA 5CFOA 4O2BF 2IYPA 2NZWA 1BD4A 1U04A 4XDGA 4UTRA 1GPLA 2AD5A 1NV9A 1VHQA 1KAGA 2L17A 2NYUA 2W83A 4UBKA 1V47A 1T36A 4EEXA 2HRZA 1V7CA 4YCMA 2ZIAA 1D4AA 2WYIA 4GMGA 5DASA 1T9AA 4Z0HO 2XA9A 3MMPA 1BMFA 1LKZA 5DF1A 4DLKA 1NDHA 1YMUA 2H6EA 4AP6A 4BNDB 1X1QA 1U1CA 5IP5A 1XJCA 3MOGA 4NOJA 5EIEA 5EXEA 4B87A 1P4AA 1I7QB 4UXHA 4GMDA 4G89A 3O7WA 1KNQA 1UPFA 2CLFB 3C4QA 3CO0S 3E3LA 4P0TA 1S4QA 1Z2NX 2Q3DA 2ZBRA 2HA2A 1W48A 4J7UA 4KXNA 4TVBA 4DV4B 1E5VA 1YK1A 5B3JC 4XGRA 4PTZA 3SN6A 3RTAA 4BHTA 1L4LA 4KRFA 4QVKA 2JZOA 1PGOA 2GASA 4WLEA 2R8BA 3IODA 1Y7TA 4I9FA 5EJIA 4ENTA 1IK4A 1UM9B 3NT4A 3GIWA 2PIDA 3HDTA 4G5SA 4MLDA 5TXGA 1EP3B 5J2TF 5CG2A 4UM7A 2C4MA 1WXIA 3FETA 2LUOA 3IHTA 1RYNA 2DBRA 3TRIA 2AIRA 3KQKA 3DLHA 3WK5A 2H9IA 5FJJA 3GDFA 5KYYA 4Z0TA 4DR4B 5AXBA 4OXXA 4WLFA 1NVUQ 4MV6A 2AS0A 1DTWA 3SAJA 4K6GA 2C61A 1QPGA 2DUUA 4D4MA 4R8MA 2CVPA 3C3PA 5EHGA 1G16A 1N5RA 2XNCA 1P9OA 4FNAA 2OG1A 5SYMA 3X44A 1YUNA 4E1AA 1O96B 2H0QA 1VL8A 2FWAA 3ER8A 1W8DA 4H7DA 4ILKA 2EARA 3FRJA 5KYYB 4WECA 1RMTA 3SGLA 4C0HA 3KHSA 5HTOA 2B8JA 2PMBA 4IQFA 3UWDA 4MW5A 2N46A 3ED5A 5KTPA 3JALB 1LRLA 3PFBA 5AXAA 3FYCA 1JKXA 1E92A 1XZ8A 3EA5A 4ZV7A 2D1QA 1YQQA 3E5HA 4Y6GB 1G2OA 1G8FA 3OOEA 1JDVA 1L9XA 1MLDA 2XEXA 2QTMA 4OJKA 5E1DA 1YRLA 3EULA 4B3XA 4EB6A 2M2IA 3GHYA 5E8RA 5IPFA 3MUFA 3AILA 3VH4A 4KQHA 1LPPA 4WGFA 1ADGA 1GUBA 2XQKA 4YRDA 3DEYX 1A2KC 5EJ2A 3PHLA 1DMSA 4Z4GA 5A5VA 1DS6A 4LE0A 2D59A 5FBWB 4XWTA 2TSYB 1HR0B 3IXMA 4MKXA 5ICFA 2DPGA 3GAMA 2G04A 3C16C 3QXCA 4M8LA 4EI2A 3MT8A 3G8DA 3LXMA 2FE1A 3Q40A 3R9XA 5ESXA 3L43A 4B3CA 3QNWA 1SHUX 4PGHA 2W70A 3RVLA 3NHPA 3PTLA 3TZKA 4KJZA 3UC5A 3TG8A 4R5HA 3OWOA 4LZZA 4OHXA 4G63A 2QIOA 3VU8A 1DAFA 5JY1A 5C7OO 2P0YA 2HYDA 4JKYA 1J42A 1EVQA 1C2YA 1VL6A 3A8TA 1W29A 1ZOOA 3H3XA 1UWVA 4NBSA 4P3KA 4NBUA 4DRXB 2D74A 1RJ9B 1Y3BE 3IAXA 4TMYA 1ONOA 1L4UA 5DT9A 3H0CA 3TPFA 4XD7D 3IEMA 2PGIA 2ZQ5A 3JSXA 4DEYA 5EXXA 1UOPA 5FLYA 3C1OA 4R98A 2H7CA 4KSCA 2FK7A 5L3SB 1RQ7A 1WZ2A 2A30A 2ERXA 2PD3A 3L7DA 4GVXA 3V8BA 4FHCA 5CB4A 4HGOA 3JASB 3K30A 4V24A 1T0PA 2IDMA 2P2SA 2JI8A 1T3TA 2YVKA 4M88A 3VR3A 1IRIA 2P90A 2X9VA 1J6UA 3PWTA 1OBCA 4GXQA 3KOYA 3VPDA 4AO8A 1EZ4A 1AIPA 2G6BA 3HM2A 2FPKA 4HKTA 1ADBA 3NMUF 1LPOA 2I80A 3WWZA 1QE0A 5IAKA 2HYIC 4S1OA 1MQ8B 1TECE 1E9FA 1Z4KA 1RHUA 2CXSA 3P5BA 5FR1A 2AGVA 1DKOA 2ADOA 2EW2A 3AOEC 2J9RA 4Z54A 2XUDA 4IEFB 1SXPA 2IXDA 3HY3A 5BSWA 1ODTC 1N25A 1JIXA 1UP4A 3NR2A 1MQAA 1T10A 4FNGA 3MS4A 4BDTA 2CK3D 6REQB 4R0VA 1IDN1 4EITA 5PGMA 1P73A 4C0SA 2WUWE 4KYVA 4G9GA 3STXA 3MYRA 1KDTA 3I0MA 1Y7HA 1QU2A 3EIWA 1PYDA 1WCIA 1Z3IX 2KI5A 3M9XA 1KY5A 5G0VA 4HDNB 2XUOA 1F6WA 4D5GA 2XIQA 5F21A 2ILVA 4JBHA 1U7OA 4R81A 3H6KA 3ZX4A 1URPA 2VAMA 1W0JD 1A04A 4FR5A 3I8OA 4PR3A 1MFPA 2XE4A 4LYAA 4XCQA 4B8YA 9ATCA 1Q0TA 1TF7A 5BXYA 1JR3A 2FZ4A 2WJ4A 1W25A 3NASA 3QVGA 1THZA 2FSIA 1JEEA 2GZHA 4HEQA 4HO1X 4OXYA 4X7BA 4NCJA 4E21A 3GELA 3OIVA 4YIHA 3UJHA 1R64A 4ZC1A 1U7HA 1JLHA 3DW1X 4YHHB 1G2QA 1UBNA 3B20A 1QXSA 5ECDA 3LHDA 1UCFA 1VIYA 1AO3A 1N2EA 3GT4A 1PR0A 3IYLW 4YAWA 4WZBB 1ZS9A 4BMDA 3FPHA 1UJ4A 2I99A 1OH6A 2JHPA 4M6WB 5CJJA 4HTFA 3QLUC 3FUXA 3BK7A 2ONZA 3IHKA 2GCPA 4IZHA 4L95C 4ER6A 1TZCA 1XNRB 3ZU4A 3V8NA 4LDRA 1NAIA 3EPJA 3QU5A 3G2HA 3C4VA 4JJAA 1YOBA 3A11A 1E2KA 3CHYA 2Y1KA 5ERXA 4FCTA 5IM4F 3OAAA 5BR7A 3OLZA 3H0KA 3VR6D 3X1MA 4XEHA 3RS4A 1EB9A 1F9AA 3ZW8A 3VC2A 1CS0A 3EPRA 1E5LA 4RABA 3TSCA 3PJRA 1YR7A 3KUUA 5EEGA 4M46A 4RTOA 4KIWA 4JJEA 1EM6A 4C2BA 1GKYA 2GO7A 2NVBA 2MWMA 2ICAA 5AVWA 1PIWA 1RLUA 4YLGA 2JAQA 1DEAA 2YASA 2CVOA 3CZRA 4UEOA 3UV7A 4E1BA 4KKVA 2WABA 3HG7A 3ETNA 