2FR3A

Crystal structure of cellular retinoic acid binding protein type ii in complex with all-trans-retinoic acid at 1.48 angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid binding protein 2
publication title The structure of Apo-wild-type cellular retinoic acid binding protein II at 1.4 A and its relationship to ligand binding and nuclear translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 36
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2fr3A00
2HMBA 2ACOA 2WQ9A 1TW4A 4ALBA 1NP1A 1QABE 3MVFA 1B56A 3EYCA 4ORSA 1GKAA 1T0VA 5JR8A 2AT6X 1MUPA 3CWKA 2N93A 1OEJA 5H9NA 1BRQA 4HPDA 5KICA 2A3FX 1MDCA 1QY2A 2ANSA 1FENA 1PEEA 1I05A 2AT5X 4IB9A 1OBUA 1IFBA 1QFTA 3DTQA 4ORXA 3P6DA 4QGVA 1BRPA 4YBPA 1B8EA 1BSOA 3G7XA 4I3BA 5EEDA 4ZHFA 4I3DA 3TF6A 4XMEA 4D6AA 2KTDA 4ORWA 1I4UA 1TVQA 1R0UA 3BDRA 1AQBA 5F58A 1KXOA 4ES7A 3WXQA 3NX2A 4CK4A 4IBAA 5F6BA 4I9RA 5IO5A 2R74A 3KFIA 2RD7C 3KQ0A 4TJZA 1T68X 5HTEA 1IKJA 1O1UA 4QGWA 1TXLA 4NNSA 1JBHA 1YP6A 1FELA 1E5PA 4IMOA 1O8VA 2NNQA 4TKHA 3BU9A 1SXUA 4OS3A 5HA0A 2OZQA 2Q4NA 2GTFX 4GNWA 1ZRYA 3K3LA 5HAEA 4YGZA 4EEJA 1ACDA 1OEEA 3EBKA 2RA6A 4N7CA 5AQ6A 2R56A 4QAEA 1DV9A 3CQRA 3TGBA 5LKFA 4ARHA 2WSJA 4OMXA 1X8PA 4ODDA 1O1VA 1B4MA 1IIUA 2AT0X 2LBAA 4YBUA 3WJCA 3BY0A 1VYGA 4NYRA 3S26A 2JU7A 4N7DA 2OFRX 4A1HA 4GE1A 1BSQA 1SY3A 1QY1A 2FR3A 2FS6A 1D3SA 2G78A 2NP1A 2EU7X 2LKKA 2Q2MA 2MJIA 3P6CA 2CZTA 5LJEA 3CQNA 1UZ2X 3FW4A 5H9KA 2E4JA 4M6SA 1OPAA 1Z24A 1DZPA 2NNDA 3HWGA 4NYQA 1OEKA 1ZNEA 5LJBA 4AZQA 2W2BA 5EDCA 4IB7A 1JJJA 1KZXA 1MX7A 2JN3A 1LPJA 1NGLA 2HYSA 3EM0A 3CR6A 4UU3A 2CM4A 2WQAE 5HZQA 3WJBA 3HWEA 1S44A 5HBSA 3WBGA 1CBIA 4RUNA 3SAOA 5LJHA 1FDQA 2LFOA 3FR4A 1CRBA 1KT5A 5HA1A 4HPCA 1X71A 1CBSA 1LNMA 3VG7A 2OVAA 1PBOA 4ORRA 1T8VA 1S7DA 2FLJA 3WJGA 4ZCBA 5HTDA 2K23A 3C76X 2L68A 1S2PA 2WUTA 4OS0A 2BLGA 1X8UA 1SA8A 1TOWA 2Q39A 1XCAA 4AZPA 3EBWA 1LF7A 1YIVA 4AZRA 1X8QA 5LJKA 1H91A 1LIEA 1MVGA 2IFBA 1EQDA 4QZTA 3APUA 2CBRA 3B2LA 3FEPA 1X8NA 5D47A 2QO4A 3CBCA 2ASNX 4EFGA 1ICMA 1E06A 1JYJA 2G7BA 4ZH6A 1GGLA 1ZNGA 2WEXA 1SY2A 3KFHA 4O9SA 4PSQA 3VG5A 4ZHHA 5FENA 4MVIA 2QO6A 4TKBA 5F7GA 4A1YA 2FR2A 1ML7A 1RLBE 1G85A 3ELZA 1FTPA 1HBQA 5K06A 1DZMA 1YWBA 4TKJA 1IW2A 3WVMA 1EUOA 2W2FA 1HN2A 3WJFA 2RCQA 1LFOA 3P6EA 5IO6A 3U0DA 1DZKA 1EPBA 4ZHCA 3FA8A 4R0BA 3UEWA 3VG2A 5F6ZA 1LICA 4NLJA 2XSTA 5BVSA 4YKOA 3ZQ3A 2ACPX 4LKTA 4YCEA 2ALLX 3L4RA 1CBQA 1B0OA 2A2GA 2OVEA 1SXWA 1L6MA 3KFGA 1I04A 4WFVA 2GJ5A 4RUUA 1ZNKA 4WFUA 1CJ5A 5FFHA 2G79A 3FIQA 3FW5A 3VG3A 3ZUOA 1E02A 5D8JA 1GT5A 4NP1A 1EIIA 3BX8A 1KQWA 3FLLA 1SY1A 2CM9A 4UU2A 4ORYA 1I06A 1IFCA 3CBSA 4TLJA 1RBPA 3NP1A 4AZNA 2Q9SA 3FA6A 3FEKA 3NQ9A 3B2IA 1CBRA 4GH7A 5HCCC 3FELA 3STMX 4GKCA 3FR5A 2HZQA 4IMNA 4YMYA 1VYFA 5BVTA 5H8TA 4ZFXA 1BWYA 3BRNA 5LJGA 2K62A 3I0AA 4ORUA 1BEBA 3B2HA 3FA9A 3WJEA 3ELXA 4YDAA 1SY0A 1OPBA 4HFOA 3B2KA 4ALOA 3RSWA 1HMRA 3P6HA 1YWCA 1KZWA 3ZUIA 1G7NA 3FR2A 4QYNA 2A0AA 2MM3A 3QKGA 1GT1A 1HBPA 3VG6A 5L8IA 2JU8A 5LJDA 1ZNLA 1A18A 1BLRA 1AVGI 3EMMA 5B27A 1TOUA 2POAA 2DM5A 3NADA 3DSZA 3P6GA 3UEVA 3APVA 3D96A 5CE4A 1LIBA 3BSZE 3UEUA 5H9AA 3PEDA 4QYPA 5L8OA 1IKEA 4YKMA 2AT3X 4MVLA 2QOSC 3MBTA 1JZUA 1YUPA 1ZNHA 3KZAA 4HPBA 2AH7X 1GT3A 3C77X 5HCEC 2AT8X 4YFQA 2CZUA 4AYHA 1LIDA 1KQXA 3D97A 4BOEA 5HZ6A 1EW3A 2NNEA 4LKPA 1D2UA 4LZUA 1A3YA 1HMTA 1GM6A 1U17A 2L9CA 2YG2A 5DPQA 4A8ZA 4XMFA 4AZOA 4YH0A 2F73A 3NX1A 2HNXA 5BVQA 5HZ8A 1XKIA 4IB8A 3TGAA 4BQUA 1GT4A 1GKAB 5EEEA 1QQSA 2R73A 4XMHA 4D6BA 3VG4A 1OBQA 3PECA 4XMGA 4I3CA 2OFMX 1JJXA 3U9PC 1U18A 2GC9A 1YWAA 2A2UA 3TGCA 2HLVA 3F9DA 3BU1A 1DC9A 1ADLA 4GNYA 5L8NA 1GX8A 1N0SA 3STNA 1P6PA 1EIOA 3GAQA 4DQ4A 2FTBA 4AW8A 3BS2A 5D48A 5IO7A 1DF3A 1BSYA 2LB6A 4IB6A 1FE3A 3CMPA 1A2DA 2FT9A 3FENA 4YCHA 2A13A 5B29A 2PY1A 3BX7A 3PH6A 4XMCA 4OS8A 4YFPA 1AB0A 2CBSA 5LJCA 2QO5A 1PMPA 3PP6A 5FAZA 1X89A 1KT4A 3TZSA 3P6FA 5C0NA 4YGHA 4TQ2A 1EXSA 5DG4A 4ZJ0A 3NQ3A 5D45A 3AKNA 1KT7A 2JU3A 3APWA 3PH5A 5F1EA 5LKEA 4QZUA 1GX9A 3O2YA 3O22A 1ICNA 4K19A 4Y0RA 2QM9A 5D4AA 4IAWA 3AKMA 1QFVA 1MX8A 4Y0PA 3HK1A 1QG5A 5EDBA 5EPQA 4AZMA 1DZJA 3PPTA 1PM1X 4XMDA 3RZYA 1X8OA 2W2AA 5KHPA 4OMWA 2P8GA 2RCTA 2WEWA 3B2JA 1DFVA 4M7MA 1QY0A 3IFBA 2RQ0A 3NR3A 4NLIA 3UEXA 1SXYA 3WJDA 1E00A 2AKQA 1G5WA 2X46A 4GRJA 2FWVA 2L5PA 1ZNDA 1ERXA 1KT3A 2KT4B 4ZH9A 1YP7A 3BLGA 4HPAA 3STKA 4KIIA 1KT6A 3O19A 1HQPA 1UREA 1NP4A 4ZHDA 4EDEA 2XKLA 1LKEA 3APXA 1KGLA 2FRSA 1JYDA 4TNNA 4ZGUA 5HZ9A 3C78X 3KFFA 4I9SA 3FA7A 1EPAA 1KOIA 4BVMA 4GETA 3U03A 4ZR2A 4ZHGA 1QWDA 4YFRA 5EZ2A 2HZRA 5HWZA 1SXXA 5HZ5A 3NPOA 1ALBA 1BJ7A 4EXZA 1YWDA 1JV4A 4YDBA 1AELA 4LZVA 3IA8A 1BBPA 4QGXA 3F8AA 2AL0X 4DQ3A 1G74A 3T1DA 5KIDA 1GXAA 2WWPA 1BM5A 2AMMX 2Q2PA 1EALA 4A60A 3FMZA 5HCDC 3I17A 1A57A 3Q6LA 2FS7A 4IAXA 3JS1A 3D95A 1ERBA 3HWDA 1OBPA 4MVKA 1U0XA 2JOZA 2L67A 2OVDA 2WR6A 4Y0SA 2LBVA 4NNTA 5H9LA 4WBKA 1FEMA 3OJYC 4YGGA 3HWFA 4Y0QA 3JSQA 1LIFA 2MO5A 2X45A 1VPRA 2O62A 1HMSA
chains in the Genus database with same CATH superfamily
