2FR8C

Structure of transhydrogenase (di.r127a.nad+)2(diii.nadp+)1 asymmetric complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
174
structure length
174
Chain Sequence
b'SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title The Role of Invariant Amino Acid Residues at the Hydride Transfer Site of Proton-translocating Transhydrogenase.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 47
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2006-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2fr8C00
4RMHA 4V1CA 3LQ1A 2OD2A 1OZHA 2EZTA 4V1CB 4D5GA 3F6EX 2IHUA 2FWNA 2PGNA 4JUCA 1Q6ZA 5MFPA 3JWPA 3PDHA 1YBHA 2H4JA 4TWJA 1Z8NA 4IG9A 1PVDA 5MFZA 5DGDA 1YHYA 5K2OA 1D4OA 2HJHA 1OZFA 4KXQA 2QQGA 4BVBA 1J8FA 1YI1A 4MPRA 5EJAA 1U2GC 4KGDA 4RJIA 2Q5JA 4QQ8A 4UTXA 3FZNA 2JI7A 1S5PA 5EJMA 4GM4A 1BFDA 2VJYA 1SZCA 2AG1A 4G1CA 2VBFA 1M2NA 1MA3A 1O96B 2IHTA 2Q5OA 4F4UA 1YHZA 4K9QA 3GLTA 4R8MA 5BWLA 2A1UA 3RIYA 2VK8A 4BN4A 4ZP1A 1M2HA 4QPZA 4UU7A 1PNQA 1M2GA 1U2DC 2VBIA 1POWA 4HD8A 2VK4A 3D81A 4J16C 2OO5C 4Q9DA 1T9BA 4V1CI 4K9LA 3OE1A 4K9KA 3JR3A 2UZ1A 5MGNA 1QPBA 1Y9DA 2Q5QA 1YI0A 4UU8A 5EJ5A 3ZG6A 5FYQA 2B4YA 2UZ1B 3EYAA 2H2GA 3U31A 4UUAA 2W93A 2FRDC 4I5IA 1ZPDA 1EFPA 4RMGA 3K35A 1M2KA 1YNOA 4FVTA 2A1TR 2NYRA 4QELA 2OD9A 1YC2A 4C78A 4D5EA 2H4HA 2H59A 4GP9A 2V3WA 4JT8A 5DEIA 1PT9A 4K9MA 4UTRA 4MPPA 4BVHA 2VBGA 2EZUA 5EJ6A 2FSVC 4JD5A 4BVGA 3FSJX 1O97D 4BVEA 2H2IA 1V5FA 1PNOA 1NM5C 2AG0A 5D7NA 4BV2A 4UTVA 3PKIA 4GG1A 4COKA 3CLTD 5DGTA 1ICIA 2EZ8A 3HWWA 2JLAA 5K3SA 5K6TA 1Q14A 1V5EA 1HZZC 4RMJA 4TWIA 2C31A 1V5GA 3RIGA 1UPAA 1N0HA 4Y6QA 4MPJA 4BUZA 1U31A 4GPEA 5BWOA 3ZGOA 1YTLA 4JUFA 4KPUA 3HWX1 4JU9A 4JT9A 2FR8C 4K9NA 2PGOA 1SZDA 4GM0A 4JU8A 4BN5A 2VK1A 2NXWA 2Q27A 1PTJC 1OVMA 4JUDX 2BRUC 4K9OA 4Y6OA 5AHKA 2JLCA 5IMSA 4O8ZA 4MQ5A 2H4FA 1OZGA 2WVAA 1PI3A 4RMIA 4UTNA 2Q29A 1U28C 2H2HA 4Y6LA 2JI9A 4BV3A 4BVFA 2IHVA 4L2IA 3PKJA 2OORC 2Q28A 2QQFA 5EJ4A 5EJ8A 1UPBA 3FLMA 4K9PA 1YC5A 4IF6A 3EY9A 4IAOA 4UTZA 4C7BA 4X3OA 4ZZIA 2OD7A 3F6BX 5EJ7A 3CF4G 4FZ3A 3U3DA 1XLTC 1PO7A 4JSRA 5MF6A 4X3PA 4HDAA 2JI8A 4JUBA 2H2FA 2EZ9A 4RJJA 5K6RA 5EJ9A 4JUAA 4L3OA 1Q17A 2JIBA 2PANA 4J1TC 3CLUD 1T9CA 5BWNA 1POXA 1DJLA 1JSCA 2X7JA 3IAFA 5FEMA 1T9AA 4FEGA 4MZXA 4FEEA 3CLSD 2H2DA 2Q5LA 1Q1AA 2EZ4A 3D7KA 3EA4A 3D4BA 2JI6A 4GM1A 3GLRA 3GLSA 1UPCA 1E3TA 3ZGVA 2WVGA 4RJKA 1T9DA 3E9YA 3IAEA 4UUBA 1EFVA 2FN3A 1S7GA 3CLRD 1M2JA 2WVHA 4F56A 1PYDA 1MCZA 3GLUA 2DJIA
chains in the Genus database with same CATH superfamily
3KEOA 2QWXA 3OM8A 2BKLA 4DNPA 1QX4A 4Q24A 2PAFA 1NYRA 3MGAA 4L0DA 3KSBC 5EIEA 1WX1A 3HCDA 3UT5B 5E6UB 3HLYA 3PD1A 5DMHA 3QBJA 5IRCD 3O1IC 2R8BA 4PZ0A 4GVPA 2B8EA 2OD2A 2FP4B 1JPUA 2ZUBA 3HP7A 1GKKA 3KVOA 3LCVB 3PC2A 4OXYA 4QEKA 4DLTA 3EZ7A 2EZTA 5EWJA 1TYCA 2EJUA 4OP1A 3RVNA 4KPGA 7YASA 1J2UA 3SI7A 2DUWA 4TKUA 3DP7A 5D5QA 4ANFA 1ZZEA 2GJAA 1NULA 1NN1A 4XQCA 3UKDA 3EGOA 2LKCA 3GLIE 8OHMA 3U49A 3QELA 3OEYA 3P94A 3AVPA 4ALMA 1ZJ4A 2XKAA 4J0GA 4DUGA 2VHYA 2DQ4A 2V5UA 3TLEA 3WGVA 3RNLA 3R5XA 2DKFA 2PG3A 2WSSA 1VRVA 2YL2A 4MWCA 3RFCA 4E15A 2PSDA 1LNSA 2O9JA 1LVUA 1Y1RA 3DLIA 3I45A 3M4NA 1Q3KA 1G8GA 1XEWY 2O8NA 3CGGA 4BLUA 5DHRA 4EA9A 2OMKA 2NZYA 3Q11A 3AIKA 3OTOB 3BOSA 2BEUA 3U62A 4M6WA 3GLIA 2WWWA 2ZE8A 2VNSA 3HI6A 5KTPA 4GKBA 2SKCA 1RAIA 1V43A 1CYDA 1C7EA 2I76A 3JALB 1XYGA 1K97A 4IG9A 4MDHA 4QUIA 4RZIA 4YJ2F 2PRZA 3DD5A 4OI2A 3REOA 3KG2A 3TTYA 5FWXA 3ZCQA 3DC7A 1GR1A 3OT1A 2QRJA 1YDFA 1L5KA 2RBKA 1PWEA 3X1ZA 2OCDA 2KQUA 3Q6MA 3ZW8A 1Z0SA 2HC9A 4JVNA 2POCA 3MA0A 4PLPA 5H1YA 3H2BA 2G82A 3ETDA 3HCNA 4MVXA 4NV3A 2WTMA 3TDNA 4H7JA 4KAFA 2OKGA 4NH0A 1R0KA 4HDCA 4L85A 3ZNNA 1RRFA 4QYIB 5ECGC 5FBWB 3A70A 3BDVA 2VJNA 4MS1B 3ZK8A 5AM5A 4XCXA 4Z7OB 2GD2A 3T7DA 3DAPA 1E9AA 3C1AA 2I3DA 3EMVA 3KAKA 2CGEA 4I6JA 1X7HA 3W7BA 5BY2A 2P5YA 5JJLA 1GWNA 1CJTC 1TM4E 4GE3A 1MAAA 4TLDA 3O3OB 4DYVA 2I4IA 1Q74A 5A05A 4G1CA 3HV2A 4ALNA 5HKAA 2C7GA 2VBFA 4R5MA 1II0A 1OU4A 2GFIA 5CFNA 5JXJA 2XUIA 3TQFA 2JHFA 3E4DA 1QG6A 4PS0A 4HDRB 4BB6A 2F4NA 4F8JA 1XLVA 2CXNA 2O0JA 3KYCA 4LJ9A 4MLZA 4B4OA 2E5WA 1NU8A 1G8KA 3HBFA 1ANKA 4N3BA 5KNLA 3TBKA 3JZMA 5BWLA 2AJDA 4M22A 5IS2A 1VMDA 2HUNA 2P4HX 1A4IA 2CNWD 1THTA 3I1IA 1E89A 2DR0A 4KLNA 4P33A 3VI4B 1M1YA 3ND5A 2A84A 4WCFA 3GFQA 2VK8A 2E21A 4RF2A 1WXXA 1PJ4A 3C5VA 4BE7B 1V41E 2IZZA 2VXOA 4G97A 5KKAA 1RWBA 4G07A 4MWTA 3OM0A 4MIKA 1C3XA 1CR2A 3R1IA 4Z9YA 4Q3AA 3IHWA 1JDNA 1KARA 4QPZA 3H4TA 4I5FA 4C7JA 1IBCA 2JGMA 1IXKA 5AJZA 3VYVA 1O94C 4O5OA 4FEAA 3FHLA 1TEHA 3QJYA 1VKRA 1CZLA 2BF7A 3NVAA 3HB7A 1Z8DA 1CX9B 4FT2A 5EUCA 2ZJ3A 2JLQA 2VA8A 1MDBA 4GOMD 1HDIA 2Q9CA 1QIEA 1TM3E 4RQUA 1EVKA 4QWWA 2K7FA 1YASA 2WWTA 5TF0A 1UJ5A 4L5AA 3MCZA 5P21A 3A6ZA 1GEEA 4CYMA 1UC4B 2BKUA 2NUTA 3O4HA 1EEHA 1JIUA 4OVKA 3WXMA 4BX2A 1BU5A 4KC0A 3SX2A 3WTCA 1I0IA 1ORVA 1TU3A 5MGNA 4QYWA 7MHTA 3H8JA 2O1SA 3BT7A 1G5QA 3OIFA 3T9FA 1QHIA 3AWIA 2ZYTX 1E2MA 2H85A 3ONFA 5HHTA 1NFFA 3E7WA 3SK0A 2JVKA 4HV4A 4IILA 4MIEA 4XWOA 1Z63A 1RRKA 5U4QA 4KXMA 3CT6A 2Q6IA 2A1TS 3DZCA 4H1HA 