2FR8C

Structure of transhydrogenase (di.r127a.nad+)2(diii.nadp+)1 asymmetric complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
174
structure length
174
Chain Sequence
b'SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
molecule tags Oxidoreductase
source organism Rhodospirillum rubrum
publication title The Role of Invariant Amino Acid Residues at the Hydride Transfer Site of Proton-translocating Transhydrogenase.
pubmed doi rcsb
total genus 47
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2006-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2fr8C00
3EY9A 4V1CI 4FVTA 1V5FA 2V3WA 2H2GA 1M2GA 4BVFA 4X3OA 4RJJA 4KPUA 1DJLA 4QPZA 4GG1A 4RJIA 1PVDA 1U28C 2H59A 1POXA 4UU8A 4L3OA 4KGDA 5K6TA 1YBHA 2WVGA 4D5GA 5EJ9A 1PI3A 4MQ5A 4JU8A 3D4BA 1PNOA 1U2DC 1Y9DA 2EZ8A 2QQGA 5EJAA 2OORC 4MZXA 3HWWA 1PYDA 1NM5C 4K9PA 4RMGA 4J1TC 5DGTA 4F4UA 1BFDA 1MCZA 1U2GC 1ZPDA 2H2HA 4UTRA 1POWA 2WVAA 4Y6QA 2FR8C 3IAFA 1S7GA 1V5GA 3D7KA 4G1CA 2QQFA 4BN5A 2IHVA 5K6RA 3PDHA 4BUZA 2H2IA 4JUCA 3EA4A 2AG1A 1V5EA 4Y6LA 1ICIA 2PANA 4GPEA 5EJ5A 4MPPA 4BV2A 5K2OA 3F6BX 4K9OA 2EZ9A 3GLSA 2UZ1B 2Q5OA 1OVMA 3FSJX 4Q9DA 3FLMA 4BN4A 2VBFA 4D5EA 4I5IA 3OE1A 2WVHA 5MFPA 5EJMA 1SZCA 3GLUA 4RMIA 4O8ZA 4V1CB 5DEIA 4FZ3A 1YC2A 1T9CA 4R8MA 2VJYA 4IAOA 4C7BA 4UUBA 5BWLA 2FRDC 2W93A 1PTJC 2A1TR 4GM1A 5FYQA 1YC5A 1JSCA 1S5PA 4UUAA 1J8FA 4C78A 3IAEA 4COKA 4HD8A 2H2DA 2PGOA 2JIBA 3K35A 1OZHA 1MA3A 1UPCA 3CLTD 1HZZC 4J16C 2Q28A 4KXQA 5D7NA 1M2KA 1M2HA 2AG0A 1M2NA 2H2FA 1UPAA 2A1UA 2OD2A 3CLSD 1T9DA 4BVEA 5EJ4A 4K9QA 3EYAA 4RMHA 4MPJA 5FEMA 5BWOA 2H4HA 2BRUC 2EZ4A 1E3TA 2FN3A 4GM0A 4TWIA 4FEGA 3CLRD 1Q1AA 1M2JA 2OD7A 1O96B 3JWPA 1T9AA 4IG9A 2X7JA 4QQ8A 4UTNA 3ZGOA 3FZNA 3F6EX 4ZZIA 1YTLA 1D4OA 1SZDA 1U31A 4RMJA 1T9BA 1XLTC 2OD9A 2OO5C 