2FQXA 4FB4A 1B73A 1RQGA 4INPA 4MUBA 1HYBA 3X1YA 1WSAA 4PZEA 1Z74A 2DLNA 3T7DA 3FG9A 4GR5A 4NCKA 3TLGA 3TZQA 2E49A 3GCDA 3QPWA 3RB8A 3GLVA 5JZBA 1GZSA 3JW8A 1A95A 2HHCA 4MRPA 2G36A 4UFNA 2OHGA 1QC5B 1YDGA 4S05A 1JWLA 3R8FA 4AP9A 4KQ1A 1VMDA 1LCIA 3E9NA 4GVPA 5DGIA 4ND3A 4OHWA 5BVGB 4CKWA 3M4JA 4PICA 5EIWA 5A5FA 4JA2A 3A4YA 3ODGA 4RJIA 1BMDA 1RAIA 1Y82A 2DT8A 4WOKA 4NX2A 1MX3A 4MVJA 2DULA 4PQRA 1H0RA 4LOKA 5ILQA 5M5BA 5AKJA 5IH3A 1ULTA 1ZUNA 3AP3A 3LP6A 1CJKC 3R5SA 1O94C 2XQGA 1T34A 1SC3A 2HCTA 2BM9A 3C3MA 1Q7EA 4R69A 4X8MA 1Z7YA 1LY1A 3NZEA 1R6TA 5FFMA 5ITZB 4XIFA 3H1AA 5DSXA 5CITA 1ZL2A 2H1HA 1BGVA 2AXQA 2PS1A 3VC7A 1UJ6A 4LVUA 2V0NA 3X1WA 5IUKC 2I2XB 1SUPA 1DV2A 2REBA 5FCDA 4MRMA 5EE5B 4L0QA 4Z3KA 4UTNA 1RLTA 1AZWA 2Q3EA 4QHTA 1FP7A 1YV9A 3PE6A 1ANKA 1LH0A 3ZDYB 2Z98A 5ALNA 5ETJA 4X60A 3LY7A 2I62A 3I4LA 3M83A 2CL7X 2HU7A 3HXOA 2NV2B 2ZRLA 3HBAA 1KDZA 3I58A 3K9NA 5I51A 1SCUB 3I83A 3FYHA 3NYRA 1DZ3A 1OLUB 3DFIA 2QUJA 4KW7A 2NUTA 4G8BA 4KV7A 4IQ0A 1P8AA 4OATA 5AUQA 4ESVA 1SUIA 2OPBA 1B15A 2REOA 3VZDA 4ALNA 4BTVA 1KTIA 1O9BA 5T8KC 5AH0A 4H60A 4WFQA 4FBMA 2ETVA 4CQLA 3AJ9A 3OJ0A 1RE0A 4F8JA 5C7YA 5A0VA 1ACMA 3BMOB 5LFAA 1B0UA 2FX2A 3AGPA 4OO3A 4RPLA 3W3AH 5F23A 1XEXA 3OM8A 3K6RA 2N1MA 5JZVA 2CFOA 2J87A 3E7DA 3U44B 2VJYA 3ZDBA 1S5PA 1I4TD 1TU0A 4GLLA 2EDAA 3C5VA 4XUEA 3FNEA 1JW9B 5ALZA 2H7YA 2IUSA 3OCVA 1TYBE 5AKGA 4RQTA 1Y6QA 2XMRA 1F0KA 1L7NA 3HUFA 4AI6A 1NYQA 1S9HA 2J09A 3C24A 4IIJB 4LHSA 1MT0A 4Q3CA 1XZQA 4EJ0A 2JGKA 3OOSA 3IR5A 4UCQA 1PZFA 4I0WB 3RABA 3VKHA 1P2BA 3QWAA 3NDJA 3TINA 5F98A 3GJ0A 4Z7OB 3EZ6A 3F8SA 4M9ZA 2O2HA 2VWPA 3NBQA 1P4RA 3WE7A 1GCOA 4ER7A 2YY7A 1M8GA 5L7TA 4TWRA 4CM7A 1T24A 3UMSA 3KXIA 5A9TA 2EP7A 3ZZTA 1KI1A 1WDWB 1R74A 3W90A 4ALKA 2C57A 2NZ8A 1RJ9A 4DY6A 2C1ZA 1MZVA 4UHCA 1UDRA 2HMVA 2F8LA 2J3IA 2OAGA 2PSDA 5AKLA 3VKUA 3HYTA 3X1ZA 5FAKA 3JR7A 5EINA 5BWMA 1E6WA 1JU9A 3C8HA 1MBZA 2G08A 2TMYA 3H16A 4GOOD 4N40A 3S1LA 4BVFA 4B4UA 3OWXA 3T9EA 4B43A 1ISFA 2C9MA 1CJTC 4BZXA 3ROGA 1FSFA 1NMYA 2A33A 4UQLA 3TCKA 2J45A 5IXJA 1V8DA 4I50F 1VOTA 4HWOA 3KYBA 4ODIA 3AR6A 2OCPA 3A31A 3FFXA 3I8XA 5D5QA 5DNVA 2L18A 5ALVA 2QB5A 4GX5A 5DGHA 1I30A 1VE7A 1ZGBA 5CDTA 3IXLA 3EXG1 2IC5A 3CVYA 2JK0A 1A8UA 4HUTA 2Y6UA 4D9EA 4EA7A 3QKRB 3ORQA 3MVEA 1O94A 3P1JA 5F12A 5KSYA 4J3JA 4YBRA 3CC8A 4U7FA 2W6QA 3L0SA 4ND6A 1XCPA 1DFIA 3ANSA 1P62B 5FBRB 1SBTA 4FYHA 3LQFA 1SBYA 4MKHA 3M82A 5IAEA 2H1WA 1V11B 4AJ2A 2YVLA 3OSUA 2H92A 1KYQA 1L5SA 3FTCA 1PFQA 1VJ0A 3PNLA 2YQ5A 2NQ8A 3C3EA 4AKGA 2B4KA 3FOBA 2G5CA 3JQCA 2F4NA 4RWZA 4EP1A 3TN7A 1BCSB 2R8EA 3RU7A 5FUMA 4XD7A 3KO8A 4PC1A 1GN8A 2XWJI 4F5ZA 3ND9A 4A2WA 4WI1A 3K2IA 4YLEA 2ZS9A 3QVLA 2DQSA 3COZA 4N9QA 2H65A 2IELA 3TX6A 5CM2Z 1OILA 5EMMA 4W5NA 2C03A 3MAAC 1S2IA 2PJUA 4WAUA 2QMUA 3IVMA 3RRXA 4ZOQI 2I66A 3PDUA 2P2GA 3D43A 3LPCA 2R8ZA 3QMVA 1XRRA 2G28A 3WZ2A 2N47A 3G2LA 4DG9A 1JHMA 2HFJA 5BOSA 3B9QA 3N2IA 5AVQA 5KTNA 2OHIA 3O9ZA 3N0VA 4JXXA 1QP0A 4CU5A 1NUHA 3DWFA 2CHGA 2C8KA 3FJOA 4IV0A 2W00A 1CZHA 3H8JA 2OP0A 2Z1MA 5AKHA 5CEFA 1VE1A 3QKRA 3OJCA 3OE1A 3QUQA 4QXRA 3PJEA 3H5VA 3I0ZA 4LJSA 4JI5B 2QL5A 1F20A 1Y9DA 4YYEA 1NZJA 4BQPA 4ZKDA 2BGMA 3O73A 2I2DA 3LYHA 4FKBA 2P67A 2BGGA 1HQCA 1QOZA 3VR0A 2NPIA 2OBFA 3HDQA 4NXNB 3B3FA 1ENZA 2EHJA 3AH8A 5F3WB 5FWNA 3TTSA 1Z7WA 3K9LA 1X9GA 1YWGO 3ZCXA 5A4JA 2MR5A 3KYDB 4X7PA 3G0OA 4FJ0A 1QYXA 3THOA 2CYCA 3WV4A 3R0XA 5COQA 1Q14A 5TT1A 1DC4A 5EUMA 1PZGA 4KXUA 1T3HA 1EK1A 2GYYA 5F51A 2Q1WA 3WWEA 5LOVF 5FLEX 1BOFA 1WR8A 1UWCA 3RUEA 3ZZNA 4UCFA 1JEJA 4LF7B 1NBME 1VG9B 1J1IA 3WQBA 4Y9TA 4MVJG 1YDMA 2RGUA 4DR2B 