4HZUB 4C3OB 2B4YA 1UEIA 2UZ1B 4QAJA 1CZNA 5CIYA 4A15A 3BE5A 3F3YA 1JAHA 1R9GA 4UUAA 3L5OA 3O4IA 2YZ7A 1ORHA 3AI3A 1P5RA 3NBKA 2ECQA 4YECA 3WWPA 2ONCA 1EK1A 2BIFA 5JMOA 2ATCA 2W6QA 1K66A 1QWSA 1DS6A 3PQ5A 1OB2A 1TMYA 3F5FA 3NANA 1K5DA 3OLXA 3ILYA 5CXUA 5AW6A 4YLEA 3MTGA 5AVWA 4ONEA 1IHDA 2Z9BA 3P71T 3ZIUA 2HMUA 1U9CA 4P8RA 3SFVA 5JWOA 4YV2A 4BC0A 2DSTA 3K92A 5KKCA 1NVKA 3S2ZA 4LC9A 4W9NA 1GFIA 3Q7TA 2JG3A 3A4MA 5L3SB 5FLYA 1MOZA 2BUCA 5G1NA 5A6SB 2YHUA 1IWPB 1T34A 4RAOA 3UHFA 4BV9A 2AD5A 1CRWG 2B9VA 3G79A 4HGQA 5M3BA 1Q16A 2RARA 4GZ6A 4YJ2A 2FRDA 2FWAA 3GUVA 4QQNA 2RCYA 4R2WA 2FW7A 4XVRA 4GU5A 5K8TA 1ISGA 1PRYA 4FFRA 4MW0A 1V7ZA 4QOHA 3AOGA 5AM0A 3WL5A 3LBHA 4FB5A 3T5TA 1T3LA 1DKRA 4EA7A 4RZSA 4XA8A 4ML3A 4C06A 2AQKA 3EZ2A 1ZISA 2FPGB 4OUDB 1NVMB 4CMEA 1XNRB 4KUHA 5B1IA 2DPXA 3H3XA 4DZZA 3GJRA 1TD9A 4Q7LA 1USWA 1MB2A 5DEIA 5IPFA 2RJ3A 2PIAA 4QDUA 3EGDA 4KGVA 4YRNA 2VTKA 4XH9B 2G25A 4EKDA 4OIFA 5CCBA 2E6KA 2XB2A 2QRVB 1S1MA 2Y4NA 3RADC 1RJ9B 2KHZA 1XP5A 2OQRA 1Z56C 1TUEA 3NW9A 2WUWE 4EHLA 2CF5A 2B4TO 1CRQA 4MIOA 3FPEA 1W85B 3JTMA 4XJSA 3NAQA 4OCZA 4QQFA 4DGQA 3RC9A 2RE8A 2IS1A 1C2TA 4JD5A 3E5HA 4EUKA 4R2MA 4HFNA 2AYZA 2X77A 4FDAA 3GVCA 3JWEA 4V0KA 2HUPA 3DXYA 1FDTA 1NW3A 3RSFA 3M2TA 1IN6A 4I7EA 2Z58A 4OHUA 3ESRA 1FFCA 4HRXA 4YCJA 2IDMA 1OWNA 1Z37A 3KFVA 3TFWA 3R7WA 2POQX 5C8VA 1XMIA 3TLZA 2ZEJA 4BV2A 1BDMA 1PZGA 4XWAA 2NV6A 1D1SA 3Q7IA 3FCSB 4CEHB 1OFHA 1EUCA 1ZJ5A 4OAPA 5CT5A 1L5SA 3PRYA 5AW1A 4DEVA 3GC6A 1ONNA 5L53A 2PYZA 5HS6A 1QG0A 1JAYA 1BOOA 3R09A 1FVFA 4RY8A 1EA7A 2XZDA 4AIRA 4KRGA 3RFTA 3HTXA 3QZUA 4IO0A 2EEPA 1EA5A 3JXEA 3N7TA 3IKTA 3HPRA 4MJ7A 5KS2A 3IPLA 4ZO8A 4FQ8A 2VAPA 3U3MA 4RPIA 3LBNA 4J07A 1O9GA 2IVZA 2I2DA 3U9TA 2JAHA 9LDTA 3RREA 2XVZA 2DHDA 5HQTA 5JBQA 2DH6A 2HK6A 5LNK6 3T7TA 2EP8A 1C0LA 3DA8A 1EP3B 1DEAA 2NU7B 3TH5A 2C7VA 3IQZA 2KI5A 4C0LA 1E63A 3K0SA 1C7RA 1ZH0A 1NKVA 1Q7TA 2FX5A 4MKZA 2BSQA 3IUYA 4WVLA 3IJ5A 2IIBA 3ZY2A 2C2MA 3A27A 2WB2A 3HZHA 4G81A 4YIKA 2VNAA 3LE8A 2ZAIA 3LLSA 2QK4A 4IEEA 4U7TB 4YXWA 2GI4A 4YASA 3D64A 3WIEA 1SBHA 9ATCA 3F46A 4PZLA 5AT1A 3VZBA 1CF4A 2QNRA 5KQGA 1UPUA 1YCGA 1L5ZA 3PVCA 1JQDA 2RGAA 1KMMA 1YACA 3FOWA 5B1DA 1W93A 3A4TA 1SZDA 1BJTA 4B4VA 1X15A 3SJCA 4JU8A 3T4PA 3MF4A 5A4DA 2VK1A 4QSHA 1DOHA 1GXSA 1GRRA 1M8KA 4RHUA 3LLCA 4HUQA 1KZYC 4EX6A 3EPPA 4TS3A 5CNJA 2YYZA 3TR5A 3WRVA 3A1CA 3K4QA 5DKFA 4C1NA 2IIVA 3EPKA 3B1XA 4RGYA 4LMAA 4Y2PA 3UWKA 1N5DA 5I7WA 1GG5A 3JQ7A 2CFRA 4S0XA 1NN0A 1XVTA 4INAA 4XARA 3WDSA 4D9HA 2FMUA 2H7VA 2XB6A 4H7IA 4AMVA 3ZHRA 1GRCA 5K8LA 3NBXX 3HS3A 1JEOA 3MWGA 3OFKA 3HHEA 1FYWA 1OZGA 2PA3A 4MQ5A 3SVZA 3TUZC 1Z2PX 4JLAA 1VJDA 5GIPE 1DRJA 1B3RA 1P3JA 3G5TA 1UDWA 4JGBA 3IMGA 4W5JA 4ZT7A 2ZUSA 3RK4A 4C1BA 4NBVA 3U4MA 3HVRA 3I09A 4V0MA 4RWEA 3EW9A 4YJGB 4EO7A 3QA9A 3GQBB 5LYJF 2GZMA 3DBHA 2UYGA 2D2IA 3PENA 4WKCA 2DM6A 1LLDA 4RZHA 3VV2A 4P6VF 4E13A 2R62A 2WHPB 1Y3FE 4ENTA 3NVKI 1USUA 3RBZA 2I55A 2CDRA 3WYCA 4MV9A 3V8BA 1RE0A 1BE8A 3PCTA 3L40A 3QUTA 2NV2B 1TZMA 4JLNA 4FNMA 4AW9A 1MV5A 2NN3C 3IAM6 4ZDJA 3ZLJA 3PQDA 3B78A 3COPA 2RAPA 4JA2A 1CT9A 2J67A 3GV0A 2F8LA 3Q2KA 1JTFA 5FLXA 3RTCA 4MQMA 4H7PA 3P19A 5JBNA 4TTIA 2TRSB 3M34A 4NABA 4RDIA 1Z6QA 4YK7A 2VYFA 2VA9A 3IR5A 1GNLA 1V1MB 4OGLA 5L7YA 3TECE 3ANSA 3F5DA 4X0EA 5LMUB 1YBMA 4YO8A 1NXPA 3PSAA 3HVIA 2AN5A 1EDEA 2VPQA 2QRLA 3PLNA 4LVUA 2QXUA 2IFTA 1O6CA 4R1QA 4KR9A 3PC3A 1QIMA 1U0NA 3AL3A 3N0RA 4P3XA 2A5LA 1BW9A 1T8YA 5EHNA 1Q21A 4WFJA 4A6DA 1EFCA 2J3KA 1SAYA 1WKCA 4WADA 2W43A 4R1SA 3TD6A 3HGMA 1WXFA 3BMCA 3ZU5A 5LQDA 1W25A 2JIDA 5BSGA 2GTHA 3RAEC 5KVVA 1PR5A 3L1VA 5IYZB 2ZU0C 2Q3LA 3I72A 4OQMA 1D6NA 4MV3A 1C30B 4G86A 3K1AA 3EXEB 4Q3DA 2Q99A 1T2FA 5IJ0A 1E1QA 3JAMA 1NDHA 2DPLA 1RI5A 1OLXA 4HH4A 5AXDA 1E4EB 2GYWA 2VL7A 3DNFA 1DB3A 1Q50A 4LZAA 4QPDA 4RY2A 4DR6B 4N0DA 3D43A 4WWHA 5KYKA 1ILEA 2JFYA 2WUVA 2PFGA 2P67A 3FCEA 3OLZA 4FYHA 4EI9A 5CH3A 3B60A 3ICOA 3PGXA 4LMBA 4L7VA 1LX7A 3WE7A 2IYFA 2E4VA 2D59A 3BL8A 3RFXA 2VT2A 1JEDA 4MVJP 2OHJA 5ALIA 2UZ4A 2OLKA 4UM9B 2XZTA 3JZIA 2FX2A 4PCUA 5CK4A 1GZ3A 3CTMA 3L8ZA 3BMNA 3TVYA 1JXOA 1JHPA 5F4ZA 1DJLA 3QXGA 4HB2A 2VUTA 2ZRBA 5KAMA 4R3WA 3TD2A 5BW8A 1PE0A 1LRLA 4IMPA 3DEKA 2A0KA 3WRXA 3K9FC 3SMQA 1Q1AA 2QSUA 2R2AA 4KRYA 3TB4A 3QKUA 3D8SA 2CL7X 4JJEA 1R8XA 3DLHA 3ZJVA 3B1KA 1GPNA 4JA0A 4BLWA 5CDGA 4H35A 2AC4A 2GBLC 1ZJJA 3H05A 4J1TA 2ZRNA 4IGEA 3AETB 4L8FA 3KZ1E 3QIAA 3WA7A 1FXUA 1M1UA 2YBEA 2QRHA 3BMQB 4OYHA 5I7AA 2AMVA 3LL4A 3DPUA 2H3HA 2ZB2A 3O7WA 3OCJA 4R2KA 1AGYA 3ER9A 1PEYA 1T6YA 4BRZA 1PQPA 2RGRA 3N2NA 4JC5A 1NOKA 4RY0A 4UBOA 5EUQB 3V9PA 4BNJA 4H0NA 5TXGA 1ZUWA 2BI4A 1R5BA 4IG4A 4RSGA 4UASA 1KDZA 4LV6A 3RYHA 4DUZB 1P39A 1GZDA 3E2MA 3FCOA 2XOXA 5DFAA 4BVKA 2FN3A 2AOVA 4YLYA 2HDNB 2XYRA 2ZTUA 2R65A 5TS3A 3USCS 4QXPA 2VT6A 5FPHA 4LK3A 4O2BF 2OUIA 3W6ZA 4UDNA 1EKXA 1NF3A 4PLWA 4KN6A 1UFOA 3GCZA 1NSTA 1DDGA 2LIVA 3UWOA 1HDRA 1LBSA 1EJ6A 1NR7A 2AOUA 2ID8A 5DX1A 4QOGA 2YVAA 4TTPA 4BQRA 3CT4A 3RSHA 4ZHQB 3TKLA 1I5OA 3M6WA 5L7WA 4I9UA 1UK6A 5KJCA 2XNKA 4MKXA 4RPJA 1G64A 3ASUA 5FCDA 1SVUA 