3JR3A 4IF6A 4UTXA 1Q14A 1PNQA 4JT8A 5EJ6A 2VK1A 3U3DA 4JUAA 4HDAA 2C31A 4K9NA 5AHKA 5MFZA 4JUFA 1UPBA 3D81A 3ZG6A 4GP9A 4GM4A 4RJKA 1PO7A 4UU7A 1O97D 2JI8A 2VBGA 3GLRA 2H4JA 5EJ8A 2NXWA 1YI1A 2VK8A 4V1CA 5MGNA 1EFPA 4JT9A 4ZP1A 1YHYA 2Q5QA 3RIGA 3U31A 2Q29A 4BVHA 5BWNA 4JD5A 2JI6A 2EZUA 4K9LA 4K9MA 1YI0A 1Q6ZA 2HJHA 4F56A 1YHZA 1Z8NA 5IMSA 2IHTA 3PKIA 4UTZA 4JU9A 2VBIA 2JI7A 4K9KA 2Q27A 1OZGA 3GLTA 4BVBA 2B4YA 2PGNA 5DGDA 1N0HA 2H4FA 2JI9A 3CLUD 4Y6OA 2JLCA 3RIYA 2VK4A 5EJ7A 3PKJA 4BVGA 2FWNA 4JSRA 4JUDX 1OZFA 1QPBA 2FSVC 3HWX1 4X3PA 2JLAA 4FEEA 4BV3A 5K3SA 2UZ1A 4UTVA 1YNOA 2DJIA 5MF6A 2EZTA 2IHUA 1Q17A 2NYRA 3E9YA 4JUBA 2Q5JA 3CF4G 4L2IA 4MPRA 1PT9A 4QELA 2Q5LA 3ZGVA 4TWJA 3LQ1A 1EFVA
chains in the Genus database with same CATH superfamily
3C5CA 5A9TA 2HSEA 2HNKA 1NUPA 1W85A 3M49A 1IG0A 4I6EA 1NLMA 4EHBA 5K3FA 4Y2UA 2J0QA 3NGLA 1M1NA 3M3DA 3UXEA 1XWIA 1NKSA 3RBVA 3RVJA 4CUJA 3WL3A 4L27A 5TDHA 2OSBA 5E1BA 4KQFA 3TCNA 1UMDB 1UPUA 4LJAA 1GPBA 3MCUA 1DBRA 4IDNA 3BTOA 4ZANA 1U65A 4NS1A 3W34A 1F2VA 1G5QA 4B6EA 4EG1A 1J4AA 3TLYA 1ZN7A 1TW3A 4B6JA 4D9MA 2FH5B 4B76A 1N9KA 3EFEA 4D3YA 4ZK2A 1P45A 4X24A 2ET6A 4JP5A 1XYGA 3QV1A 1YE3A 1F8UA 2OG1A 2G4CA 3T5AA 4ZRMA 2G08A 3WGNA 4D9HA 2WWYA 1N8TA 4XVQA 5ALSA 3DVAA 3LGXA 3O2SB 5JOQA 2ETXA 1S2MA 3O84A 4C3OB 3VJKA 3QYFA 2XGOA 5KYXB 4PNEA 4POOA 2PX2A 1E2BA 3LX8A 1ZK2A 1EFRD 5JARA 2Z9DA 2Z2JA 5AHXA 1QQ5A 5HF9A 3WFZA 1MKYA 2IY7A 1EGMB 1M34E 2VK2A 4KXXA 4TTRA 4A2CA 4Q3OA 2J0SA 3E7DA 3ICOA 4H59A 5LZ7A 1L5SA 4B5LA 5CT9A 1CFZA 5I7FA 4O2RA 4LOKA 4WOKA 4D8VA 3WLQA 2ODNA 3PL5A 3BD6A 2G72A 3SF8B 3S0JA 1D9ZA 1XFAA 1ZX1A 3HVUA 2Q3EA 2O52A 3RKUA 5FAKA 3LMKA 4RCVA 3LX4A 3GJRA 4Q7JB 2SNIE 2XEDA 5EP4A 5EWMB 4LY0A 3KTOA 3BZBA 4U0KA 1VIYA 3RUAA 5BWOA 4MPJA 3LECA 2B36A 3AEZA 1CS4C 5ALGA 3DFUA 