2HMBA 2ACOA 2WQ9A 1TW4A 4ALBA 1NP1A 1QABE 3MVFA 1B56A 1PBYA 2OL8O 1LCWA 3EYCA 4MEEA 4ORSA 1GKAA 1T0VA 5JR8A 2AT6X 2IZJA 2KD2A 1SRGA 3SLTA 1N9MA 1MUPA 4BBOA 2MWHA 2BC3A 1RSTB 3ZW2A 3CWKA 2N93A 3FDCA 1OEJA 5H9NA 1BRQA 4HPDA 2Y3EA 4O4OA 4OKAA 2A3FX 1MDCA 1QY2A 2ANSA 3KVNA 4QRLA 1FENA 5KICA 1PEEA 1I05A 2AT5X 4IB9A 1OBUA 1IFBA 2MF6A 1SRFA 2X55A 1QFTA 3DTQA 4ORXA 3P6DA 4QGVA 1BRPA 4YBPA 1SWQA 1IJ8A 1B8EA 1SLFB 1LELA 3X00A 1BSOA 1SRJA 2BT9A 3LV4A 1VWBB 3G7XA 4I3BA 5EEDA 4BX7A 4ZHFA 4EQAC 4I3DA 3TF6A 1HY2A 4XMEA 4D6AA 1JIWI 2FKGA 2JGSA 2KTDA 4ORWA 2DJFA 3T2WA 5CHKA 1I4UA 1TVQA 3RDUA 1SWSA 1Y55X 2CAMA 3T6LA 1R0UA 3BDRA 3N91A 1AQBA 5F58A 1KXOA 4ES7A 4L3RA 3WXQA 4NV7A 3WYQA 3NX2A 4ML7B 2OYBO 4CK4A 4IBAA 1SWKA 5F6BA 2FGSA 4I9RA 1AVDA 2R74A 4O3ZA 2I5VO 3KFIA 5IO5A 3SLOA 1VWMB 1HQQA 2RD7C 2Y32A 3KQ0A 4TJZA 2RTBB 2FHLA 1SWLA 1T68X 4QQ1A 4JNJA 4ZGFA 5HTEA 1IKJA 1O1UA 4O4SA 4QGWA 4CPEA 1TXLA 4BGFA 2RTMA 4JO6A 4NNSA 3RDQA 1VWQB 5AEOA 1VWEB 4OEMA 1JBHA 3HTYA 1YP6A 1RAVA 2MHDA 1FELA 1VWIB 1JJUA 1E5PA 2DJGA 4IMOA 1O8VA 2NNQA 4TKHA 2QCBA 3BU9A 1SXUA 3UAQA 4OS3A 1VWGB 3VGWA 5HA0A 3VPJE 3HPEA 2OZQA 4O3XB 5AJCA 2Q4NA 2GTFX 4GNWA 2IZEB 3RDMA 2RTJA 1ZRYA 2KW1A 3K3LA 5HAEA 2IZGB 4GZVA 4YGZA 4EEJA 1ACDA 2C1QA 2IZDB 1OEEA 3EBKA 2RA6A 4N7CA 2A8GA 3AUMO 5AQ6A 4CDCA 1SWOA 2R56A 2GTLO 4QAEA 1SLEB 5IRUA 1DV9A 4GU8A 3CQRA 3TGBA 5LKFA 4ARHA 1SWEA 2IZLB 2WSJA 1X8PA 4ODDA 1SWDA 4OMXA 2VDFA 3T6FA 5IRWA 1O1VA 1B4MA 1NQNA 1IIUA 3SZIA 2AT0X 2LBAA 2X56A 3D4RA 4YBUA 3WJCA 2FKJA 3BY0A 1VYGA 4NYRA 4GGZA 3S26A 2JU7A 4N7DA 3F6ZB 4B55A 2OFRX 2QOMA 4A1HA 4GE1A 1BSQA 1SY3A 1QY1A 4FBVA 3RKGA 4U8UN 2FR3A 2FS6A 1D3SA 2G78A 2JW1A 1KL4A 2NP1A 2EU7X 2LKKA 2Q2MA 2RTEB 2MJIA 3P6CA 1VWKB 2CZTA 4CPIA 5LJEA 3CQNA 1UZ2X 3FW4A 5H9KA 2E4JA 4M6SA 1Y9LA 2RTLA 1OPAA 1Z24A 1DZPA 2NNDA 3HWGA 4NYQA 3ZW1A 4Z27A 2OY8A 1OEKA 5K68A 1ZNEA 5LJBA 3T2XA 4AZQA 2W2BA 5EDCA 4IB7A 1JJJA 1KZXA 1MX7A 2JN3A 1LPJA 1NGLA 2HYSA 3EC5A 3CR6A 3EM0A 4JHQA 2CM4A 4UU3A 1VWLB 2WQAE 5HZQA 3WJBA 3HWEA 3ZWEA 1PTSA 1S44A 2OY1O 5HBSA 4CPHA 3WBGA 2OFAA 3ZW0B 2BS5A 2RTFB 1CBIA 2WPUA 4RUNA 3SAOA 2RTQB 5LJHA 1FDQA 2LFOA 1VWHB 1CRBA 2M4LA 1KT5A 3FR4A 3PDFA 5HA1A 5B5FA 4HPCA 1X71A 3PQSA 1CBSA 1LNMA 4BJ8A 3WZPA 1KL5A 3VG7A 2OVAA 2X8FA 3MG5A 4EKVA 1PBOA 2G8CO 4ORRA 1T8VA 4COTA 2OF8A 1S7DA 2FLJA 3WJGA 4ZCBA 5HTDA 3QQ2A 5FQ8E 2K23A 3C76X 2L68A 1S2PA 2WUTA 4OS0A 2BLGA 3OD9A 1X8UA 4PJ2A 1SA8A 1TOWA 2RTHB 2Q39A 1XCAA 4AZPA 1KL3A 3EBWA 1LF7A 1YIVA 4AZRA 1X8QA 5LJKA 1H91A 1LIEA 1MVGA 2IFBA 1EQDA 1N4JA 4O4UA 4QZTA 1STSB 5F2BA 3LHNA 5L3YA 3APUA 2CBRA 3B2LA 3FEPA 1HXLA 1X8NA 5D47A 1SWGA 2QO4A 3EW1A 3CBCA 3GE2A 1SWUA 2ASNX 2RTAA 1SRIA 4EFGA 1ICMA 1E06A 2AVIA 1JYJA 2G7BA 4ZH6A 1GGLA 1ZNGA 2RTRB 4CPFA 2WEXA 3MM0A 1SY2A 3CKFA 1SRHA 3KFHA 4O9SA 4PSQA 3VG5A 4ZHHA 5FENA 1MEPA 4ID2A 4MVIA 2QO6A 4TKBA 5F7GA 4A1YA 2FR2A 4ON1A 5B5GA 1ML7A 1RLBE 1G85A 3ELZA 1FTPA 1HBQA 1I9HA 3H3IA 1DZMA 1YWBA 3SOTA 4TKJA 4Y5DA 1IW2A 3WVMA 3OE3A 1EUOA 1GX3A 1HN2A 2W2FA 2C1SA 2RCQA 3WJFA 4MISA 1LFOA 1VWDB 3P6EA 5IO6A 1KFFA 3U0DA 1DZKA 1EPBA 2VFBA 3FA8A 4KC8A 4R0BA 4Y59A 3UEWA 3V8UA 3VG2A 5F6ZA 1LICA 4NLJA 2XSTA 5BVSA 4BX6A 4GGTA 4YKOA 4KC7A 2ACPX 4LKTA 1VWJB 2ALLX 3L4RA 4U46A 4YCEA 1CBQA 1B0OA 2A2GA 2A5CA 2OF9A 5AJBA 2OVEA 2X32A 4KT5A 1SXWA 1L6MA 3KFGA 1I04A 4WFVA 2GJ5A 4RUUA 3NBXX 3SZHA 1K24A 4ZHCA 1ZNKA 4WFUA 1CJ5A 5FFHA 2G79A 3FIQA 3FW5A 1DF8A 3RDXA 3VG3A 3ZUOA 1E02A 4MVEA 5D8JA 1GT5A 4NP1A 1EIIA 3BX8A 4I6SA 2GTLM 1KQWA 3FLLA 1RSUB 1SY1A 2CM9A 2X4MA 4UU2A 3ZQ3A 1UYOX 1LDOA 2HKDA 4ORYA 1I06A 1IFCA 1SMPI 1VWNB 3CBSA 4TLJA 1RBPA 2IZIA 3NP1A 4AZNA 4GDZA 2Q9SA 3FA6A 3FEKA 3HOEA 3LTWA 2I5ZO 2IZHB 3NQ9A 3B2IA 1CBRA 4GH7A 5HCCC 3FELA 3STMX 4GKCA 3FR5A 2HZQA 4IMNA 2X8SA 4YMYA 1VYFA 4O3WA 4I95A 5BVTA 5H8TA 4ZFXA 1E2TA 1BWYA 1MM9A 3BRNA 5LJGA 1RXHA 2K62A 1WBIA 3I0AA 1FJ1E 4ORUA 1BEBA 1SWPA 3B2HA 3FA9A 3WJEA 3P24A 3ELXA 2RTPB 4YDAA 1SY0A 1OPBA 4HFOA 3B2KA 4GK9A 1SWNA 3RSWA 1HMRA 3P6HA 4U9CA 4ALOA 1YWCA 1KZWA 2IZAA 3ZUIA 1G7NA 3MX7A 3FR2A 4QYNA 2A0AA 2MM3A 3AEHA 3QKGA 1GT1A 2BSZA 3ZI8A 2IZBA 1HBPA 3VG6A 5L8IA 2JU8A 5JD2A 1N9YA 1ZNLA 4FBOA 5B2AO 5LJDA 3WZNA 1A18A 5B10O 1AVGI 1LCZA 3EMMA 1BLRA 3SZJA 5B27A 1TOUA 2POAA 2DM5A 3NADA 4GUZA 2OFBA 3DSZA 4MIRA 3RDOA 3P6GA 3UEVA 3APVA 3D96A 5CE4A 1EALA 1LIBA 3BSZE 1Y0GA 3UEUA 5H9AA 2Z4IA 1JMZA 3PEDA 4QYPA 5IRAA 3VHIA 2UYWA 1IKEA 4YKMA 4BX5A 2AT3X 5L8OA 4MVLA 2QOSC 4HWMA 3MBTA 2KTSA 1SWBA 1JZUA 1YUPA 1ZNHA 3OBLA 3KZAA 4HPBA 2G5LA 3PQUA 2Y3FA 2AH7X 1EI5A 1GT3A 2X8TA 3C77X 1MK5A 5HCEC 4INNA 2AT8X 4YFQA 2CZUA 4AYHA 1LIDA 1KQXA 1SWJA 4O4XA 3D97A 4BOEA 1VWFB 5HZ6A 4Z2VA 1EW3A 4O3YA 2NNEA 4LKPA 1D2UA 2YMSA 4LZUA 1A3YA 2UZ2A 3ZW0A 1HMTA 1MOYA 1SWRA 5B3MO 1GM6A 1U17A 2L9CA 2YG2A 5DPQA 5FQ6E 4XMFA 3S5VA 4A8ZA 4AZOA 2F09A 4YH0A 2F73A 1N7YA 3NX1A 2HNXA 5BVQA 5HZ8A 1XKIA 2Z4HA 1Y52X 2C4IA 4IB8A 3VE1A 3TGAA 4BQUA 1GT4A 1GKAB 1K3BA 1QQSA 1VWAB 2BS6A 4LQZA 5EEEA 2R73A 4XMHA 4Z2PA 4D6BA 3VG4A 2FHNX 1OBQA 3PECA 4XMGA 2F01A 4I3CA 2OFMX 4U8UO 1JJXA 3U9PC 1U18A 2GC9A 1YWAA 2A2UA 3TGCA 2HLVA 3F9DA 4GGRA 3BU1A 1DC9A 1ADLA 4DNEA 3WOVA 3D9WA 4C5PA 4GD9A 3RWXA 4GNYA 3FIDA 5L8NA 1GX8A 1N0SA 3STNA 2PI3O 1P6PA 5FQ7E 3GAQA 1EIOA 4DQ4A 2FTBA 4Z6JA 2A5BA 4AW8A 3BS2A 2RTIB 5D48A 3E3CA 5IO7A 4OELA 1DF3A 1BSYA 2LB6A 4IB6A 1FE3A 1SWCA 3CKGA 3CMPA 3S60A 1A2DA 2FT9A 3VHMA 3EW2A 3FENA 4YCHA 2A13A 5B29A 4GDAA 4BX7B 2IZCB 2PY1A 1STPA 3BX7A 3PH6A 3RBYA 4XMCA 4OS8A 4YFPA 4I60A 4FGIB 1AB0A 3PK2A 1VWRB 2CBSA 5LJCA 2QO5A 1PMPA 1VYOA 3PP6A 5FAZA 1SWFA 1X89A 3RY1A 1KT4A 4CDEA 3TZSA 4KCAA 3P6FA 5C0NA 2GTLN 2LA7A 4YGHA 4TQ2A 1EXSA 3SLJA 5DG4A 1VWOB 4DCBA 4Z2OA 4ZJ0A 3NQ3A 2RTDB 3AKNA 1KT7A 2JU3A 3APWA 1Y9TA 3PH5A 2IZKA 1SWHA 5D45A 5F1EA 5LKEA 4QZUA 1GX9A 3O2YA 1W4TA 1ICNA 3O22A 4K19A 4Y0RA 2QM9A 2AF5A 2RN4A 5D4AA 4IAWA 4BX6B 1NQMA 1LDQA 3AKMA 1QFVA 1MX8A 3WYPA 4Y0PA 3HK1A 1QG5A 4FBRA 3RY2A 5EDBA 