1E7RA 3RVPA 1OYYA 4PPFA 5HJ2A 2YVLA 2VR1A 2DWCA 1CF2O 1FBNA 1LWNA 1ZI6A 1KK1A 1YZTA 1CUDA 1L7AA 1CIJA 1JLKA 2HRCA 2A9VA 4HQRA 4PO1A 3RSSA 4F2GA 1KAGA 3HE3A 3CF2A 4WN9B 2AJBA 1GGVA 3HSYA 5LYJA 2ZSFA 3FTFA 4OBEA 4DLKA 2XX3A 1Z3CA 5CA0B 2BHRA 4KFUA 4KL8S 3IEXA 2XR1A 4EIWA 1P45A 1K63A 2W6ZA 3DXFA 2UUPA 1EK0A 2OYSA 1A0OA 3SF8A 6AT1A 3PQ4A 1KIAA 2ZU6A 1F4VA 4RKEA 4XYEA 1NLZA 1D9XA 2FPKA 2I78A 3AEUA 4PLTA 4YEDA 1SKBA 1CY4A 1MVNA 1X0VA 2IEDA 3KLMX 5L40A 1FJXA 2VOJA 4FBLA 3VO2A 2OB2A 5AUOB 2SNIE 1BSVA 4RVDA 2ZYAA 4PRZA 1FFBA 1OY1A 2QPTA 1H2HA 2ZAGA 1GQOA 1ZY2A 1GNVA 3CZ5A 3K09C 3RS5A 6YASA 2NZUG 1LGYA 4CQJA 5BRAA 2YVUA 3AFHA 4MUIA 3T1TA 4D9NA 4ZOCA 5ER6A 2P9GA 3CH4B 3IH5A 2RBEA 4M7RA 5AJXA 3BWMA 4ARAA 2QW1A 2YWEA 4Y2GA 3SLGA 4D02A 5JAMA 1P44A 3IE1A 1TA4A 2EXXA 3LPLA 3E18A 1UXIA 3JQBA 1IWBB 3KWLA 1USGA 3THXA 4KXQA 2Z2ZA 1TCVA 1JIQA 3AERB 2AZ4A 1N4DA 3HCCA 3FTPA 3P2JA 4JJFA 5TR9A 2ORWA 3KR1A 1K0FA 3A9UA 1UPXA 2PXCA 1PJQA 3RDPA 3MOGA 1R5NA 1YB7A 5DNDA 1WD7A 5HE9A 3VI3B 4J1SA 2X8WA 3HR4A 4AJ4A 5LR6A 3U6KA 3O5AA 1HM5A 2CLOB 3NH9A 4JS0A 3U4CA 1NVGA 2EBFX 3WMXA 5KPDA 3HBLA 1GNTA 1YI1A 1IOZA 4YJ3B 5CTAA 4YQYA 4YMSA 1L5NA 4AJPA 4EPWA 1H22A 5G41A 2P6UA 1Y9AA 4HXGA 4CMKA 1OH5A 4QQ8A 1I3MA 1UM9B 2PJZA 1OZ0A 2QM7A 3O4JA 3O2JA 4LYYA 2JARA 2PH1A 2PX6A 2JW5A 2XYGA 4CM5A 1R2QA 2FKNA 1BFDA 3RABA 3DPSA 2EFJA 3CUWA 3VJKA 1TO2E 2QPOA 3W6OA 1EVIA 4ZMBA 2W7TA 3H2KA 4MP6A 4ESEA 2G9QA 1TZBA 4B3JA 1AQ6A 1T5TA 3PFWO 4RA9A 5KNDH 1RJDA 4WGGA 1OH8A 4Q05A 4EJ6A 2RHWA 4IIYA 4XQ0A 3RS0A 1LNQA 1XEAA 3H4MA 3TLMA 4QHTA 3WOHA 4I3FA 3T9BA 1YF3A 2OC4A 1U4OA 1JNYA 1J0BA 3NRJA 4BKOA 1OLSA 2O7QA 1EGQA 4Q00A 3WQHA 1U2SA 3CWCA 1TPZA 2X2EA 3ESBA 4LZWA 1MB0A 1II8A 3B85A 3IALA 3COZA 5FR2A 3E2IA 4OYRA 3T9CA 3LP5A 2G71A 4RKYA 5KIAA 1ADFA 3Q3VA 1IIRA 2XNDA 3L3BA 1XXLA 4QXOA 1FRVA 1CZHA 1WP4A 1J5XA 1IUOA 2ZRMA 3SZOA 1VRCA 2GWHA 2R4QA 1XYYA 1YR1A 5G2OA 5LXTA 2NP7A 1BVRA 2OY0A 4UHKA 1YRHA 4JBNA 5HQJA 1YB2A 4PLFA 1OX4B 4B46A 4X60A 5JPCA 4FW8A 4L5IA 3NVMB 3UQYS 5KHLB 4HNQA 3VU8A 3L1JA 1UBMS 2AC2A 2X8JB 1MT0A 4L27A 1U8CB 3QOWA 2QD5A 3B1FA 5JPIA 1T8UA 4DE5A 3SDSA 2QJRA 3FR7A 4OQ4A 3ZHSA 4ZI3A 3AK4A 3Q88A 2P0YA 3CPJB 1XKLA 3UJ6A 1DT5A 1XQVA 2A59A 3QPAA 3WMRA 1A5BB 3NAMA 2RI1A 4O2BA 4DBZA 4TGLA 2H17A 3QF4B 1KEEA 1Z6PA 1EFHA 2J3MA 1RFLA 3C5EA 2OHGA 3H5WA 3I9MA 4CMIB 4DCVA 5J59A 2EHDA 3RD5A 1V7QA 1T4DA 1NBEA 1RJEA 5IUNC 2EC5A 4DY6A 4L08A 5IVDA 2J3QA 1UDRA 2NO1A 1G16A 4LDAA 4URXR 4I6GA 1DEXA 3ONWA 3E22A 3ZK9A 4ER7A 1P4JA 1U2TA 5IEJA 1T13A 2E37A 2CDAA 1ICEA 2O3TA 4RGQA 1PZHA 1U5CA 1D2HA 3SD7A 4RIIA 1GG9A 3JTEA 4M37A 2G1UA 5EEGA 1I6MA 1MAHA 3KPVA 2IW3A 1U8TA 2RGBA 5AUPB 2ZB3A 2ZT7A 3N70A 3NHWA 1X7XB 4AXBA 1G2QA 2YW2A 1KP2A 3IELA 3PA6A 5KOJB 4PYOA 4Q4HA 3LGXA 4IS2A 2IH5A 1PKXA 1AQLA 4IUCS 4P58A 4P32A 1UBGA 1PWHA 3RANA 2QAGC 4JT2A 1GQ2A 4K26A 1BN7A 5H80A 1N2OA 3AKCA 5ELLA 3AMVA 1AZTA 3ZCTA 4R9UC 4YRBA 1Q91A 1Q0TA 4HVTA 1X1TA 3RRBA 3RVMA 2QAIA 5CG1A 4L3VA 2SKEA 4RHYA 1KFKB 3BK2A 4NIMA 3P0HA 4HGNA 4ITRC 1QYVA 3TZEA 1CS0B 4RDHA 4DV4B 4P93A 1AO0A 1E99A 1TAUA 3I9KA 4G5SA 2HGSA 4IV5A 5EVCA 4ZVMA 3X1DA 4YRAA 4J6EA 3JZFA 2GD1O 1SVLA 3PP8A 4M55A 4QU5A 2LV8A 4QELA 4RABA 5D6OA 4CLRB 1AKWA 3LHFA 5COAA 3WGKA 6REQB 3UGJA 2EQBA 2FQWA 3U7QA 4DQXA 1B6SA 1D6MA 1G6OA 3ZZ0A 2J5BA 2XB8A 5H4GA 2IEAA 3P9NA 1EVEA 2QMEA 2HFJA 4HNHA 1YV9A 1HE4A 4IEFB 4O1HA 3UJDA 5I6DA 4MHTA 4P7GA 1EFTA 2XQVA 4M9CA 4UULA 1VM6A 4R6WA 3C6KA 1Z47A 4FYXA 5T4BA 3I92A 3LPCA 4QJ4A 4DREA 4D41A 2XCSB 2BYTA 3ZLTA 4B7ZA 5HMMA 1ZVKA 1BKDR 1VBMA 2WSIA 1U3WA 2CL0X 3E27A 4WZBA 3AIMA 1NVAA 4UTRA 3HR7A 2ZSUA 3VR1A 1N33B 5B6PA 3A9CA 3WLNA 3SE0A 2DOKA 2D3TA 4BVHA 2WUEA 4N8DA 4MHSA 2D1QA 5BN1A 4IOKA 5HZKA 2BGIA 1IULA 2BC9A 3RJTA 5JCOC 1B2LA 5KHAA 1MQ9A 2R751 5BYBA 1PT7A 4IDQA 5HSGA 3W5AA 4I50B 5IDQA 3FBGA 2G0NA 2IWHA 3UWDA 4X6XA 3R7SA 1CPYA 3C8UA 3U0VA 1M83A 5BT9A 1F8UA 3NKLA 2X6RA 1ZR4A 1CWUA 1GNPA 1GZVA 3FGZA 4PG7A 4BVGA 4W5TA 4KQGA 5TJHA 2I1WA 3QSGA 2PS1A 1L8AA 3VR3A 4Z49A 5JAHA 1DKMA 2WZBA 5A1JA 1RP1A 2YY5A 3PV0A 4LJ7A 4X6UA 4BNMA 1GTSA 2VJMB 1DLJA 1XIVA 3G7UA 3IE2A 3K5PA 3PHJA 2HXYA 2OHHA 3T3OA 4RTPA 3BB1A 2BFNA 1W46A 5KC9A 3T4XA 3PUWA 3NHLA 3QVGB 4GOXA 3ZHXA 4U02A 2Q6VA 3CMMA 3L84A 3PDWA 4N6OA 1IEQA 1NUSA 1DELA 1Q6YA 5TS2A 4XRGA 5I9IA 2PZJA 3ZS8A 5G4KA 3KFXA 2BR3A 3A9RA 4F91B 3W6UA 1DG1G 4EUFA 1H2XA 1ID1A 4GOKA 4INPA 1R16A 1SKYB 1YDGA 3H1GA 4ZCIA 1JHOA 3QP9A 4UUNA 7REQB 7ABPA 4XYMA 4KWEA 3L7LA 4ZGBA 1XWWA 3V1TC 3U60B 3W5BA 1NF9A 1HEYA 2B30A 5BSFA 5IABA 1SVKA 4AY5A 1Z0DA 2VYQA 1ACJA 4GIBA 1I24A 1XLUA 1RHKA 2AFHE 5CYPA 4PQRA 3PYXA 4WERA 1K5GA 1QQ6A 1BCRB 3GCDA 5FULA 2AZMA 4WUVA 2D1FA 3CB2A 4MIYA 2IS6A 1JFFA 1TJYA 4OXQA 1LZLA 2IHZA 3BD7A 5GV8A 1OI4A 4NJEA 3LUPA 3L1UA 3SZGA 4EDHA 3GFRA 1CQIA 4ZT6A 1NAIA 1LTQA 1N32B 1YTLA 3MTEA 4D9BA 3NTXA 3T9AA 2YJZA 4KH0A 3A6DA 3GRAA 5L3QA 3I9LA 1L7BA 3WGOA 4ID3A 1AUVA 1UMKA 4DNXA 4AJNA 3AFIA 4ZU1X 1S9DA 2Y2UA 4Q4JA 2X9QA 2DCMA 1KYTA 3W5JA 3ND9A 2VSFA 1V9CA 1HDXA 4K9NA 2QVYX 4QYMA 1L8OA 4KPUB 4MWEA 3V00A 3CNLA 4BN5A 2VHWA 2WFLA 