1L3BA 3Q15C 3TXAA 4PGFA 3H1FA 4QNMA 1H2XA 4D43A 4MSUA 1ZSYA 1Y7LA 2QE7A 1QBKC 1NW3A 1TZMA 2JCYA 4ZV9A 5TX7A 3ZD8A 5JMTA 5J4YA 3LM8A 1TA0A 1GZ3A 1VRWA 4A6PA 4K3VA 5KOIA 4P58A 1C8BA 4BPBA 1KS2A 2JJ1D 3SYKA 2RH5A 4Q6BA 3T35A 4OP3A 1IY8A 2VR1A 1ZI9A 3F9RA 5JALA 5DNWA 4R7GA 4P0QB 4M1SA 4EQZA 5M3BA 4G09A 1A82A 2Q4OA 3IDFA 2HU2A 2CUNA 2IXTA 1HM5A 2XQIA 3FHOA 3ZQJA 4L4XA 4OG2A 2NO1A 2AQHA 3CO5A 4X1KA 1G5RA 3C0KA 4UPEA 2A7XA 1ULHA 4EUSA 3JRXA 2V0GA 2WF5A 3U44A 1CS4C 1M8FA 2A8YA 4Q66C 4NZMA 2JI7A 3L6RA 1OXBB 2G70A 1V9LA 2QUAA 3O03A 1Q3HA 1QVVA 3NS7A 3BD9A 1KZ6A 5GWXA 4E30A 2VPXA 1DCKA 1O1YA 3DZFA 3JD3A 4LZNA 4AG6A 3D5EA 2MSEB 5JQGB 3R23A 2HLDA 5AJXA 1X3LA 1SU7A 1SUEA 4C4ZA 3FTQA 5FNZA 5CD9A 2CFTA 4JL5A 2XRYA 5A6VA 3V5NA 4EVIA 2I67A 5D7BA 5EHQA 1OLXA 1JA0A 2M32A 4RK7A 3WYBA 3IFSA 3MWYW 5ES4B 1YTUA 2FQYA 1AKRA 1YR9A 4P81A 2XVYA 3P9NA 1JEYB 5AW1A 4OEHA 4W5QA 4ZOLB 3SDBA 1GRNA 3TNYA 1Y5LA 2XGJA 2F43B 1VJ1A 1K92A 2EKDA 4QBKA 5AW9A 4QBGB 1CRQA 4QSMA 2W4QA 3WYAA 3DHYA 4QUEA 4F7DA 5K4HA 2RGWA 5CB8A 5L3SA 1OX5A 2CHFA 3LX5A 5IMBA 2TMGA 4ZO9A 1IOWA 3OT1B 1IPHA 3TYXA 2QMHA 3WL5A 4MGIR 3B6ZA 4B40A 3ONVA 3QIAA 4ZQBA 3K96A 4YFYA 2QM7A 3QI7A 3GJ6A 3OQMA 2Z3VA 1Z62A 2B34A 3CWCA 4C6HA 3THWA 3BIFA 4YRRA 5CFNA 1N8NA 4KWTA 3U7QB 2FPSA 3JVVA 4TXJA 2XADA 1JWAB 2J41A 1P7CA 3IQGX 5KNCH 1Z08A 3EPKA 4MW4A 4RIGA 3ROXA 1U5BB 4TMFA 3WLPA 4AJJA 4DGQA 4URWR 1QIDA 4MVJD 1EFKA 2E1RA 1A88A 2KLBA 1CJUC 3H9UA 2VTDA 3RG2A 4YX9A 4YP7A 2PJDA 3O26A 4JCOA 3VJKA 2DF8A 2PKQO 1S3SA 1U4OA 1H5UA 1WKVA 2BBTA 2Q4TA 3WGOA 1Y4UA 2AJDA 4UTPA 4AY2A 4YTEA 1WPXA 1I24A 1E1KA 1XRNA 1RCFA 3JYNA 4CMBA 3L0ZA 2PSJA 4Q9NA 5D3ZA 1MORA 3ZHRA 2NU6B 2Q5JA 3Q3HA 3T95A 4BE9A 4H3HB 1YS4A 1RXVA 3P27A 1SM4A 4NK5A 4V3CA 2NSLA 1OGYA 4BX2A 2VF4X 3KYJB 1O9GA 1YHYA 5HK8A 3O4JA 2WRZA 1YB1A 4JX9A 4RX1A 1LK7A 3AKCA 5FI0B 1EXVA 4TM8A 1X14A 1XT6A 1C3OB 4F92B 4C04A 4ARSA 1EUDA 2ONCA 1Q2XA 2R4UA 5GJVC 5AOVA 4E5DA 2KSQA 5AI9A 3LY9A 2BD0A 4U7GA 2ZVPX 3JQFA 1VPWA 3MYYA 3H05A 4N5HX 1U7TA 1W96A 2V58A 1Q44A 3VSBA 2OO5C 3B6EA 5EN4A 1KHHA 5EMNA 3OLYA 4KL8S 3UJ7A 2VP5A 1O0CA 4XVHA 1AJEA 1OV6A 2WBLC 1S3IA 1JYSA 3C3YA 1LI7A 3K7EA 3RNOA 4ZYVA 2QL7A 2IBTA 3VFDA 1KI2A 4GI2A 4DHEA 5KWJA 3OCJA 5C1DA 2P1DA 2JDIA 1Q19A 4G5HA 5HRUA 4BLUA 2ZR9A 3OD1A 4KR2A 3PK0A 1BX1A 3VSEA 5KYGA 2RAFA 4UXIA 5AK6A 1FSGA 1SK9A 4C4AA 5KQRA 2B3DA 4XX1A 3AFNA 2EL9A 2PX8A 3L0OA 2GBPA 3NDIA 4O3FA 4YC7A 4TLEA 1C1YA 4KG7A 3L7BA 2YVQA 3C98A 1U28C 4LEIA 2HPAA 3SYNA 4ZCMA 3UK2A 2CXHA 4PC2A 2VUTA 5BN1A 4Z4EA 4X44A 2WKQA 5H5JA 5F73A 3V42A 3ZS9A 3D31A 1R9GA 3TI7A 4HTFB 1R10A 2DUWA 2Z2YA 1HZZC 3KWFA 4Y0VA 1H1TA 2ZR0A 1YL5A 2QLFA 4QYMA 1OA1A 1B14A 2GTHA 5JS2A 4K9LA 4AQDA 2H5JA 3UMVA 3PDIA 5B58T 1F0NA 1QHXA 2P9BA 2IDKA 2XTNA 1C7ZA 3VAYA 3SQXA 1DCFA 1OYYA 2GZRA 5FUQA 4AYTA 5LQRA 2C4VA 2X0FA 4C2UA 4UULA 2B2NA 4ND1A 3ZVNA 1X9HA 4MWZA 1SOMA 2I34A 3EK2A 3QY9A 4P36A 4C0XA 1JDSA 3N0RA 2VI5A 2CLKB 3IX7A 3LZDA 3E1GA 3QMWA 3K8OE 3NUGA 4JR2A 3CU5A 4MEBA 4NONA 4TTIA 1C0KA 5T5QA 5JMWA 3ZDAA 1ZAKA 1O95D 4PX5A 2JIMA 2I3BA 2WMYA 4TM7A 2AJ8A 5FR2A 3U1VA 1TTHA 3SE7A 1S9DA 2ZVJA 3FOZA 1ZI6A 2ZE7A 3OZGA 2PYDA 2ECPA 1KC1A 4A15A 2ZRGA 1FZTA 2BMAA 2J6BA 3ONEA 2ZWIA 5L7WA 4KQ6A 1MABB 1QH1B 5CLQA 4XQ0A 2G82A 2OO7A 2IPLA 2XV1A 4B4KA 1AN9A 4IHAA 1L5QA 2V54A 4GF5A 1IJEA 5FI3A 1DMRA 1G8JA 3G2OA 4EQ6B 2P4UA 3EC7A 2GBGA 1ZJZA 1M6YA 4KCGA 1OH8A 1LC0A 2J0QA 1R9JA 2ZYSA 4B47A 1MEJA 4YMUA 4Y2XA 1E1RD 2XYPA 3LBYA 5TQJA 5F9FA 1DIBA 2BTEA 1OAKA 4TTJA 1WB6A 4PRLA 1O5TA 3B36A 4TV8F 3SF0A 4B3HA 2QKYA 3IBCA 1J9GA 3CUKA 3GRRA 3IVCA 3KFVA 5AM0A 5H16A 3I2HA 