4BCSA 5EPQA 4AZMA 1DZJA 3PPTA 5B11O 1PM1X 4XMDA 3RZYA 1X8OA 2W2AA 2ZAIA 4OMWA 5KHPA 2P8GA 2RCTA 2WEWA 3B2JA 1DFVA 2ZSCA 4M7MA 1QY0A 2JMBA 3IFBA 2RQ0A 3NR3A 4NV8A 1N43A 4NLIA 1W5RA 3UEXA 4CV7A 4CSBA 1SXYA 3WJDA 3VHHA 1E00A 2AKQA 5K06A 1G5WA 2X46A 2ZAGA 4GRJA 2FWVA 1JQPA 2L5PA 4WHIA 5CYBA 2OY5O 1VWCB 1ZNDA 5K67A 1ERXA 1KT3A 2GH7A 2KT4B 4ZH9A 1YP7A 3BLGA 4HPAA 3STKA 4KIIA 4YVBA 1SWAA 2RTKA 2OL7A 4GJSA 1KT6A 1NBXA 3O19A 1HQPA 1SLGB 1LUQA 1NP4A 1UREA 2RTCB 3S5XA 4EDEA 2XKLA 1LKEA 3VU1A 4ZHDA 3FYFA 4L1NA 3APXA 1HXZA 4CDDA 1KGLA 2FRSA 1W6FA 1JYDA 4TNNA 4ZGUA 5HZ9A 3C78X 1LCVA 3KFFA 4I9SA 3FA7A 1RXJA 1EPAA 1KOIA 4Z28A 4BVMA 4GETA 2IZFB 4QNIA 4U3QA 4CDFA 5CSEA 4IABA 4ZR2A 4ZHGA 3U03A 1QWDA 4YFRA 5EZ2A 2HZRA 5HWZA 1SXXA 1AVEA 5HZ5A 3NPOA 2RTOB 1ALBA 1BJ7A 2OL6O 1STRB 2RTNB 3VE2A 1YWDA 1JV4A 4YDBA 4EXZA 1I78A 2X34A 4LZVA 1AELA 3IA8A 1BBPA 2BHVA 3F8AA 4QGXA 3ZW1B 2AL0X 4DQ3A 1G74A 3HOLA 3T1DA 3WZOA 5KIDA 1VWPB 1GXAA 1NDJA 2RTGB 1SWTA 1JMXA 4KH8A 2WWPA 4BX5B 1BM5A 1NC9A 2AMMX 2Q2PA 2QMIA 3P02A 4GJVA 4O49A 3FMZA 3RE5A 3WZQA 4A60A 5HCDC 3I17A 4CPHB 3JQOA 1A57A 3Q6LA 4FQBB 2FS7A 1SLDB 3NQKA 4IAXA 3JS1A 3D95A 1ERBA 3HWDA 4NW4A 1OBPA 1Y53X 5IXGA 5BYPA 4MVKA 1U0XA 4IRWA 1SREA 2JOZA 2L67A 2OVDA 2VFCA 2WR6A 4U8UM 4Y0SA 4NNTA 5H9LA 2LBVA 4JGLA 4WBKA 1OSPO 3Q34A 1FEMA 3OJYC 4YGGA 3HWFA 1UYNX 4Y0QA 2OY7A 2OVSA 3RE6A 3JSQA 1LIFA 1RXKA 2MO5A 2X45A 3ZZVA 1WUBA 1VPRA 2O62A 3RDSA 1HMSA
chains in the Genus database with same CATH topology
2HMBA 2ACOA 2WQ9A 1TW4A 4ALBA 1NP1A 1QABE 3MVFA 1B56A 3EYCA 4ORSA 1GKAA 1T0VA 5JR8A 2AT6X 2KD2A 1MUPA 2MWHA 3ZW2A 3CWKA 2N93A 1OEJA 5H9NA 1BRQA 4HPDA 4QRLA 4O4OA 3VPJE 2A3FX 1MDCA 1QY2A 2ANSA 5KICA 1FENA 1PEEA 1I05A 2AT5X 4IB9A 1OBUA 1IFBA 1QFTA 3DTQA 4ORXA 3P6DA 4QGVA 1BRPA 4YBPA 1B8EA 1BSOA 2BT9A 3LV4A 3G7XA 4I3BA 5EEDA 4ZHFA 4EQAC 4I3DA 3TF6A 4XMEA 4D6AA 1JIWI 2KTDA 4ORWA 1I4UA 1TVQA 1R0UA 3BDRA 3N91A 1AQBA 5F58A 1KXOA 4ES7A 4L3RA 3WXQA 3NX2A 4ML7B 4CK4A 4IBAA 5F6BA 4I9RA 4O3ZA 2R74A 5IO5A 3KFIA 2RD7C 3KQ0A 4TJZA 1T68X 4QQ1A 4ZGFA 5HTEA 1IKJA 1O1UA 4O4SA 4QGWA 1TXLA 4NNSA 5AEOA 1JBHA 3HTYA 1YP6A 2MHDA 1FELA 1E5PA 4IMOA 1O8VA 2NNQA 4TKHA 3BU9A 3UAQA 1SXUA 4OS3A 5HA0A 2OZQA 4O3XB 5AJCA 2Q4NA 2GTFX 4GNWA 1ZRYA 2KW1A 3K3LA 5HAEA 4GZVA 4YGZA 4EEJA 1ACDA 1OEEA 3EBKA 2RA6A 4N7CA 5AQ6A 2R56A 2GTLO 4QAEA 1DV9A 4GU8A 3CQRA 3TGBA 5LKFA 4ARHA 2WSJA 4OMXA 1X8PA 4ODDA 1O1VA 1B4MA 1IIUA 2AT0X 2LBAA 3D4RA 4YBUA 3WJCA 3BY0A 1VYGA 4NYRA 3S26A 2JU7A 4N7DA 3F6ZB 2OFRX 4A1HA 4GE1A 1BSQA 1SY3A 1QY1A 4FBVA 3RKGA 4U8UN 2FR3A 2FS6A 1D3SA 2G78A 2JW1A 2NP1A 2EU7X 2LKKA 2Q2MA 2MJIA 3P6CA 2CZTA 5LJEA 3CQNA 1UZ2X 3FW4A 5H9KA 2E4JA 4M6SA 1Y9LA 1OPAA 1Z24A 1DZPA 2NNDA 3HWGA 4NYQA 3ZW1A 1OEKA 1ZNEA 5LJBA 4AZQA 2W2BA 5EDCA 4IB7A 1JJJA 1KZXA 1MX7A 2JN3A 1LPJA 1NGLA 2HYSA 3EM0A 3CR6A 4UU3A 2CM4A 2WQAE 5HZQA 3WJBA 3ZWEA 3HWEA 1S44A 5HBSA 3WBGA 3ZW0B 2BS5A 1CBIA 4RUNA 3SAOA 5LJHA 1FDQA 2LFOA 2M4LA 1CRBA 3FR4A 1KT5A 5HA1A 4HPCA 1X71A 3PQSA 1CBSA 1LNMA 3VG7A 2OVAA 2X8FA 1PBOA 4ORRA 1T8VA 4COTA 1S7DA 2FLJA 3WJGA 4ZCBA 5HTDA 5FQ8E 2K23A 3C76X 2L68A 1S2PA 2WUTA 4OS0A 2BLGA 3OD9A 1X8UA 4PJ2A 1SA8A 1TOWA 2Q39A 1XCAA 4AZPA 3EBWA 1LF7A 1YIVA 4AZRA 1X8QA 5LJKA 1H91A 1LIEA 1MVGA 2IFBA 1EQDA 4O4UA 4QZTA 3LHNA 3APUA 2CBRA 3B2LA 3FEPA 1X8NA 5D47A 2QO4A 3CBCA 3GE2A 2ASNX 4EFGA 1ICMA 1E06A 1JYJA 2G7BA 4ZH6A 1GGLA 1ZNGA 2WEXA 1SY2A 3KFHA 4O9SA 4PSQA 3VG5A 4ZHHA 5FENA 4ID2A 4MVIA 2QO6A 4TKBA 5F7GA 4A1YA 2FR2A 4ON1A 1ML7A 1RLBE 1G85A 3ELZA 1FTPA 1HBQA 3H3IA 3SOTA 1DZMA 1YWBA 5K06A 4TKJA 1IW2A 3WVMA 3OE3A 1EUOA 2W2FA 1HN2A 3WJFA 2RCQA 4MISA 1LFOA 3P6EA 5IO6A 3U0DA 1DZKA 1EPBA 4KC8A 3FA8A 4R0BA 3UEWA 3V8UA 3VG2A 4ZHCA 5F6ZA 1LICA 4NLJA 2XSTA 5BVSA 4YKOA 4KC7A 2ACPX 4LKTA 4YCEA 2ALLX 3L4RA 5AJBA 3ZQ3A 1CBQA 1B0OA 2A2GA 2OVEA 4KT5A 1SXWA 1L6MA 3KFGA 1I04A 4WFVA 2GJ5A 4RUUA 3NBXX 1ZNKA 4WFUA 1CJ5A 5FFHA 2G79A 3FIQA 3FW5A 3VG3A 3ZUOA 1E02A 4MVEA 5D8JA 1GT5A 4NP1A 1EIIA 3BX8A 4I6SA 2GTLM 1KQWA 3FLLA 1SY1A 2CM9A 4UU2A 4ORYA 1I06A 1IFCA 1SMPI 3CBSA 4TLJA 1RBPA 3NP1A 4AZNA 4GDZA 2Q9SA 3FA6A 3FEKA 3HOEA 3NQ9A 3B2IA 1CBRA 4GH7A 5HCCC 3FELA 3STMX 4GKCA 3FR5A 2HZQA 4IMNA 2X8SA 4YMYA 1VYFA 4O3WA 4I95A 5BVTA 5H8TA 4ZFXA 1BWYA 3BRNA 5LJGA 2K62A 3I0AA 4ORUA 1BEBA 3B2HA 3FA9A 3WJEA 3P24A 3ELXA 4YDAA 1SY0A 1OPBA 4HFOA 3B2KA 4GK9A 4ALOA 3RSWA 1HMRA 3P6HA 4U9CA 1YWCA 1KZWA 3ZUIA 1G7NA 3MX7A 3FR2A 4QYNA 2A0AA 2MM3A 3QKGA 1GT1A 3ZI8A 1HBPA 3VG6A 5L8IA 2JU8A 5LJDA 1ZNLA 4FBOA 1A18A 1BLRA 1AVGI 3EMMA 5B27A 1TOUA 2POAA 2DM5A 3NADA 3DSZA 4MIRA 3P6GA 3UEVA 3APVA 3D96A 5CE4A 1LIBA 3BSZE 3UEUA 5H9AA 2Z4IA 3PEDA 4QYPA 5L8OA 1IKEA 4YKMA 2AT3X 4MVLA 2QOSC 4HWMA 3MBTA 2KTSA 1JZUA 1YUPA 1ZNHA 3OBLA 3KZAA 4HPBA 3PQUA 2AH7X 1EI5A 1GT3A 2X8TA 3C77X 5HCEC 4INNA 2AT8X 4YFQA 2CZUA 4AYHA 1LIDA 1KQXA 4O4XA 3D97A 4BOEA 5HZ6A 1EW3A 4O3YA 2NNEA 4LKPA 1D2UA 2YMSA 4LZUA 1A3YA 3ZW0A 1HMTA 1GM6A 1U17A 2L9CA 2YG2A 5DPQA 5FQ6E 4XMFA 3S5VA 4A8ZA 4AZOA 2F09A 4YH0A 2F73A 3NX1A 2HNXA 5BVQA 5HZ8A 1XKIA 2Z4HA 3VE1A 4IB8A 3TGAA 4BQUA 1GT4A 1GKAB 5EEEA 1QQSA 2BS6A 4LQZA 2R73A 4XMHA 4D6BA 3VG4A 1OBQA 3PECA 4XMGA 4I3CA 2OFMX 4U8UO 1JJXA 3U9PC 1U18A 2GC9A 1YWAA 2A2UA 3TGCA 2HLVA 3F9DA 3BU1A 1DC9A 1ADLA 3WOVA 3RWXA 4GNYA 5L8NA 1GX8A 1N0SA 3STNA 1P6PA 5FQ7E 3GAQA 1EIOA 4DQ4A 2FTBA 4AW8A 3BS2A 5D48A 3E3CA 5IO7A 1DF3A 1BSYA 2LB6A 4IB6A 1FE3A 3CMPA 3S60A 1A2DA 2FT9A 3FENA 4YCHA 2A13A 5B29A 2PY1A 3BX7A 3PH6A 3RBYA 4XMCA 4OS8A 