2NXWA 4R2LA 5C46F 2Q27A 3ZGZA 1O95D 1ZK2A 1XRNA 3K16A 1RC8A 1R0WA 5ESWA 1Q22A 4GEKA 2X0RA 1VFNA 1ECBA 2HIGA 3MRSA 2CNDA 5GONF 4NG4A 4AT1A 3HCWA 3H5TA 2ADMA 5FFNA 4RTSA 4L73A 2R9VA 2JLVA 3SYTA 2HIHA 2F1OA 5EJIA 3U37A 2WU0A 1MOSA 1Z26A 1BX0A 2Z2XA 3FF4A 5E2IA 2YCBA 1ZLYA 3FUXA 1LDGA 1ZU4A 4YCNA 2PBFA 4O3MA 2FJ0A 3DFMA 3KZXA 4EGCB 2A92A 4UM8B 5AW5A 5JD4A 1AKQA 1YJ5A 1YS9A 2JJ8A 4M46A 5ENVA 1MJGA 1YZGA 2HDOA 4HBZA 2D4AA 1XNJA 3DBLA 2C59A 2G04A 1W36D 4MB0A 3BXEA 4P83A 4L78A 3JY6A 2C9BA 1UK9A 1C7JA 1MORA 2IUYA 3DV0B 4Y6SA 2P6RA 1JP7A 1WB5A 2ZJ6A 3TOXA 3BTSA 4P31A 1U8ZA 4EMTA 5CA1F 4OXKA 1LDNA 1U3FA 1QZZA 2RDMA 3G2HA 2ZYIA 1HEIA 3B9BA 2J0SA 4L2IA 1QXSA 4YVFA 2OORC 3QLEA 3T54A 4RX1A 1U8FO 2X42A 4OOFA 1WCV1 4POOA 3R9XA 1M0TA 4OHCA 2XDWA 4B76A 1E2JA 2D0IA 1JALA 4K9PA 1RQ7A 2O5EA 1NW5A 1W30A 4RIHA 2AJLI 4C7KA 3QJ5A 1OYOA 2AWNA 4L5BA 3HY6A 2QE6A 5KWVA 1JEJA 1X6VA 3MSCA 1SUIA 1CUCA 4ZJYA 1QHEA 1JJVA 2R7MA 2F9MA 1RLJA 2OB1A 3GI1A 4BMVA 1T4MA 1S3SA 3B7GA 3BCSA 1E62A 3NWEA 4MMXB 3HSKA 2RJOA 4UKDA 2QU7A 3FYHA 3E7PA 3V9AA 2QYSA 3FGNA 4Q6BA 3I01A 4MRNA 2IKSA 2ENWA 3DYIA 1XMSA 2AZTA 1I0LA 1VL6A 3HEMA 1KEZA 3OZUA 1W88A 1JLLB 1IWOA 1Z6TA 3NBMA 4FP9A 1R0SA 3OMXA 2HM7A 3D4LA 2QVBA 3X1XA 1MG0A 1Z5PA 2K2QB 1DAFA 2QEQA 3MLBA 1XZ8A 3GJSA 2QX7A 4N5DA 1GR0A 1PFWA 2ISSD 4FI3C 3VTZA 2VPYA 4WZAE 2IXAA 3VZPA 4EKEA 1P6UA 5JWRA 5JDIA 2KPOA 1W1WA 1KSHA 4AZTA 1KI7A 1KZ7B 2EYQA 2QPLA 4MR7B 4N3GA 1RJFA 2UZAA 1KAHA 3TIGA 4FCTA 1YFZA 3INGA 3JATA 2Q50A 2BGWA 4W9MC 1SC4A 1Q17A 3ORHA 4TKLA 3T61A 4WUTA 2PMCA 2R8OA 3RUEA 4N3CA 3SKXA 3AHHA 3NBFA 2YJGA 3DOIA 3V4FA 1T10A 2J0EA 4R1OA 5CX1B 3FWKA 4DSUA 5LDGA 3KXIA 4RV5A 5JCXA 3UG6A 4RHFA 4K7JA 3EVFA 1BEZA 3VR4A 1Q0PA 2QUJA 3B3QA 3WK8A 5JSZB 4FFVA 1V3UA 1V1RB 4YCSA 1NXOA 2OHIA 2ZYVX 1U99A 1KVTA 2C0QA 5C1IA 2O8VA 3FYDA 4LF8B 3BWCA 4IDEA 4FEEA 3UMYA 1YFKA 3AOEA 3H75A 1WTCA 2IXGA 3EMDA 3D4BA 2ZQ5A 2OCKA 2JI6A 1I01A 3D54D 3R3WA 4LCEA 5HF5A 5IBQA 1DO8A 1QU3A 1ZNZA 3QVUA 5CPBA 2BHNA 1CUFA 4QJIA 5HIAA 1E9VA 1QIKA 2RGNA 3KPUA 3QVXA 4FILA 2IU0A 5LDDC 3DMTC 3HYRA 2NTJA 3DLBA 3VDNB 1NUAA 1YGYA 1KS2A 1GAQA 1H1LA 2ZM6B 5CVDA 1EX1A 1ZMRA 1TRKA 2QRNA 3FHOA 3TNJA 2PCJA 3Q5DA 5KTTA 4XDGA 3Q0TA 2NSJA 3B2EA 3ORSA 2I65A 2Q4TA 4HXEB 4DDKA 3M9XA 4RMNA 4A1FA 3THSA 4RK0A 2H7YA 1SHZA 4M54A 3U7JA 2GXUA 3CEJA 4L4UA 3VPGA 1KH3A 2VP6A 2PN1A 1XTSA 1EFVA 3HA2A 3HJCA 3K8OE 4TROA 3WIDA 3M5WA 2ZSBA 3AUAA 5GONA 2FFQA 1J0CA 3U7RA 2CYCA 4K87A 4A3SA 4AJLA 2MHCA 3JPWA 5HFAA 4EY3A 3DKIA 3ELUA 3QX7A 3IPXA 1Z28A 1BYUA 3JYOA 3BEDA 1RZ3A 1FSGA 1NW9B 2GN8A 3H0CA 4DDUA 3EZNA 5FBZA 2O8DA 3LUDA 4JI8B 1OUMA 5DYWA 4C9BA 4TMVA 1J7KA 4B7AA 2Q3HA 4ZIRB 1MO4A 1Y3CE 5B3LA 1H6DA 3O8DA 1NRXA 4M21A 4Y7DA 5JMTA 5AVKA 1SMKA 2GAIA 4R54A 5DSZA 5BUSA 5LUAA 1QTQA 1SD1A 3GLFB 1OFUX 2J30A 3R6TA 2A7QA 1QVRA 3DB1A 2GJKA 3OE5A 3M6FA 1U7ZA 4TS4A 3RSLA 1UP7A 3F7MA 4YDHB 4XGRA 3V8VA 5CA1A 3HBNA 4TSKA 1ECLA 4JI4B 5DNYB 1DDOA 2XMDA 4W7SA 4LF4B 3X3HA 5HZHA 3THRA 2PU5A 1CUBA 4IDGA 1S2LA 2C9DA 4ER3A 1A5TA 1FU8A 2O59A 5IBRA 2NU9A 3R8FA 1ZD5A 3BC1A 4X54A 3HCAA 4RCYA 4D8UA 3IEIA 1N0UA 3D6VA 4EYOA 4KJZA 4BWGA 1U8EA 3D3WA 5TT1A 4P54A 5EWJB 2Z4RA 4DMLA 4N82A 1Q6ZA 3OWHA 2OGSA 1YE3A 3LLUA 4TKUB 3OEHD 4HQ6A 5I9SA 1WD5A 3E9CA 3GO4A 3JWPA 2FQXA 3ZDZB 2WYOA 5HEKA 5IZCC 3RWBA 4YP6A 2YQ4A 1CJUC 1JKIA 2D5LA 3QELB 4J2OA 4WK2B 3L8GA 3LDAA 1N5LA 4JVOA 4HQNA 4A92A 4XVCA 4HWKA 3DDHA 4TWJA 3HNPA 1FEZA 2OBFA 4HT3B 1IVSA 5E1OA 3HY4A 4EG3A 2O14A 3HMKA 3KQSA 3S99A 3HU5A 1Z4KA 3HKBB 3GAZA 4KR2A 2O8BA 1DBVO 3FGOA 2UXCB 2JASA 4S1VA 3SNHA 4RENA 4FONA 1T2UA 2J9ZB 5D1HA 4ENSA 5KJFA 2BEUB 2BDTA 4PQGA 1LSSA 3NWJA 4M6WB 4AS2A 3R3ZA 3GLIB 1UBHS 4RHTA 1QIDA 1DG3A 2A4MA 1ZN2A 3DWEX 3G1TA 3IT0A 1J8MF 2Q7DA 2B6HA 3WDMA 2GARA 3BN3A 4BQSA 3DMRA 1QVVA 4AJKA 4GDMA 3ND7A 1D04A 1ONOA 1P0FA 3OT1B 5FWXB 1C0IA 1XDZA 5EJAA 5J2UF 1YTUA 1OAOA 3D8BA 4EHFA 4NHOA 3IBGA 1VLLA 1TUIA 2Z3WA 4DKJA 4FFLA 4AULA 1ZVMA 1BGXT 3U3OA 3ZCVA 4A9AA 4J0EA 2A9JA 2BFFA 3K72B 5FT9A 2JLRA 3A3NA 4G5OA 1TUGA 2FUCA 4KQMA 1U0EA 2DLDA 1J1IA 1BXRA 1G8HA 1OZAA 4I1UA 4QQKA 4Y1EA 2WYIA 4H7EA 1MNAA 4J49A 3TE6A 1T35A 1NIPA 2GN0A 3C8DA 1YKSA 1B8PA 3ESDA 2WJYA 2XSZD 2GTIA 5BUCA 4RK5A 3S29A 3RV4A 3VTFA 2PCLA 1OIVA 4H6XA 5CT9A 2PKQP 1HKUA 1U2GA 2V7TA 3L1HA 4QOJA 3HJNA 5IFLA 3GLTA 2C57A 3KXDA 3OKAA 4K2HA 1ZUIA 1R50A 1KTVA 1J39A 1W2HA 4NL4H 5HILA 3JQ6A 2G1KA 2ZPUA 4IIXA 3DOOA 4MR8A 2QQ0A 4K88A 5B2ZA 3RJZA 5HX7A 1V5IA 1NXVA 3T41A 1SIWA 1FLVA 2FPIA 3UQZA 3NT4A 2GHQA 3E3MA 3FW1A 2EP7A 1G60A 3ONVA 3MMPA 4MRMA 4TMTA 1ISPA 1LH0A 1XF1A 3KYCB 1LJUA 1YL5A 2P2GA 2Y0CA 3BILA 1JYEA 2BZSA 3VOAA 3FTQA 5HIMA 5I4IA 2P6NA 1JH8A 3G2PA 1OWMA 2FPUA 2G7ZA 2IYPA 1NFQA 3HDHA 3PC8A 3A14A 1OV6A 1ST3A 4OFXA 5DN6D 3NRBA 1M1YB 1WUHS 1KZ4A 1QKIA 2PXXA 2H07A 2QB5A 4XGNA 2HWXA 4ZA2A 4G5RA 3PDJA 3P9CA 1HLPA 3JWGA 3K53A 3ABIA 2GZ2A 2HDHA 4L4ZA 4LG1A 5LL6P 5GZ6A 1TOAA 3EVDA 3R3UA 3GXOA 2CD7A 4M1TA 4E5MA 5IDXA 2WPDD 1JEQA 3HMQA 2XTMA 3Q98A 3H17A 3R7DA 4EEXA 4YMTA 4UU0A 5BQ5A 1LSJA 1W1UA 3DXZA 4G5GA 4C0AC 1M73E 4AAYA 5JNRA 3HUDA 