4DBLC 3M1IA 1N3IA 3P9CA 1QRAA 1P8JA 2D4AA 5FL7A 1HSOA 1Q0SA 2UVPA 1R5JA 3FWZA 2K7ZA 1ECGA 1IHPA 2QU8A 4WY2A 4IZOA 3WMRA 5CCEA 2IIPA 3N28A 4OHYA 5G41A 2AYXA 5CB4B 4JR1A 1QMGA 1N2ZA 3DPSA 3NAZA 3KZOA 2PFSA 4B2IA 1RDFA 4A73A 3G0IA 1KR5A 5H82A 3G2PA 2FP4B 5DTIA 1X8LA 2CNDA 5F7JA 3VYRB 4B7CA 1XTZA 5CA0B 1XKLA 3TQOA 5HEKA 1MDBA 2IOQA 2MR6A 2P91A 4OL9A 3EH1A 5ALGA 5I47A 3U2QA 4XEUA 4YUAA 4KBYA 3QUBA 1FYVA 4K6MA 3VR4D 4C6RA 2DR0A 4NJOA 3RI3A 2H11A 2D1TA 3QW2A 4BFUA 2HWWA 3ETDA 2OAP1 4O5AA 4IR7A 3IALA 1QF9A 2ABWA 3QQ5A 1KY2A 4RK5A 2CN1A 1O5IA 4OHUA 2JI9A 4D26A 1SA0B 4J8PA 1O54A 2QXYA 4RTPA 5J4VA 2PWAA 1TEVA 5H81A 1Q91A 3RYHA 2B8NA 4A0HA 1MO4A 1Z2PX 2PK3A 4EHDA 1ZK1A 1XKXA 4G4IA 3BRWA 3SY8A 4B6EA 4EX7A 1ECBA 4OY3A 1T0UA 1XO1A 4WIAA 4EPWA 3EZLA 2BONA 3R4CA 5HMLA 5TSDA 1IUOA 5HIIA 4FFBB 3WGVA 4CMEA 2IITA 1ZR2A 3AIIA 3S0JA 2Q62A 3WB2A 5AIBA 2PH3A 2VRNA 1QRTA 3SYMA 3T3NA 5JNTA 4IDOA 2ORVA 3QEBZ 1M6HA 1ZITA 2XNDA 4M0UA 2IRWA 1EFPA 1P81A 4LGMA 2BE9A 3L1UA 1NOKA 4QOSA 2PUFA 3SC4A 5BUZA 1T9BA 1EXWA 1Q1BA 2P9FA 4MJ7A 1N78A 1OXKB 1OB2A 1KMHA 1HT0A 4ZHSA 1ZCZA 2YDXA 4LVOA 5LBIA 3VI4B 5K0JA 1SUDA 1X94A 2DHEA 1K63A 1K88A 1CE8B 4LRWA 4ARBA 2LD4A 4FYJA 3L92A 3G8BA 5I7EA 1SH7A 1CUFA 5EXDA 2EQBA 5I9NA 4B2PA 3RUCA 1W9MA 2QG6A 1BJRE 2V3VA 5K8IA 1QVZA 2NLOA 4NENB 1M54A 2FPOA 2IGBA 1M1YB 2C9YA 2DKFA 2Q5OA 4RQAA 4DWOA 1R3UA 5GM2A 3KSBC 1QU3A 3K9BA 3NP7A 1XRJA 2A5GA 3E5NA 3THSA 1T91A 1XF9A 3KPJA 4YCDA 3WRVA 1UPXA 3DT9A 1XZIA 3U7GA 4ZTUB 3FIUA 1KQNA 2PUBA 2XE6A 1Y1PA 4FE4A 4WK4B 1WMBA 3ABZA 3EXEA 1GGHA 1OT3A 4I1VA 5HP4A 2ACEA 3KHUA 3DKRA 1RCUA 2DM6A 1H6AA 4RVGA 5FO1A 4DA4A 5ABPA 2W98A 3BGIA 1V25A 4I3FA 5FI1B 5BQOA 1EVJA 4DLLA 4DR5B 3FCCA 1CP2A 2WPDD 4UAVA 3VHLB 3KQTA 3IR6A 4OB6A 4DEXA 2E4YA 1RWBA 2E9SA 2VCYA 1Z0AA 3CUSA 1UBEA 1MF7A 1Z0IA 4EB0A 4RZ2A 1KSHA 1AUPA 3NOXA 4G67A 4UAGA 4YVFA 4IGIA 5CDSA 1PT7A 1EB8A 1ZK3A 5CD1A 3CA8A 1KIFA 3F78A 3W4KA 4YJFA 5KNDH 5LA6B 1CERA 5E3HA 1CQJB 4NYJQ 3WAGA 3OTOB 2YKGA 3ZWMA 3G5AA 2Y2VA 1DNPA 3RV3A 1A7AA 2WF7A 4XGIA 6AT1A 4XYMA 3OOWA 4Y1RA 1DI0A 2VPYA 1ZGCA 2GJ9A 1K98A 1QB8A 2DTEA 2RGGA 5AHXA 3R7LA 2PS0A 3ZW7A 4UU0A 2WJZB 5EFZA 1U11A 4AJNA 4AJLA 4Q4CA 1Y4AE 4MARA 4EBFA 5LKRA 1BAPA 3PPWA 4AK9A 5CEEA 2LWIA 1HNNA 1YQEA 2YJTD 4U3JB 3LH5A 2C5SA 2VDVE 1RWOA 3HB9A 3H4VA 3FSGD 5K01A 4M53A 3Q8KA 5ITVA 1Y5IA 2BFCA 2C5AA 2QV7A 4UUPA 5C1PA 5C5DA 4P4NA 4ALLA 1O5OA 2YC4C 2EFHB 5DIFA 2APJA 1WMAA 3GEBA 4NOKA 3MJDA 1QZ3A 4X61A 3RSOA 4HYYA 3VH2A 1G38A 1FY2A 4OLAA 1JFSA 5AW6A 1VKNA 2YS7A 4P54A 3ADCA 3I9V1 5EWMB 2ZZMA 1DPGA 3ORSA 3EGEA 1QLJA 4CIVA 1MXFA 3IO3A 1H3FA 3NIFB 3FMOB 3IMEA 5FUBA 1POWA 1NQTA 3EGOA 3W8DA 1Y3FE 2V6MA 8LDHA 4GFDA 3UWPA 4DR6B 2FMKA 3IURA 4BCCA 1M2JA 4CKXA 3BFVA 5TT0A 1TQ6A 3OM9A 4DAOA 1DP4A 3RSQA 3H83A 2ZCUA 1J8MF 3TUIC 3R76A 3KQYA 5I7UA 1ORWA 1JN0A 3RK4A 2YXEA 4H2DA 4LYDA 4PG7A 1PK8A 4AY3A 3ELBA 2PKYX 1W9HA 3AP2A 1QP8A 4R51A 2H1SA 2W2TA 3H5LA 3PUYA 4RM2A 3T4EA 3HA5A 1UMCA 4HQ6A 4HRYA 4S2UA 5F9HA 1EUQA 4KO4S 1K66A 3FFTA 4GECA 1NR7A 2CCKA 2YDYA 1YD7A 5J5VA 1VDMA 3RSGA 1CIJA 3EIEA 2YOHA 2HUNA 2LE0A 2OL4A 2Q0QA 3MCZA 2I2WA 2XKBA 3D2AA 5DTEA 3TRJA 1KBQA 1JMVA 3W78A 4B3DA 4EI9A 4F72A 3W1WA 2Z8XA 4J2TA 3AI2A 4MNTA 4DZZA 5CDFE 2Z56A 4HNQA 4PO1A 4NCAA 1EA7A 4DXAA 4F4UA 5L6LB 4EYOA 2PUHA 4GOXA 3D8NA 3H2SA 1Z47A 2BGTA 1DUIA 3I2IA 5DNAA 9LDTA 2PWPA 3OQOA 4GXTA 1YVUA 3VTZA 1QH0A 4N6OA 2Q7OE 2X8WA 1LNZA 4BB6A 1C0LA 2QSUA 4BNZA 3CB4A 1RTKA 3V8PA 4BNMA 1KETA 1J5PA 4RV9A 3GRPA 3PGJA 4NZ9A 5HGXA 2PD4A 4S12A 2YQ4A 1V4VA 3CUUA 5IVDA 1C9EA 1JJIA 5IULC 5AW7A 5FTWA 2MMCA 5D8DA 4D1YA 4F3CA 