2FR8C

Structure of transhydrogenase (di.r127a.nad+)2(diii.nadp+)1 asymmetric complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
174
structure length
174
Chain Sequence
SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title The Role of Invariant Amino Acid Residues at the Hydride Transfer Site of Proton-translocating Transhydrogenase.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 47
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2006-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2fr8C00
1Q14A 4RJKA 2FSVC 1YHZA 4FEGA 4MPRA 4RJJA 4J16C 5DGTA 4RMGA 2H2IA 1PNOA 3PKIA 2VK1A 5DEIA 2Q5OA 3OE1A 4FEEA 2NYRA 3U3DA 5K6RA 4V1CB 3F6EX 5K3SA 4K9NA 4BVEA 2UZ1B 4GG1A 4RJIA 2FN3A 4J1TC 4BVBA 2WVAA 3RIGA 3D81A 4C78A 2JI8A 4IF6A 4GM4A 1PVDA 4Y6QA 1SZCA 5EJ4A 4L2IA 4C7BA 3GLTA 1J8FA 4FVTA 1PO7A 4JUDX 4K9PA 1NM5C 1PYDA 4JT8A 3D7KA 3JWPA 2UZ1A 4IAOA 5EJ5A 2DJIA 3EY9A 5AHKA 4GPEA 4FZ3A 1T9BA 1YC2A 2NXWA 4Y6LA 4O8ZA 1YTLA 4X3OA 1UPCA 2H4JA 3PDHA 4GM1A 1N0HA 1E3TA 4JUAA 3EA4A 1U2GC 2B4YA 1M2GA 3FZNA 1O96B 4F56A 1M2NA 1XLTC 2OORC 4COKA 2FR8C 2Q28A 1YBHA 4BN4A 1V5EA 1Q1AA 1PTJC 2A1UA 2PGNA 1YNOA 1ICIA 2EZ9A 4UTXA 2EZ8A 2OD9A 1DJLA 1YI0A 4MPJA 4X3PA 4JU9A 2Q5JA 3FLMA 4UTNA 5K6TA 2HJHA 2VK4A 1D4OA 4ZP1A 4Q9DA 4KXQA 2W93A 2OD2A 4GM0A 1UPBA 2X7JA 4KPUA 1POXA 1V5FA 1EFPA 5FEMA 1PI3A 4MQ5A 1Q6ZA 3GLUA 5BWNA 3HWWA 1YI1A 4F4UA 4BVGA 2VJYA 1T9CA 4JSRA 5MF6A 3GLSA 4JU8A 2PANA 2QQGA 4KGDA 1U28C 2OD7A 4QQ8A 3F6BX 4V1CI 3D4BA 4MPPA 2H2HA 3CLTD 1OZGA 1ZPDA 1O97D 4V1CA 1Y9DA 2IHTA 4JUCA 5D7NA 2PGOA 1M2HA 2JLCA 5MFPA 1UPAA 2FWNA 1HZZC 2Q5QA 2QQFA 5EJ7A 3HWX1 1OZHA 4RMIA 1MA3A 4L3OA 4G1CA 4UU8A 2BRUC 4UTZA 2H2DA 2VBGA 3IAFA 2V3WA 3EYAA 3ZGOA 2H59A 3U31A 1OZFA 4IG9A 2VBFA 5BWOA 4RMJA 3E9YA 3GLRA 1EFVA 4UUAA 2IHUA 2JI7A 2JLAA 5MGNA 5EJ8A 4K9QA 2IHVA 5K2OA 1BFDA 2JI6A 5EJ6A 4UUBA 4ZZIA 1T9DA 2Q27A 2WVGA 3LQ1A 5DGDA 1S7GA 2EZUA 1PNQA 5BWLA 2JIBA 3CLRD 1S5PA 2H4FA 1U2DC 1JSCA 2AG1A 3CF4G 3CLUD 4JD5A 1YC5A 2VK8A 1YHYA 2C31A 1POWA 2VBIA 4Y6OA 4HD8A 5FYQA 4JUFA 2H2GA 4GP9A 2EZTA 2Q29A 5EJAA 4BVFA 3K35A 4BN5A 2Q5LA 4K9KA 4BVHA 2AG0A 2WVHA 1T9AA 3PKJA 1U31A 4MZXA 3ZG6A 4UTRA 2EZ4A 1MCZA 1M2JA 1V5GA 4JT9A 5IMSA 2FRDC 5EJMA 4JUBA 4UTVA 2H4HA 4QELA 4K9LA 4K9MA 4RMHA 4D5EA 3RIYA 4I5IA 4UU7A 4QPZA 3FSJX 4HDAA 3CLSD 1Z8NA 4TWJA 4TWIA 4R8MA 4BV3A 4BUZA 2A1TR 3IAEA 3JR3A 2JI9A 4BV2A 1M2KA 1SZDA 4D5GA 5MFZA 4K9OA 1Q17A 2H2FA 3ZGVA 1PT9A 5EJ9A 2OO5C 1OVMA 1QPBA
chains in the Genus database with same CATH superfamily
1Q0TA 1Y48E 3KKEA 4ARAA 4N40A 1NVUQ 3DJYA 2NG1A 3JD0A 4I50B 3OBBA 3L18A 3VR1A 1DAOA 3AGQA 4LHSA 2WPNA 1UKBA 4NBTA 3WKDA 5JFGA 4WOKA 2YJZA 4Q4DA 1RM5A 1REQB 1MJFA 1YQWA 3KO8A 3U49A 3BZWA 1SULA 4P4SA 1ZWKA 4WOPA 3ZHQA 2ZUDA 3IJPA 3ADOA 2CKMA 1PKEA 2TMGA 4WI1A 3RYHA 4MPRA 1RMYA 4BUCA 5M04A 1FSPA 1Y7LA 2OV1A 3BZBA 4G1EB 5ICCA 1N36B 2JIOA 3PHBE 3V00A 2SCUA 3AB3A 3T0IA 2YJ5A 4E31A 1X86B 2GR9A 3VGJA 1GZHB 4R7TA 3DMHA 4DM7A 1C3OB 5F2NA 4N3GA 2PL1A 4PFSA 5JG7A 2NO0A 1I3KA 3JASA 5A71A 3PWKA 4P82A 4V1CB 2YY7A 4P86A 5CB4A 4WESA 2JANA 1R37A 5AW3A 4YRPA 1Y6FA 3TK1A 2NU9A 2ZBPA 1WQ3A 2O2IA 1P18A 2KJQA 3EDMA 5IC6A 3FPGA 3WADA 2ZJYA 4OUKX 4OI2A 2CBZA 2B1QA 3B13B 4U9UA 4X7PA 1CB7A 1Q7TA 3INGA 5E2AA 2GJ4A 3GD7A 1KDZA 3A4VA 5F3WB 1H5UA 5F73A 2AJBA 2AFHB 1GL7A 5TSDA 3KUXA 4RSRA 3TNDA 2QF7A 4C7OA 2YYSA 1QOPB 2QP4A 2YIDA 1W1WA 3KEOA 1UQTA 4XJVA 3MEQA 5L3RA 4H4CA 2CLMB 1YVPA 4LWQA 1O6GA 2IYXA 4HGRA 2QJWA 3O1HB 5CVVA 4I4TA 1EDEA 2BM9A 3FHJA 3H0CA 5EMLA 2OCLA 2TMKA 5HE8A 4R9NA 1MC5A 1I1OA 1U0TA 2H9IA 3G8CA 4O2BB 3CZAA 1TRHA 2Z6UA 3ROMA 5GGYA 3LUHA 1F2TA 3OX4A 3AKDA 4WGFA 3FCCA 5EMKA 3TRIA 4Z4GA 3LECA 3OLQA 5AW2A 4MVJE 4NYMR 3CN7A 4R2XA 2YOHA 1Y1RA 3B85A 3Q85A 1RXVA 3SVTA 2Y9PB 4LY3A 2CFCA 4A0GA 4CYMA 4X84A 2Q5EA 1ZINA 2OE2A 3M6IA 3G1WA 3I37X 4L8GA 4REMA 4Y2UA 2GZ1A 3EFOB 1RM0A 2WF7A 1M0WA 3CPJB 2A94A 4OKSA 4UW9A 5K3AA 4DRZA 2O8CA 3H4TA 1KP2A 1EG2A 2OP0A 5ICSA 5AHKA 1T2DA 4GPEA 1N92A 5BWMA 8AT1A 3L8MA 1RQ7A 5FF9A 1BJTA 1VCNA 1N7JA 4EYSA 4QBGB 6REQB 1Z6PA 3CTMA 1E2JA 1Y3IA 4ID9A 4A7PA 1ZIYA 2A9VA 2Z6AA 2I9PA 1EFTA 4EUFA 4RIGA 1Z37A 2UYHA 5A3JA 1PWXA 2I22A 4TLCA 2EX1A 3URMA 4P5PA 5AWFC 2I65A 6Q21A 2VT2A 1JPNA 3GCZA 3J81k 1A04A 4LWOA 4DM3A 1W36D 1E2BA 2IHNA 3K2EA 1TPZA 1U4NA 5BOSB 1E9CA 1K88A 2EJCA 1ODFA 3BC1A 3EUFA 3EA4A 2HA4A 1FOEB 2YN0A 3ED1A 5AO9A 3RJMA 3VTZA 4EM6A 4C0JA 3RREA 4R7GA 2CNBA 3GDOA 1B43A 4QKQA 1JR3E 1RQPA 2C4MA 3QF7A 1V25A 3GI1A 2FPIB 4B17A 3JPWA 2XAUA 5CDYA 4MARA 1IN5A 1XDUA 3U2QA 1VL2A 2H2WA 3WLIA 4TYYA 4YP9A 4O4JF 5BYKA 4V0QA 2G6TA 1PQ4A 1V1JA 1MH9A 1T2CA 2VH2A 2XVYA 3EGDB 3GB9A 3DDCA 3H5WA 3UICA 3FFXA 1J1IA 2FPUA 3DXXA 2Z2IA 3KYCA 1FZQA 2QSZA 3GG9A 4N7MA 3R24A 4RVGA 5C8YA 2OBBA 3RUHA 3HHPA 3P9IA 4H7DA 1CIVA 4MHSA 1PK7A 4IFIA 3AJDA 2R00A 3ABZA 1PTJC 1R0YA 2H08A 3D6VA 3GZNB 4LGMA 4M1SA 5B3JC 2W71A 3O3CA 4UMVA 1PL6A 3G7SA 1B6GA 2Y2UA 3NPAA 3MRXA 6PFKA 2KQUA 4JFAA 4U7DA 2D2IA 2DHDA 3EIQA 3I72A 4I19A 1FUEA 2G07A 1MA0A 1VDZA 2GM3A 4LCJA 2PKEA 1P81A 4LF9B 1JH9A 