5FBQB 1YH3A 5CLGA 4GE0A 1G6Q1 4KR3A 2D5AA 3CZ9A 4BDSA 4ZT4A 5B7GA 3MHTA 4QAQA 1UJNA 4BMZA 3RS4A 3H6HA 1Q1ZA 2C5LA 1SBQA 2NUTB 2ZSKA 2YXBA 3QLUC 5FP0A 2QIOA 3BX1A 4CNQA 4V3BA 4I81A 5EGSA 3AY6A 5JAUA 2XDQA 2YWFA 3WWZA 3FPKA 2WHQA 2GSDA 2ZUDA 2HJSA 2VDKB 3ROEA 3B3FA 2R7AA 1KF0A 1NXTA 4JWTA 4JL5A 1DDIA 2VHVA 4II3A 1HFWA 3SY8A 4C7MA 5BMVF 4QLAA 3RHTA 1JBKA 1R6AA 2ODBA 3OJWA 3GHYA 1VGQA 5EXXA 5LBIA 3T5CA 3HYSA 4QHSA 5EKDA 4RTMA 1H5UA 1JW9B 4MB2A 3TINA 3UJBA 4WKNA 3PDCA 5DTEA 3H4VA 3T5DA 1P81A 4DA0A 1VYHA 8LDHA 1YNOA 4OGFA 3EE6A 4ZAGA 1XT6A 1WW2A 1ZG3A 4LC0A 1XPOA 1S3IA 4BEWA 3GJXC 4JLSA 1R8YA 4GVXA 2PKEA 2AQHA 2EOAA 4YWJA 4EB3A 3SQXA 1KHTA 2B3TA 2IUEA 3QNWA 3BZWA 1N9ZA 3FTEA 4U7JA 1O4VA 3DE3X 3RIMA 3PNBA 5DASA 2GN6A 4WXRA 4F6LA 4P3OA 3ILSA 2ZUEA 2FZWA 3SS9X 1DQPA 3CEAA 5DSTA 2VDJA 2JCGA 5KNDD 4CEJB 3DWGA 4I8XA 2XWQA 2Q5IA 3EC1A 2IU6A 1PT9A 1U0LA 4G41A 4YJ2B 5AOVA 3V2HA 1SY7A 2DHCA 1VGRA 1SBTA 1ZK0A 2ENUA 3LJKA 3DTVD 3IJRA 3RO7A 3AVUA 2IYWA 3IVMA 4TRRA 1ORDA 1IHXA 2K2WA 5U9CA 5L95A 5J2UA 1ORIA 1RCUA 1PJRA 5ALWA 4L6CA 3PJFA 4KBFA 4AQ7A 3N5KA 1K4MA 3EOAI 1PJSA 3LXMA 4CM4A 4XE5A 4LQLA 2O3UA 1UJMA 3MILA 4FYYA 1JGTA 3WQBA 2R86A 2R7NA 2HO4A 1W44A 2BEWA 2PL5A 3EGDB 4QUAA 4L9SA 1KR2A 1WMBA 1LSOA 2R87A 1Z5GA 3MWJA 1Y3HA 5K3FA 4RADA 5IXSA 1Q0RA 4BLQA 1M75A 3ONNA 3BFVA 4GRDA 4PSAA 3RV3A 4DWJA 3WWEA 3IERA 1LTKA 1X1QA 5KYXA 1H65A 1YO6A 4TM8A 4U39A 3AJDA 4I3HA 5JAIA 3JRNA 1PNOA 2W22A 1KJ9A 3IAXA 4JP2A 2FQQA 1HTWA 3FF1A 1UK8A 4MUNA 1EXVA 3WLKX 3JQPA 4EPVA 1W0JA 2GDZA 2FDXA 3PPXA 3GLHA 3QVWA 4FYIA 4I3GA 4L7QA 4WBSA 5LZ5A 4RJTA 4I9FA 4V2UA 1NASA 5IMBA 2WYHA 2CHFA 4EL0A 2C2XA 2XXJA 2REOA 5T4HA 4OHFA 4RD3A 2DWOA 2ZYGA 2VH2A 1WZUA 2IX3A 2KSQA 2R97A 2V55B 3QBDA 4QDXA 3EGWA 5CFMA 5H7XA 4LGCA 1QHFA 3CSUA 1Q0LA 2GVDC 1V6AA 1W8DA 3KAPA 1KI2A 1XZDA 4RK6A 4AU1A 1L4HA 1H94A 2ZETA 3CLHA 3NWPA 4DJ5X 4RE6A 1JU9A 3Q8XB 1EUCB 1DBIA 5EE9A 3W7AA 4JYAB 3QFRA 2OCAA 1VYUA 4CIXA 4RMJA 3NM4A 2ZTMA 3IO3A 5G0WA 2GKSA 4BFLA 4WESA 2R1TA 2XODA 3E70C 4E46A 3F8TA 4Q3OA 4YQEA 1F12A 1PGNA 1MJFA 4JJ6A 3AU8A 3JARA 3LD9A 3IV7A 3O3NB 2AUNA 2G07A 3JQQA 2J31A 1GDDA 1YIOA 2AYXA 2QZPA 2BFPA 1BQ3A 2XE6A 3D0QA 4MV6A 3QTTA 4Q47A 5LJIA 3VAZA 1U0BB 2E4ZA 2VJKA 4WV3A 5DYNA 4ARCA 2P2NA 3L6OO 3PSHA 3M3HA 4YUVA 3ET5A 2Z57A 4M0MA 3H65A 1U5AA 4KQIA 2C4WA 4LDJA 1TKBA 1RAGA 4MQ6A 3F5QA 3EVAA 4D1YA 1FFGA 3OF2A 3GNLA 1IN7A 3FMIA 2P3LA 5CVEA 1TJ4A 3KTAA 4AZSA 5AHXA 2PGOA 1SWWA 1GU1A 2PJDA 4GM0A 2X0FA 1BD3A 3K4HA 1FX0A 3BDIA 2EU8A 1B1CA 3GARA 3BQ9A 3DTNA 4FFSA 4CTNA 2Q5HA 4WH0A 4J90A 2XUOA 1JR3D 4ZD6A 1EAYA 1TIKA 4UOQA 2BUBA 1L1EA 3ZPXA 3CVXA 2IYQA 2H1LA 5BMVA 1Q15A 1CERA 2OV6A 3ZWPA 5K0TA 1E7SA 3BSWA 3LC2O 5DWDA 4NU6A 4NMXB 2Y27A 1GXSB 1WVIA 2WTBA 1J9EA 3NBZC 3JWIA 3ZHCA 4YRGA 5H5JA 5C51B 2QM8A 3BH0A 2JATA 1CVLA 4HUQB 1WHSA 4LX8A 3R74A 1G6KA 1G21E 3NT5A 3L1IA 4LDRA 1U28C 3ZDYB 1KC3A 1PTJA 4X8MA 1EFAA 4KBGA 1V26A 5HBGA 4ED9A 1IN4A 1T1JA 1TGYA 1WMAA 2P4UA 3SC6A 4BVFA 1DQYA 1E2HA 4UEWA 1MRZA 5DT9A 1UEXC 3IULA 4M7PA 2ZTHA 3GJTA 4E11A 3EDYA 5GTDA 5EJ4A 5HJ7A 1H8HA 2HU2A 3LM8A 1VHJA 3ZY5A 1LF0A 1ZU5A 2EJCA 1G21A 1QHHA 1T1SA 3FLMA 4H9GA 4QO8A 2MCFA 4D3SA 4EY5A 4U2FA 2WJWA 4MGYR 2WU4A 1FU7A 4MH0R 1F2TA 2DTDA 2VCEA 3OMWA 4TQUS 2IXBA 1E2KA 3DBHB 1RXWA 4HPWA 3NDJA 3DZBA 1FSPA 1ZOOA 1QOQB 1JA1A 5DGCA 4MITA 2HXGA 5LQMA 1IBLB 5AW3A 4FZ3A 5K3DA 3W1WA 1QTIA 4CG0A 2EHJA 2X0IA 4DCNA 4NYMQ 1HNZB 4IEIA 1MO3A 1ZC3A 2N0SA 4YCMA 3FSRA 3UW3A 4KRFA 1HFEL 3EZFA 1CEXA 3GJ7A 1KOJA 4OHPA 1SULA 3TLGB 3HYTA 1Y42X 4C0XA 1DX9A 4FEYA 2ZYDA 4D6XA 1AIPA 3E8SA 2ZREA 4F4CA 3VPCA 4G1EB 2PS0A 2ZXEA 2N42A 4HZGA 3AZQA 3I6MA 3DDSA 3ISTA 1F6BA 1YMVA 3CO0S 4HJRA 3K31A 5EMNA 5FPSA 3TL3A 4CF7A 2X9LA 2H2FA 4OFWA 5G3YA 3RLIA 2EZ9A 5CH8A 2B3DA 1WV0A 2VFAA 4M1ZA 1Z7YA 4LZNA 4MV8A 1JH9A 1MD9A 3PGVA 5ADUS 2Z3ZA 1B8OA 3V7YA 2IUFA 4O25A 3Q41A 5JE8A 4DA9A 2XUJA 3EEBA 2C29D 4IZOA 1VJTA 5KB3A 4IV8A 5KJEA 3BMCB 1F5NA 3ZQKA 4MDEA 4JUAA 1GCOA 1HLGA 5ALGA 5AI9A 5AW2A 1KZ1A 2EYUA 4WCDA 1J1UA 3LI2A 3Q9UA 1XHFA 4TZKA 3W9SA 2BM1A 3GFPA 4KJXA 4MUGA 4RUKA 3WKAA 3SS7X 3VR0A 2XTAA 3K1AB 5GOZA 3ITDA 1UXJA 3DONA 5IJ0B 4Q1DA 2QUKA 2RHJA 4O8CA 3MGCA 3Q7EA 2XHEA 5EIBD 2Q46A 4D99A 3HBMA 4GBGA 4D0GA 1BVYF 3I83A 3LHSA 1DAIA 4GI1A 3RVDA 4B6FA 2IGTA 1EWKA 2ZJ2A 1KC1A 2X7JA 3FKQA 3G2NA 3WLEA 5BQFA 2ZT5A 4MRPA 4MZXA 1YULA 1E96A 3GGDA 1ULZA 2VHTA 1AC5A 2Q5LA 4YUYA 2Q3EA 3ZZMA 3PS9A 1ULAA 3D7KA 4WJKB 2Z9CA 2XGSA 1RZVA 4OQFA 1EDOA 1EVYA 1ZBQA 2Z04A 4ZMRA 4RXTA 2FF5A 2PLWA 1VJ0A 4D8WA 3O91A 3RSGA 1EX6A 4U7WA 3SQMA 3M9WA 4ALIA 1FTQA 4G0PA 4IWYA 4G8CA 1Y3AA 2Z98A 3IEUA 1E4OA 1OQAA 1HYGA 1HFKA 4HEA1 1TTHA 2ZVDA 1HT0A 1XOIA 1FPQA 2ZRIA 3JQGA 4HVAA 5KVCA 3D7MA 4ND5A 4S24A 4FDUA 2V7VA 3ZI0A 4HQ0A 3ZGVA 2WMYA 4QHYA 4DS3A 3ECSA 3CVOA 3PGMA 1YQEA 5EIFA 1T9DA 3NDRA 3NHJA 4Z0TA 4ISCA 1OR8A 2C1XA 2C7PA 3PWZA 2JB9A 1XTBA 4R68A 3IV6A 2PM8A 3VNRA 1X86B 4RHXA 2TMYA 4PYIA 5C5EA 3VSCA 1CQXA 2MR5A 4KW7A 2DFLA 4J7AA 3F98A 4J3NA 4BX9A 4H77A 3RYHB 3KUCA 5EMKA 2GPSA 2BSXA 4JP8A 4IM7A 4MB6A 3VFDA 3PGJA 3ITEA 3VOTA 1N8KA 