4YFPA 4FGIB 1AB0A 2CBSA 5LJCA 2QO5A 1PMPA 3PP6A 5FAZA 1X89A 1KT4A 3TZSA 4KCAA 3P6FA 5C0NA 2GTLN 2LA7A 4YGHA 4TQ2A 1EXSA 5DG4A 4ZJ0A 3NQ3A 5D45A 3AKNA 1KT7A 2JU3A 3APWA 1Y9TA 3PH5A 5F1EA 5LKEA 4QZUA 1GX9A 3O2YA 3O22A 1ICNA 4K19A 4Y0RA 2QM9A 2RN4A 5D4AA 4IAWA 3AKMA 1QFVA 1MX8A 4Y0PA 3HK1A 1QG5A 4FBRA 5EDBA 5EPQA 4AZMA 1DZJA 3PPTA 1PM1X 4XMDA 3RZYA 1X8OA 2W2AA 2ZAIA 4OMWA 5KHPA 2P8GA 2RCTA 2WEWA 3B2JA 1DFVA 4M7MA 1QY0A 2JMBA 3IFBA 2RQ0A 3NR3A 4CV7A 4NLIA 3UEXA 4CSBA 1SXYA 3WJDA 1E00A 2AKQA 1G5WA 2X46A 2ZAGA 4GRJA 2FWVA 2L5PA 4WHIA 5CYBA 1ZNDA 1ERXA 1KT3A 2KT4B 4ZH9A 1YP7A 3BLGA 4HPAA 3STKA 4KIIA 1KT6A 3O19A 1HQPA 1UREA 1NP4A 3S5XA 4ZHDA 4EDEA 2XKLA 1LKEA 3VU1A 3FYFA 4L1NA 3APXA 1KGLA 2FRSA 1JYDA 4TNNA 4ZGUA 5HZ9A 3C78X 3KFFA 4I9SA 3FA7A 1EPAA 1KOIA 4BVMA 4GETA 4QNIA 4U3QA 3U03A 4IABA 4ZR2A 4ZHGA 1QWDA 4YFRA 5EZ2A 2HZRA 5HWZA 1SXXA 5HZ5A 3NPOA 1ALBA 1BJ7A 3VE2A 4EXZA 1YWDA 1JV4A 4YDBA 1AELA 4LZVA 3IA8A 1BBPA 2BHVA 3F8AA 4QGXA 3ZW1B 2AL0X 4DQ3A 1G74A 3HOLA 3T1DA 5KIDA 1GXAA 4KH8A 2WWPA 1BM5A 2AMMX 2Q2PA 2QMIA 3P02A 4A60A 4O49A 3FMZA 1EALA 5HCDC 3I17A 3JQOA 1A57A 3Q6LA 4FQBB 2FS7A 3NQKA 4IAXA 3JS1A 3D95A 1ERBA 3HWDA 4NW4A 1OBPA 5BYPA 4MVKA 1U0XA 2JOZA 2L67A 2OVDA 2WR6A 4U8UM 4Y0SA 2LBVA 4NNTA 5H9LA 4JGLA 4WBKA 1FEMA 3OJYC 4YGGA 3HWFA 4Y0QA 2OVSA 3JSQA 1LIFA 2MO5A 2X45A 3ZZVA 1VPRA 2O62A 1HMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMB A;  2ACO A;  2WQ9 A;  1TW4 A;  4ALB A;  1NP1 A;  1QAB E;  3MVF A;  1B56 A;  3EYC A;  4ORS A;  1GKA A;  1T0V A;  5JR8 A;  2AT6 X;  1MUP A;  3CWK A;  2N93 A;  1OEJ A;  5H9N A;  1BRQ A;  4HPD A;  5KIC A;  2A3F X;  1MDC A;  1QY2 A;  2ANS A;  1FEN A;  1PEE A;  1I05 A;  2AT5 X;  4IB9 A;  1OBU A;  1IFB A;  1QFT A;  3DTQ A;  4ORX A;  3P6D A;  4QGV A;  1BRP A;  4YBP A;  1B8E A;  1BSO A;  3G7X A;  4I3B A;  5EED A;  4ZHF A;  4I3D A;  3TF6 A;  4XME A;  4D6A A;  2KTD A;  4ORW A;  1I4U A;  1TVQ A;  1R0U A;  3BDR A;  1AQB A;  5F58 A;  1KXO A;  4ES7 A;  3WXQ A;  3NX2 A;  4CK4 A;  4IBA A;  5F6B A;  4I9R A;  5IO5 A;  2R74 A;  3KFI A;  2RD7 C;  3KQ0 A;  4TJZ A;  1T68 X;  5HTE A;  1IKJ A;  1O1U A;  4QGW A;  1TXL A;  4NNS A;  1JBH A;  1YP6 A;  1FEL A;  1E5P A;  4IMO A;  1O8V A;  2NNQ A;  4TKH A;  3BU9 A;  1SXU A;  4OS3 A;  5HA0 A;  2OZQ A;  2Q4N A;  2GTF X;  4GNW A;  1ZRY A;  3K3L A;  5HAE A;  4YGZ A;  4EEJ A;  1ACD A;  1OEE A;  3EBK A;  2RA6 A;  4N7C A;  5AQ6 A;  2R56 A;  4QAE A;  1DV9 A;  3CQR A;  3TGB A;  5LKF A;  4ARH A;  2WSJ A;  4OMX A;  1X8P A;  4ODD A;  1O1V A;  1B4M A;  1IIU A;  2AT0 X;  2LBA A;  4YBU A;  3WJC A;  3BY0 A;  1VYG A;  4NYR A;  3S26 A;  2JU7 A;  4N7D A;  2OFR X;  4A1H A;  4GE1 A;  1BSQ A;  1SY3 A;  1QY1 A;  2FR3 A;  2FS6 A;  1D3S A;  2G78 A;  2NP1 A;  2EU7 X;  2LKK A;  2Q2M A;  2MJI A;  3P6C A;  2CZT A;  5LJE A;  3CQN A;  1UZ2 X;  3FW4 A;  5H9K A;  2E4J A;  4M6S A;  1OPA A;  1Z24 A;  1DZP A;  2NND A;  3HWG A;  4NYQ A;  1OEK A;  1ZNE A;  5LJB A;  4AZQ A;  2W2B A;  5EDC A;  4IB7 A;  1JJJ A;  1KZX A;  1MX7 A;  2JN3 A;  1LPJ A;  1NGL A;  2HYS A;  3EM0 A;  3CR6 A;  4UU3 A;  2CM4 A;  2WQA E;  5HZQ A;  3WJB A;  3HWE A;  1S44 A;  5HBS A;  3WBG A;  1CBI A;  4RUN A;  3SAO A;  5LJH A;  1FDQ A;  2LFO A;  3FR4 A;  1CRB A;  1KT5 A;  5HA1 A;  4HPC A;  1X71 A;  1CBS A;  1LNM A;  3VG7 A;  2OVA A;  1PBO A;  4ORR A;  1T8V A;  1S7D A;  2FLJ A;  3WJG A;  4ZCB A;  5HTD A;  2K23 A;  3C76 X;  2L68 A;  1S2P A;  2WUT A;  4OS0 A;  2BLG A;  1X8U A;  1SA8 A;  1TOW A;  2Q39 A;  1XCA A;  4AZP A;  3EBW A;  1LF7 A;  1YIV A;  4AZR A;  1X8Q A;  5LJK A;  1H91 A;  1LIE A;  1MVG A;  2IFB A;  1EQD A;  4QZT A;  3APU A;  2CBR A;  3B2L A;  3FEP A;  1X8N A;  5D47 A;  2QO4 A;  3CBC A;  2ASN X;  4EFG A;  1ICM A;  1E06 A;  1JYJ A;  2G7B A;  4ZH6 A;  1GGL A;  1ZNG A;  2WEX A;  1SY2 A;  3KFH A;  4O9S A;  4PSQ A;  3VG5 A;  4ZHH A;  5FEN A;  4MVI A;  2QO6 A;  4TKB A;  5F7G A;  4A1Y A;  2FR2 A;  1ML7 A;  1RLB E;  1G85 A;  3ELZ A;  1FTP A;  1HBQ A;  5K06 A;  1DZM A;  1YWB A;  4TKJ A;  1IW2 A;  3WVM A;  1EUO A;  2W2F A;  1HN2 A;  3WJF A;  2RCQ A;  1LFO A;  3P6E A;  5IO6 A;  3U0D A;  1DZK A;  1EPB A;  4ZHC A;  3FA8 A;  4R0B A;  3UEW A;  3VG2 A;  5F6Z A;  1LIC A;  4NLJ A;  2XST A;  5BVS A;  4YKO A;  3ZQ3 A;  2ACP X;  4LKT A;  4YCE A;  2ALL X;  3L4R A;  1CBQ A;  1B0O A;  2A2G A;  2OVE A;  1SXW A;  1L6M A;  3KFG A;  1I04 A;  4WFV A;  2GJ5 A;  4RUU A;  1ZNK A;  4WFU A;  1CJ5 A;  5FFH A;  2G79 A;  3FIQ A;  3FW5 A;  3VG3 A;  3ZUO A;  1E02 A;  5D8J A;  1GT5 A;  4NP1 A;  1EII A;  3BX8 A;  1KQW A;  3FLL A;  1SY1 A;  2CM9 A;  4UU2 A;  4ORY A;  1I06 A;  1IFC A;  3CBS A;  4TLJ A;  1RBP A;  3NP1 A;  4AZN A;  2Q9S A;  3FA6 A;  3FEK A;  3NQ9 A;  3B2I A;  1CBR A;  4GH7 A;  5HCC C;  3FEL A;  3STM X;  4GKC A;  3FR5 A;  2HZQ A;  4IMN A;  4YMY A;  1VYF A;  5BVT A;  5H8T A;  4ZFX A;  1BWY A;  3BRN A;  5LJG A;  2K62 A;  3I0A A;  4ORU A;  1BEB A;  3B2H A;  3FA9 A;  3WJE A;  3ELX A;  4YDA A;  1SY0 A;  1OPB A;  4HFO A;  3B2K A;  4ALO A;  3RSW A;  1HMR A;  3P6H A;  1YWC A;  1KZW A;  3ZUI A;  1G7N A;  3FR2 A;  4QYN A;  2A0A A;  2MM3 A;  3QKG A;  1GT1 A;  1HBP A;  3VG6 A;  5L8I A;  2JU8 A;  5LJD A;  1ZNL A;  1A18 A;  1BLR A;  1AVG I;  3EMM A;  5B27 A;  1TOU A;  2POA A;  2DM5 A;  3NAD A;  3DSZ A;  3P6G A;  3UEV A;  3APV A;  3D96 A;  5CE4 A;  1LIB A;  3BSZ E;  3UEU A;  5H9A A;  3PED A;  4QYP A;  5L8O A;  1IKE A;  4YKM A;  2AT3 X;  4MVL A;  2QOS C;  3MBT