4MI3A 4GMGA 3EZGA 2WJPA 4C03A 5BPHA 1GGVA 4MYUA 2QZSA 1LQUA 2FXVA 5C3MA 2XYPA 1H2XA 1KAQA 4HQ0A 3AJ8A 1V9SA 3B7PA 4OHPA 1E8NA 4TKZA 1Y8RB 1IH8A 2QQEA 3AEQB 3HVJA 3IQXA 4O4IA 5FFMA 2B92A 3SPXA 3LTNC 3ZDEA 2C4VA 4TSFD 1JDBB 4BVAA 2O8BA 1FYEA 5AI5A 1K8RA 5FCDA 5JSQA 1UAGA 4P58A 1JDSA 1PZFA 1T1SA 1XGKA 5CNMA 3BTSA 2JCYA 3G2OA 4G4IA 1JYFA 4LZNA 5FT9A 1O9GA 4TLLB 1WHTB 1W36B 1RPJA 3L2OB 3CMMA 1CVLA 4KTVE 3TI7A 4UKDA 3MUOA 1JLKA 5SY9A 2FLKA 2VJNA 3DLAA 4KPUA 3ZHXA 1XAGA 4BLQA 2CVFA 1EGQA 3WLPA 4KVFA 1U5BA 3F90A 2YOGA 2ATIA 5IVDA 3F49S 1OBHA 2NU6A 4JLNA 4CM4B 2WZBA 4XD7D 4ZOAA 4D46A 5J4KA 3MWKA 2JATA 1TYDE 3ND9A 4YB8A 4B6SA 2J0QA 1M0TA 1UPXA 3OURA 4IS3A 4DVGA 3SLRA 4FFRA 1ZH8A 1CPYA 3OMLA 4TGLA 1V3VA 4L5IA 2JG3A 5ENDA 3AUJB 4PO3X 4EHKA 1ISMA 1WQ4A 2O2XA 4KCGA 2YYAA 5BQPA 4XGRA 3TRDA 4KRFA 1D6JA 4UQPA 1AIPA 3V4ZA 5DZSA 2CYCA 1JDBC 4I55B 3CR3C 1VZ2A 2B2XA 3AJ9A 1H0KA 1EK5A 3AW9A 3V8PA 1Y1KE 3SFVA 1W1UA 2VQ6A 4L4UA 4AFNA 4W8HA 1YOVA 5D01A 3K94A 4PAWA 2QQGA 3FYTA 2A9PA 3AG5A 3JWGA 4ENUA 3MGBA 1IG3A 1ZIPA 5CG1A 1KI8A 3BE5A 3UJ9A 2XYHA 4TS4A 4DIFA 1S9DA 2C04A 1U4SA 2AYYA 2VCYA 3B70A 3BCSA 2I2FA 2J6HA 3NHYA 4QXMA 4UEOA 2EL9A 5FWAA 1SRQA 4CLXA 1Z7BA 3DYBA 5JAIA 3U44A 2I03A 1KFEB 4B73A 4ROSA 5K3FA 3ZW9A 2ZI7A 1NBWB 1XTQA 3FNIA 4H7PA 1PFUA 1UXKA 2FP4B 2L2QA 1LTHR 3AILA 4P83A 4CMKA 3WK8A 2E1PA 3G8BA 1KRXA 2CDAA 1ULHA 4FWBA 3FHOA 4C5CA 4D0GA 1L4EA 2B1GA 4GD3Q 5E3IA 1DRWA 3ZDQA 4B3CA 1E20A 4CCWA 1ZN2A 1JWBB 4X5OA 1NVVQ 3OQNA 4G85A 1JDPA 2I5PO 3H16A 4GPBA 3B51X 1U6KA 2V96A 3LY8A 3C3KA 3FOWA 4AZ0A 2F1IA 4DR1B 2O06A 3A6ZA 2BGLA 1H4TA 2FEOA 3WLTA 3OLCX 3LA8A 1PVVA 4YCLA 5CT8A 1UH5A 3D2CA 4O25A 3DTVD 1DV2A 1L7MA 5ESDA 4H08A 1EP1B 4JV5B 4O4HA 2C95A 3JRNA 4URXR 3P0FA 2VP6A 3L92A 4Z9AA 5FPPA 2HJWA 3OOWA 1KNXA 2HMVA 4UDNA 1WABA 4HAXA 4RL6A 5EZYF 3CFYA 4BFVA 3UPDA 4OHVA 4EBFA 4KXUA 3OM1A 5JWHA 1SCUA 3Q7RA 4FOSA 5SYMA 1BAPA 3SYTA 3GJ0A 4P3OA 4D96A 2QD3A 1V8FA 4IH1A 4U2EA 2I6QA 4M1YA 3ZI4A 1A1VA 4H6PA 3GU3A 3VNVA 1IN7A 3RS3A 3QVLA 1YBMA 1U0GA 2FEKA 4QXAA 3VC1A 4Y9UA 4IG9A 3B1YA 4YACA 3ZD6A 3BWDD 3CUYA 4J7UA 4NC9A 3TR5A 1LI5A 1OAOC 2PTGA 1A5ZA 4KLZA 4O3MA 3D2LA 4WK6A 4P2BA 1JQ5A 2P9FA 5FP0A 4G2NA 3B3QA 5DDIP 3HFRA 1BC5A 1YL6A 2AQKA 3M6UA 5C8ZA 3QWBA 1XZLA 1AKYA 3IALA 3OPYI 4S1OA 2LE0A 5TE9A 4BLUA 3OM9A 1JS1X 1TTHA 4QBTA 2IHVA 1XMJA 4TUYA 3LZDA 1PEYA 5EQDA 2QQ5A 1Y6ZA 1RZVA 1O7JA 1JRLA 3A2MA 4MQBA 5DXJA 2C03A 3BGVA 2DEUA 4W5HA 4YDHB 5E2IA 5BOVA 4JVMA 2DFTA 4IDOA 4PZ9A 3IUYA 1N7GA 3V2IA 3UAYA 1MV8A 5EIWA 5LA6A 3H04A 1O94A 2E4ZA 3UVEA 5IBPA 1W87A 2WHRA 1BVRA 1Z8HA 2XSZD 4LHZA 3E15A 5MN6A 2P9GA 4AKGA 1Y1QA 4R4JA 2EBWA 1XEXA 2X4IA 3ETJA 3I9KA 4HRAA 1CF2O 2G72A 4M8LA 4MB6A 3DTVB 5T41A 3VTFA 4FONA 1RPNA 3WO1A 4G5QA 3RUEA 1P2VA 4TQGA 5LOVB 1P44A 5F5LA 1QRTA 5DISB 3T5DA 1D2AA 4MV7A 2H0AA 1YAHA 3ASVA 4O29A 3NM6B 4RFVA 3W79A 5CPFA 1KIFA 4PR3A 2R11A 2FKNA 1W4ZA 3EW9A 3PEUA 4N8SA 4EEXA 3TF5A 5BSGA 2WM9B 2OZLA 3ZDYB 4NZPA 1JG1A 3NNNA 1FJHA 4DXDA 4WLVA 3WXBA 3PYLA 3NM5A 3PGMA 5IC5A 4KIJA 4ME6A 4YC7A 4DAEA 1RDFA 4YWJA 1B8NA 2IEBA 1VCOA 3GLFB 1Z26A 5A62A 2CLIB 1U3FA 3Q3EA 4UMDA 3HCBA 1ADFA 3E3LA 4R7ZA 4C0HA 2HA2A 2ZYVX 3U0BA 4C3ZA 4IJQA 4Z2AA 4ZOQI 3ODPA 5LYJA 3NB0A 2IZ1A 1G3RA 1ZCJA 4RA9B 4C2AA 1G9XA 1DELA 3WWCA 3ZXXA 3IL2A 3EZLA 1B0ZA 2BFFA 3EFEA 5FWXB 3NHFA 3QLVA 1F0KA 3IIMA 3JYHA 4RV4A 1WWKA 1Y82A 2EZTA 1ZCFA 4CDMA 4KK3A 5JUWA 3H1EA 1DQRA 1A98A 4HAUA 4BS9A 4FUQA 5DYWA 4R05A 3BVPA 4Y98A 3PSAA 4DZZA 1B6TA 1WB6A 3FGOA 1RT9A 4BN5A 1S8FA 3BJRA 2PZAA 4UM7A 4TTVA 1BS9A 4JIMA 3TTUA 1EWQA 3O2QB 3HBFA 4KUGA 3BWCA 3EDYA 3WLSA 1K68A 3U3RA 2IYRA 1I9GA 2W37A 4Q3OA 4QXOA 5JI3E 2HF7A 3PXAA 3PQ7A 4N76A 5B4TA 1Z4KA 3DBLA 5AJWA 1P1CA 3V8QA 4BMPB 4GXTA 3U60B 1F48A 1N6KA 3GAMA 3P9PA 2P5TB 4Y9RA 2IZ0A 3ILXA 1ISHA 1QGDA 1LUAA 1ZMOA 4B5KA 1QQAA 1L5GB 3JZFA 4P0PB 3QEMB 5GJCA 4X8LA 1IB0A 1CZHA 2B36A 2DSNA 4YBRA 4M21A 4G5GA 3O8BA 4RTNA 1R0LA 3SZRA 3Q6MA 5HQ3A 4ETNA 2V1XA 1XOIA 1OA0A 4AWXA 3UWSA 2C7RA 1UMDA 4YJ3A 1Q2XA 1QHNA 3E8MA 3KIPA 1J39A 3HB9A 1S2LA 1XKLA 4XRGA 3K9LA 3MGAA 4RK5A 2XLCA 2AJDA 3NIGB 4C4XA 3DXZA 4L07A 4OX9Y 5E6UA 3HR7A 4BJ5A 4HUTA 1K8XB 1V35A 2CGEA 5ECWA 3CONA 1XJWA 4L5AA 1JB9A 1XWIA 2TYSB 1QO9A 5HFAA 2C8JA 3WGZA 3TBKA 5LXTA 3JQPA 1TJ5A 4D4MA 4E32A 2P30A 3FM9A 1G6HA 2JBWA 3BRCA 3DYVA 4MVJA 5EPOA 5TT1A 3BIFA 2JAHA 3EMDA 3LF1A 4EPRA 2IEIA 4NDNE 3DE5X 5I5EA 4PYJA 4P3XA 4AI6A 5DU2A 3P9NA 2K87A 1VBNA 4C4AA 2K4MA 4N82A 1RRVA 1M8JA 1WZCA 2IIVA 3FDXA 3MGGA 4MLPA 4BWYA 2IYAA 4FGUA 2F2TA 1AKNA 6AT1A 1UBGA 3RLIA 4BKQA 2P78A 3WK5A 4QRDA 3BCRA 2OOKA 3QKWA 2HSJA 1ZD4A 3VPGA 1F1BA 4PSVA 3I05A 1MHTA 4GOND 3GAZA 4IRXA 5JT1A 2POQX 4LGCA 3NJ4A 2A57A 2RCNA 3HC7A 1CYDA 1PD1A 4QPZA 2FW8A 4KKVA 5H0IA 1Y80A 2HKIA 5FPSA 4E33A 1KEVA 3CB2A 1W581 2OY0A 4TWIA 3WGMA 1BX0A 5J2UF 4MV8A 1RWVA 2RK6A 3HS3A 5G3YA 3MYRA 4OXKA 3ONWA 8GPBA 5K0NA 1X7YB 4N01A 3S2GA 4XD2A 5BSTA 3QP9A 4PPYA 4RZHA 2W43A 1LLQA 1TMYA 1WULS 1XDSA 2WJ4A 3UH1A 3LTEA 5GOZA 4GRAA 3DVRX 3N86A 5AI9A 2XNSA 3IBCA 3QV2A 4A6XA 1ESEA 4AURA 1H94A 3AW8A 1JE1A 3G2NA 