3WGIA 5EFOA 2Q1UA 3FRHA 1CTQA 4PLHA 4CMKA 3Q12A 1SRQA 3BULA 3FMVA 1D7AA 1FS6A 4OAQA 3QY0A 1DT5A 2W0MA 4GG1A 4MMYB 4EGQA 2OMKA 5EIFA 2VHYA 3KQSA 1QH9A 4ARUA 4AMGA 4BN0A 3H13A 3UY4A 4V0OA 2NTNA 1U3DA 3S70A 4EZBA 3PRHA 5ELMA 3GCZA 4L3OA 1OYOA 2X42A 1NSYA 2CHQA 4DCPA 2UYYA 2BOVA 4BFLA 2BFDA 2V74B 1L5OA 4J0GA 5F1OA 1VG8A 4RFSA 1K86A 1PZHA 1I1QB 4PE5B 1S2LA 3I37X 5H3CA 1VECA 3HWRA 4KB5A 1ZOSA 4NP6A 5JNRA 1EIWA 3CX6A 4KHZA 1CUUA 1NGSA 3EEIA 1FNNA 1MG0A 1SZPA 4LE1A 4ER5A 3Q7RA 1J20A 1DWUA 1DINA 1V9SA 2WTBA 3E1SA 1XTTA 5A05A 4YLYA 2PGJA 3RIHA 3RK0A 4FBGA 5BR4A 1DEKA 1PYOA 3IDOA 4DCSA 4DMGA 4FI3C 3V8QA 4D56A 5KNCD 1Z4OA 1RJDA 4LOJA 4JOBA 4BLOA 1QX4A 2ZYTX 3DCIA 3PJFA 4CMEC 5DYGA 3EDMA 3FTPA 3HCAA 4ZD6A 2O8VA 1BKYA 1R12A 3I6BA 1I94B 2EJUA 3VMMA 4E51A 3R6WA 4RVHA 2C0QA 2O6LA 3UHOA 3DE5X 1EP2B 1KXZA 1FX0B 3D8UA 1ZMOA 4O63O 1U7ZA 1R00A 3S27A 3GRFA 4RLSA 5IDQA 4OQXA 3C87A 4OXQA 2VHZA 4P3XA 3KZVA 4ZO4A 5JR3A 4MUHA 4WCDA 1BH2A 3W5SA 5JYEA 1JZTA 2HNBA 3ES9A 1XYVA 4TMXA 5EJGA 1TGVA 4PM4A 2AH5A 1Q1NA 3BD8A 5B1SA 3MLAA 2DPXA 2ONYA 4XLZA 2CDCA 2ZBPA 1XZCA 5IDYA 3R40A 4RIEA 3WIVA 3HM9A 1FJ2A 2IHBA 3UO8B 1SEVA 5HDBB 1JXOA 1XHLA 3HGTA 4AJOA 3VMFA 3BXOA 4IEIA 2V96A 1TM4E 1GG8A 3LLCA 2ZI9A 5A06A 3D3WB 2GSDA 5J23A 1JP7A 3A9SA 2JPDA 1JNXX 2RI1A 3P9YA 3PC2A 1ZMRA 1RI2A 1TMGE 1JQLB 1WUKS 2K7FA 3O8LA 1D3AA 3U7FB 1ZLXA 4CR8A 4MKRA 1I4EB 1WSBA 2W2NA 2FN7A 4OVKA 3SCZA 4A3SA 4F96A 1HYGA 3ZHTA 1QIEA 1DIGA 3WNQA 3ZEAA 1ML4A 1RHQA 1WLYA 3BS4A 3GWZA 1F17A 3C7TA 1RWWA 4DQVA 2RGAA 5L3QA 4QVGA 2KJQA 1UDAA 4FZVA 1ETUA 4R8VA 5CHEA 2P6PA 5KWEA 4HDRA 4JROA 3TOSA 1RWQA 2M6SA 3N8NA 3HU1A 1XK7A 1TX4B 1FRNA 1ZN8A 4XZ3A 3S2ZA 1QP4A 4G5RA 3IAM6 4TV8A 2R2AA 4EO4A 1JHOA 3IEKA 4WUVA 1LPBB 1SKUA 5AHRA 1RABA 1Y9JA 2QD1A 2W6OA 3ILSA 4JLMA 4YMWA 1R5NA 2Q6OA 3ANMA 3LCMA 4QYTA 2FSGA 3GEHA 3TO5A 1KVRA 2V7QA 2YWXA 4KVAA 5EPUA 3AUAA 1E4YA 2VT6A 2JFUA 3L41A 4HNRA 3OKCA 4XSHA 2TMDA 2Q2QA 3K2EA 3L6BA 4FD2A 2AFHE 5UKDA 4PWZA 4BO0A 3EXIB 4JYAB 1YVDA 1ZNZA 4FS3A 4LJ6A 3GAFA 5JFOA 2CK3A 1YJ5A 2PN1A 2QX7A 3H75A 4QT4A 3S1SA 2YIVX 1GTVA 5HFAA 2QT1A 2BBWA 3FI9A 2BFDB 5FBZA 2ZSUA 3S2FA 3ELYA 3VNAA 1QCDA 2P79A 3BOSA 4FYVA 3CLVA 4IXNA 1Z2AA 1CUAA 10MHA 3QFRA 1MENA 1RHRA 5KREA 2FHSA 2DKOA 4Q7MB 5E2IA 4OXIA 4BX9A 2VTKA 3O3OB 1H0HA 3PRKE 4B1FA 1RS0A 3QLJA 2NNWB 4HX9A 2J07A 1OTYA 4X00A 2H0RA 1W76A 1WUHS 4R84A 4BS9A 4I4LA 2AFHB 1XYYA 4JN6B 3UMYA 3EH2A 2DBQA 3ABQB 4FOPA 2QRMA 1BYUA 4FE7A 5GONB 4MWCA 3DZCA 3HRHA 2GUGA 1JVSA 1ECJA 2F3SA 3PD0A 1E5QA 4JJIA 1ORVA 4KFSA 4Q02A 1BXKA 4CMJA 1I2DA 3B3JA 4L2IB 1UZAA 4P6VF 1W85B 2F1RA 3ZPXA 5EVCA 3LQ4A 1CCWA 3F3MA 3PT5A 4FWBA 3K9HA 4R9SA 5E1OA 3ER9A 1J24A 4WBNB 1O97D 3DMRA 3L77A 3PSHA 3CLRD 3HKEB 4ZJUA 3O6VA 4FC7A 3DTVB 2H1LA 3OZFA 1KI3A 1WEKA 4CL8A 1TF2A 5HRAA 5BOSB 4XFJA 1ZD9A 4JUCA 4LCJA 1NRXA 3LDFA 2YTZA 3E2IA 4BAZA 1W1IA 2I1VB 3GLTA 5MFPA 3FFAA 4JH0A 1H1DA 3D0OA 4YBZA 4C1BA 2VTBA 1YS6A 1X0XA 1IZZA 3R7NA 3VPGA 1HFWA 1JFFA 3GGJA 2VYVA 3MSXA 3A6EA 4HVCA 3VJRA 2PBLA 1XKQA 3HNRA 4X20B 3ND5A 3J7TA 1AXRA 1LU9A 4BMOB 2R1UA 3QGMA 3TQQA 5AI8A 4XYLA 2O0JA 4I8DA 5EJ8A 3RT7A 1IATA 1XZFA 2WMNB 3OX1A 5CGQB 3VNUA 1P1FA 1BEEA 1JDTA 2CEKA 3TF5A 1M6EX 5IN5A 1E8DA 2OBNA 2XLBA 4YRZA 3Q5GA 1K8ZB 3G82C 2ECOA 2GZ2A 4DKXA 4RZHA 3B9BA 5EZSA 2C94A 3GLUA 3KOXA 3QPVA 4HWRA 4J0IA 3GK3A 4DMCA 2O0LA 3X3HA 3GJ8A 4NBVA 2H1FA 2QRHA 2A9FA 2A7QA 2WWXA 3R6GA 4NNJA 4O4JA 1TU3A 2NZVG 3LZCA 3B2QA 3MD0A 2O2EA 2WMOB 1CUVA 1OAAA 1ORHA 1PV1A 2PTHA 3B8HA 2RI6A 4DEVA 3AJEA 5J4LA 1RYEA 1AQNA 1Y9AA 1X1EA 2Q3LA 4UKDA 1ESCA 5I3ZA 1GNQA 2BYTA 1RKVA 2ZTSA 4XYEA 