A;  1JZU A;  1YUP A;  1ZNH A;  3KZA A;  4HPB A;  2AH7 X;  1GT3 A;  3C77 X;  5HCE C;  2AT8 X;  4YFQ A;  2CZU A;  4AYH A;  1LID A;  1KQX A;  3D97 A;  4BOE A;  5HZ6 A;  1EW3 A;  2NNE A;  4LKP A;  1D2U A;  4LZU A;  1A3Y A;  1HMT A;  1GM6 A;  1U17 A;  2L9C A;  2YG2 A;  5DPQ A;  4A8Z A;  4XMF A;  4AZO A;  4YH0 A;  2F73 A;  3NX1 A;  2HNX A;  5BVQ A;  5HZ8 A;  1XKI A;  4IB8 A;  3TGA A;  4BQU A;  1GT4 A;  1GKA B;  5EEE A;  1QQS A;  2R73 A;  4XMH A;  4D6B A;  3VG4 A;  1OBQ A;  3PEC A;  4XMG A;  4I3C A;  2OFM X;  1JJX A;  3U9P C;  1U18 A;  2GC9 A;  1YWA A;  2A2U A;  3TGC A;  2HLV A;  3F9D A;  3BU1 A;  1DC9 A;  1ADL A;  4GNY A;  5L8N A;  1GX8 A;  1N0S A;  3STN A;  1P6P A;  1EIO A;  3GAQ A;  4DQ4 A;  2FTB A;  4AW8 A;  3BS2 A;  5D48 A;  5IO7 A;  1DF3 A;  1BSY A;  2LB6 A;  4IB6 A;  1FE3 A;  3CMP A;  1A2D A;  2FT9 A;  3FEN A;  4YCH A;  2A13 A;  5B29 A;  2PY1 A;  3BX7 A;  3PH6 A;  4XMC A;  4OS8 A;  4YFP A;  1AB0 A;  2CBS A;  5LJC A;  2QO5 A;  1PMP A;  3PP6 A;  5FAZ A;  1X89 A;  1KT4 A;  3TZS A;  3P6F A;  5C0N A;  4YGH A;  4TQ2 A;  1EXS A;  5DG4 A;  4ZJ0 A;  3NQ3 A;  5D45 A;  3AKN A;  1KT7 A;  2JU3 A;  3APW A;  3PH5 A;  5F1E A;  5LKE A;  4QZU A;  1GX9 A;  3O2Y A;  3O22 A;  1ICN A;  4K19 A;  4Y0R A;  2QM9 A;  5D4A A;  4IAW A;  3AKM A;  1QFV A;  1MX8 A;  4Y0P A;  3HK1 A;  1QG5 A;  5EDB A;  5EPQ A;  4AZM A;  1DZJ A;  3PPT A;  1PM1 X;  4XMD A;  3RZY A;  1X8O A;  2W2A A;  5KHP A;  4OMW A;  2P8G A;  2RCT A;  2WEW A;  3B2J A;  1DFV A;  4M7M A;  1QY0 A;  3IFB A;  2RQ0 A;  3NR3 A;  4NLI A;  3UEX A;  1SXY A;  3WJD A;  1E00 A;  2AKQ A;  1G5W A;  2X46 A;  4GRJ A;  2FWV A;  2L5P A;  1ZND A;  1ERX A;  1KT3 A;  2KT4 B;  4ZH9 A;  1YP7 A;  3BLG A;  4HPA A;  3STK A;  4KII A;  1KT6 A;  3O19 A;  1HQP A;  1URE A;  1NP4 A;  4ZHD A;  4EDE A;  2XKL A;  1LKE A;  3APX A;  1KGL A;  2FRS A;  1JYD A;  4TNN A;  4ZGU A;  5HZ9 A;  3C78 X;  3KFF A;  4I9S A;  3FA7 A;  1EPA A;  1KOI A;  4BVM A;  4GET A;  3U03 A;  4ZR2 A;  4ZHG A;  1QWD A;  4YFR A;  5EZ2 A;  2HZR A;  5HWZ A;  1SXX A;  5HZ5 A;  3NPO A;  1ALB A;  1BJ7 A;  4EXZ A;  1YWD A;  1JV4 A;  4YDB A;  1AEL A;  4LZV A;  3IA8 A;  1BBP A;  4QGX A;  3F8A A;  2AL0 X;  4DQ3 A;  1G74 A;  3T1D A;  5KID A;  1GXA A;  2WWP A;  1BM5 A;  2AMM X;  2Q2P A;  1EAL A;  4A60 A;  3FMZ A;  5HCD C;  3I17 A;  1A57 A;  3Q6L A;  2FS7 A;  4IAX A;  3JS1 A;  3D95 A;  1ERB A;  3HWD A;  1OBP A;  4MVK A;  1U0X A;  2JOZ A;  2L67 A;  2OVD A;  2WR6 A;  4Y0S A;  2LBV A;  4NNT A;  5H9L A;  4WBK A;  1FEM A;  3OJY C;  4YGG A;  3HWF A;  4Y0Q A;  3JSQ A;  1LIF A;  2MO5 A;  2X45 A;  1VPR A;  2O62 A;  1HMS A; 
#chains in the Genus database with same CATH topology
 2HMB A;  2ACO A;  2WQ9 A;  1TW4 A;  4ALB A;  1NP1 A;  1QAB E;  3MVF A;  1B56 A;  1PBY A;  2OL8 O;  1LCW A;  3EYC A;  4MEE A;  4ORS A;  1GKA A;  1T0V A;  5JR8 A;  2AT6 X;  2IZJ A;  2KD2 A;  1SRG A;  3SLT A;  1N9M A;  1MUP A;  4BBO A;  2MWH A;  2BC3 A;  1RST B;  3ZW2 A;  3CWK A;  2N93 A;  3FDC A;  1OEJ A;  5H9N A;  1BRQ A;  4HPD A;  2Y3E A;  4O4O A;  4OKA A;  2A3F X;  1MDC A;  1QY2 A;  2ANS A;  3KVN A;  4QRL A;  1FEN A;  5KIC A;  1PEE A;  1I05 A;  2AT5 X;  4IB9 A;  1OBU A;  1IFB A;  2MF6 A;  1SRF A;  2X55 A;  1QFT A;  3DTQ A;  4ORX A;  3P6D A;  4QGV A;  1BRP A;  4YBP A;  1SWQ A;  1IJ8 A;  1B8E A;  1SLF B;  1LEL A;  3X00 A;  1BSO A;  1SRJ A;  2BT9 A;  3LV4 A;  1VWB B;  3G7X A;  4I3B A;  5EED A;  4BX7 A;  4ZHF A;  4EQA C;  4I3D A;  3TF6 A;  1HY2 A;  4XME A;  4D6A A;  1JIW I;  2FKG A;  2JGS A;  2KTD A;  4ORW A;  2DJF A;  3T2W A;  5CHK A;  1I4U A;  1TVQ A;  3RDU A;  1SWS A;  1Y55 X;  2CAM A;  3T6L A;  1R0U A;  3BDR A;  3N91 A;  1AQB A;  5F58 A;  1KXO A;  4ES7 A;  4L3R A;  3WXQ A;  4NV7 A;  3WYQ A;  3NX2 A;  4ML7 B;  2OYB O;  4CK4 A;  4IBA A;  1SWK A;  5F6B A;  2FGS A;  4I9R A;  1AVD A;  2R74 A;  4O3Z A;  2I5V O;  3KFI A;  5IO5 A;  3SLO A;  1VWM B;  1HQQ A;  2RD7 C;  2Y32 A;  3KQ0 A;  4TJZ A;  2RTB B;  2FHL A;  1SWL A;  1T68 X;  4QQ1 A;  4JNJ A;  4ZGF A;  5HTE A;  1IKJ A;  1O1U A;  4O4S A;  4QGW A;  4CPE A;  1TXL A;  4BGF A;  2RTM A;  4JO6 A;  4NNS A;  3RDQ A;  1VWQ B;  5AEO A;  1VWE B;  4OEM A;  1JBH A;  3HTY A;  1YP6 A;  1RAV A;  2MHD A;  1FEL A;  1VWI B;  1JJU A;  1E5P A;  2DJG A;  4IMO A;  1O8V A;  2NNQ A;  4TKH A;  2QCB A;  3BU9 A;  1SXU A;  3UAQ A;  4OS3 A;  1VWG B;  3VGW A;  5HA0 A;  3VPJ E;  3HPE A;  2OZQ A;  4O3X B;  5AJC A;  2Q4N A;  2GTF X;  4GNW A;  2IZE B;  3RDM A;  2RTJ A;  1ZRY A;  2KW1 A;  3K3L A;  5HAE A;  2IZG B;  4GZV A;  4YGZ A;  4EEJ A;  1ACD A;  2C1Q A;  2IZD B;  1OEE A;  3EBK A;  2RA6 A;  4N7C A;  2A8G A;  3AUM O;  5AQ6 A;  4CDC A;  1SWO A;  2R56 A;  2GTL O;  4QAE A;  1SLE B;  5IRU A;  1DV9 A;  4GU8 A;  3CQR A;  3TGB A;  5LKF A;  4ARH A;  1SWE A;  2IZL B;  2WSJ A;  1X8P A;  4ODD A;  1SWD A;  4OMX A;  2VDF A;  3T6F A;  5IRW A;  1O1V A;  1B4M A;  1NQN A;  1IIU A;  3SZI A;  2AT0 X;  2LBA A;  2X56 A;  3D4R A;  4YBU A;  3WJC A;  2FKJ A;  3BY0 A;  1VYG A;  4NYR A;  4GGZ A;  3S26 A;  2JU7 A;  4N7D A;  3F6Z B;  4B55 A;  2OFR X;  2QOM A;  4A1H A;  4GE1 A;  1BSQ A;  1SY3 A;  1QY1 A;  4FBV A;  3RKG A;  4U8U N;  2FR3 A;  2FS6 A;  1D3S A;  2G78 A;  2JW1 A;  1KL4 A;  2NP1 A;  2EU7 X;  2LKK A;  2Q2M A;  2RTE B;  2MJI A;  3P6C A;  1VWK B;  2CZT A;  4CPI A;  5LJE A;  3CQN A;  1UZ2 X;  3FW4 A;  5H9K A;  2E4J A;  4M6S A;  1Y9L A;  2RTL A;  1OPA A;  1Z24 A;  1DZP A;  2NND A;  3HWG A;  4NYQ A;  