4XVUA 4HNSA 3FCEA 3BH7A 4UPVA 5JMPA 3WLRA 1JR3A 4EHIA 1T5OA 2O8NA 1FS4A 5K0BA 1Y3BE 3WL4A 1YQDA 1T0JB 1JHMA 4DMUB 3CUEF 4OQ4A 2G9NA 2XBMA 3GXOA 4ZCPA 2W2NA 2WTBA 1IQRA 1PT9A 2C9OA 3HBLA 4AMZA 1IZZA 2GKGA 2XXAA 3KQPA 2I8AA 3OX3A 5EXTA 4B3IA 4IZHA 3WMWA 2QB5A 4OP1A 1VCIA 2VWQA 3CNHA 1Z4MA 3MA0A 4HATA 3TG2A 1KMIY 3GZJA 4B80A 3KJHA 1Z63A 5K2MA 2YXDA 3HCEA 5ER9A 5KTMA 1KHTA 3C39A 1JU9A 3E03A 5TVKA 7MHTA 1T26A 2AMVA 2NPOA 1YHZA 4BQPA 4F06A 3HKEA 1AQYA 4PSDA 2W70A 1E1QA 1OWMA 2PX0A 1D4AA 3OPXA 4YRNA 5IKXA 1KZ6A 3QKSB 3QKTA 4G0UA 4FINA 3UG7A 5A9RA 4LYDA 4RYDA 1TLLA 3AVOA 3PYMA 5CT6A 2VSXA 2WWTA 3JAWB 4V3CA 3S4YA 1V4BA 2BZ1A 5JJBA 1COWA 4D3DA 3OE1A 2QI9F 4B46A 1DB3A 1KVSA 2NYRA 3JATA 1TAHA 2QTVA 3OZRA 4MVXA 3I9V6 1KY4A 1PGPA 4ZVSA 3HXTA 3RU3A 2FFAA 2Q1WA 3F9RA 1RWBA 1D2MA 2P0EA 4UVEA 1JALA 4RV5A 4UBIA 4BGVA 3PQEA 1PJQA 1JDZA 2OGTA 3N6VA 2GNPA 5JBIA 3FDFA 3FKQA 4UZEA 4CMCA 4FR5A 2YDXA 2ZBQA 3KQQA 1MOPA 3OUTA 4D57A 4ZHQB 1X7GA 4NWIA 3GLFE 5JD3A 5F51A 1QCDA 4V02A 1XHLA 4ED9A 1GGKA 4DADA 3A14A 3ETLA 5FOTA 4WDQA 3RVNA 4H77A 3ZHOA 4TYNA 1MD9A 3DCYA 3IOMA 1EA5A 1L5ZA 1R4ZA 2HEIA 3I30X 3NRBA 4I50A 3F7OA 1R00A 5FV7A 4ND6A 3VH4A 4BMOB 4BYGA 1GO2A 2QLNA 2WVAA 3IMCA 5KWEA 4A2QA 1VYHA 1UJMA 5BNFA 2BL4A 2O23A 3D81A 4E2ZA 1RZ3A 2BOVA 5B55A 2PU7A 3LDAA 3INRA 1DT5A 3HG7A 4RF3A 1QCYA 1KYYA 1MUUA 2GYVA 2QE7D 3JVEA 2PRIA 4ONEA 5IH3A 5A4DA 5IT5A 3KK0A 3TKAA 4BOYA 4AF6A 4NP6A 3ZU6A 5GJBA 3U7JA 2BDTA 3LLSA 4M0LA 2DOKA 3PFBA 3TX2A 3G6KA 4DT1B 3I4LA 4GX2A 1DKRA 3D7LA 5CUQA 3DB2A 1UBHS 4JUDX 3VH2A 1VCMA 2NXJA 3WIBA 3W3AD 3HEAA 5DN6A 3TE6A 3RK0A 5CEFA 3OEEA 1TL7C 3F4BA 1CFJA 1V37A 4JIGA 1TUBB 5CJPA 2ZDQA 1VQ1A 4RFSA 4TXHA 3B6KA 4UUOA 1R12A 2X7XA 2EXXA 3NKVA 2GBCA 2OAP1 2G71A 3TSYA 2X8WA 2HXYA 1JLHA 2CBGA 1PSWA 3LP5A 4R1MA 5FX2A 5K4HA 3U7FB 1SR8A 1TKBA 4M1MA 1W93A 4X95A 9MHTA 1K89A 3VZSA 2C0QA 1W85A 2EP5A 3E4DA 3GBVA 4FQ8A 2H9AA 1UT5A 1XVAA 3FCXA 3OF3A 3CSSA 2ROQA 4L51A 1ND6A 1Y33E 4MKIA 2N47A 1R27A 1WZEA 4N9QA 4OXRA 4MV3A 2DLNA 2MHCA 4MUAA 4OG2A 2XZOA 1HNNA 4YRDA 3QELB 3Q98A 4WD3A 4Y6LA 1VA4A 3KVYA 1YRAA 3IEUA 4G26A 2DU8A 5IDWA 4K6OA 1P45A 5A9SB 1HO3A 3Q5EA 4FE7A 4K1XA 2J6BA 3BEDA 1T5DX 4LAFA 3H2IA 2P9JA 4MINA 4TYQA 3BK2A 1TQ2A 4YO7A 3QWIA 4FXOA 4RWZA 3L0SA 5FTWA 3I2YX 4D0LB 3F3YA 5HGXA 4E22A 5JAHA 1KMQA 2SECE 3BL6A 4J3JA 4P32A 5F1YA 3JXEA 2D6FA 1XWWA 4DLZA 3H7AA 5BSHA 1AUQA 1JLMA 4P1ZA 5L51A 5ALXA 4LY6A 1HDZA 3A31A 1G8HA 4PO1A 3N7UA 2A5DA 3O8NA 3VC7A 5LMZA 3EFOA 3HBNA 1PT7A 3TMAA 1BVYF 4H7KA 4U7TB 1QFZA 1YV9A 1V5EA 1O5TA 2C2GA 3SYKA 4BXOA 1OWNA 3A1WA 1V8BA 4MA0A 2PWZA 3AXTA 1GTVA 3I32A 3LSTA 4O5OA 1GVNB 1JAIA 4P33A 4BGEA 3LBYA 1UC5B 4XLLA 2IYTA 5CGQB 4E88A 3LFHA 5ALTA 5SZJA 4UNRA 1NNI1 1BHO1 6REQA 1XRLA 2PWYA 1Q0SA 4EECA 2GEFA 3GX1A 4JWTA 1CY6A 4WINA 4OBWA 1V3QE 5B3JA 1Q77A 3QVXA 4Z0PA 5H5JA 1PVOA 1YWGO 4E2YA 2NUBA 5CLIA 2YMQA 3EASA 4Z9BA 2Q5JA 3ZHRA 1PJ3A 4GZ6A 3VOTA 2PAFA 7ABPA 4PYRA 1P7WA 5MN5A 1DV1A 2XA1A 1Z6YA 3O73A 4I36A 5KPDA 5D6OA 4BNNA 3ZS9A 1MT3A 5CXQA 5FI3A 3HACA 3PQFA 4DYVA 2OGUA 3UV3A 2OD2A 3P9CA 5E7MA 4HFRA 4LGVA 2GYWA 4GL2A 2QD4A 3RFVA 1F17A 3GNSA 1XHFA 3KWFA 2DHEA 2GK7A 3VVBA 1QYRA 3WJ7A 3DZKA 1SKBA 3VJKA 5I45A 4UFNA 1UPBA 1X8KA 1I1NA 2CL6X 3IDQA 1DQZA 1GQSA 3D54D 4KEAA 3U7GA 2NP6A 1CR6A 5FBRB 4NYIQ 1XMQB 1BJRE 5IFKA 2HREA 5I7WA 2O9JA 1UOEA 1G98A 2CFRA 1RAFA 1EB8A 1E3EA 1TB4A 2R8BA 2VNAA 4PM4A 2XADA 3U39A 4I66A 4D4GA 1H2WA 2I6UA 4L85A 1EB9A 3Q1LA 4B81A 1A8SA 2V6IA 2WC1A 3ZDAA 3L7CA 4KFTA 2I6XA 3UB3A 2G83A 2Q4DA 5DI9A 3IURA 4BNUA 5HIJA 5KYGA 3R3JA 4JK3A 1DKLA 5U1PA 4BFXA 2OHVA 3ZCVA 2WZDA 5EIEA 2SKDA 4J7XA 4R0VA 4YRIA 4YK7A 3TZ6A 2Y67A 2ZAGA 1QHFA 2GHTA 4CUZA 3LUAA 3AEQA 3GGPA 4KN5A 1QE0A 1BEEA 3EHDA 2B99A 2V45A 4BNVA 1OXUA 3AF1A 4HGZA 4RD6A 5CMLA 3RJ9A 3TSAA 3WA7A 2FN8A 1EUZA 1VDMA 1W5FA 1RAGA 2PNJA 3KQNA 3W6ZA 3IEKA 3PDUA 3QU4A 2GF2A 3CCFA 2ODNA 3K1ZA 3KAPA 3R0QA 4OLHA 3KLPX 1AHNA 1OOEA 1S2IA 1WHTA 3ZX4A 3DZFA 1BQ4A 1ECCA 4YRFA 3VPSA 1V5WA 4FHFA 1C0IA 5AJUA 5JO0A 1QG0A 3THXA 2ACKA 1X3LA 1UMCB 4IMIB 2AN9A 2VUHB 5EEGA 2B7CA 4BE4A 1QG4A 4D74A 3K9WA 1B0AA 1PUIA 2X2OA 4FFPA 4Y2RA 3S2FA 1HZJA 3MN1A 1PLJA 3G6WA 4CETA 4C4OA 4KVGA 3LG2A 1DRKA 5KSPA 2Q5QA 3KFLA 4ZOLF 3SR3A 1NLYA 1DADA 2B3TA 2AJCA 1R5JA 3HN6A 4LRXA 3ZU2A 1XPRA 2X9QA 2AOTB 4KGXA 4JBGA 4IDDA 1JQAA 3LH5A 5CPBA 4I55A 2DQYA 4RADA 4RMIA 1KY2A 1RLJA 2IVZA 4LRSB 1QV9A 4JLUA 1G291 4OHRA 4PZUA 3V1TC 4BMYA 1KDOA 2GRAA 4HVAA 2HLDD 2VDUE 3L07A 1C1DA 2H1CA 2Q49A 3UMRA 3UK1A 1MJ5A 3IBTA 1XCMA 3MC1A 5EWJB 1XJ5A 4BNGA 3VPXA 3K9FC 3PCTA 1W49A 4WKCA 4CKCB 3WAGA 3R6GA 2OCDA 3P9XA 1PKXA 4EF6A 5LSAA 1UJCA 3HXOA 1F51E 2L42A 4ITRC 1YD7A 5AKJA 2PV7A 5FBWB 3OA0A 5GONB 3TIXB 3P9SA 2FP4A 3EQ7A 4NS4A 4RMJA 4DDTA 3QMWA 4OA8A 4BP1A 3TJMA 3VR4H 4TSFA 4LJ8A 4GKKB 1FY2A 3M7IA 1L4LA 3WAKA 3ITEA 3AM3A 5ADVA 3ELWA 4TTQA 1VI2A 3U4HA 3ABQB 4H27A 3TGLA 4Q5IA 2P9HA 3P2MA 3Q9NA 4X7RA 1DAEA 4HSGA 3S28A 3ZI0A 3FCSB 4CL8A 4H59A 4HXEB 3EJWA 1CDZA 2ZB4A 3KB6A 4UBOA 1BE6A 4UUBA 5KTSA 1FL9A 1E7YA 2PVCA 5A2QA 2YWCA 3EW7A 4UD6A 1QDLB 1DC7A 