3OVMA 1DC5A 5CLLA 5J5AA 4XLTA 1J9ZA 3A28A 3ZW9A 1V3UA 3AF5A 4RPGA 3IJPA 4JI3B 3OJFA 4W5HA 2GGSA 4CM5A 5KIAA 4EQ6A 1GZHB 1WEHA 3CNQS 2QVCA 1ZGHA 2OHJA 3KJEA 4TS1A 3ECCA 3GFTA 1ZD3A 3CE9A 4PZ0A 1F9EA 5HZMA 1C30A 4YB8A 2ASVA 1U2SA 1OWNA 4JS0A 4AU1A 4R71A 4B6RA 4BLRA 5ED4A 3ZCPA 1NUSA 1CFZA 3DE7X 2JIZD 2Q2WA 4ZOEA 5ALHA 3D7MA 5F35A 2VDLB 4MRNA 5E6SA 4B75A 1EE9A 4RVCA 2JARA 4M86A 1HFEL 2AYZA 3OZXA 4HLCA 4I4TB 4WOCA 4IRMA 4EJSB 1H9CA 1FMLA 3W2EA 1X7HA 1YB2A 4PF1A 5IAAA 2IWHA 1ZBQA 2GSWA 2MSKA 4NU6A 3R7SA 4E11A 5I7OA 1U0HC 3CXRA 4DSOA 1B41A 2CFIA 2FFBA 3QHPA 3U3ZA 2JEYA 2Q5HA 2O50A 1XTSA 3PGLA 4UPDA 1HK7A 2P41A 3TD2A 4M37A 1ZZGA 3UUWA 3MTIA 4JKOA 3K32A 3BPSA 4KIJA 4MINA 4LF5B 1HUQA 1PEYA 3KR9A 4UEJA 4AMUA 2W9XA 2WTMA 1FC0A 2R6DA 1ZH4A 4MVJE 1NX9A 1TKBA 3KQMA 3PF8A 4Q4HB 5GIPE 4E33A 3F47A 1Q77A 3ESAA 3VR6A 4MEJA 1Z4IA 5E7MA 1E2IA 1A76A 3DWEX 4HDAA 4EHIA 4NHEA 4YP0A 3TJMA 1MW9X 4TMVA 5E6UA 1KOFA 3GGOA 3CNOA 4C2AA 2CT8A 2QX9A 3CT4A 1JXQA 3N2KA 3C6QA 2QRUA 2QVXX 3OHSX 3HCRA 1QE3A 1T3GA 4M7RA 3TK1A 1G8SA 1UBCA 5E38A 1D6JA 2ZETA 4RDHA 2HMYB 4WEQA 4ZICA 2JGIA 1I6LA 4KMSA 2R8YA 4ONEA 1W4AA 2VP0A 5CVEA 1NV8A 1P0MA 4R4JA 3VYSB 2C3UA 2EGHA 2RGCA 1Y1QA 1KEVA 1QAQA 1T8UA 5J2TA 1K6JA 4LPKA 3A70A 3STVA 4ZPJA 1AKWA 4ZO8A 3N59A 1E3DA 5DHQA 1DG3A 4X20A 1SB9A 4HJXA 5EG5A 1Z82A 4KUEA 4Q7EA 3IUYA 2CVQA 1EUDB 1KEUA 4ZDWA 4WINA 4HG2A 2QTBA 4MICA 4S1TA 1K9SA 3UZUA 4K03A 1PJSA 4ETWA 3BFXA 1DEHA 5CEJA 3FVWA 2ZUSA 4XQGA 3NG1A 3UAOA 3GVHA 1I14A 3MINB 1IQPA 4PZ9A 3K5HA 5DBFA 5DO9A 4DUPA 1YE5A 4YAIA 1JAHA 1QGZA 1TNDA 3R7WB 3E81A 1BQ4A 5BV8A 3GUVA 3PWSA 5TPWB 1QM5A 4IXMA 1PBNA 4US1R 1L7AA 4AKIA 3IO5A 4WK0B 2IV2X 4L28A 1KMNA 1ODSA 3A6JA 4YAJA 721PA 2YXDA 1YHNA 1SPXA 4N3GA 2GN2A 3DT6A 2JLQA 3UH0A 3BWEA 5KOHB 2EP5A 2PZFA 2WILA 4WJLA 3A9RA 1L0BA 3AUJB 3L1HA 5G1OA 4OBBA 2WP8J 5ALTA 2WJAA 7MHTA 1M1NB 1HDEA 1PVDA 3AM5A 3DBRB 1J8VA 5DTRA 1U3CA 5IBQA 3UNXA 1Y8RA 4MTCA 1WPRA 3U7QA 4CL0A 1Z2CA 4PN3A 2CXOA 1YQUA 4FZ3A 4TT8A 2MTBA 2CC2A 1P5RA 3PJDA 2PM8A 4OMDA 3ZGNA 1S7CA 4D8VA 2BR4A 3T5MA 2YINC 3A3PA 3WGKA 2W22A 3I12A 4M7WA 1SCQA 3I2YX 3OQIB 4MIYA 2O5RA 3LHIA 2YFKA 2IH2A 4XQ9A 1ZGAA 4D4HA 2GF2A 4DCVA 1OLSB 5CLGA 1WS6A 1VG0B 4QM6A 2FZWA 4Y7CA 1E0AA 4P3OA 5B3JA 1RU3A 4F04A 2I6FA 1J2JA 2HC9A 3RYIA 3ZH9B 1T1EA 1U3UA 4YXWA 4Q4AA 3PRYA 2I7TA 3PB3A 4R3NA 1P39A 3FKQA 4CDMA 1TT5A 1XCMA 2DJ5A 4HNTA 1L4FA 4GYYA 3FPBA 2H0AA 4QUKA 1ML3A 4O4IB 4RESA 4BNLA 4IZIA 5G0UA 3EVNA 1T0BA 3K0AA 1WOYA 2IXBA 3F6EX 1KK3A 1D6NA 1WWKA 3L04A 5CX1A 4BL5A 3K92A 2V7QD 2ZJBA 2O2IA 4TKZA 4TVKA 4XPIA 2FPXA 3SIPA 9LDBA 5A0TA 1GWNA 3R5HA 4GOND 2WW8A 4N7RA 2PGNA 4B7UA 2VRCD 4BB0A 3JVDA 1ZXXA 3GZNB 1NVKA 3IQHX 5SZKB 3SEFA 1PF7E 3BF8A 1F12A 2R6HA 2O8FB 3LBFA 3EXFA 3SVZA 5JNWA 4DSNA 2XZPA 3PR3A 4II7A 1X7ZB 1YE3A 4PHFA 5JLJA 1YBFA 3HFSA 3HXTA 1TFRA 2Z2ZA 1N9ZA 4WJKB 4E13A 2DPMA 1QKJA 3GN2A 4J29A 4JU9A 2WFMA 3AI1A 4Q1VA 4YN3A 3VDNB 3LE8A 4LGYA 2X8LA 5C35A 1LEHA 3N5KA 3EVEA 4CM3A 1ZJJA 3IT1A 3OJOA 1KP3A 5BYKA 3KT8A 4R41A 4BKOA 2CJYA 3TVTA 2B9VA 5KQLA 1XTJA 2XD4A 2GA9A 2B4AA 2WZBA 2XE7A 2CXQA 5HM8A 3RT1A 2QL9A 3AR4A 4DR1B 2V6IA 3NNDA 3CIOA 2ZJ8A 4MYSA 4DY4A 4TWBA 2V7EA 3A14A 1FPQA 2PKQP 1AHHA 4O1MA 4WJZA 3BE4A 2L69A 4Q3KA 3BCRA 3IBTA 5U4XA 4F60A 2QUZA 1Y3AA 3OZTA 3FA2A 2WJJA 5FL3A 3ZDDA 2ZB4A 4RJ2A 3P4YA 3HNOA 2EG9A 2K2QB 3UB2A 1JPUA 4HF7A 4MUKA 2NG1A 5E95A 2WVJA 1V45E 3DR5A 2OQIA 3TCXB 4JUAA 3KAQA 2VUIB 3NT2A 4LBZA 5LSAA 4FYPA 1JI3A 4I19A 4B76A 4BRSA 4X41A 1WVIA 5I7RA 2YXNA 5KYUB 4BLQA 2BRUA 2OLKA 4QUGA 4FHDA 1TUBA 1HT1E 4NZOA 5IWCA 2IHZA 3UB3A 2FPMA 2W6MA 5KYWB 4D80A 