3ZW1 A;  4Z27 A;  2OY8 A;  1OEK A;  5K68 A;  1ZNE A;  5LJB A;  3T2X A;  4AZQ A;  2W2B A;  5EDC A;  4IB7 A;  1JJJ A;  1KZX A;  1MX7 A;  2JN3 A;  1LPJ A;  1NGL A;  2HYS A;  3EC5 A;  3CR6 A;  3EM0 A;  4JHQ A;  2CM4 A;  4UU3 A;  1VWL B;  2WQA E;  5HZQ A;  3WJB A;  3HWE A;  3ZWE A;  1PTS A;  1S44 A;  2OY1 O;  5HBS A;  4CPH A;  3WBG A;  2OFA A;  3ZW0 B;  2BS5 A;  2RTF B;  1CBI A;  2WPU A;  4RUN A;  3SAO A;  2RTQ B;  5LJH A;  1FDQ A;  2LFO A;  1VWH B;  1CRB A;  2M4L A;  1KT5 A;  3FR4 A;  3PDF A;  5HA1 A;  5B5F A;  4HPC A;  1X71 A;  3PQS A;  1CBS A;  1LNM A;  4BJ8 A;  3WZP A;  1KL5 A;  3VG7 A;  2OVA A;  2X8F A;  3MG5 A;  4EKV A;  1PBO A;  2G8C O;  4ORR A;  1T8V A;  4COT A;  2OF8 A;  1S7D A;  2FLJ A;  3WJG A;  4ZCB A;  5HTD A;  3QQ2 A;  5FQ8 E;  2K23 A;  3C76 X;  2L68 A;  1S2P A;  2WUT A;  4OS0 A;  2BLG A;  3OD9 A;  1X8U A;  4PJ2 A;  1SA8 A;  1TOW A;  2RTH B;  2Q39 A;  1XCA A;  4AZP A;  1KL3 A;  3EBW A;  1LF7 A;  1YIV A;  4AZR A;  1X8Q A;  5LJK A;  1H91 A;  1LIE A;  1MVG A;  2IFB A;  1EQD A;  1N4J A;  4O4U A;  4QZT A;  1STS B;  5F2B A;  3LHN A;  5L3Y A;  3APU A;  2CBR A;  3B2L A;  3FEP A;  1HXL A;  1X8N A;  5D47 A;  1SWG A;  2QO4 A;  3EW1 A;  3CBC A;  3GE2 A;  1SWU A;  2ASN X;  2RTA A;  1SRI A;  4EFG A;  1ICM A;  1E06 A;  2AVI A;  1JYJ A;  2G7B A;  4ZH6 A;  1GGL A;  1ZNG A;  2RTR B;  4CPF A;  2WEX A;  3MM0 A;  1SY2 A;  3CKF A;  1SRH A;  3KFH A;  4O9S A;  4PSQ A;  3VG5 A;  4ZHH A;  5FEN A;  1MEP A;  4ID2 A;  4MVI A;  2QO6 A;  4TKB A;  5F7G A;  4A1Y A;  2FR2 A;  4ON1 A;  5B5G A;  1ML7 A;  1RLB E;  1G85 A;  3ELZ A;  1FTP A;  1HBQ A;  1I9H A;  3H3I A;  1DZM A;  1YWB A;  3SOT A;  4TKJ A;  4Y5D A;  1IW2 A;  3WVM A;  3OE3 A;  1EUO A;  1GX3 A;  1HN2 A;  2W2F A;  2C1S A;  2RCQ A;  3WJF A;  4MIS A;  1LFO A;  1VWD B;  3P6E A;  5IO6 A;  1KFF A;  3U0D A;  1DZK A;  1EPB A;  2VFB A;  3FA8 A;  4KC8 A;  4R0B A;  4Y59 A;  3UEW A;  3V8U A;  3VG2 A;  5F6Z A;  1LIC A;  4NLJ A;  2XST A;  5BVS A;  4BX6 A;  4GGT A;  4YKO A;  4KC7 A;  2ACP X;  4LKT A;  1VWJ B;  2ALL X;  3L4R A;  4U46 A;  4YCE A;  1CBQ A;  1B0O A;  2A2G A;  2A5C A;  2OF9 A;  5AJB A;  2OVE A;  2X32 A;  4KT5 A;  1SXW A;  1L6M A;  3KFG A;  1I04 A;  4WFV A;  2GJ5 A;  4RUU A;  3NBX X;  3SZH A;  1K24 A;  4ZHC A;  1ZNK A;  4WFU A;  1CJ5 A;  5FFH A;  2G79 A;  3FIQ A;  3FW5 A;  1DF8 A;  3RDX A;  3VG3 A;  3ZUO A;  1E02 A;  4MVE A;  5D8J A;  1GT5 A;  4NP1 A;  1EII A;  3BX8 A;  4I6S A;  2GTL M;  1KQW A;  3FLL A;  1RSU B;  1SY1 A;  2CM9 A;  2X4M A;  4UU2 A;  3ZQ3 A;  1UYO X;  1LDO A;  2HKD A;  4ORY A;  1I06 A;  1IFC A;  1SMP I;  1VWN B;  3CBS A;  4TLJ A;  1RBP A;  2IZI A;  3NP1 A;  4AZN A;  4GDZ A;  2Q9S A;  3FA6 A;  3FEK A;  3HOE A;  3LTW A;  2I5Z O;  2IZH B;  3NQ9 A;  3B2I A;  1CBR A;  4GH7 A;  5HCC C;  3FEL A;  3STM X;  4GKC A;  3FR5 A;  2HZQ A;  4IMN A;  2X8S A;  4YMY A;  1VYF A;  4O3W A;  4I95 A;  5BVT A;  5H8T A;  4ZFX A;  1E2T A;  1BWY A;  1MM9 A;  3BRN A;  5LJG A;  1RXH A;  2K62 A;  1WBI A;  3I0A A;  1FJ1 E;  4ORU A;  1BEB A;  1SWP A;  3B2H A;  3FA9 A;  3WJE A;  3P24 A;  3ELX A;  2RTP B;  4YDA A;  1SY0 A;  1OPB A;  4HFO A;  3B2K A;  4GK9 A;  1SWN A;  3RSW A;  1HMR A;  3P6H A;  4U9C A;  4ALO A;  1YWC A;  1KZW A;  2IZA A;  3ZUI A;  1G7N A;  3MX7 A;  3FR2 A;  4QYN A;  2A0A A;  2MM3 A;  3AEH A;  3QKG A;  1GT1 A;  2BSZ A;  3ZI8 A;  2IZB A;  1HBP A;  3VG6 A;  5L8I A;  2JU8 A;  5JD2 A;  1N9Y A;  1ZNL A;  4FBO A;  5B2A O;  5LJD A;  3WZN A;  1A18 A;  5B10 O;  1AVG I;  1LCZ A;  3EMM A;  1BLR A;  3SZJ A;  5B27 A;  1TOU A;  2POA A;  2DM5 A;  3NAD A;  4GUZ A;  2OFB A;  3DSZ A;  4MIR A;  3RDO A;  3P6G A;  3UEV A;  3APV A;  3D96 A;  5CE4 A;  1EAL A;  1LIB A;  3BSZ E;  1Y0G A;  3UEU A;  5H9A A;  2Z4I A;  1JMZ A;  3PED A;  4QYP A;  5IRA A;  3VHI A;  2UYW A;  1IKE A;  4YKM A;  4BX5 A;  2AT3 X;  5L8O A;  4MVL A;  2QOS C;  4HWM A;  3MBT A;  2KTS A;  1SWB A;  1JZU A;  1YUP A;  1ZNH A;  3OBL A;  3KZA A;  4HPB A;  2G5L A;  3PQU A;  2Y3F A;  2AH7 X;  1EI5 A;  1GT3 A;  2X8T A;  3C77 X;  1MK5 A;  5HCE C;  4INN A;  2AT8 X;  4YFQ A;  2CZU A;  4AYH A;  1LID A;  1KQX A;  1SWJ A;  4O4X A;  3D97 A;  4BOE A;  1VWF B;  5HZ6 A;  4Z2V A;  1EW3 A;  4O3Y A;  2NNE A;  4LKP A;  1D2U A;  2YMS A;  4LZU A;  1A3Y A;  2UZ2 A;  3ZW0 A;  1HMT A;  1MOY A;  1SWR A;  5B3M O;  1GM6 A;  1U17 A;  2L9C A;  2YG2 A;  5DPQ A;  5FQ6 E;  4XMF A;  3S5V A;  4A8Z A;  4AZO A;  2F09 A;  4YH0 A;  2F73 A;  1N7Y A;  3NX1 A;  2HNX A;  5BVQ A;  5HZ8 A;  1XKI A;  2Z4H A;  1Y52 X;  2C4I A;  4IB8 A;  3VE1 A;  3TGA A;  4BQU A;  1GT4 A;  1GKA B;  1K3B A;  1QQS A;  1VWA B;  2BS6 A;  4LQZ A;  5EEE A;  2R73 A;  4XMH A;  4Z2P A;  4D6B A;  3VG4 A;  2FHN X;  1OBQ A;  3PEC A;  4XMG A;  2F01 A;  4I3C A;  2OFM X;  4U8U O;  1JJX A;  3U9P C;  1U18 A;  2GC9 A;  1YWA A;  2A2U A;  3TGC A;  2HLV A;  3F9D A;  4GGR A;  3BU1 A;  1DC9 A;  1ADL A;  4DNE A;  3WOV A;  3D9W A;  4C5P A;  4GD9 A;  3RWX A;  4GNY A;  3FID A;  5L8N A;  1GX8 A;  1N0S A;  3STN A;  2PI3 O;  1P6P A;  5FQ7 E;  3GAQ A;  1EIO A;  4DQ4 A;  2FTB A;  4Z6J A;  2A5B A;  4AW8 A;  3BS2 A;  2RTI B;  5D48 A;  3E3C A;  5IO7 A;  4OEL A;  1DF3 A;  1BSY A;  2LB6 A;  4IB6 A;  1FE3 A;  1SWC A;  3CKG A;  3CMP A;  3S60 A;  1A2D A;  2FT9 A;  3VHM A;  3EW2 A;  3FEN A;  4YCH A;  2A13 A;  5B29 A;  4GDA A;  4BX7 B;  2IZC B;  2PY1 A;  1STP A;  3BX7 A;  3PH6 A;  3RBY A;  4XMC A;  4OS8 A;  4YFP A;  4I60 A;  4FGI B;  1AB0 A;  