1FBNA 1N4DA 4I08A 4ND7A 4RHTA 4UAJA 5AM4A 5IZCC 1CXZA 1NI4A 3LY7A 3FVRA 4IGIA 3F8TA 2P5UA 2LIVA 3Q3CA 5AICA 5FA8A 1SZPA 1LDMA 2J5BA 3EODA 4GECA 4ZEWA 5IABA 3DT6A 2VF2A 2O20A 5BR4A 5A4AA 2X0EA 1MP0A 2BFBA 1QMGA 1Z4QA 2C8LA 1J2EA 2X9LA 1X74A 5IAKA 5JAPA 3OF5A 1G8GA 1OV6A 4EFNA 4MRMB 2AMJA 1XDWA 2QR3A 3AVPA 3EMKA 4K87A 5T8KC 1XTIA 2ZI9A 1LJUA 1ISGA 4XFKA 3GDHA 3CF0A 2X0JA 3DJFA 1UZLA 3JYPA 5HKBA 2Y1LA 2VQFB 4BO0A 5FPKA 3OHSX 5THQA 3MSCA 4TRMA 1H42A 3OUZA 1GKLA 2RHOA 5AKKA 3STHA 3ZDXB 3A1EA 4AZTA 2ZXFA 4AMUA 2HHAA 3QU5A 1E6WA 3CRVA 3TFQA 2I0FA 5D5PA 3CVYA 2ERXA 1Y5NA 2EGHA 4B75A 3ONNA 2PLFA 1ECJA 2BFCB 3O83A 4UCQA 4ZPXA 3HVRA 1QP7A 5MGBA 1GPNA 2W4IA 4YJKA 2F1HA 3T06B 4OXQA 4V03A 5A02A 4RW0A 3IUMA 4J2OA 2YWDA 4TZ6A 2H8GA 1XD8A 5KREA 4N5MA 3VH3A 4P0QB 1U3UA 3ZXIA 4AIIA 4JUFA 4M0UA 1FLVA 1FRQA 4FFOA 4QUJA 2FCAA 4Z53A 5JCPA 4F3TA 2LTAA 3CKLA 3LVRE 4P7JA 3GBPA 1EZ4A 3JQ7B 2OHOA 1RWPA 5CVJA 2P3LA 3GAAA 3NBQA 1KPIA 1P6XA 1P61B 1R10A 1ZICA 1U9IA 2OECA 4ITUA 5CNJA 3TQRA 3W05A 5GWXA 4NXNB 1XLUA 3UGJA 3DTVA 1HQDA 4C04A 1QSGA 4Y9SA 1T2AA 3IMKA 4IIHA 3ETGA 3E05A 2B4TO 2RD2A 5LZ7A 2CUNA 3ZWMA 5JSZB 2WVHA 5J63A 4W5RA 4KQIA 2RGYA 1LDEA 1DG3A 1NNEA 3NEAA 4KIGA 5FYDA 5I51A 3M4JA 4CEJB 2P6RA 2UUBB 1FB5A 3TNLA 1K98A 1PJLA 5LQKA 3A9TA 2V7QD 3TJRA 4QM6A 1RHJA 2OPHA 4EGAA 3LHFA 2VEOA 3B1VA 3GLFA 1ZC4A 1OV4A 1VE6A 3JD3A 3NBYC 4M1KA 5JS6A 3FIJA 3I45A 3ROGA 4Q4HB 4JC0A 3OJXA 2RI0A 3Q3VA 4OQQA 2P67A 1ECGA 1EFCA 2BEVB 2QUAA 3V4PB 5F33A 5DIFA 4RA9A 4DILA 2W83A 2XEDA 4FX2A 4A6DA 5DX0A 3RBXA 3ORYA 5FWXA 3NM4A 1ZOIA 4ZTUB 5LFAA 3OCZA 3RODA 1X3SA 3ND6A 2HK7A 1RAAA 3CSUA 3C43A 4B9AA 4I0WB 4DN6A 2EQ5A 4EAAA 2FMIA 2GDZA 3B12A 3W7BA 4HBZA 1T8PA 1U2TA 7AT1A 4KDCA 3DAFA 1J8MF 4I81A 2ZWMA 1I3LA 2OG1A 3VX4A 4BLVA 4HNAA 5C80A 1PGNA 2VSQA 1FCJA 1TE2A 2I2DA 3QXJA 1RWWA 1JFFB 4JUIA 3WL8A 1W5AA 1X9GA 2JVIA 1XCBA 1ENYA 3H9EO 4R2LA 1AV7A 2BMFA 2OFXA 1M34A 2WP8J 3VZBA 1VE9A 1QIGA 2J5QA 2XSZA 3P32A 4H15A 1YUNA 3P2OA 5DNAA 3MPOA 2PX8A 5BSUA 4CM5A 3KTAB 2WF9A 2A5YB 2Z5FA 2DH6A 4BE7B 1HV8A 4HXFB 3K0AB 1MOZA 2F9FA 3KZOA 4LXHA 4Q6BA 3BREA 3A1DA 3TPCA 2XHEA 3B3FA 1NYRA 5FBKA 5HKLA 2I9KA 5C1IA 3CX8A 4Z2YA 1N5IA 2HSGA 5JAQA 4ZYWA 1JP7A 1OX6A 3GELA 4KDFA 4CDNA 4NBUA 5HKKD 5CU7A 1HDYA 3K9CA 4EGSA 1FLDA 3HCAA 1EFHA 4LYGA 1I9CA 5CLQA 2H1WA 2HMUA 3S7TA 3I2FA 2XPCA 1W0JD 4EJSB 1NYQA 1TCBA 3B7WA 4S24A 1WD7A 5CFOA 2P2NA 2HD4A 3JRWA 4MI9A 2X0RA 1M66A 1SBNE 2JI9A 5G1PA 4A8JC 5ALEA 1BKSB 1HTTA 3Q0EA 2B61A 1NN3A 4WXYB 1ACLA 4UHCA 2ZGVA 3DAYA 4KX3A 1WV0A 1LEHA 2J4DA 1MX3A 3SLGA 2FR1A 1ONBA 2VHXA 4D8YA 1A8PA 1T4CB 5FWYA 1MRZA 3JVIA 1E7WA 2WIBA 2J32A 2HEGA 5JZMA 2BCGY 1V7CA 1F3OA 4HADA 1RJWA 2GTHA 3CM0A 4HGYA 5LJIA 1KKMA 2J9GA 3K4HA 5ANRB 2GBFA 2KMLA 1DAGA 4L72A 2FMUA 3ZLBA 1NBEA 1GV0A 3ZHCA 4IWYA 2VTBB 2GZSA 2PTHA 2X6RA 5EFZA 1FW8A 5I7AA 7YASA 2Q99A 4F91B 3EF3A 1GA6A 2DT5A 3BKWA 3EC1A 3B2NA 1DFGA 4N6NA 5LQCA 1FC0A 3A9RA 1ZRSA 3JALB 4KVZA 2BJWA 2B8WA 4DA4A 1F14A 2FSVC 1XQYA 3PQDA 4QPCA 4Z7JA 5CH8A 4EJSC 3MRVA 4MR9B 1XFAA 2V65A 1C9YA 5GOTA 1QH9A 1ZN9A 1RLUA 2LRHA 2Q2OA 3HO8A 3NPMA 3TDNA 4BKPA 1P3DA 4L2IB 8ABPA 4P08A 1DCKA 1PNOA 4MS1B 3ICWA 1RKQA 2ZRGA 3GRVA 1X7YA 4OMDA 3SZLA 3MHTA 1IM2A 1O9BA 4BASA 2WYIA 4CTJA 4Z7QB 2J3QA 4QVKA 4US1R 2PSJA 4E2XA 1BDJA 5J47A 2GXQA 4H4DA 4KYUA 3HA3A 3RDPA 2BZGA 2VKTA 4CKEB 5HR5A 3V7WA 2RFLA 2C5HA 3F6EX 4OHKA 4PU0A 1EP3B 3B9BA 4UBLA 2VRWA 4AB1A 3WWDA 2CWDA 2SBTA 1HNXB 3M9LA 4A15A 2VDOB 4BPBA 3RAPR 1PN3A 3PHIA 2OLJA 1DHTA 2MYPA 3CE6A 4FU0A 1I4EB 1WSBA 4RH0A 2ZXUA 4INOA 2OHIA 3ENWA 2WU4A 1NLMA 3A26A 3N7AA 1PZNA 2H07A 4GYJA 4TL9A 1G21B 2E87A 3UFXB 3AIIA 1N2BA 3IPLA 4JR1A 5DEOA 1GAWA 4NCIA 4YY3B 1NJ1A 3MELA 1VKRA 2ANBA 4MLDA 3TXXA 2XUZA 4N03A 3R3WA 4C4TA 2IUEA 5TRTA 3ITDA 4DTCA 3KR9A 1HYHA 2NT3A 2QN2A 3A4YA 4EUEA 4Q01A 4QM7A 2MWMA 3EXG2 4OA5A 2Z9BA 3H1GA 2JVKA 5A4FS 5EJ4A 1VMDA 3QKSA 3T3PB 4GKBA 5HHTA 2NP7A 4YCJA 2GN4A 3F3SA 4FS8A 1UFRA 4FVTA 3W5CA 1B1CA 1H9CA 3JAWA 1WUTA 4HYEA 1KS2A 2COUA 1NM5C 4K9PA 2O8DB 1T1GA 3DNMA 3DSRA 3G8DA 4AXBA 2RC6A 1N5JA 3ISTA 3STWA 1ZH4A 2OYSA 1EQAA 4AZSA 4GBMA 3WKBA 3GUCA 4KPEC 1K3TA 2Y8EA 3LZ6A 2GKOA 1LDGA 2PL5A 1FRFS 2QL6A 2QN9A 1TLFA 4P7KA 1PWHA 2FQ1A 4XM0A 1CVRA 1F4VA 2HOQA 4NMMA 1N6OA 3X2SA 3N3BC 4WZBB 3EQ9A 4N7JA 4RGBA 1OGIA 3HU5A 2G9ZA 4OXNA 1GG2A 1TM5E 3A6EA 3TWOA 2OCKA 3C5VA 4I1OA 3O92A 3OFJA 4FZ3A 5EINA 3VISA 2GN1A 4FI3F 1O89A 4WASA 5BYAA 1X1SA 1XYYA 1WCYA 2W0MA 3EGIA 4YHBA 4JEUA 3VSAA 4CU2A 4GZ3A 5BMVB 3WYGA 1VJ5A 2I6SA 1QIHA 3I9FA 4YXFA 2BUBA 2YIMA 5FI0B 1H65A 5D3MB 1IAQA 2O2SA 3BF8A 4GL4A 4JC4A 3HB1A 4G5HA 5AXAA 1GT6A 2QK4A 3SG0A 4EJ6A 4UEKA 1S2NA 3RIMA 3AM1A 4N3BA 1CY4A 3M1IA 1UC4B 2QQ0A 2ZUBA 4X7MA 4KPFC 1VC2A 2JCBA 4F3RA 2OV3A 1NJ2A 1PTKA 2QL5A 3CW2A 1I7PA 1KZ9A 1V26A 3E9QA 3MT8A 2VDVE 3I5YA 1M2GA 5DMXA 1RBZA 3Q6NA 1Z75A 2QY6A 3DNFA 3V33A 3VKHA 1TUBA 2EJUA 2PKCA 2QUKA 3BORA 1T8UA 2CVPA 3OZ7A 1AA6A 4GP7A 2IYOA 2HUPA 3AHIA 1LTQA 1P17A 4LHWA 4FMBB 1XTSA 1WMEA 1V96A 1CUZA 1XQXA 1MB9A 1DXOA 3MWYW 2A1TS 4PRLA 4DLTA 3FJ1A 3G79A 2V0CA 2REXB 