4GT1A 1J97A 3B3JA 3CCBA 4UMVA 4KV7A 5FL7A 4P0QB 2B2CA 2Z5GA 3ETNA 4CVNA 1AOXA 2W70A 1J20A 2PK3A 3C6BA 2AOUB 2G0AA 2P41A 3PIIA 4CIWA 5IWCA 1T24A 4WKBA 4XJVA 2BR4A 3ZV4A 1WPXA 1YD7A 3MIZA 1JVBA 1NP6A 2KBEA 2HCFA 4N5IX 1XSEA 4FHZA 4EFDA 2ZR8A 1EJ0A 5CEFA 1KZGB 3K05A 2XZOA 3ZHYA 2QL7A 5AJYA 5JYDA 5D3MA 2FG5A 3GT7A 3O90A 3LA8A 2GDJA 1BMFA 3OTHA 3ROGA 1Q1GA 5LYJB 5ALHA 1U6JA 2H2AA 2OLJA 5AJUA 5ALFA 2B8NA 2HHLA 1RKVA 3SJBA 1Y3BE 5IT4A 2BHLA 4RYDA 1XPRA 2NNLD 2OFOA 2OYCA 4PLZA 4IRMA 4X97A 3F8WA 3X1MA 3SXJA 1R74A 2ANBA 4TN1A 2OZVA 4HN2A 3SF8B 1M1XB 1A9QA 2FW6A 2V1XA 3IBFA 1GPJA 4FLFA 4BMXA 1JTEA 4EARA 2I4RA 3MC1A 3PPVA 4JJ7A 3WGGA 3JVDA 4MQ4A 4U8GA 4MYRA 4CG3A 2X22A 1QO7A 3EGVA 5JSKA 5SZIA 1G9TA 2GEFA 1Z8NA 3IOYA 3PZRA 4MVJG 4M1MA 1DMRA 1E1NA 2E55A 5KQMA 5BMOA 1L4LA 1YB1A 1D4OA 1F4LA 3G8YA 4XB1A 1PR3A 1CR4A 3CXRA 2Q4BA 4TQAA 2G36A 4KDFA 1XQWA 4YAEA 1GRQA 2HPZA 5C5CA 1QPGA 1GTZA 2DUMA 2W9XA 1C9NA 4JQYA 2RGDA 3KDPA 5K8VA 4QM7A 4L07A 1P77A 1ZGAA 4BNKA 4PTYA 2VZEA 4D9GA 2NSLA 4MVJH 2QR3A 2XUFA 1ZCJA 3TZ6A 3G0BA 2VYND 1Y6JA 2C07A 1E66A 1UJ4A 2EW1A 2PD4A 1NL3A 2QRUA 3I2HA 4KUGA 3TTUA 2X5JO 3THXB 1THMA 1Q57A 2X8BA 3KQYA 1CSEE 5CYOA 4B8WA 1K88A 4IQFA 3KVVA 3EVCA 4X91A 3IEMA 2FE4A 1MC4A 3N8IA 4NX2A 4PSCA 1E94E 4L28A 4QT0A 3LRTA 4M0PA 3WBFA 1MZPA 2HK8A 4GKVA 1I7PA 1YZNA 5DBFA 3ZZNA 3M33A 1AM4D 4X85A 1VIAA 1DIBA 2OECA 5DM60 2WZQA 1J9ZA 3FVQA 2XOEA 3QVLA 4I9NA 4Q3EA 3ZHZA 1RQNA 2Q1YA 3KBOA 2DVMA 4QE3A 3RBAA 4Z4HA 1N2BA 1KVRA 2J46A 4KLAA 3RIXA 4H0CA 1INLA 1C1DA 2P9BA 1JSRA 2W2PA 4B2YA 3A1NA 2NPFA 5KTKA 3C7CB 3M83A 2I7XA 2IYZA 2CDBA 3JW8A 1DBWA 4IWXA 4EI7A 5JXGA 1YBVA 3EC2A 1MENA 1S02A 5E2AA 2F1HA 2RH4A 1EHCA 3BFPA 4RA9B 3R0ZA 1RMQA 1AGRA 2NO9A 2ZTVA 4AUNA 3TS1A 1RLUA 3VYUB 1CK4A 3IJEB 3P8ZA 4OSEA 1S2GA 2VEDA 5ERYA 3TSCA 4ARZA 1PG2A 1M66A 1XHEA 1OXXK 1OLSB 4UBJA 5E3JA 4B84A 2B1GA 4DCSA 4EI2A 1AZWA 1M2HA 1II8B 2NPOA 2V9ZA 1DO2A 1V47A 4X92A 1FDOA 3H5LA 4M1SA 5TVKA 3STUA 4EITA 3D4PA 4I14A 3CLSC 2GKGA 3BQMB 5F2OA 5ADHA 2EX4A 4PGFA 1VXOA 4G0OA 5B2EA 4B9EA 2NSHA 4C5BA 5LXTB 3KKOA 3A1WA 1PNQA 1PT5A 1G41A 2FOXA 3PYMA 1ACMA 2YWDA 4XR4A 1XKQA 1ADJA 2ZYSA 3KO8A 2ORIA 4RS4A 2O05A 1BU8A 2EIHA 1E2NA 3F5SA 4EYQA 3W34A 1RWNA 1N2CA 2EFDB 3AIOA 2WM8A 4XOIA 5BR1A 4O2BB 4IVPA 4E6PA 1KEEB 4ZO6A 4PHTA 1VLQA 3U26A 2WJPA 3K71B 3NC4A 1Z6XA 1FXWF 4YIHA 1LI7A 1QLHA 3DDWA 2C8JA 3DXXA 1SURA 4Q21A 4EY8A 4QGHA 2PEYA 5DYYA 3RF7A 4WPGA 1KETA 5KYUA 5AJWA 2E9SA 3R4VA 4LOLA 1TE2A 2EKZA 3GEDA 3PNMA 4WD3A 3IRVA 5REQA 1XF9A 3E22B 1COWA 3N7UA 1B0UA 3VR2A 5H02A 2CDCA 2P8JA 2W2LD 3ZEAA 4N49A 4Q9JA 4JB3A 4AXXA 2W2TA 5GM1A 1LVHA 5A5EA 1T5SA 2F59A 4LHWA 5IDVA 4QNRA 5FADA 3VOSA 3VVMA 2EGUA 3ROFA 3PE4A 4Q4HB 3MAAC 3OZAA 4BQEA 1KO5A 4WMLA 3K5IA 5TEVA 2CXHA 3C3MA 1JHXA 4C0SA 3ESAA 3VHLB 3I5AA 5HA5A 5CB4F 1O03A 1BGWA 1XZFA 2XWJI 4IQ8A 4GYYA 5DK6A 3DMHA 2D13A 2OK7A 5EIWA 3FSGD 2QRQA 1YMUA 3CEHA 1X74A 1WWKA 1SBYA 5GY7A 2JGIA 1R4NA 3II6X 2EL9A 2FXVA 1NVVQ 2FHPA 2V8BA 3UXYA 4CTMA 3ZGNA 2IP4A 4JSTA 2GXAA 3FHCB 1NDQA 4DXDA 5B3JA 1M0WA 3UPTA 4JJAA 4DWVA 1TUBA 3IDOA 4U3JB 2XBLA 1CUVA 3H4IA 3KOXA 2J6IA 1DRUA 1V48A 2XNSA 2KE5A 3ZE7A 3GRFA 4ZHSA 1DCMA 2O2YA 4ZQEA 3CX6A 3RIHA 3KVNA 1QQ7A 3OI7A 5FO1A 1GCGA 4MPPA 3JR7A 5JS2A 5B1YA 4WL0A 4W1RA 4NCNA 4KVFA 4RNCA 1XJQA 5EJ6A 4K46A 2ATVA 2FSVC 2Q6LA 3SKYA 2FETA 4I55F 4JYCA 4PO9A 3VH1A 3JRWA 2CJYA 1AF4A 4WZBB 5DRYA 1GZ7A 2HF7A 2Y05A 2ONYA 3D6HA 1NX6A 1RABA 1O96A 2H7CA 3CWZA 3KKNA 3MTBA 3EXHA 4IOJA 2VRBA 1A2QA 2VTEA 2OCBA 2Z2JA 3O26A 3OEHA 2WT8A 4UMDA 2YOHA 4G5FA 5H59A 4EOGA 2CHUA 4FGUA 2B69A 3DDOA 3E9DA 3GZ4A 4BVEA 4KEAA 3FUWA 5DWVA 4GPBA 1M1NA 1ENZA 3FYTA 5ER9A 4AF8A 2O06A 1NM5C 3EVNA 5LB2A 2MTBA 1KVSA 1HDOA 1L7VC 2RHDA 3BRQA 3PI7A 4B3SB 3O1HB 3CA8A 2V74B 1B2RA 3D2LA 2V03A 4XVUA 1JFRA 1F3LA 1NA5A 2C3UA 1UBNA 4UBIA 2AKEA 4HBGA 1DC7A 4HMQA 3KR2A 3MRVA 2HWWA 4PQYA 4JGIA 3HWWA 2PBLA 3D6NB 3CR7A 2JLAA 1EGVB 3FPCA 4I4LA 3KKQA 2XCLA 5K6TA 4AMZA 1KJZA 2H7XA 2JK1A 4QICA 3RRMA 1GT91 1MDFA 4KMRA 5DNUA 1FFEA 3UMMA 5IFKA 4ZC8A 4XX1A 1I33A 4MW5A 2XCQA 1ML4A 2CLDX 2CVOA 4OQEA 4TYPA 5KDLA 1L5GB 3VPDA 2WB4A 4DCCA 1UKVY 1Y1KE 5K09A 3OJCA 1LI5A 5C7IO 4CU2A 2JFOA 1SUFA 2N75A 2CVPA 1NUPA 5F1YA 2P3SA 5IKOA 4OSPA 4F84A 2P9EA 1A50B 4IGKA 1ZITA 2VRWA 3BSSA 3L4EA 3QFHA 3Q8LA 2OHOA 4REQA 3RK0A 1NMYA 2PH7A 2SICE 3DSRA 3MUNA 2Z08A 4R7GA 1DRWA 1H5NA 4Z8XA 5K0LA 4AUKA 3C3YA 2ZYUX 4FLMA 1H2YA 3WL6A 4ACBA 4EJMA 2BBSA 5IN4A 2HSZA 4FZJA 4IMIB 4FK8A 3V4RA 1G4AE 4Y1FA 3AR7A 3UWPA 1UC5B 2QLFA 3P2YA 1K5PA 1W19A 1XRSB 3MCTA 4GNRA 3QMVA 2ZJAA 2X3YA 4ZCTA 4OHKA 2O3SA 2CFTA 1JFFB 1FXWA 3UZUA 3WL8A 4INJA 4MLDA 3DEZA 5E4TA 2XBUA 4NJEB 3EIWA 4Q9HA 1V71A 4HX9A 4QO7A 5JW6A 4DMGA 2CNOA 1JR4A 2B83A 1SIBE 1XQ6A 5L3QB 3KQMA 1JJIA 2GZ1A 5BOSA 2RGEA 1SUCA 3BDAA 3LC7O 5IK2D 1FRNA 5EP2A 2BRUC 2HO5A 3AM5A 4TN5A 2DBRA 5TMDA 4Q4JB 4OY3A 2XF8A 4AECA 4NBLA 3ZVRA 2COEA 3A26A 4K28A 5T3UA 4CQMA 2GF0A 1YJAA 2H5JA 3A6GA 3MRXA 1K4KA 4AY4A 1J2RA 2GPWA 2GM9A 1COZA 5LQSA 2WFLB 2IEBA 4X1IA 3I64A 4BMDA 2Q3MA 3FBTA 5L6LB 4J6FA 1NSFA 3KLOA 