3O83A 5FJIA 5G3YA 4BPRA 3WAGA 2LGJA 1Y37A 1QQTA 3UJHA 4B7UA 2FFAA 4POAA 4IQFA 3LO5A 1JDJA 4DR7B 1NV9A 4FBLA 3T12A 5IRCD 1TF2A 1Q44A 2LCFA 3NHRA 3QX8A 4JEMA 3DV0B 2HSWA 2H9YA 3OT4A 4LXTA 4AJOA 2BEVB 1ISSA 2EARA 3VPBA 1ABEA 4LNUA 4EH1A 1OLUA 1U3TA 2GNPA 1SHKA 1EJ2A 5CM2Z 2OLKA 4HDAA 1HL7A 2FG7C 4IIFA 2ZITA 4MRRA 3T3EA 4L02A 4RJKA 1VSUA 2HPZA 2W6QA 5BVHB 3K92A 4MUGA 4DE5A 5F64A 2Q1YA 5ALPA 3T1TA 1GL3A 1R4MA 2CV0A 2QGNA 3UNXA 4DA8A 1W6RA 3PYLA 1ODSA 3HCAA 2AOUA 5EAIA 4BDTA 4I5FA 4NESA 3TTWA 1KI2A 4OHVA 4WOJA 3K1AA 1YQXA 5I3ZA 2FG6C 3IE1A 2ZIEA 4BVBA 1D8TA 4J0KA 2PH3A 5ED4A 3N2IA 4S04A 4TKZA 4CKYA 5JBNA 1BFKA 1NLZA 2DH5A 4PZAA 2OFFA 4TT8A 3KV1A 4BCDA 4C7OB 4LV6A 4EO7A 1YF3A 2NXEA 1L4UA 2ATIA 2ZZMA 3PX3A 3WB1A 1EX9A 1YNSA 1G66A 2HIAA 3F8WA 1V8DA 3GB9A 3HJHA 3K0AA 4TYMA 1KH3A 3UQZA 4E2WA 4A8JB 3M6MD 3T5MA 2JLBA 1P19A 2AQ8A 1I5RA 4B32A 1YJAA 4FT2A 4AT1A 1Y0BA 3EEYA 5A7GA 3D5TA 5JWOA 4D1YA 2QD1A 2R00A 3V4VB 3SXJA 3FAKA 4OGFA 1O5TA 1NW3A 1NVEA 3FHLA 2FPPB 1SHLA 3ZGYA 5JC8A 3O4VA 5JE8A 3P0IA 4DAEA 3ACCA 4A8JC 3BTVA 2G82A 1FMJA 3OIWA 1G20A 1RQGA 3OIYA 1N5DA 2VDLB 4X9XA 4XUCA 4PG7A 4RESA 4UTRA 4AVYA 5A5VA 4R5HA 3C24A 2BFBA 2BLLA 2DLDA 3P4YA 1BSVA 5J4YA 4Y30A 4KR7A 2GVZC 1DDIA 1PS8A 3EA4A 4EMSA 4F4FA 3RUHA 5EJ5A 2YV4A 5LIRA 3QLTA 3AC0A 4M1OA 3QKWA 1VMKA 4H7DA 3GLIA 4QJ3A 1G55A 2VPQA 1TCVA 1RE0A 4LJ8A 4E4TA 2NVBA 2P9ZA 4S24A 4CMEA 3R6LA 4I4IA 2EFEB 4U7DA 2XVMA 3RAEC 4D6PA 5CFZA 4RZ3A 1HLPA 2G63A 3X1MA 2VJLA 2AZTA 2VJYA 3MOSA 2Z8YA 4X45A 4PAOA 5MDHA 2DBVO 2Z4TA 3BTSA 4P93A 3TD9A 2PSSA 3FKJA 4KUGA 4EEZA 3AESA 3AQIA 4YRDA 3RRXA 3DDSA 1PKEA 2FPIA 4HSEA 3WBFA 2XX3A 2JEZA 4DCCA 2PD6A 3PQEA 4RK1A 3AF0A 1GGVA 1NYLA 2BHSA 3ABQB 4QUEA 4Q34A 4R8KA 1U3DA 1KY3A 4PCVA 4CM5A 2OD2A 4EGQA 3KALA 2WHPB 2YASA 1W4AA 4KUHA 2AJTA 4RHXA 3SSMA 