3V5NA 4KWCA 4MVJM 2OL4A 2AFVA 2WJAA 3BWYA 2ZJ7A 3PNOA 4HN2A 5FOSA 4AC9A 5HUQA 1U0JA 3L7DA 2H4ZA 4Q3BA 2V3CC 3R7WB 2GERA 1XJ0A 1Y4SA 2IIPA 4FLEA 5E0KB 4WWHA 4HNQA 1VE3A 1MKYA 2GJKA 1OLOA 2CNKA 1WPRA 1WOYA 2O50A 1GZDA 2OAEA 4Q19A 2QD5A 2P8JA 3GBSA 1GZSA 5ESRA 1HL3A 2ZETA 4LTMA 3RSLA 3Q40A 1YDEA 4NU5A 3GLGB 3JVUA 3BD9A 2OO7A 2H5IA 1G5PA 1SY7A 3HKCB 3IQFA 4NFYA 5IDYA 4JI4B 3CXRA 5JS1A 1VKNA 3OUUA 1E7QA 3LBNA 2QG4A 5ECDA 3SJZA 4EVRA 3JTMA 1RPTA 2ABWA 2IUTA 3GEGA 2P9ZA 4FILA 4BAUA 2PL3A 2GLUA 1W4RA 4QHTA 1C4XA 2QE7A 1CJBA 1GUBA 5WRFA 2PVSA 4IGAA 4L3WA 2XRMA 2ZE8A 3CWZA 5FWDA 3AHGA 3NAGA 4M1ZA 4NE9A 5CXXA 2X0IA 2W6JA 4OQDA 1DG9A 1A5BB 4X8OA 5EESA 5AKXA 4TYMA 2W0SA 4QNRA 3BBLA 2Z4SA 1QG2A 3IE1A 3AEYA 1PI3A 3L93A 2PH5A 3OH8A 1V71A 3W3AA 4JP3A 2IW3A 3B89A 1IC6A 1RVDA 1NVDA 2OYRA 4BCDA 4YYZA 1HG0A 4WY8A 2G88A 4HQ6A 2F3QA 1MR3F 4NPCA 3ZV6A 4C5BA 1VIYA 2B6HA 1O77A 3IULA 1UBMS 3ND5A 3O3NB 5KI6A 2DTEA 4LRTB 3GLSA 2I1VB 3GJSA 1NW8A 1YBFA 2GX6A 4RQBA 1Z0JA 4Q05A 1QHSA 1OBFO 1XCJA 1R3UA 3PFKA 4KDRA 3IILA 2ZSIA 3JU3A 4EG8A 4RSGA 2Y1OA 3SEFA 4AZWA 2W6ZA 1U7WA 1BYIA 2XTNA 3D0KA 4YRRA 2RCYA 4HNTA 2EERA 4B32A 2CXUA 2JGRA 1IYZA 1KI3A 3DUWA 4MS3A 5MN4A 4QYTA 1AH2A 3L06A 4NCNA 2JHFA 3R6LA 2BGJA 2LKDA 1ZPDA 2V7TA 2BFEB 4HDSA 2VAWA 3GJTA 4REQB 3SJ7A 5JFOA 5CTJA 4MWDA 1AV6A 3ROXA 1IUPA 1RCTE 4D56A 3LE8A 4B3SB 2VHYA 1AZWA 1U9ZA 1GADO 1NNSA 4YMVA 2QZPA 5EHIA 3IOCA 5KMGB 2PUEA 1ZVQA 3L40A 5BQXA 1XMOB 2R6AA 3ROFA 1JUDA 3D6FA 1USWA 2I76A 1G3IA 1JYSA 5ED0A 2FWNA 3BGIA 4C89A 1N6NA 1OIXA 2H1OA 2LDXA 3PDIB 2B37A 3ZR4B 4OM8A 4CV0A 5HSGA 2ZJFA 4KQGA 5E38A 5E9WA 5E4JA 5EQTA 1E2NA 4HJRA 4E21A 4OHWA 1YZQA 3LM8A 5GZ6A 4BZXA 3QENA 1AZSC 1FTNA 1N1MA 2WK1A 4AY4A 4KAFA 3ILSA 1YZ3A 1JHVA 2BRUC 4J29A 2WV9A 1VFNA 1X15A 2Q6IA 4J0DA 2WIKA 1VG1A 3D3WA 4O2BF 2V7WA 1TU3A 4TSRA 1RWOA 1G66A 3PNVA 1OT5A 2VHUA 4YIKA 1XQ1A 3QSGA 3MMSA 1EHIA 1AOXA 1FTYA 1I8TA 1QZZA 1SBHA 3CKMA 3DDNA 3EYAA 3MIIA 3V48A 3A9CA 4KMSA 5IT9A 1KEPA 5BSMA 4M6WA 4EGCB 4F6RB 3DMFA 3P2JA 5AJYA 4WZBE 3AL2A 4OCZA 3S81A 3W4JA 2IKQA 5FWYB 1Z0SA 4UUMA 2YRFA 3KPVA 5KHOC 1VP9A 2KX7A 5AM2A 3IOYA 1USUA 3X44A 4E1BA 1ZEMA 2YHUA 1NP3A 1UMCA 2Q7XA 2O0LA 2IXGA 5CX1B 4ZQHA 4D02A 3PUVA 3PG5A 4BX8A 3QSYA 4JA0A 3TINA 1VLZA 3FSGA 1J20A 2GJ9A 1KZ7B 4BJHB 5EJ8A 4U7WA 4FIZA 4TMZA 2IZ7A 3L7OA 2W5UA 2B4QA 2JRLA 4ILEA 5DSXA 3H3JA 3WYNA 1TOAA 2QRLA 1H6CA 4OFZA 4B48A 1GHTA 1JYEA 4JZYA 4RD3A 1TIKA 4QFDA 4XJSA 2WSYB 4UPEA 1AQLA 5AM1A 1RWMA 3L84A 3T9DA 1BE1A 2AR7A 2V97A 3RIEA 1LI4A 2IZ5A 2Z1DA 4PG6A 4UFPA 1GKKA 4FKBA 4RKQA 2HXGA 4CXMA 3ZS8A 1HETA 1TJYA 1N2XA 1XRNA 2Q27A 3FNRA 2WB2A 2AD1A 1JXQA 5IJ9A 2KI5A 1Y5MA 4LQ4A 1OQAA 1YJQA 4KE6A 1LSUA 3SP1A 5IJAA 2HI0A 3VOBA 4Q18A 5J3JA 2V6MA 2CUTA 1S7GA 2E4UA 2WU3A 2Z2ZA 3QX9A 1E1RD 1WCWA 4FC7A 3K7EA 4DNQA 4ENRA 1PV4A 3FLAA 3ROZA 4IJUA 1P1HA 5ARDA 2LCQA 3QLTA 4KJZA 2YDYA 1HDCA 3NHMA 4B33A 1PQPA 2OXCA 2YHAA 2IYZA 3UAOA 4OX9B 4HQLA 4K6CA 3NZEA 5JXGA 3G02A 1NJFA 3JR7A 5DLYA 4DGSA 4PSCA 3OO1A 1NE7A 2RH5A 4TSKA 4ZC8A 5JXHA 3K70D 1MXFA 4NEGA 3G7NA 2MT9A 3I2GA 1FVHA 5J4HA 1CVIA 3GLGE 3PTLA 3O1JC 2PYIA 2ASVA 4K6MA 2I3GA 3KTOA 5EA2A 1DCFA 1FNSA 1P4RA 2CLHB 4QUDA 1GP2A 3ZZMA 3DYIA 3EEFA 1AURA 3AETB 1YS6A 2CDBA 2BEUB 4AT1A 4BZZA 3WVNA 2VDRB 5JC8A 5UKDA 3W9SA 3IP7A 3OPNA 3DFKA 1XPOA 1JHRA 4FGKA 1GGFA 4HDMA 3T1HB 5DWVA 2FTKE 3LT5A 5L3QB 3RQIA 2QTGA 3LDFA 5CDHA 3PFWO 3VYSB 5LQNA 2V7GA 4MRMA 4MX8A 4BVHA 4K7JA 3V4LA 3U7RA 3DH0A 4FE4A 2HLDA 3K16A 3ESAA 3F5QA 1LBHA 5DK6A 1M6NA 4L95C 2OKCA 3PKJA 1T0BA 3TJZA 1GZ7A 1W47A 1C9NA 1JV2B 1I2ZA 2V7VA 2N3ZA 3LY5A 3SC6A 3PF9A 4IJMA 1UBKS 1TDJA 3REQA 2O3TA 3NOXA 1VBKA 2HL6A 1N1DA 2WP0A 2FN7A 4HI0E 1YE3A 1NXOA 3TYXA 4A8TA 1E1LA 2DFDA 2EGGA 2BFCA 3C97A 4H3SA 4BKRA 5JBNA 1DX6A 1M6VB 3Q87B 3MCUA 5J5VA 1BDBA 3ZIAD 1R50A 4FGLA 3GXBA 1QC5B 4OU4A 5FLKA 3UATA 3BHIA 1TVKB 3CWCA 5YASA 4JGIA 5IWCA 3D8NA 2VZEA 3G7UA 3K6SA 1YR2A 1HZZA 3K70B 3LCVB 1PJBA 3JQ7A 2DPLA 3U4CA 1W4AA 4Y30A 1BTOA 4IEEA 3NKLA 2GA8A 5F12A 1C7IA 2YINC 3A2NA 3C8UA 1STOA 2JA2A 3IQEA 4QELA 3VU0A 1J4AA 3CUUA 4JEMA 2WRZA 3KZNA 5KS2A 2I4MA 4KQFA 2ECQA 4P80A 1AQUA 4RTPA 3UC9A 4CM6A 3AV3A 4DNFA 2WU1A 3ZD9A 1XSEA 1SVOA 2VDPB 1UBLS 4HAYA 5JSZA 3OPMA 3QVMA 4OKNA 1HURA 2ZZKA 4R51A 3GFGA 3U5TA 3I76A 5AKHA 4MHTA 3NU1A 1AQNA 3IUSA 5IM5A 2NACA 3SD7A 4IKEA 3R6TA 3BWEA 1ZJYA 3CRW1 2JCSA 1ND5A 4CIDA 5F7OA 4TV9F 3ZY5A 2I4LA 4OB7A 4Q34A 5BWBA 1XXHB 3JQCA 1MAVA 3PV0A 3QBEA 4CT4B 3AP1A 4GOMD 5LDHA 3VC2A 4KB5A 4F3NA 2GUGA 2NO9A 3AHFA 3C7AA 4JZKA 4NAVA 2L17A 2BEVA 3S29A 1E3QA 1OFVA 2YY6A 4EYEA 3K0CC 2PXXA 1M8FA 2EBHX 1CETA 3L7LA 3VPBA 5DNCA 1G6KA 2VWGA 2GQ0A 3HU3A 5BW5A 2A1TR 2AZDA 2EFCB 3KQLA 4BO8A 4BV2A 4CEHA 3DBVO 1FEZA 3WYBA 3W4KA 5LDDC 5JZ9A 3P2KA 3Q8KA 3LW8A 1ZW6A 1GNVA 3FDJA 2PD6A 1GTMA 3QVTA 3E9ZA 1H3FA 3H5LA 1P9LA 1JFFA 1M33A 1U3DA 5CVTA 1HH4A 1CULC 2ZCJA 1D1SA 3NRCA 1QF7A 4OQPA 4BFYA 1S1CA 2HK6A 5D5HA 5EHGA 1OVMA 3DE0X 4MGKR 3SGLA 3QPBA 2HV8A 3X1ZA 2GLTA 5DTIA 4GNRA 4YVFA 3ELBA 3DHVA 5C5DA 4Q1VA 4ALNA 3LUFA 3FBGA 3AXSA 2PR2A 3KEMA 3T5AA 1E61A 3K0AA 