3PK2 A;  1VWR B;  2CBS A;  5LJC A;  2QO5 A;  1PMP A;  1VYO A;  3PP6 A;  5FAZ A;  1SWF A;  1X89 A;  3RY1 A;  1KT4 A;  4CDE A;  3TZS A;  4KCA A;  3P6F A;  5C0N A;  2GTL N;  2LA7 A;  4YGH A;  4TQ2 A;  1EXS A;  3SLJ A;  5DG4 A;  1VWO B;  4DCB A;  4Z2O A;  4ZJ0 A;  3NQ3 A;  2RTD B;  3AKN A;  1KT7 A;  2JU3 A;  3APW A;  1Y9T A;  3PH5 A;  2IZK A;  1SWH A;  5D45 A;  5F1E A;  5LKE A;  4QZU A;  1GX9 A;  3O2Y A;  1W4T A;  1ICN A;  3O22 A;  4K19 A;  4Y0R A;  2QM9 A;  2AF5 A;  2RN4 A;  5D4A A;  4IAW A;  4BX6 B;  1NQM A;  1LDQ A;  3AKM A;  1QFV A;  1MX8 A;  3WYP A;  4Y0P A;  3HK1 A;  1QG5 A;  4FBR A;  3RY2 A;  5EDB A;  4BCS A;  5EPQ A;  4AZM A;  1DZJ A;  3PPT A;  5B11 O;  1PM1 X;  4XMD A;  3RZY A;  1X8O A;  2W2A A;  2ZAI A;  4OMW A;  5KHP A;  2P8G A;  2RCT A;  2WEW A;  3B2J A;  1DFV A;  2ZSC A;  4M7M A;  1QY0 A;  2JMB A;  3IFB A;  2RQ0 A;  3NR3 A;  4NV8 A;  1N43 A;  4NLI A;  1W5R A;  3UEX A;  4CV7 A;  4CSB A;  1SXY A;  3WJD A;  3VHH A;  1E00 A;  2AKQ A;  5K06 A;  1G5W A;  2X46 A;  2ZAG A;  4GRJ A;  2FWV A;  1JQP A;  2L5P A;  4WHI A;  5CYB A;  2OY5 O;  1VWC B;  1ZND A;  5K67 A;  1ERX A;  1KT3 A;  2GH7 A;  2KT4 B;  4ZH9 A;  1YP7 A;  3BLG A;  4HPA A;  3STK A;  4KII A;  4YVB A;  1SWA A;  2RTK A;  2OL7 A;  4GJS A;  1KT6 A;  1NBX A;  3O19 A;  1HQP A;  1SLG B;  1LUQ A;  1NP4 A;  1URE A;  2RTC B;  3S5X A;  4EDE A;  2XKL A;  1LKE A;  3VU1 A;  4ZHD A;  3FYF A;  4L1N A;  3APX A;  1HXZ A;  4CDD A;  1KGL A;  2FRS A;  1W6F A;  1JYD A;  4TNN A;  4ZGU A;  5HZ9 A;  3C78 X;  1LCV A;  3KFF A;  4I9S A;  3FA7 A;  1RXJ A;  1EPA A;  1KOI A;  4Z28 A;  4BVM A;  4GET A;  2IZF B;  4QNI A;  4U3Q A;  4CDF A;  5CSE A;  4IAB A;  4ZR2 A;  4ZHG A;  3U03 A;  1QWD A;  4YFR A;  5EZ2 A;  2HZR A;  5HWZ A;  1SXX A;  1AVE A;  5HZ5 A;  3NPO A;  2RTO B;  1ALB A;  1BJ7 A;  2OL6 O;  1STR B;  2RTN B;  3VE2 A;  1YWD A;  1JV4 A;  4YDB A;  4EXZ A;  1I78 A;  2X34 A;  4LZV A;  1AEL A;  3IA8 A;  1BBP A;  2BHV A;  3F8A A;  4QGX A;  3ZW1 B;  2AL0 X;  4DQ3 A;  1G74 A;  3HOL A;  3T1D A;  3WZO A;  5KID A;  1VWP B;  1GXA A;  1NDJ A;  2RTG B;  1SWT A;  1JMX A;  4KH8 A;  2WWP A;  4BX5 B;  1BM5 A;  1NC9 A;  2AMM X;  2Q2P A;  2QMI A;  3P02 A;  4GJV A;  4O49 A;  3FMZ A;  3RE5 A;  3WZQ A;  4A60 A;  5HCD C;  3I17 A;  4CPH B;  3JQO A;  1A57 A;  3Q6L A;  4FQB B;  2FS7 A;  1SLD B;  3NQK A;  4IAX A;  3JS1 A;  3D95 A;  1ERB A;  3HWD A;  4NW4 A;  1OBP A;  1Y53 X;  5IXG A;  5BYP A;  4MVK A;  1U0X A;  4IRW A;  1SRE A;  2JOZ A;  2L67 A;  2OVD A;  2VFC A;  2WR6 A;  4U8U M;  4Y0S A;  4NNT A;  5H9L A;  2LBV A;  4JGL A;  4WBK A;  1OSP O;  3Q34 A;  1FEM A;  3OJY C;  4YGG A;  3HWF A;  1UYN X;  4Y0Q A;  2OY7 A;  2OVS A;  3RE6 A;  3JSQ A;  1LIF A;  1RXK A;  2MO5 A;  2X45 A;  3ZZV A;  1WUB A;  1VPR A;  2O62 A;  3RDS A;  1HMS A; 
#chains in the Genus database with same CATH homology
 2HMB A;  2ACO A;  2WQ9 A;  1TW4 A;  4ALB A;  1NP1 A;  1QAB E;  3MVF A;  1B56 A;  3EYC A;  4ORS A;  1GKA A;  1T0V A;  5JR8 A;  2AT6 X;  2KD2 A;  1MUP A;  2MWH A;  3ZW2 A;  3CWK A;  2N93 A;  1OEJ A;  5H9N A;  1BRQ A;  4HPD A;  4QRL A;  4O4O A;  3VPJ E;  2A3F X;  1MDC A;  1QY2 A;  2ANS A;  5KIC A;  1FEN A;  1PEE A;  1I05 A;  2AT5 X;  4IB9 A;  1OBU A;  1IFB A;  1QFT A;  3DTQ A;  4ORX A;  3P6D A;  4QGV A;  1BRP A;  4YBP A;  1B8E A;  1BSO A;  2BT9 A;  3LV4 A;  3G7X A;  4I3B A;  5EED A;  4ZHF A;  4EQA C;  4I3D A;  3TF6 A;  4XME A;  4D6A A;  1JIW I;  2KTD A;  4ORW A;  1I4U A;  1TVQ A;  1R0U A;  3BDR A;  3N91 A;  1AQB A;  5F58 A;  1KXO A;  4ES7 A;  4L3R A;  3WXQ A;  3NX2 A;  4ML7 B;  4CK4 A;  4IBA A;  5F6B A;  4I9R A;  4O3Z A;  2R74 A;  5IO5 A;  3KFI A;  2RD7 C;  3KQ0 A;  4TJZ A;  1T68 X;  4QQ1 A;  4ZGF A;  5HTE A;  1IKJ A;  1O1U A;  4O4S A;  4QGW A;  1TXL A;  4NNS A;  5AEO A;  1JBH A;  3HTY A;  1YP6 A;  2MHD A;  1FEL A;  1E5P A;  4IMO A;  1O8V A;  2NNQ A;  4TKH A;  3BU9 A;  3UAQ A;  1SXU A;  4OS3 A;  5HA0 A;  2OZQ A;  4O3X B;  5AJC A;  2Q4N A;  2GTF X;  4GNW A;  1ZRY A;  2KW1 A;  3K3L A;  5HAE A;  4GZV A;  4YGZ A;  4EEJ A;  1ACD A;  1OEE A;  3EBK A;  2RA6 A;  4N7C A;  5AQ6 A;  2R56 A;  2GTL O;  4QAE A;  1DV9 A;  4GU8 A;  3CQR A;  3TGB A;  5LKF A;  4ARH A;  2WSJ A;  4OMX A;  1X8P A;  4ODD A;  1O1V A;  1B4M A;  1IIU A;  2AT0 X;  2LBA A;  3D4R A;  4YBU A;  3WJC A;  3BY0 A;  1VYG A;  4NYR A;  3S26 A;  2JU7 A;  4N7D A;  3F6Z B;  2OFR X;  4A1H A;  4GE1 A;  1BSQ A;  1SY3 A;  1QY1 A;  4FBV A;  3RKG A;  4U8U N;  2FR3 A;  2FS6 A;  1D3S A;  2G78 A;  2JW1 A;  2NP1 A;  2EU7 X;  2LKK A;  2Q2M A;  2MJI A;  3P6C A;  2CZT A;  5LJE A;  3CQN A;  1UZ2 X;  3FW4 A;  5H9K A;  2E4J A;  4M6S A;  1Y9L A;  1OPA A;  1Z24 A;  1DZP A;  2NND A;  3HWG A;  4NYQ A;  3ZW1 A;  1OEK A;  1ZNE A;  5LJB A;  4AZQ A;  2W2B A;  5EDC A;  4IB7 A;  1JJJ A;  1KZX A;  1MX7 A;  2JN3 A;  1LPJ A;  1NGL A;  2HYS A;  3EM0 A;  3CR6 A;  4UU3 A;  2CM4 A;  2WQA E;  5HZQ A;  3WJB A;  3ZWE A;  3HWE A;  1S44 A;  5HBS A;  3WBG A;  3ZW0 B;  2BS5 A;  1CBI A;  4RUN A;  3SAO A;  5LJH A;  1FDQ A;  2LFO A;  2M4L A;  1CRB A;  3FR4 A;  1KT5 A;  5HA1 A;  4HPC A;  1X71 A;  3PQS A;  1CBS A;  1LNM A;  3VG7 A;  2OVA A;  2X8F A;  1PBO A;  4ORR A;  1T8V A;  4COT A;  1S7D A;  2FLJ A;  3WJG A;  4ZCB A;  5HTD A;  5FQ8 E;  2K23 A;  3C76 X;  2L68 A;  1S2P A;  2WUT A;  4OS0 A;  2BLG A;  3OD9 A;  1X8U A;  4PJ2 A;  1SA8 A;  1TOW A;  2Q39 A;  1XCA A;  4AZP A;  3EBW A;  1LF7 A;  1YIV A;  4AZR A;  1X8Q A;  5LJK A;  