4KB5A 3F7TA 1G55A 1Y7PA 2QT0A 5LP6F 2VRNA 3OBIA 1ZJWA 5CB4A 2WJ6A 5FOUA 1HBJA 3FCAA 6Q21A 1O95C 3FNRA 3P96A 3EBPA 6GPBA 2J7PD 3S1AB 3OQ6A 4AZWA 1JR2A 3E7DA 1DXHA 4J0KA 3JQAA 3INNA 5CVJA 3UMSA 6NULA 1HMYA 2ZIZA 1YQ9A 3GPCA 1N5IA 4JYPA 1GIAA 4RQAA 2AEEA 1MH9A 1E9BA 2E5FA 3G8CA 4JKOA 4QTTB 3SR0A 3JYPA 3PL1A 3WFZA 3ZOZA 5ICEA 1YR6A 3BCHA 1U2RA 1D3AA 1ZQ1A 2XUHA 2WD7A 3ABRB 3DBLB 4OQYA 3F6RA 4V0OA 2RHLA 5HMLA 3V3KA 1UPBA 3FNIA 5EJ8A 1JT9A 4UVDA 4Z4EA 1S0UA 4DG9A 5SY4A 3GEEA 1DFHA 2FX3A 3KV3O 3QA3E 1CZOA 4XTRA 5LZ7A 3T5GA 4D0SA 4DMKA 1V96A 1W36C 1U02A 1QDLB 1U5BA 4RH1A 1OWOA 3FRIA 4PFQA 5THQA 4M76B 2OENG 4L2IB 3KQNA 1V3TA 3V4PB 1FMCA 3F6BX 4MVJI 4Z53A 3LKDA 5AJVB 4AQDA 3WSWA 4Y8VA 3R9XB 5FTKA 4E33A 2XEDA 3EVZA 4QATA 4F72A 4ECAA 4I55A 1PFYA 3KE8A 4QNNA 2EKPA 5K2MA 1NC1A 4TYWA 1JPNA 3UCXA 5K9ZA 2DSNA 3E3OA 1L1RA 4KVZA 4B3RB 5CM8B 1REQA 2PUDA 3HB1A 2AQIA 5A7HA 1TLLA 3IQFA 2MDTA 3QKWA 4BLRA 2MSEB 5DISB 1VP9A 3OLWA 1MH1A 2O3JA 3D02A 2R8EA 4OHBA 5I9MA 3D6TB 5DGIA 4B73A 3SC4A 2XCRB 1E0JA 2OCXA 3ER6A 1WBJB 4IJWA 4Y6RA 1WBBA 2VJDA 4FC7A 4MS4B 3PRKE 2DECA 4CM9D 3NX4A 3I9V6 2BVNA 4LQ4A 4LNUA 1ZJYA 4AWAA 2QX9A 4OV6B 4B3CA 2P4SA 3TJMA 4EG4A 4ERXA 4BKRA 1UFKA 4HAVA 4ENUA 1JQAA 4D9FA 4M9UA 5DW0A 1W88B 1YKGA 2JKYA 3O75A 5JMPA 3HNRA 2OQVA 4XSHA 5JDCA 2PRSA 2XLCA 3MK31 4NJMA 4XASA 3B1VA 3KEMA 2AZXA 4C29A 3CISA 3BZUA 3KJHA 1DNPA 3L6RA 3BUSA 1O97C 3GP3A 3NUGA 1MAWA 4GX2A 2LIPA 2V6BA 2ZSIA 1GNSA 2WM3A 3TKYA 1NY5A 1HLDA 2XMPA 1EP1B 1PDVA 2WIJA 3AUTA 1QF6A 3RT1A 2X58A 1MEOA 3JATB 4HNGA 3U16A 1P9NA 3MD0A 4G0VA 4L6AA 3OHMA 1FP4A 3I2GA 4PC7A 5CVTA 1R0XA 3NB0A 4DTCA 2P2SA 4PC6A 3L4BC 3GEHA 1SCUB 1F0KA 4XIJA 1AQYA 2Q49A 3Q8WA 3B5JA 5LIRA 2FHSA 2C8KA 2ISQA 1ZQ9A 2YWJA 3QY9A 1OYWA 1AU9A 3T1OA 3DL0A 2XITA 2R6CA 3T0GA 2DWQA 4E5DA 1TEVA 3LFUA 4B2IA 1U80A 1E3TA 1ODCA 2IITA 5A4MS 4R51A 1RYZA 2WKWA 1MTZA 3BE6A 3L49A 4GYWA 1OW3B 2YBDA 2WVGA 3CF6R 3SLKA 3CWQA 1Z0ZA 1VBNA 1Y4UA 4F5WA 2XADA 1EESA 1DIHA 2WM2A 5EINA 3FZYA 3H9JA 3Q4GA 3VR6H 3GLGA 3PX2A 4EO4A 2BEJA 3O21A 4IH4A 1EWQA 2PSHA 3HXPA 2BKEA 3M6MD 5F1KA 3PFCA 3SIWA 3QBTA 1H1LB 2IZ0A 3H1EA 4UCWA 5EQFA 2WWVD 4AJ9A 2PLAA 2AFVA 8ABPA 3EWIA 4ZQFA 1M8GA 3G49A 3RU3A 4CM1A 1VL2A 2JBAA 3FJOA 2E1PA 3VNSA 1E0KA 5EPOA 5C4MA 1N34B 1NKTA 4UHHA 2FG7C 1VHWA 5LP6A 1YS1X 2O7SA 3W5CA 1EFVB 4LNAA 1E5TA 4B3IA 5CRIA 4NS4A 1B41A 4FIZA 1QF7A 4DV2B 4RKFA 1SHKA 3MCWA 3O4FA 2CVFA 4G25A 2JVIA 4JLJA 1JQEA 4HAWA 4I9HA 5I9LA 3SMVA 1G17A 2O8DB 2GASA 1A8SA 3MSXA 4X93A 5F73A 2ODTX 3V4VB 2YFYA 2VAVA 2ZI5A 1LDYA 1JB9A 1KSJA 3P9IA 5JRZA 2ZIWB 2VUSA 1IPHA 2ET6A 2ZAOA 2A5DA 4UCQA 1UDBA 3QOFA 4DRYA 5CA1B 2YYAA 3CH5A 1KDVA 3ZNOA 5DLYA 3KSDO 2HRBA 4JUIA 1SHJA 3X1KA 4ZPXA 2QX8A 1P75A 3BL6A 2OO3A 2P3OA 5CHYA 3S4YA 1P62B 1JR3A 1TYDE 1T3TA 3CU5A 3A4VA 3MWKA 3ZQ4A 2NU9B 4QOFA 5D84A 2HPHA 4M1QA 1NTOA 3OFJA 1A04A 4A8JB 4QUGA 4KTTE 5AQEA 4Q7QA 2HRQA 3D3WB 1VJGA 1XTPA 2HHAA 4Y0NA 4RANA 1HDYA 4TTTS 5AVTA 1BKYA 3RVOA 1R00A 1CIVA 3E3LA 2R84A 3GJZA 3BB4A 1BG6A 3BFKA 1G7CA 4CFZA 1JPJA 3HFJA 4RQTA 1U0FA 2V0GA 2GESA 3B6KA 4S1PA 2QJFA 5DF1A 5HIIA 2QQGA 3BRSA 3ZKWA 1QIHA 4AO8A 1XRQA 4GR5A 3D8RA 2JGLA 2IKQA 2YMPA 4K1XA 1YK1A 3B5EA 1IVYA 5B7QA 2C2KA 4NLLA 4TXJA 1KQFA 3B1JA 4ZZ0A 2O8BB 4OB7A 5LZ8A 1M5TA 1L1FA 4HAXA 4CMAA 1PFUA 4ZPJA 1OILA 2IL1A 3HRHA 4P5DA 4KGDA 4XM1A 3ENWA 4KQ1A 4RLQA 5E7QA 4D0RA 3DVSX 3FIUA 1S4QA 1FMLA 2DUNA 3IBCA 2Z6QA 1DKNA 4BBZA 2O2DA 1HE8B 3E6AA 3K2QA 3VMMA 1CU1A 2JJ1A 4FOLA 4PAOA 3ZWBA 4QDOA 5HCNA 1G3UA 2C00A 2PGJA 1NFRA 4QUDA 1U2EA 1GM5A 4E1BA 4HFMA 3P0RA 4BAGA 1GYPA 3KB8A 2LZ0A 5IC5A 1K68A 5T64A 3NO4A 2BFFB 1ZK4A 3KOZA 2ONZA 3FA2A 4UPVA 3L6EA 1BXRB 2X76A 4C6HA 2BGMA 1SCNE 4WA8A 4U4AA 1U7OA 3B13B 2EF0A 4XGQA 4C4AA 4II2A 4BNWA 3V7WA 4CWAA 2GHRA 3CEMA 3CB4A 2YTZA 3WSVA 3SFTA 4B80A 3IBSA 5PNTA 4W5HA 1XXHE 1QGAA 4A73A 5AI0A 3ESYA 1OPXA 5J4HA 1I7NA 2O5RA 2ZW9A 3PUJA 4RIFA 3NNNA 3R3SA 3ROTA 4WZ6A 4B74A 4CZ2A 1PV1A 2IODA 3DW1X 5FQOA 1YJBA 5CDFA 4MR9A 4JDUA 1EVJA 2GYYA 1SGWA 4MR8B 3FETA 3SF0A 1WBDA 3EDOA 3WNVA 5B64A 3KBBA 4NESA 1NOIA 4XB2A 3RFUA 2FPIB 2BFBA 3K0CA 3RODA 4BQQA 1AB6A 1UXOA 4DA4A 4CMGA 4EGQA 4MRMB 3MTQA 4ZOBA 4IBOA 4M99A 1KBZA 1U81A 3LX8A 3R4CA 2HTEA 4U9UA 4J16C 1EFLA 2CN1A 4IIDA 4Q9LA 5IAGA 5CD1A 1FZTA 5GQSA 3QX3A 4KI0A 3X44A 5BV2P 1WKBA 2GCOA 4CMJA 4Z9BA 5AM4A 2O8CA 3CBGA 1GL7A 2EWMA 5C31A 3RCBA 1LA2A 5F7JA 3CBQA 1IXYA 1N7HA 4FFPA 4FBGA 4PCVA 3ANXA 2B8WA 3AR9A 3QUQA 5CR9A 4IIEA 4XVQA 5EXTA 1CYEA 4K9DA 4TVSA 4NZZA 3P9ZA 2Y1EA 4DR1B 3T4EA 3N2GA 1AK1A 1TT7A 1SVWA 1QQ5A 3DH0A 1JEQB 4DADA 5BURA 3UUGA 1JG1A 3Q3CA 3ZG6A 1C9KA 1FLAA 2P9YA 3ECAA 3MTIA 2YYSA 2DRIA 2AW5A 3GX1A 5AVXA 1VL1A 4HWSA 1CY6A 3EYAA 4DM7A 2I87A 2BFWA 1J70A 4KQWA 2VNHA 2ZBPA 2CFIA 1EGMB 1LK5A 3ZQ6A 3GAAA 5BVHA 1PWYE 2V7XA 3BSYA 3ZOKA 1GJRA 4JN6B 4DN6A 3CZMA 4DNFA 1IIBA 3VHXA 2P27A 4YCCA 3O84A 1AH2A 2FMFA 5T67A 4QDTA 1TX4B 3HRIA 4QODA 1L9XA 1CDOA 4AF7A 6CHYA 13PKA 2XDQB 5LKRA 3L0SA 5JS1A 4ASUD 4LEIA 1E6UA 3RU7A 3ZHQA 3NYIA 4GZMA 4M4SA 3T7AA 4C04A 1EP2B 1M54A 1II9A 1NVEA 5KDOA 2J6HA 2BFDA 