4MO2A 2QUHA 2ETVA 3Q4GA 3WGOA 4EKDA 2W6ID 5GZ1A 5JEDA 5JASA 4ER0A 1BWRA 4NENB 3G5UA 3SVLA 1L7OA 1I2AA 2G17A 1GNSA 1NQAO 1FP7A 3I53A 2NUAA 2Z98A 1HC7A 2DG2A 2NO4A 2QSUA 4PPNA 3ECSA 2VUUA 1VP3A 2WD7B 3TQOA 3ZWCA 2VRNA 2QX9A 1F60A 2A2ZA 4NK4A 1FUIA 3C8DA 2IE0A 4XQ0A 1P1RA 1ZD8A 2V7QA 5TARA 1EFLA 2XA2A 2C4TA 1OXXK 1VJ0A 1GAQA 1L8AA 1JLRA 3RHSA 3K1TA 4CMIA 3VU1A 4RSMA 2VXCA 3O38A 5LP6B 4X65B 1N0WA 2NX2A 3B8HA 3A9VA 1HEYA 4XPZA 2XYVA 2YNMC 1F8UA 3C5EA 4MOWA 1ORDA 1T4CA 1PDOA 2C78A 5LOVF 2OMEA 3RASA 4KOEC 5GJVC 4CR8A 5KSWB 4MGYR 5HJ2A 2ATCA 4YT5A 2BH2A 1VA5A 2HSWA 1W19A 4FP9A 1W0KD 1Z39A 2PX3A 3A1CA 3HSSA 4WFKA 4YEDA 2WR8A 2I2CA 2Y27A 1GAXA 1FFSA 5DLDA 3PQCA 1CX9B 3VNUA 1PWYE 1N8TA 4JI7B 2VYNA 1N2CB 2XTJA 3R4VA 3RTDA 1PR6A 4EH1A 2IDZA 3Q7PA 4FCTA 4QYSA 3FB4A 2WLTA 1DIRA 1G0OA 3JALA 1UK6A 4BTVA 1U80A 2VNKA 3UJNA 1WEHA 1ZU4A 3BXPA 1EM8B 2Z2KA 3PC3A 3VJMA 5KO2A 1LD3A 4KQMA 2UUCB 5IG2A 4CTMA 1CLEA 2VCEA 5AVQA 2VDKB 5J58A 3CINA 4FNMA 1YL5A 4KNVA 2PXAA 4MR9A 4X45A 2ZE7A 1D5CA 1EZZA 1J8YF 1NR5A 2JGKA 4XJTA 4L2IA 4P6VF 1X13A 5LP6C 5CLFA 2PRJA 2BKAA 3DKKA 3ZIUA 5FB3A 2WJYA 2ICAA 3OQHA 2R84A 3MWFA 5DHUA 4B6OA 3PQ2A 1LWOA 3IBGA 2CL5A 4I99A 3EWAA 5AI4A 3ZK7A 1DUSA 1EDZA 4CKEA 2YVAA 3LJKA 1JL3A 3P4UA 3CZ4A 1QJ4A 1FSZA 3GL9A 3JWPA 3MTEA 3OLYA 2QRKA 4CKXA 1NM5A 2RMKA 1MJGA 1QHHA 1XIVA 2I7VA 3PPVA 2Q4OA 1W0JA 4GPTA 4DQXA 2YMMA 3CNNA 4M9ZA 4KX5A 1CZNA 4J49A 5EAIA 4ZVLA 4YREA 1IRIA 2NTEA 3AONB 5IAOA 3HZRA 4DYDA 5HRUA 2GD2A 4DUPA 5EXEA 1KZHA 1MAHA 3DDUA 4FDLA 2R8OA 3ZX5A 3OPYB 4R9UC 3D0RA 4F60A 1U04A 5IC4A 1JWAB 4HLNA 1P4HA 2KM1A 2PKQO 1NHWA 4NKRA 4NFLA 5DYNA 2O7SA 1LV8A 1YDFA 2I2BA 2AT1A 2ONKA 3CGWA 1E66A 1GQQA 1SKAA 1YTLA 4J0JA 4RIFA 1VYUA 3BBPA 5EJIA 1EHCA 2IIBA 4X3OA 5BRNA 3SZMA 5JR3A 3IKMB 1JLLB 1VHJA 1N0HA 2QNBA 4DCTA 4ZJYA 3C1OA 4LI0A 2XTAA 1FYWA 2A5JA 1JIKA 4A92A 4R1PA 4R2WA 4EB3A 1E2QA 1LPAB 3M9WA 2JFZA 1C7QA 1U2GC 2I67A 4A6EA 1CQZA 2VAPA 4OH1A 1GCGA 5HRAA 3KOYA 3QRWA 5AKIA 3QFSA 4RCYA 3D59A 3SKVA 3K70C 2O8DA 1US8B 2RJNA 1XFDA 2NGRA 4PGGA 1Q7GA 2V8OA 3FZNA 1ZD3A 2PMFA 4E13A 1L5OA 1SOAA 3GVCA 3QNMA 3IVAA 1HDRA 1N2HA 1QUFA 3DD1A 3WIEA 1RHQA 3KYBA 1G42A 1WHSB 3MTAA 1PNRA 3MQ4A 1C14A 1PR1A 4CRWB 4WZBA 1LVHA 2Y1EA 2E7ZA 3I83A 1G4HA 5G0WA 1ZIXA 3ECCA 3D6JA 1YKGA 5E1BA 2X14A 3QXHA 4BAZA 5AOCA 1H2YA 2QTZA 5IHPA 1ENPA 3LP8A 1IULA 3EG9B 5DOZA 4JJKA 3WLEA 4OJMX 1VB3A 2UYQA 2GVZC 5KQSA 4PPQA 3PWZA 1ZD2P 1ZMRA 3E23A 1YI0A 2P91A 4ERNA 1KXZA 1V7QA 3HDVA 3O2NA 1GUYA 2D06A 5D3MA 1YASA 1ZK2A 2ACWA 4RQTA 5F3RA 1G59A 5B7GA 3JYQA 4GMXA 4L57A 3I6MA 4E30A 1T34A 1K8YB 1Z7GA 3CZMA 1CUSA 1G9TA 1YFKA 5FUQA 4OK5A 5ALSA 1Y9JA 2IH2A 3A2LA 3N2NA 1E58A 2C2YA 2DY1A 4FD2A 4K5QA 2ZBVA 1WQ1R 4UE6A 4EKEA 3E9RA 3BFKA 5TQJA 4GI2A 3VVCA 4XWKA 1GSHA 4J9VA 5KTYA 6NULA 2Q1UA 5DM4A 4RK7A 3F4KA 2HY7A 3SX0A 1QR6A 1K5GA 2RH8A 2OHHA 4JWKA 1V11B 2YFKA 4MKZA 5A6VA 3AZOA 5EI5A 4YO8A 3A1VA 4BFSA 3CH5A 4QOIA 5LWQA 1YJXA 3FUUA 1RM3A 1E63A 1A2BA 3DZJA 4DIKA 4GH5A 5KOHB 3N6XA 4F7WA 1FVXA 1HE1C 4HWTA 1XMPA 2HF9A 1DEOA 3KUDA 3MT0A 2P6PA 5E3HA 2WWRA 1ABBA 2ZRIA 1PL7A 3SHVA 3OKAA 1FMCA 2ZVPX 4BBJA 1S2OA 1N3IA 4FYYA 3SEQA 2B35A 4AG3A 1CR1A 1HLFA 1ODIA 4MA5A 1QV6A 5AIBA 1ESDA 2Y9MB 2XLBA 1VCHA 3R7WA 3A04A 1T9CA 1A27A 3EH1A 3NP9A 1JEYA 3V3KA 1UM9A 2X23A 1JBEA 1JJFA 5F35A 1VMIA 1EGVB 4DCUA 4CEIA 5HX7A 3UGQA 4LK2A 5C35A 5C0OE 4E6PA 1W76A 2Q45A 3A1FA 4ERXA 3IIJA 2OD7A 3HKCA 3EFHA 2ZRBA 4CMAA 1UBOS 1IY1A 2QMHA 2QUBA 3C3BA 3RIXA 3I6ZA 2Q07A 1E2EA 1QANA 2H2HA 3BXOA 4GBED 1GFIA 1MO2A 2J5XA 3LQYA 4H7JA 3OM0A 4MV6A 1QIEA 3UXHA 3WHLA 3X1XA 5IKMA 1SOVA 2VT6A 5JISA 4AX4A 5K8CA 2GBLA 3DE7X 1ICEA 4OUDB 2VKQA 3WNBA 1Z0KA 4N0QA 2FFJA 4XX0B 3IUQA 5HTOA 3LNTA 4BWGA 1XTZA 4H1HA 2J41A 5TB5A 3NWEA 4ZHQF 4E70A 1AF4A 1ZJZA 3EZYA 4INZA 3VBCA 1RFLA 2XNKA 3PK0A 4MJ3A 2XV1A 5EKUA 4JNKA 5CHEA 3TLKA 1ODLA 3OKCA 4D9HA 3CT6A 1HFEL 1EDDA 3WNCA 3CEPB 2M6KA 3OCXA 5EJ7A 3RUIA 2ZRQA 4BMNA 1EJ6A 4R5MA 1E5TA 3ANLA 2NTNA 4BU0A 4LFBB 4JL5A 1JIVA 1I4TD 3WKAA 3TRHA 3EVTA 5CFQA 1Z6XA 5I8PA 2PLNA 2Q21A 2OG2A 2W6OA 4YQZA 4DCCA 1RP7A 4HTFB 4DJJA 4GOJA 3PC8A 2RGNA 3FWZA 3A28A 5AHOA 3IR6A 4X54A 2O2CA 3M33A 1IXZA 1Y81A 2QR5A 4LMAA 4ZAWA 5KDLA 1PFQA 3EMVA 1WX1A 3IAFA 2V3WA 1RXIA 2PBZA 2GPTA 5AP9A 2XE4A 2BRUA 2O0MA 1ONSA 2NSYA 4C20A 1Z7EA 3LK6A 3MMXA 2FWJA 1XTTA 3REGA 1RMQA 2FKAA 4M0FA 4PV7A 4W82A 2P1ZA 3I8SA 4YR9A 4CG2A 2YXPX 1SUDA 2BFEA 2TSYB 4P7GA 1E9BA 4RM2A 4Y2JA 4B5LA 4FB4A 5C37A 821PA 3CT4A 2AS0A 1E60A 4PGAA 1RPZA 3GLRA 2CXQA 2HQBA 5FNVB 3DWEX 1NJSA 3ORQA 2P5SA 1M75A 4HH1A 4OQXA 5C1DA 3QPVA 4HDRA 5AW8A 1BGXT 4JITA 2C7OA 5KMGA 3B1FA 2F3UA 3CPEA 2C5GA 5E7QA 1PX2A 4TV8F 1LW7A 3IHKA 3PDIA 1RI3A 3RC8A 2V98A 3T94A 5TLSA 3DF7A 1FFHA 1Q74A 3HB7A 2A9JA 3MBIA 3HJTA 2F6RA 4PVDA 4UAGA 1FFAA 1ADYA 4IEFB 4U0JA 4BNHA 2VP0A 3P20A 2Q50A 2P9BA 1GDTA 3SDZA 3PUJA 4UEJA 1P1IA 5AVKA 4JKOA 3UK2A 5IFLA 4MITA 3VPCA 3L46A 3WLQA 1ATZA 1TKAA 3ISVA 3QIVA 4IOKA 4RKWA 3ESRA 5KYUB 3H5IA 3KKNA 1NOIA 3KAQA 4MKRA 4MWZA 2AK3A 1XX6A 3WQQA 3LCRA 3TTTA 3EPJA 2H7XA 5KOYA 2FN4A 3IUNA 3RABA 