1L8OA 3B5EA 1GKUB 2FWBA 3LYUA 2P9CA 4EY3A 3KCNA 4GEKA 2AUTA 3QTBA 3VOSA 1V8OA 1CU1A 1KI7A 3HL0A 3LYAA 5BSGA 5DLEA 1GCGA 2V7GA 4QC2A 2P0EA 4YJ3A 4IIEA 4D0NA 4EGJA 4FB5A 2ZT6A 1CT9A 2GEFA 5FXMA 4CETA 3HPQA 4KAJA 2FP3A 4RXTA 2QD2A 3N8HA 1N5DA 4FSHA 1YS2X 4Z4QA 3G1TA 5A3QA 1ZCJA 3F1LA 1NLFA 2AJTA 3WWDA 3N2YA 3L7CA 2YW9A 3ZU5A 1DAOA 1IZ8A 4TL8A 3HB7A 4HWPA 5DBOA 2D0PB 2I4TA 2IOFK 5JASA 2MJLA 3MIZA 3OOYA 5CH8A 4BNUA 2Z4TA 4JI0B 3HL4A 4EKIA 1P2TA 2YOFA 2JD1A 2E5FA 1NPTO 1NVTA 2YOGA 1KKMA 3K4PA 4CLEA 5ENVA 2OENG 2PLFA 3EIHA 2Q0HA 3RWBA 1XCOA 2F3QA 2ON6A 3FNBA 1ESZA 1NMXA 3I09A 3TNDA 1VSTA 1YJ8A 2AOUB 3GLHE 3I34X 5ALXA 5GONA 4YREA 3R09A 1UXIA 3KP1A 3ORHA 1Z8NA 4EA6A 1WE2A 4X66B 1M66A 1Z12A 3QNUA 3EEBA 2YV3A 3B7PA 3Q6IA 3FMIA 4K0KB 2NM0A 4KQ9A 4YV0A 1QAOA 1JJAA 2FZLA 5K9ZA 3OU2A 3U1TA 2XCSB 1HNZB 2C2YA 3GQBA 3FM9A 4NWIA 2A67A 1IZ7A 1ODCA 1GUDA 1XG5A 2DQZA 3CUTA 1AO0A 4Y2GA 2BI4A 2OGSA 4AZ3B 4O3MA 2QRJA 4M0LA 4LGVA 3UT6A 2AUNA 2FMUA 2HA3A 2HRDA 3DDOA 3N8KA 3QNMA 4G0XA 2GXQA 2EBUA 1JQAA 2XNJA 4WESA 2AMYA 1WDKA 1SUFA 1G9SA 1WZUA 4P98A 1E9EA 4XUCA 2JIOA 5EEHA 3DLIA 3W6ZA 2JKYA 1PN3A 3IUPA 3ESDA 3E9QA 3R6LA 4A82A 3NHRA 3N2KB 3EQ6A 4ZALA 1L5HA 4JC0A 3WQRA 2I03A 2JAHA 4X8HA 1YU6A 3UJ3X 4H1WA 1KY3A 3FNFA 2JLAA 1DCTA 1BWQA 5K1ZA 1QYVA 4DBZA 3QVMA 2NUAB 1BH6A 4GD3Q 5C8DA 2NQ2C 3CRQA 4QX6A 4UMEA 2ATVA 3VU9A 2JANA 1EXNA 1MO6A 1RXEA 3M89A 4H15A 1YI8A 1YI0A 4P4LA 1B2LA 2OVBA 2QU7A 2MYTA 4WH0A 4C76A 1L4BA 1DBSA 1QHEA 1VGRA 2MYNA 5KS2A 4YO8A 4HVLA 1EK0A 1G9TA 2ZSDA 3O47A 1MVNA 3BZWA 1I5OA 1YUMA 1UFVA 3LT0A 4N0MA 4MVXA 1VCHA 3AESA 2Y4NA 3IUNA 1PKEA 3OY2A 1OT5A 4LOAA 2GAOA 3G9ZA 4G26A 2ZBUA 2ZZKA 1LV7A 4WXEA 3LUDA 5JNUA 1BRTA 3DTNA 8GPBA 1MJHA 1EUCB 4HZGA 4OQPA 3IAAA 1FFDA 3LPAA 4CEJA 5CB6A 1FUYB 2GZ1A 3DWIA 3MWFA 3D4LA 2B92A 2BTOA 3N3BC 4M9SA 4PC6A 3VR2D 5FHQA 4ZO6A 5DXFA 3B82A 1NFRA 4QGHA 2ZIGA 3M3DA 3SC2B 3BHJA 3OT4A 3PD7A 1DWQA 2BHTA 3BGDA 4TX1A 4U6QA 3TIFA 4W5TA 4H7FA 4F3KA 3NPAA 1BE8A 1C30B 1R4AA 3SFZA 3WK7A 2HK6A 3EPLA 2B8WA 3DLBA 1GCIA 3KELA 4JJGA 3P4XA 5LL6P 4XA8A 4ZKEA 2X0IA 4BO1A 4Y8VA 3LTEA 1G2IA 4IDBA 3NDBB 5COAA 5DMXA 1W73A 5KCMA 4IJ5A 3VNSA 2O7RA 1XI2A 3T5CA 2OZLB 4LXHA 3RYCA 4O8ZA 2WWIA 3K9CA 3KEFA 4JLNA 4QODA 3FW1A 5HBGA 3CZAA 3OC6A 4EPRA 2XUPA 1JZQA 3L8ZA 4UNQA 3SSAA 3WQQA 4TTQA 4CWAA 2CMKA 4PZZA 1SN7A 1TVKA 1OXUA 1IPEA 2GYUA 2X1VA 3PFFA 4OMCA 4P82A 3ESQA 3R44A 4DDWA 4BWGA 1EFVA 1TYCA 3C3CA 4KAAA 1Y98A 2W37A 4A92A 1P4SA 1RHMA 2QTNA 1E6MA 2HTFA 4B4VA 2PAFA 4DILA 3BWCA 3KB8A 1WBBA 3DCNA 2PGDA 2IYRA 3H5WA 1SHJA 3MTJA 5FADA 2XMQA 5U9CA 1DHTA 3CCBA 1J0DA 3MS7A 3RJZA 3B9RA 1C7QA 1PR3A 5IANA 3FTNA 5ISMA 1JEAA 4XX0A 3T7AA 1MVOA 3IUJA 4AJHA 1G4HA 1N0WA 5JBQA 5ERYA 1XELA 1TJ5A 1DXQA 3HJTA 4ZK6A 4MVJM 3PKIA 3LT2A 2Z5LA 1R0BA 4GEGA 3UHFA 1U81A 2Q41A 2JFVA 2FLVA 4EFDA 6NULA 3LF1A 4QPJC 1Z4JA 2HWUA 1H85A 1TD9A 2R65A 3RO7A 3IDQA 5JTTA 3PQ4A 1HNWB 4FJ1A 4KE6A 4HLDA 1EGQA 3P2OA 4PLTA 1CLUA 3FBWA 5AVJA 5JPIA 4BQFA 2QZJA 3BXPA 2XT9A 5FUVA 2VDOB 4XIJA 1B8UA 4EL0A 3GOHA 4U7PB 1U65A 2FWPA 4HS4A 4IIVA 3GA7A 5ES3A 4WOBA 3A06A 1GGMA 3H1TA 3INNA 4R05A 3U3XA 3GEMA 5A3VA 4X64B 4AZ3A 5JWRA 4C0LA 4UTZA 4W6QA 4BNJA 3W3AA 2B69A 1QCZA 1YAJA 2Q9CA 2ZSIA 4GZ3A 3IP7A 2X2PA 2QJWA 2VVTA 3D6HA 3GBVA 4YRTA 1Q50A 3JVUA 5DGCA 4BO9A 5HQTA 4QE3A 5FEUA 2MIIA 3OG9A 4JLAA 4BQOA 2JLZA 2NXCA 1P7YA 2XNSA 3WAJA 5FO0A 4GAEA 1KYYA 3A1UA 4F56A 2HHLA 2YJ4A 3BTSA 2HWKA 3FPSA 3PFWO 3DDWA 4D92A 3IKLA 3BD6A 3DLTA 2WZQA 2OLEA 4PS1A 4S04A 2V4UA 4RVUA 4E5UA 2WIKA 2P4EA 4ARZB 2CXXA 1YS1X 1UOEA 3CSSA 4HBZA 1DKQA 1M2FA 1COWD 3K16A 3SBEA 5IX8A 