3WNBA 5JIBA 2F48A 3PEEA 1DIOB 1YC2A 3GY0A 5DTMA 2J0VA 4C78A 3VU0A 3IVCA 3ZUPA 4FFOA 3M0EA 4TTJA 4LFCB 2OBYA 2D2VA 4PC3A 3GP8A 2NZJA 3ZKAA 3G2QA 2WG2A 1GDHA 3LQRA 1KH1A 3B8HA 1QPZA 3PR2B 4HTFA 1SQFA 2PX4A 1NOJA 3HJBA 2PD3A 4HEQA 4TPKA 1KOGA 1A9RA 1GPWB 1ZD2P 1ZMXA 2AF3C 4YRCA 4BQIA 1KJWA 1ETUA 1M34E 2EW2A 4IH9A 4NENB 5DNCA 4BY9E 1JKMA 2ONJA 5AP9A 2O50A 3K1TA 3T0IA 2Q2WA 4IYRA 3SHFA 2LD4A 1WU7A 4WY2A 5CXQA 3TG2A 5BR7A 1Y1QA 1AGPA 5JV5A 4WLFA 2P75A 5I3CA 1FJ2A 3CUYA 1XZPA 1RKUA 2HMVA 4GKKB 2Y0PA 2E18A 4FT4A 4RD2A 5C1PA 5K4AA 3JRXA 4ND1A 2JDIA 3H9GA 1ZM2A 3KEQA 3DPIA 4K8RB 5EXSA 5TF4A 5IF9A 2GCPA 4AM8A 1XVAA 2P0EA 2Q9AA 2HF9A 3FY4A 2JI4A 2YC4C 3HUEA 2W2XA 3NFRA 3Q7QA 2WJIA 2H52A 1FZQA 4HGPA 5AXAA 5J2UB 5A5GA 4FE7A 4C2TA 3OFND 4TYMA 4NRDA 2CEKA 3NOXA 3WIOA 4E22A 5JC1A 5KTSA 1TYBE 2WI8A 4CM4B 3DDUA 3M6AA 1G4HA 4F4FA 2ZJ0A 4GHWA 5D86A 4F1KA 2NU6A 4MUKA 1GT6A 5IKMA 1YDWA 2H0RA 1OT3A 3NPAA 2BEWB 3ZQJA 1CXZA 3EG9A 4YO7A 5K3FB 2CJPA 3KE9A 4BMYA 4ZI2A 2EEZA 3C7TA 2Y9MB 3D5TA 1Z7EA 3DHVA 3GGPA 3MRTA 2E7ZA 3PKIA 4Z86A 5FBLB 5C0OE 2WNSA 2H0QA 4QREA 5E3HA 2I6TA 1CZRA 2PGLA 1QTRA 5KYXB 1WPQA 4US1R 1K7CA 2KW5A 2QM3A 2Z4TA 4V38A 3KQOA 3B1ZA 3GLKA 3I3SR 5E6RA 3C6ZA 4EGSA 2WHEA 3FCYA 1WQ4A 3U13A 1OXTA 3HDTA 4GICA 1FYFA 3GLHB 4UEJA 3B8EA 1JDBC 2WWFA 2VYNA 4CFSA 2H1RA 3GJ3A 1PR0A 2ZGVA 3UV6A 3IP5A 1FY2A 4Z2YA 1XD2B 3ENQA 3PUYA 4HN4B 5I45A 2MSCB 2OOKA 3NAZA 3UC5A 3UV7A 4OHXA 2B1RA 1P1KA 3ESQA 4IICA 3A9VA 2YHIA 1WPRA 2OGWA 3C3XA 3CV3A 1BE0A 1L7MA 4MPJA 1GPDG 5KBYA 4MRVA 2ZWIA 3DEHA 3AY7A 3SOPA 5FHQA 3REQA 1L9KA 2R44A 4MO9A 3W0LB 3LUAA 4RFLA 3Q5EA 2WDZA 3HM9A 1VSVA 3AHEA 4BCBA 3LTNC 3O3MB 4WESB 2R1TB 2WKSA 3PQCA 3IS3A 3O31A 3JARB 5CEJA 1Z29A 1OBOA 4JU9A 3GYGA 3F9CA 3TE7A 3IQEA 3AONB 3LZ6A 2AYYA 2EAUA 1W4LA 1ZXXA 1D9ZA 3KYBA 4EFMA 4WECA 5IASA 2ABWA 3OO1A 4YX9A 1W0KA 1VXRA 4F8YA 4RVGA 2ZDHA 3G89A 4QBHA 1BX3A 1A5AB 1PGPA 3PGA1 2B5OA 3OU7A 4BGUA 3BWYA 4FWIB 3OEWA 4P98A 2R5WA 3WL4A 3HB4X 1DC3A 3BQNB 3KTAB 4Q18A 1HC7A 3RYFA 2PE5A 4ZZ3A 2RI0A 1RHQA 5SY6A 2O19A 3O4VA 3UM9A 1FMFA 2ZRGA 4QDKA 1FX0B 2JLCA 3G0IA 7GPBA 5EHZA 5LWQA 4DR4B 2VLBA 4QOIA 2PKYX 2ZWOA 4P9NA 3DKRA 1MW8X 3UW1A 2EARA 2NUPA 2FUEA 1TF2A 1UJ2A 2QN9A 4H7HA 3VRHA 3AHGA 1CUJA 3AM1A 1PI3A 4RMIA 5FOQA 5FUWA 4CKCA 2Q4RA 4ZK6A 3FOZA 4QPPA 4MUFA 5BMVB 1QH1A 3AVXA 1ABEA 1GTVA 4Y6LA 3TX6A 4R1LA 4B8YA 1Z0AA 1P2DA 4KWIA 1VMAA 2EJBA 5E8JA 4LI0A 5FBHA 4YWHA 4UZFA 5HGJA 3V2GA 4L5CA 2GPBA 5AK6A 4BV3A 4DLZA 1AKEA 2G4CA 1UDCA 2WTAA 1AUQA 4H18A 4QBFA 4WEOA 4MYDA 5AHOA 1Y7TA 2RGWA 3WB0A 1DV2A 1RC1A 3K0AA 1L4MA 4RCVA 1WCIA 2WEKA 4MDYA 4LYAA 2PNJA 2DXIA 4DDVA 1HPLA 1CDDA 1MRSA 1PJAA 2WOOA 1NT2A 2XT0A 3BGIA 3BWXA 2ZYHA 2JGKA 4NYIR 2VWGA 3TAXA 1P2VA 3U9LA 4LSZA 4ZZIA 2C3PA 3TWOA 2CNLA 2VNIA 5FBVB 4YGYA 1OBHA 1WE2A 2COKA 2MSDB 2W2LA 4L95C 2Y1XA 1L4BA 2IUSA 1G21B 1P9WA 1QHHB 1T25A 1XLTC 1UBUS 2L69A 2ZRLA 3BIWA 3P32A 4G4IA 4ADSG 2IHJA 4C0HA 3M81A 3IP9A 4OHRA 4HH3C 1F2TB 5KNBD 5MF6A 3N07A 1UAYA 5JNLA 4BPBA 3ET4A 5BV8A 1G3IA 2FYTA 2P2LA 3GJ8A 3BXGA 1GZ4A 3IVXA 4CKWA 1QP4A 1RR6A 2HT6A 5F5XA 221PA 4F12A 2F8SA 3MB8A 4ENWA 5EPEA 5FAKA 1FP6A 2ZJ5A 3F49S 1GVNB 4ICIA 2AMLA 5EE0A 3TQSA 4XYLA 1CD5A 1E2LA 1F8FA 1SKQA 4OH7A 4EGFA 3FPFA 1SPBS 5CDSA 1FX1A 4LJ6A 1NQOA 1XZIA 2CXRA 1GO2A 4EUNA 3F9RA 3L4KA 1CUGA 1SQSA 1TQ4A 4RJJA 5ECYA 1OROA 3RGWS 3GDHA 3S2IA 2PX3A 3AF0A 4Z8YA 2FFJA 3A9TA 2IU4A 5K7SA 1X7WA 1T2DA 2HMTA 1V9SA 5CURA 3X43A 3NXSA 4PN7A 3IURA 3DE6X 3YASA 3DHEA 1W5AA 1DEHA 2B2XA 2XRYA 2EFGA 1ISIA 2QTGA 2ZBRA 3FYUC 1ZNQO 4LNHA 1Z7GA 3HC7A 3ORRA 3TTVA 3WGJA 2OV3A 1BWQA 4YI3A 4RKWA 5CDUA 4ZYVA 1XB2A 2H92A 2QMHA 4JBXA 1N1GA 3CRQA 3NR2A 4M2LA 1ZM4A 1HQCA 2HNBA 1J2TA 2I2XB 1A2BA 4JFAA 4KQKA 4L4XA 4LN1A 5FEMA 5EKUA 1FBTA 2CVQA 1TGVA 5A04A 3O3CA 2G6BA 3KB2A 3PFHA 1GSOA 1OFIA 4OKNA 1TC1A 5FX2A 2F3SA 1QYDA 3AFOA 4KO3S 4WK0B 5EE5B 3B1YA 4BNFA 3NYQA 1J09A 1KL7A 1MX5A 4MV0A 5BN3A 4FJ0A 1TZJA 4JLOA 5K0SA 1U1IA 1I4OA 1CV2A 2YV4A 3X2EA 5A3QA 2BM9A 2Z83A 2AOXA 4OQDA 3B20A 2IE8A 1J4AA 2PWZA 2N1BA 3JV7A 4GQAA 3MHPA 4MWOA 1Y9EA 1PKEA 4PG6A 5T8KC 2H1FA 1LCIA 2HH9A 3JAKA 1BNCA 3GJ0A 3P4UA 4FX2A 3J7TA 4M7OA 2ZCUA 4U9IS 3W1EA 2PX2A 3W78A 4ZCMA 1LNZA 1OD6A 5TJ9A 3RS7A 3VC3A 5B6IA 1NJ6A 2OCYC 2WF7A 4KGXA 1KZ9A 5ECDA 1ZRHA 4AJIA 1O58A 1WCYA 3H8WA 4EKGA 1NZDA 3D0RA 1C4OA 3K9HA 3O1JC 4H6PA 2ERCA 4EPXA 4EW2A 1XDBA 4RVUA 5K05A 3LPMA 4FHDA 4IGIA 3JQGB 5JALA 1LKZA 1QM5A 2RG7A 1EK6A 2CNBA 1WY7A 2WVHA 4IDDA 4V02A 3U3KA 3UHPA 1KJYA 2V98A 4M9QA 3V6MA 1O6ZA 3AV3A 4YV7A 2XE8A 1XFDA 2FPSA 4M0FA 1ZIYA 1RLOA 2FFRA 1Y5LA 1WS6A 2WLSA 1MP0A 3R7LA 2DJIA 3AR6A 3P9QA 1PD0A 2YNMD 4QFBA 5EXEA 1N3IA 5H70A 3RM3A 2C3YA 1QTNA 2V1UA 3GZNA 3S7ZA 3B2QA 2ODWA 4N65A 1HMPA 4AJHA 2EJWA 2FEKA 5AOCA 1M1ZA 2W0SA 3EFEA 3H83A 2ZIVB 4HAZA 4NE9A 5KOIA 1QP0A 1QDEA 4WLVA 1F5SA 2VCYA 1T29A 4HVLA 1QOZA 2R5FA 3Q7RA 5JJKA 1W94A 1XDGA 3KUKA 5EI5A 4EABA 3QMMA 3DOCA 4E12A 1SG0A 4LRXA 3G9UA 4ENPA 3R41A 1RZUA 4CT5A 1AS2A 1NF8A 4FYVA 3WG9A 3ER8A 5HNKA 4EYSA 3LYLA 3B9PA 3C1UA 3D3JA 1EQAA 4LF9B 1RLTA 1RYEA 2GPAA 3WWYA