2PPVA 4PNPA 3EEBA 2J9FA 4HUQA 4S2EA 1L4FA 2B94A 4ZREA 3GCDA 2H3HA 3G9UA 3H17A 4K40A 4HB4A 1INLA 3T7AA 1TM4E 3OOSA 3DTNA 4E94A 1MG5A 2FEPA 3K4PA 1FPMA 4EO4A 3OU2A 5L6MB 3VVMA 1C1XB 3C1TA 1M8PA 1AXGA 1LW6E 1GKYA 5AK0A 4H1UA 5CX1A 1A50B 3QBTA 5LBTA 3CNOA 3KC2A 1DAMA 2CD9A 4TT8A 1E89A 3I6QA 4QAQA 3WGKA 1U2DC 2YCBA 4DQVA 3VV3A 3FOZA 3JV7A 4QRIA 2MR6A 1Z2OX 2GK3A 2WWFA 2HA0A 3T3HA 3PX7A 4KLNA 4XA8A 3WWOA 1GZ4A 4MQ6A 4U1RA 2GM4A 1E59A 5EP4A 1NOKA 1SHZA 1IBMB 1V39A 4YIHA 3SC4A 3ORHA 3CVWA 2DTDA 1BXGB 3LK7A 4HAWA 3ZCXA 1VPVA 1Z4IA 1EE1A 5FYQA 1EVLA 5B53A 2RIRA 2B5WA 2CXTA 3DZGA 3PFGA 3RRJA 5CT5A 5SY6A 3U4AA 3D7SA 3HV0A 5I7HA 4ICIA 1UODA 4KAJA 1YK0A 1TQ4A 2C5SA 3D3NA 3COSA 2XZPA 5AK3A 3T99A 4BMVA 5ED4A 1L5VA 2PGIA 1G4UR 2WKSA 1Y4AE 2Q29A 3NCTA 3PNSA 4FJ0A 4KNWA 3E7WA 4M76B 2FYTA 1FJXA 3S6JA 2HTFA 2PRKA 4E5YA 1ECPA 1RE1A 2ZYGA 2Q7OE 2VPTA 5JU6A 2M1XA 4UM5A 1FRNA 5LZ2A 4IRUB 2VF4X 2G6BA 5CCXA 3QQ5A 1JZTA 2OC4A 5GM1A 1EK6A 3OZFA 2NVBA 2OGSA 2X42A 2VJPA 3K4QA 1N2JA 4GX5A 4Q4LA 3RRNA 3TRFA 3VR3D 4KHPB 5DM2A 3W8NA 2OQIA 3ESXA 1IZ7A 1GTG1 4PVCA 1SOUA 2PMWB 4EHJA 2ZKIA 2DBZA 4J4TA 5GAJA 4JLAA 3UMSA 2YV2A 3CSDA 5BPFA 3FPHA 3HY4A 2JGDB 3A36A 3M49A 2R4TA 2IX9A 4UOZA 1V5GA 3LC2O 4EG3A 2XRFA 3VSBA 3V6LA 3ZNOA 3U4IA 1CC1S 4CGYA 2NV6A 4Q9KA 5JE8A 2C9YA 3MILA 3VR6D 4QC2A 4RHUA 4P22A 2HWWA 3L77A 1F5SA 1GQRA 1KQOA 1LWNA 2GO7A 3BJEA 4XCXA 5KJEA 3HSKA 3AETA 4LDQA 1PK8A 4MVJI 3S55A 2R7KA 4U2FA 5BV0A 2QG6A 4F85A 2R8PA 4JUBA 3QLUC 1AS2A 4IYJA 5AT1A 3OJOA 1E1MA 2X41A 4B74A 4EG5A 3CVXA 1XBTA 4N18A 1RKVA 1GGEA 2R2AA 2YFHA 4M89A 2CFIA 3EPKA 2PSEA 3ZHYA 3RC9A 5L3QA 2VUIB 3KSAC 2O8FB 1V3UA 3A05A 4MP6A 4NLLA 1SC4A 2R60A 3SLKA 3HFGA 1A4RA 1VL5A 1WDTA 2ZU6A 3ESCA 3GJQA 3UWMA 1NFFA 1MB2A 4YFYA 5JLJA 5LJLA 3BUSA 1IVNA 4D9GA 3CUSA 3ILHA 5BT8A 2LBPA 2BE9A 3NORA 2DR2A 3W5DA 1E1RA 3G23A 1IB6A 3N58A 1CIPA 1U3VA 4RM3A 4X44A 2MDTA 3FOEC 3GPLA 5LZ9A 2I3AA 2WNIA 3QUCA 3NDJA 4NBNA 3UJ8A 4EB8A 4LJSA 1BCSB 2CZCA 1JJIA 1G8AA 3F5FA 3FPKA 1N3LA 4HDAA 5DBOA 4M0EA 1VPDA 4TWJA 1Q0PA 2FSSA 3ILYA 4PC2A 3RC2A 5BP7A 5JDIC 1QIJA 4R8MA 4OQLA 1DPGA 1QC5A 1FQWA 1C9EA 2BI7A 2R8YA 2X6TA 1HE5A 4PYMA 4RVHA 3EPHA 1TVKA 1BE0A 1Y3DE 2Z3WA 4MXDA 4NARA 1XUOA 4BZPA 5IK2D 3I01A 1HT2E 1XROA 4DDKA 1KMHB 1PFVA 2JCGA 2MSWA 3BRWD 4RD0A 3I9LA 2IBSA 1N75A 3K0CA 4RF4A 3UCXA 2PS9A 2NVUB 3OM8A 5TV2A 5K7SA 3R20A 2A58A 1A5TA 1JMKC 4TZTA 1NBIA 1W4BA 3OY2A 2QVBA 3O4GA 2IX3A 1N6PA 1ZA2A 2RDMA 2W98A 1RU3A 1N6RA 3E27A 4M98A 3R5SA 5HW0A 1PAUA 4Q1DA 3L8ZA 4EHBA 4I1PA 3ZZ1A 4IOJA 4TVKA 3ZE2B 5HF5A 5EUQB 2X9GA 3TZKA 5C8DA 5TT0A 2FN9A 2XDWA 2QW0X 1LX7A 1YR7A 2KLHA 2FP3A 2WOJA 2WT9A 1G7CA 5KB3A 1JAYA 1LVGA 1W9MA 3GUVA 1FNBA 3I2KA 4X20A 5TMDA 3PE3A 2QX6A 1P2DA 3TIIA 3USCS 3ZHTA 3KETA 4H1TA 3V4RA 3AHDA 3WTCA 2J7KA 3AKEA 3NO4A 4J16C 3PRJA 2BR4A 2XMZA 3J7TA 5B58C 4C7JA 5ICEA 2IEZA 2GBIA 4QA9A 1JVNA 1U1EA 2FPGB 2IOYA 3C6XA 1ECFA 3LLVA 1V6AA 3JQQA 4MIYA 1ZMTA 2WF8A 4P5DA 3RVPA 5A05A 3ZNNA 5IZ4A 1JIJA 3RYFB 4OFXA 2NLOA 3JQBC 2R68A 1DJMA 5ALLA 4NHOA 3BA1A 5HTKA 3V9AA 1CDOA 3I52A 4YDSA 4IDBA 4QEDA 4W63A 1A2QA 4WOJA 5TQ0A 4PCLA 1PCXA 1I3OA 2D1RA 1MV5A 3ZIAA 2JASA 2WSIA 3FTPA 4OHMA 4CFSA 4NVRA 2A33A 2GVDC 4C05A 3IS3A 2CDCA 3ZDRA 1OLXB 5AXBA 3RW9A 1IHXA 3E22B 4GG1A 4M1TA 1DEKA 1RP1A 2WFAA 1DUVG 3RVJA 5BQ3A 7REQA 5L3SB 2Q8NA 3T3EA 1II8B 2XH8A 2ODQA 5DNEA 3NHBA 1BQ3A 1VKJA 4BVKA 2XZLA 1FFWA 3A0UA 4IOMA 1ODKA 3P0JA 2AK2A 4YJ2F 3RIGA 2IEGA 4JJ6A 4U00A 2Z83A 1DWOA 4O5AA 4C78A 4NENA 4XIYA 2JI8A 4YECA 1KEZA 4JS0A 4N5HX 3W3ZB 1ZMXA 2P41A 2ESRA 2CLCX 3P9ZA 4Q9IA 5G53C 5T4HA 3T12A 4X66B 2DCMA 1FDOA 2WD7A 1FDSA 4JBHA 5ALRA 2ZZNA 2R8ZA 3AHCA 5B1SA 3JQRA 1K3UB 1D9ZA 4U7GA 1NQXA 3T34A 3FD8A 1HNZB 2HCFA 2HZ7A 3NTUA 3C2QA 1YBVA 5EXSA 1KQFA 3PJDA 1T5BA 4FFBB 2PBFA 3HQ4O 1TMGE 1EIWA 1ZSYA 4G0ZA 4JT8A 4ZYUA 2HH9A 3LBFA 3L7IA 4XVRA 3SKXA 5LP6A 4ISCA 4EW1A 1PG2A 3P9RA 4PSAA 3ZJVA 1H2HA 1HFJA 2KHZA 4Q9HA 2QIOA 3CC8A 3EMBA 4FGZA 3NIDB 4KOAA 4D3FA 3D7MA 4URWR 2Z9DA 2D1SA 4J9UE 1GYRA 5DHAA 1OKKA 1H2BA 2KLBA 3E8SA 5A3SA 4NBSA 4ZQEA 5FAKA 3KBOA 1KEUA 3ND7A 1ZGZA 4G09A 3ZWVA 3PI6A 3HYRA 4OATA 4L4SA 3GIWA 4I2NA 3TQSA 1RXWA 2EW2A 1DOZA 1K6MA 1D2NA 3IUJA 3T4EA 2Q9AA 4WLEA 1BN6A 5FJIA 5AVTA 2A78A 2QORA 2QPLA 3GFRA 3B20A 3QVWA 2PGXA 4UDXX 4JT4A 4F86A 2ZFUA 1O08A 4F6CA 4CIYA 1ZYUA 1ZKDA 1IATA 1IK4A 4LN1A 4AWAA 1JZSA 1PRYA 2AFIB 3LQ4A 2YFYA 4ABTA 5HJEA 3PUYA 5HILA 1G9SA 2OBFA 5JYBA 4DV0B 4P0TA 5KQPA 1E92A 1RWXA 4MIKA 4QGSA 1O57A 1QQ5A 1DDGA 3L6CA 4DOMA 2W6IA 3L1UA 3K0FB 2BE7A 2XQIA 4ZGWA 2J0EA 4JBLA 3L7MA 3KB8A 5AVOA 4JAVC 3F97A 4MNTA 4MMZB 2EJVA 4DRXB 1U2GA 3G89A 5L3ZA 5CDUA 1W88B 2ZSJA 3OTGA 4X8HA 1FDIA 3H2ZA 5EKDA 3WR5A 4CU5A 3C41J 3D4PA 1ZCAA 1FBTA 2ZQ5A 3UWDA 4O2AB 2IUYA 2YWHA 3SS7X 3DHNA 4LYHA 4BJ3A 3ZDFA 2ODAA 4CR6A 4NNJA 3R0XA 1KBZA 4E4YA 2W6NA 3OBIA 3QUTA 5MDHA 4D92A 4BJ6A 3YASA 1EE9A 3DR5A 4JQZA 1QHYA 2ZT5A 4M7PA 2IYSA 3T3MB 1L1EA 1R8XA 2EZ8A 1OH5A 3UBMA 5H02A 1DJLA 4XDYA 4ALJA 4XQCA 1S2MA 2C83A 4ZI5A 5BVGB 1DARA 1W0KA 2F8LA 1R0WA 5FOVA 3SM3A 3DHWC 3FLMA 1QVAA 2H65A 