3F74A 2VT3A 3LMKA 3RVRA 5F1KA 5I3CA 3CF6R 3U9TA 2OZEA 2XGMA 2Y66A 3K73O 5G4LA 2HAEA 4LVNA 3LK7A 1UJCA 2HOQA 1QTQA 4MTLA 2ZDGA 2X4DA 1OMOA 2ODWA 2RCNA 3RREA 4J03A 4BNVA 2R00A 4NOMA 1OA0A 3SPXA 2ZRIA 1ZDMA 4F12A 2VJKA 2Z57A 4KO8A 5KBYA 1SOAA 1QF7A 3IVRA 4YT4A 2DY1A 4QEZA 4LJ4A 1DKRA 3WK6A 3AZPA 3D6JA 5F5LA 4PZPA 4IWXA 3LVQE 2Z08A 4WNAB 4HFRA 1N9GB 4X24A 2CE7A 2YHAA 3KVYA 4P34A 4Y2PA 4QM7A 3EDOA 4DARA 5AJYA 1E2MA 4KQFA 3J81k 1MGOA 2JA1A 2G7MC 2JF0A 3ICOA 2R6R1 1DAEA 4JNKA 3TAXA 3ZY6A 4BJHB 4RANA 3F4BA 4X1YB 4BBZA 5HS6A 4ITUA 3CN7A 2GKGA 4U00A 3ROFA 1EX1A 1KI6A 4D98A 2Q1SA 2VCEA 3G89A 1XQVA 3G8AA 3I9LA 2JL1A 1LLQA 1XP5A 2NO6A 4ND7A 4GU5A 3ZNPA 3A9TA 4D2IA 4C4OA 2XB4A 1XZAA 1IBMB 1OYWA 4LS3A 3CGWA 1K08A 1C4OA 3F2IA 1DJNA 1GUZA 2E21A 3AHFA 5THQA 4KXVA 3RVJA 3P94A 2JHGA 3OPXA 4OA5A 3W79A 4A36A 4H3VA 1Y34E 3RSZA 4P3YA 2XTAA 1WNFA 1HKUA 3QPBA 2BM8A 4MUEA 4O2LA 1VKRA 4B31A 2WG2A 3PQ8A 5J2UA 3LQ2A 1IQRA 3WAKA 4CM6A 1SD2A 3PEEA 5DBIA 3OQ1A 3KS9A 1WHTA 2B8TA 5K6TA 4MUJA 1W8IA 3W05A 3T06B 4K40A 1CHNA 1CUZA 1H1LB 2GM9A 1A8QA 1F4LA 3Q3EA 4XTCS 4F93B 3VGJA 4R0NA 4RENA 1KJQA 3I1IA 2B1GA 4FHFA 5FTKA 4BLTA 4MQLA 2ZIUB 5FQNA 1EMDA 2ZIXB 1EG2A 3PV0A 4UNRA 1PW5A 2X58A 4YV2A 3ERCA 2XQVA 3R77A 5H83A 3ZS8A 1K8RA 3P9QA 5CFQA 1VHJA 5KVCA 3PICA 5GONF 4ZU1X 4OFWA 2C92A 1G9XA 2GN0A 3BRWD 3DKKA 1YR6A 3IEXA 3KJNA 3SC2A 3UW1A 2UVQA 1GCAA 3RLIA 3LKDA 3F3KA 1SU8A 3WYFA 1QDLB 3FSEA 1HC7A 5FT9A 2QVLA 4P5DA 1DRJA 3U7HB 4X5OA 3JWPA 1HLFA 1M34A 2H18A 2F59A 2TS1A 4M4SA 4Q48A 3BJZA 4YUVA 3UHJA 5JROA 1VHDA 3VHQA 3PFNA 4J75A 1Y3DE 4ACAA 2O8FA 5AHOA 5B6IA 1WDMA 4Q9JA 2Q45A 4M3NA 4CRWB 4DPKA 3P20A 5JNLA 2RH9B 1E77A 2GN4A 3A6PC 4EEZA 4K28A 1X74A 3VPSA 1E2HA 1DIRA 4RJLA 1B16A 2VNKA 2LCQA 1KJZA 2ZRJA 1L8AA 1V1MA 1LW6E 3G13A 3PFKA 4QPCA 4UTOA 2PXHA 4L8WB 5TQ0A 2A9KA 4ICIA 2FN4A 4J49A 3NOQA 2DCUA 5DLQC 1U2DA 4AL4A 1YIOA 4D02A 1NLUA 4J76A 2ISSD 3NTUA 2ASEA 4KODA 4L51A 5EQFA 4Q01A 3USES 3QG5A 5HIAA 3M6WA 2WJ3A 1C81A 1E1CB 1X1SA 3GEDA 4MLCA 5HG0A 3PEWA 1D03A 1OOEA 2X1LA 4OI0A 2XDYA 2IE0A 2X9LA 1UK6A 3TLZA 4FWIB 4IIYA 1UKEA 2PSHA 5JNSA 3ZK7A 1E3SA 2YWGA 1DO0A 1N6OA 1U99A 2ZP1A 2YV2A 3ZU3A 1C1XA 2V0CA 3CIFA 4F97A 5J63A 4L16A 4OQQA 1ZG3A 2GNOA 4NENA 4GZ5A 4MW7A 2IXGA 2QTVB 4PX3A 4H7IA 1PV4A 4LE2A 1OXSC 4D46A 2II6A 1HDOA 1XDGA 2BFFB 1X80B 1ZN7A 1RRKA 2E2WA 2O6HA 1HDCA 2B1IA 4HX5A 2X2OA 3H04A 1H3EA 2NYRA 3G7SA 1FYDA 1ZUD1 2VP9A 5TNXA 1G21A 1DB3A 1BE0A 2O3SA 3QQPA 3IQEA 2WPDA 2RHDA 3C3DA 5KX5F 1OH7A 1BQ3A 4IUCS 1AV7A 3P7MA 4WN9B 5LQSA 4PZAA 1FP1D 4F0JA 3CLUD 3OUUA 3KT0A 4TYWA 1L7XA 3N75A 3HUDA 4IHJF 2FPLA 3BFKA 5BV0A 4HOYA 4I5EA 1IBKB 1VE5A 2ZBDA 2FOLA 4GX2A 3TLEA 2IJGX 4G1VA 3GPBA 1XZLA 1UBJS 4MB0A 1UAAA 1D0VA 1E64A 2ZAIA 1A98A 7REQB 3AMVA 2GZ3A 1KFCB 2CUKA 5EZYF 4ACBA 4BJ6A 1U7DA 3NALA 4D82A 1AK1A 3OSZA 2WWYA 3ZLJA 1GV0A 4ZTZB 1ULBA 4YDRA 1E3WB 1S3FA 2HL6A 2SNIE 4N5IX 3TKYA 3TKLA 2XX3A 1OIVA 2J85A 3NRCA 4OHBA 3ONFA 1AVTA 2AKYA 3BTOA 4QDUA 1TEHA 1VCNA 1Z18A 3B85A 3PL5A 4F4IA 2FW7A 1CUYA 3T7KA 3DZDA 2DPHA 4HDCA 1NF8A 3TLAA 2E7ZA 3K94A 4C3ZA 4BU1A 1L5YA 4DWWA 2QN1A 5P8WA 1E3IA 2I65A 4MJ3A 3IESA 4ZI2A 1PNRA 4CMIA 2V4MA 3ORRA 3DMTA 4ARIA 5JJLA 4QUAA 2UUOA 1S2GA 3HKBA 3LIPA 1RMYA 1U0EA 1XRMA 3OUTA 2P9YA 1HQYE 2OCLA 4GM0A 4LJ8A 2VDNB 3IELA 4DCGA 1E9BA 2KB0A 2XTJA 4XASA 2AMJA 1M75A 1Z5VA 2A86A 3NYQA 4ZEVA 2CKMA 2XZDA 4I81A 4F1WA 3ZE6A 2DC1A 4DLNA 2R47A 4QBHA 2Z8YA 5KNDD 4MIKA 4FFOA 4F3YA 3AL3A 2MSNA 3K72B 1JEDA 4EHAA 2W6JA 3CNBA 4YJGB 3OF3A 4YJGA 3SIXA 4L0DA 2D54A 3ISTA 5HJ2A 6PFKA 2Q6VA 1PV2A 3CN9A 1E5DA 2PPVA 4QOGA 2O3TA 3NATA 4OLBA