5FOWA 4D3XA 1VB5A 3ZU6A 1K98A 4LXQA 1V1RB 4DMMA 1YJQA 1T36B 3I92A 4C4AA 1I0ZA 3RFTA 1R0XA 3BIWA 2P41A 3IR6A 3OTQA 5AW6A 4K5QA 1LX7A 5KYGA 4K9RA 4KIGA 1T9HA 2QXYA 2WMYA 1OH8A 2OO5C 2AC2A 4QRIA 3ULKA 3X1XA 5M5BA 1QYRA 3E5RA 5H3LA 4LZJA 3W1VA 4ZVTA 1F8YA 4DLNA 5TQ2B 5ANRB 5HGJA 4DQLA 3TNYA 4OLBA 2TECE 5I9TA 4R1OA 3STYA 5GVRA 1VFNA 2E49A 2P0AA 4XQ9A 1QIDA 5B3AA 4AZSA 1O97D 3HB7A 4PC6A 2JK0A 3EPPA 6REQA 2I6TA 2RG7A 3DKPA 1ZI8A 1VE6A 1R00A 2ZPTX 4XWAA 4YAWA 1DS6A 5EMLA 4AB1A 3ZJUA 1E8NA 4MO2A 3PQ4A 5HMLA 4K9MA 4Q4HB 3RT9A 4EUKA 2B4AA 4PHCA 5D51S 4V0RA 1Z28A 5H70A 2R1TB 5D86A 2QJFA 4LGMA 1NF2A 3LY8A 5H9WA 1NXXA 5EUCA 5FWNA 5H16A 5TSDA 1PLLA 4JDUA 4BO6A 1AQIA 3WNZA 4BKMA 2HHLA 3E1SA 1VLMA 4PN3A 5J2UF 3BZUA 2CLOB 1RW4A 3DL2A 4LXGA 2AMYA 1PLJA 1Y3BE 4OHUA 1MH1A 1X94A 5K3SA 5BYJA 3T1VA 2PH5A 2DJIA 4MI3A 3IVGA 2HF8A 3BSYA 4B2LA 4IOMA 1VYVA 2GOYA 2CCJA 4WW0A 4HDSB 1RR6A 3M5WA 2FHPA 2B8JA 5E3HA 3SD7A 5LCXA 3GBVA 2O6HA 3ZCTA 4RNDB 4A8TA 2AEJA 1KS2A 1ZOSA 5IUJC 2Y99A 4RHCA 3PA8A 2MIIA 1PEAA 2CXNA 4Q3NA 3HDQA 1N0VC 3HFRA 2MR5A 1VJRA 1F12A 2QM8A 4HWSA 4RWEA 1X2BA 4W8HA 5FX2A 4MWSA 2PUDA 4B3TB 2JLWA 3T5PA 1SHZA 3QP9A 2DRIA 3C3YA 2I4MA 4HQNA 1UBHS 4CFYA 1TVEA 4KBFA 1H6AA 1CIJA 1G8GA 5JXGA 2HZBA 3O2NA 3P2KA 3HY6A 4YXWA 3TECE 1J1IA 3GJ6A 1FQJA 2VNKA 5E7IA 1XCLA 2GN2A 1R16A 1LDYA 1R4MB 2Q49A 5K0BA 2V7XA 4EABA 2FZEA 3FYUC 5I45A 4JMPA 3DBHB 1QHHB 3CF6R 4GPAA 4M0DA 4U9UA 1ZN2A 4IF4A 1I2CA 1O4VA 1A04A 4C4OA 2WF6A 2YWCA 1JR6A 1Z0AA 2B6HA 4C08A 1U6KA 3TTVA 1BCRA 3VU1A 2BRUA 5BRAA 5AW1A 2I2BA 3IA2A 4ARCA 3AETA 5FBVB 2C4UA 4OHRA 3I6MA 1G5PA 4QO8A 5E6RA 1ZMBA 4B3RB 1LBIA 2PXXA 3HA3A 2R96A 2FP4B 2J41A 1ZVMA 4Q02A 4TVBA 2DHCA 3KL2A 4XW2A 3PUZA 1NJ8A 4NXNB 3PD0A 3MLEA 1WB9A 4IEFB 3EHEA 1VHQA 1UODA 5EHGA 2CBXA 2HC9A 2DQSA 3LCRA 2MSCB 3K7EA 