3EWSA 4QBIA 4LVNA 2PD3A 4FUTA 5BR7A 1H05A 4CV3A 2XCSB 1FFCA 3QITA 2FZLA 1VJCA 2DRIA 2PKYX 3C1AA 3GV0A 2NZWA 4Q82A 4F1WA 2C9BA 3QEAZ 4HCJA 3KX2A 3KV1A 4LJKA 3OCYA 2IW1A 1TM3E 3ID6C 4KN8A 2RARA 4C22A 2A14A 3CZRA 4PLPA 4F9GA 1US8A 4O02B 4DDHA 1AGYA 3O93A 4UE3S 4DG8A 1NF2A 5C7OO 4MUIA 2JA1A 4RPJA 1ZK3A 2NSLA 4ZT5A 3TLGB 1K7SN 5JZOA 2HN9A 1Q7BA 4ZU1X 2C1XA 1SELA 1D2GA 3KVOA 1PF7E 3OFSA 3OX1A 3HEMA 4OMFG 2QM8A 1WHSA 4HVLA 1WKBA 3K3PA 2JFXA 4BMDA 1SHKA 2D2VA 5AD1A 4EKIA 1JDVA 3A70A 3WG9A 4GW3A 5J2TF 4IBOA 1TO2E 4ZTZB 3D6AA 1JJ7A 1JIUA 3IO5A 1TVCA 1Z0UA 4C88A 3FXAA 3G2HA 2MSKA 2QY9A 5AM0A 1GFZA 3WGLA 2Y4OA 3IA2A 2XMBA 2GAOA 2XQFA 1IN8A 5FA5A 3W2FA 2ZI5A 4DGQA 5H3CA 2CE2X 2DM6A 3UW3A 2QLMA 2DR3A 3ADKA 3RFFA 2JFOA 4XSVA 5AJTA 2BYTA 1G18A 2FQQA 1A9XB 1GQ2A 3PPYA 1YE8A 4Y6PA 5KX5F 1XTVA 1ZI6A 4G37A 1QGED 4QBKA 4QECA 4PGMA 4C6TB 1ABEA 4LRYA 4YMSA 4NOLA 4QIHA 1WB9A 2Y05A 1O5OA 4HNGA 4RS4A 4KGDA 1R9JA 2ETXA 4URHA 3A1SA 4IX1A 5CA1F 3GPCA 3D4NA 4UE2A 3T1TA 3R75A 1THGA 1O54A 4P54A 1EU1A 1VJRA 2M1ZA 1RAIA 1Y7IA 4BEJA 4KR7A 4MPPA 3KKOA 2VYVD 5ER6A 1V47A 2D4HA 2X8LA 2Z6VA 1GILA 1NXVA 2Y66A 1MIOA 3TLEA 3F6RA 5EKTA 1Y37A 2UYOA 4GEKA 3H0KA 4I9FA 4XLZA 5FWNA 4L4YA 3AG6A 3RAJA 3H3XA 1ADBA 1C0KA 1EE2A 3DZIA 4K8RB 1K5PA 2C96A 1CRPA 2FFRA 3DOCA 1EA7A 1EVIA 1M2OB 1QTRA 1H6BA 2ACVA 1UOPA 3BDVA 3K5IA 3K9HA 3EIHA 4QFBA 5ES3A 3RC1A 1D1QA 3IV7A 5BV2P 2ECPA 3IQGX 3VU9B 1N32B 1AUOA 1QB8A 4FMDB 3HDGA 2FW1A 2W4QA 1CEXA 2FZGA 4Q1BA 1II9A 2CZGA 1GPKA 1MZVA 1UT6A 3NONA 4J6FA 4DIDA 4YCMA 3Q5DA 2KS6A 4G1CA 4IS2A 4E08A 1EX7A 2G0AA 2C5FA 3CBGA 1KI4A 3R3VA 4MW7A 1JX6A 3AEZA 1A1SA 3OZWA 5B58T 3RI3A 1U8EA 2H2DA 4K0KB 3RNLA 4YAIA 1ST3A 4Z4FA 2D1QA 1MQSA 2X9VA 2H59A 1JW9B 2O2ZA 3DV0B 4NCBA 2XRZA 2JJ1D 1X38A 2HMAA 3BSFA 4MUXA 2BBSA 2X77A 3ZCQA 2E82A 2BAGA 4LJ4A 1P7PA 1YK1A 1L1RA 1QOZA 4UNQA 3BT7A 5IASA 2E4VA 2ZRHA 1XVIA 3QYJA 4OUDA 2FJ0A 2QUIA 4H2DA 4XPIB 1SXJD 1WMSA 3KJXA 4XX0A 4I1RA 5FL7D 4B6JA 4CN9A 2BONA 3AWDA 4JLVA 4CQMD 3UPTA 1TYZA 3OCUA 1QOQB 2IBTA 3WQSB 4E1AA 4MCJA 3MRSA 4YAJA 1DAKA 3RGWS 3W9UA 3PITA 5JW6A 3D4LA 3NTLA 4AQ7A 5DPMA 1CQJB 4CMHA 4RTQA 1MJGM 4XWAA 2ZJ8A 5BMVF 3DD5A 1U7ZA 1TW2A 5LLDA 5JJKA 2WHPA 4DZRA 2JFWA 2GFIA 2D54A 2XCTB 3F9CA 5HGJA 1EUQA 1T9DA 4FSXA 5LQMA 2WJZB 5EFOA 4C3OB 2WVGA 2FETA 4AECA 4DV5B 2IS2A 1PJCA 4EATA 4GI3A 3AEUB 5GINE 2XCOA 4LIPD 1P2GA 2GOYA 4FYWA 2PUFA 3C98A 1QQ7A 5JNUA 2G4VA 1V8ZA 2VA9A 2EZUA 2OWEA 5KIAA 5CBPA 3AUKA 1PNQA 5FUMA 1ZQ1A 1MTOA 4M0CA 5D8DA 1EX1A 4LQLA 5KOJA 3VPDA 4F3CA 3ESBA 4JOBA 2RAPA 1OLUB 1I5EA 3LW7A 3KELA 3DVAA 1MOSA 3KD2A 3N59A 3L41A 5DNVA 3ET5A 4QYXA 2AC2A 3L79A 3QG5A 1B0PA 2GSDA 3D8SA 3HYSA 4YAFA 4HLUC 3ZH2A 5FNVA 2OO3A 5ES4B 3CEHA 4N5LA 3ZGNA 3OAAD 5HEKA 1IN6A 3DEFA 3I6IA 3E53A 3HRKA 2AEMA 3WGYA 2VSYA 2WQZA 3PBKA 2P1DA 1SIBE 3O2SB 1DDIA 1YHYA 3I39X 4NBKA 4ZO7A 3MJHA 1SXJB 4YAOA 1PW5A 1GCAA 3DMNA 2WUFA 2MINB 1D6NA 2QRGA 2XUQA 4RJ2A 3QU7A 4CQMB 4CPDA 5I6DA 5CIWA 1FLNA 3SFTA 2UVPA 4IYRA 3KLMX 4TTRA 5DXAA 3IXMA 1P0FA 3EXAA 1LNSA 3LLCA 4D3SA 2HYIC 1XZBA 3CIFA 3FYUB 4R2JA 4B84A 5CYGA 4ISBA 8LDHA 4U2KA 1X19A 3CTPA 4MWSA 3LDHA 1T9GS 4HRXA 1VGVA 3DR3A 1BIFA 2I4NA 1X2BA 2L82A 5KYUA 3GP3A 1L7XA 5JCJD 4D6PA 3D64A 1VSTA 4HYYA 3FMFA 3NV7A 5DNYB 3DEZA 2NMVA 5ILQA 4E5VA 3DHYA 3T3NA 3K5WA 1A95A 1UFQA 1MF7A 2ZUUA 1L5FA 1Z6TA 3NHPA 4MQMA 4BO4A 5BQFA 1C1XA 3T9EA 1U7OA 4GI7A 3I23A 3RAFC 4W8GA 4ALIA 1E2UA 1UFKA 2QTCA 5DCUA 1QE5A 1J70A 2HADA 3CNEA 4UZSA 4Y6GB 2P40A 3NWBA 1YCHA 5SZHB 2VWPA 3MLEA 1KSGA 2G9VA 4XDHA 4EKYA 4DANA 5BN3B 1OPXA 4UARA 2E89A 4PQEA 4AQYB 2JIMA 5AUQA 1U0BB 4JQOA 2O52A 3BWXA 3FYUC 4PFJA 4WBNB 4YCBA 3NALA 1C30B 1DBIA 1BXGA 1G8FA 1H0SA 1RABA 1WXFA 1L4UA 3T41A 3FOCA 5BNIA 2BBWA 1Z2DA 1M6YA 2NZYA 3G0BA 3KVVA 3ORFA 2ZAIA 2YWXA 3B6JA 2C4NA 3OVMA 4W1SA 5ERGB 5G0UA 1YQUA 1YULA 3AOGA 5TS3A 4RC9A 4BKMA 3OOEA 4DREA 2HGZA 2OB2A 4J0GA 4ID3A 4KH0A 1E98A 3HP4A 3KL2A 2C5LA 2GZMA 4JBNA 2HJRA 1IVSA 1GPUA 1UC8A 4D0SA 4KFUA 4UM9D 2PFSA 3UT5B 5EERA 4EMTA 4IVQA 1Z3IX 1NDUA 4W9RA 3D1LA 3OEHD 2UKDA 2ZJ4A 4YPFA 2R1VB 3T7EA 2XX3A 3EARA 2CCJA 3ZXUB 1DQYA 5ALYA 5KWSA 3D0QA 5KJ1A 3HP7A 1NN5A 5KYWB 4NZYA 1FFXB 2BPOA 3L0DA 4WKOA 2GCOA 3V46A 3ZNQA 4C3UA 4LW8A 4D8VA 5IDQA 3K8OE 4XE5A 1GA4A 1ZNZA 4QNNA 3VJLA 1K9SA 4WLFA 4D0NA 4F12A 1IAVA 4Z49A 4LYAA 3UAXA 1Q0ZA 2ZR8A 1IBKB 2AEFA 4P31A 4EA7A 4JKIA 1OI7A 2I78A 3SBEA 1Y6QA 4KQJA 4D9BA 2CF5A 1K0UA 3R7BA 1KAEA 3A1NA 2I91A 3D6HA 3EZXA 2ZSUA 4YJFB 1IQ0A 2V7UA 3GHYA 2A88A 3JS5A 4DDVA 1AGNA 1E9DA 2Z8ZA 5K3CA 5BW4A 1JF8A 4PQGA 3DCIA 2C94A 1SVNA 2DFNA 3MTJA 5GMOA 4ECEA 1T6BY 4WIAA 4L8FA 2M6LA 4JXKA 5JDIA 3JQ9C 1M2KA 4CMGA 4E4RA 4IOLA 1M0SA 4RZ3A 4RESA 1BW9A 4D5GA 3L8EA 3GFQA 3MJCA 1RHRA 1E6KA 4DHWA 2VS1A 3PS9A 3TAXA 4V2UA 2O8FA 3SQDA 1KJ9A 4D80A 4V3BA 2H2FA 3N0RA 2MYNA 1UOQA 5AKLA 5F76A 2ZBUA 3STTA 3OJ0A 2OO5C 4E2WA 4BGDA 4QSMA 4YUXA 2E0IA 1LBEA 3GT0A 3NI2A 2PT9A 2PUCA 2C7VA 1T4DA 4C07A 3O4JA 5KNBH 3M3HA 1ZITA 4UM9B 1TCVA 4X6UA 4GZMA 4C2UA 1OZAA 1YMVA 4NX2A 4NXMB 3MWGA 2Q0QA 5KSYA 2HDNB 1UXOA 4ALLA 3DGFC 1WXHA 1BCSA 3QEJA