1H91 A;  1LIE A;  1MVG A;  2IFB A;  1EQD A;  4O4U A;  4QZT A;  3LHN A;  3APU A;  2CBR A;  3B2L A;  3FEP A;  1X8N A;  5D47 A;  2QO4 A;  3CBC A;  3GE2 A;  2ASN X;  4EFG A;  1ICM A;  1E06 A;  1JYJ A;  2G7B A;  4ZH6 A;  1GGL A;  1ZNG A;  2WEX A;  1SY2 A;  3KFH A;  4O9S A;  4PSQ A;  3VG5 A;  4ZHH A;  5FEN A;  4ID2 A;  4MVI A;  2QO6 A;  4TKB A;  5F7G A;  4A1Y A;  2FR2 A;  4ON1 A;  1ML7 A;  1RLB E;  1G85 A;  3ELZ A;  1FTP A;  1HBQ A;  3H3I A;  3SOT A;  1DZM A;  1YWB A;  5K06 A;  4TKJ A;  1IW2 A;  3WVM A;  3OE3 A;  1EUO A;  2W2F A;  1HN2 A;  3WJF A;  2RCQ A;  4MIS A;  1LFO A;  3P6E A;  5IO6 A;  3U0D A;  1DZK A;  1EPB A;  4KC8 A;  3FA8 A;  4R0B A;  3UEW A;  3V8U A;  3VG2 A;  4ZHC A;  5F6Z A;  1LIC A;  4NLJ A;  2XST A;  5BVS A;  4YKO A;  4KC7 A;  2ACP X;  4LKT A;  4YCE A;  2ALL X;  3L4R A;  5AJB A;  3ZQ3 A;  1CBQ A;  1B0O A;  2A2G A;  2OVE A;  4KT5 A;  1SXW A;  1L6M A;  3KFG A;  1I04 A;  4WFV A;  2GJ5 A;  4RUU A;  3NBX X;  1ZNK A;  4WFU A;  1CJ5 A;  5FFH A;  2G79 A;  3FIQ A;  3FW5 A;  3VG3 A;  3ZUO A;  1E02 A;  4MVE A;  5D8J A;  1GT5 A;  4NP1 A;  1EII A;  3BX8 A;  4I6S A;  2GTL M;  1KQW A;  3FLL A;  1SY1 A;  2CM9 A;  4UU2 A;  4ORY A;  1I06 A;  1IFC A;  1SMP I;  3CBS A;  4TLJ A;  1RBP A;  3NP1 A;  4AZN A;  4GDZ A;  2Q9S A;  3FA6 A;  3FEK A;  3HOE A;  3NQ9 A;  3B2I A;  1CBR A;  4GH7 A;  5HCC C;  3FEL A;  3STM X;  4GKC A;  3FR5 A;  2HZQ A;  4IMN A;  2X8S A;  4YMY A;  1VYF A;  4O3W A;  4I95 A;  5BVT A;  5H8T A;  4ZFX A;  1BWY A;  3BRN A;  5LJG A;  2K62 A;  3I0A A;  4ORU A;  1BEB A;  3B2H A;  3FA9 A;  3WJE A;  3P24 A;  3ELX A;  4YDA A;  1SY0 A;  1OPB A;  4HFO A;  3B2K A;  4GK9 A;  4ALO A;  3RSW A;  1HMR A;  3P6H A;  4U9C A;  1YWC A;  1KZW A;  3ZUI A;  1G7N A;  3MX7 A;  3FR2 A;  4QYN A;  2A0A A;  2MM3 A;  3QKG A;  1GT1 A;  3ZI8 A;  1HBP A;  3VG6 A;  5L8I A;  2JU8 A;  5LJD A;  1ZNL A;  4FBO A;  1A18 A;  1BLR A;  1AVG I;  3EMM A;  5B27 A;  1TOU A;  2POA A;  2DM5 A;  3NAD A;  3DSZ A;  4MIR A;  3P6G A;  3UEV A;  3APV A;  3D96 A;  5CE4 A;  1LIB A;  3BSZ E;  3UEU A;  5H9A A;  2Z4I A;  3PED A;  4QYP A;  5L8O A;  1IKE A;  4YKM A;  2AT3 X;  4MVL A;  2QOS C;  4HWM A;  3MBT A;  2KTS A;  1JZU A;  1YUP A;  1ZNH A;  3OBL A;  3KZA A;  4HPB A;  3PQU A;  2AH7 X;  1EI5 A;  1GT3 A;  2X8T A;  3C77 X;  5HCE C;  4INN A;  2AT8 X;  4YFQ A;  2CZU A;  4AYH A;  1LID A;  1KQX A;  4O4X A;  3D97 A;  4BOE A;  5HZ6 A;  1EW3 A;  4O3Y A;  2NNE A;  4LKP A;  1D2U A;  2YMS A;  4LZU A;  1A3Y A;  3ZW0 A;  1HMT A;  1GM6 A;  1U17 A;  2L9C A;  2YG2 A;  5DPQ A;  5FQ6 E;  4XMF A;  3S5V A;  4A8Z A;  4AZO A;  2F09 A;  4YH0 A;  2F73 A;  3NX1 A;  2HNX A;  5BVQ A;  5HZ8 A;  1XKI A;  2Z4H A;  3VE1 A;  4IB8 A;  3TGA A;  4BQU A;  1GT4 A;  1GKA B;  5EEE A;  1QQS A;  2BS6 A;  4LQZ A;  2R73 A;  4XMH A;  4D6B A;  3VG4 A;  1OBQ A;  3PEC A;  4XMG A;  4I3C A;  2OFM X;  4U8U O;  1JJX A;  3U9P C;  1U18 A;  2GC9 A;  1YWA A;  2A2U A;  3TGC A;  2HLV A;  3F9D A;  3BU1 A;  1DC9 A;  1ADL A;  3WOV A;  3RWX A;  4GNY A;  5L8N A;  1GX8 A;  1N0S A;  3STN A;  1P6P A;  5FQ7 E;  3GAQ A;  1EIO A;  4DQ4 A;  2FTB A;  4AW8 A;  3BS2 A;  5D48 A;  3E3C A;  5IO7 A;  1DF3 A;  1BSY A;  2LB6 A;  4IB6 A;  1FE3 A;  3CMP A;  3S60 A;  1A2D A;  2FT9 A;  3FEN A;  4YCH A;  2A13 A;  5B29 A;  2PY1 A;  3BX7 A;  3PH6 A;  3RBY A;  4XMC A;  4OS8 A;  4YFP A;  4FGI B;  1AB0 A;  2CBS A;  5LJC A;  2QO5 A;  1PMP A;  3PP6 A;  5FAZ A;  1X89 A;  1KT4 A;  3TZS A;  4KCA A;  3P6F A;  5C0N A;  2GTL N;  2LA7 A;  4YGH A;  4TQ2 A;  1EXS A;  5DG4 A;  4ZJ0 A;  3NQ3 A;  5D45 A;  3AKN A;  1KT7 A;  2JU3 A;  3APW A;  1Y9T A;  3PH5 A;  5F1E A;  5LKE A;  4QZU A;  1GX9 A;  3O2Y A;  3O22 A;  1ICN A;  4K19 A;  4Y0R A;  2QM9 A;  2RN4 A;  5D4A A;  4IAW A;  3AKM A;  1QFV A;  1MX8 A;  4Y0P A;  3HK1 A;  1QG5 A;  4FBR A;  5EDB A;  5EPQ A;  4AZM A;  1DZJ A;  3PPT A;  1PM1 X;  4XMD A;  3RZY A;  1X8O A;  2W2A A;  2ZAI A;  4OMW A;  5KHP A;  2P8G A;  2RCT A;  2WEW A;  3B2J A;  1DFV A;  4M7M A;  1QY0 A;  2JMB A;  3IFB A;  2RQ0 A;  3NR3 A;  4CV7 A;  4NLI A;  3UEX A;  4CSB A;  1SXY A;  3WJD A;  1E00 A;  2AKQ A;  1G5W A;  2X46 A;  2ZAG A;  4GRJ A;  2FWV A;  2L5P A;  4WHI A;  5CYB A;  1ZND A;  1ERX A;  1KT3 A;  2KT4 B;  4ZH9 A;  1YP7 A;  3BLG A;  4HPA A;  3STK A;  4KII A;  1KT6 A;  3O19 A;  1HQP A;  1URE A;  1NP4 A;  3S5X A;  4ZHD A;  4EDE A;  2XKL A;  1LKE A;  3VU1 A;  3FYF A;  4L1N A;  3APX A;  1KGL A;  2FRS A;  1JYD A;  4TNN A;  4ZGU A;  5HZ9 A;  3C78 X;  3KFF A;  4I9S A;  3FA7 A;  1EPA A;  1KOI A;  4BVM A;  4GET A;  4QNI A;  4U3Q A;  3U03 A;  4IAB A;  4ZR2 A;  4ZHG A;  1QWD A;  4YFR A;  5EZ2 A;  2HZR A;  5HWZ A;  1SXX A;  5HZ5 A;  3NPO A;  1ALB A;  1BJ7 A;  3VE2 A;  4EXZ A;  1YWD A;  1JV4 A;  4YDB A;  1AEL A;  4LZV A;  3IA8 A;  1BBP A;  2BHV A;  3F8A A;  4QGX A;  3ZW1 B;  2AL0 X;  4DQ3 A;  1G74 A;  3HOL A;  3T1D A;  5KID A;  1GXA A;  4KH8 A;  2WWP A;  1BM5 A;  2AMM X;  2Q2P A;  2QMI A;  3P02 A;  4A60 A;  4O49 A;  3FMZ A;  1EAL A;  5HCD C;  3I17 A;  3JQO A;  1A57 A;  3Q6L A;  4FQB B;  2FS7 A;  3NQK A;  4IAX A;  3JS1 A;  3D95 A;  1ERB A;  3HWD A;  4NW4 A;  1OBP A;  5BYP A;  4MVK A;  1U0X A;  2JOZ A;  2L67 A;  2OVD A;  2WR6 A;  4U8U M;  4Y0S A;  2LBV A;  4NNT A;  5H9L A;  4JGL A;  4WBK A;  1FEM A;  3OJY C;  4YGG A;  3HWF A;  4Y0Q A;  2OVS A;  3JSQ A;  1LIF A;  2MO5 A;  2X45 A;  3ZZV A;  1VPR A;  2O62 A;  1HMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...