3UFXA 4Z4IA 4K0KB 2CL7X 4O2AA 3G2HA 2FJ0A 4ZYZA 1F1JA 4JBGA 3KWLA 1BD4A 3FPHA 1T9ZA 5IW8A 1AQJA 2BFWA 1AUOA 2CL0X 1FNSA 1H94A 4D9NA 1EQ2A 3VH1A 2VDQB 4G81A 2XPCA 1TMYA 4D4JA 1SEVA 3FOFC 2IHBA 5DHFA 4QQ8A 3ZGOA 2VUHB 4IIYA 3ED1A 2PKQO 2DQZA 1ORVA 4AKEA 4Z9FA 5K03A 1QU3A 1KDTA 2L69A 2O8CB 4AMVA 3FDJA 2GPTA 4NU0A 1OGJA 3ZWPA 4MUYA 2B2XA 4BJHB 2EKDA 1GU0A 2QSZA 1ZC4A 4NJEA 1T3HA 3B7WA 1UKYA 4PE5B 1NUHA 4C6SA 2V7WA 5T3YA 4D80A 5JZVA 1SJ9A 3E5NA 1CERA 1KZ7B 3JX9A 4ZYVA 1IXKA 2DQ4A 4FCTA 5DK6A 3DH0A 3KFXA 1YE8A 4GVPA 3DQZA 4L8WB 4PRLA 4TYWA 4FC6A 4JB8A 4XWYA 1TUIA 2NXJA 5AP9A 2GZRA 1ZEMA 3CPEA 3LUGA 5CA1A 5L7TA 4QYIB 3QFFA 1E2JA 1GZ3A 4GPZA 3TWOA 3CKMA 4KYTA 3DE0X 3A1CA 3SQLA 1EUDB 5FTKA 3ILVA 2ZT8A 4JB3A 3TSAA 4AJ2A 5JNWA 4BASA 1M2EA 4TWBA 3H3FA 3IEXA 4US2R 2ZUBA 3ZPXA 5CA0F 2CVZA 2OA0A 3D5QA 5FADA 3U37A 1T0JB 4AXBA 1TJYA 1ZUWA 2QPAA 3FROA 1WVIA 4KQKA 2W9XA 3DLTA 3EG5A 3FCAA 5JJBA 1P8AA 1USUA 3KJNA 4RJJA 4JC8A 4B35A 1KDZA 3SC6A 2V1XA 1R6DA 3ZVMA 1VLVA 4KE6A 2OZVA 4BO7A 2UYCA 1HX7A 4G56A 3FF1A 1XXHE 3O1IC 1NRIA 4EY7A 3DV2A 4C7VA 2DHRA 4QDOA 1Y1RA 2FW0A 3MT0A 2Q0QA 4S3MA 2FMHA 2NU7A 3OKCA 3R3VA 4QTZA 1V2GA 2I9PA 2XITA 2Y3IA 5KU7A 1MCZA 2VDNB 1J24A 3GFPA 3WO0A 1GZ4A 4LJKA 3WP1B 2P77A 3HFGA 4QBTA 1ENOA 1LRLA 2WSSA 2WVAA 1A76A 2I7TA 4MWTA 2R6AA 4J0JA 2RBKA 4X94A 2GNOA 4HQFA 721PA 1FJXA 1UPFA 2PS3A 1AUXA 1Q0LA 1UJ4A 4CM4B 1GDDA 1OAAA 1JH8A 2HX1A 3RTCA 3UENA 3ZNOA 3GT0A 1OSNA 3OX2A 4YCNA 4O4JA 1RKXA 8MHTA 1UM9B 3AM5A 4EW6A 4IBOA 4BNKA 1FNDA 4CTKA 1J7JA 8ADHA 3BDAA 4BO1A 1EH5A 3HEAA 4HQ0A 2TSYB 4RK7A 4R16A 1WOYA 2EFDB 1YQDA 2X2EA 4QODA 5LP6B 5CT6A 5FWYA 1E0DA 3NJ4A 2C03A 4IIJB 4BNDB 2ENUA 3NHJA 4E12A 2O6LA 1B73A 3FMFA 4U7HA 3BERA 4XDHA 4DRZA 4PYOA 2NXNA 1O8CA 3UN1A 3KQYA 3SZMA 2X6QA 1E1LA 3WA7A 1LBTA 3CEJA 4A8HA 1CD5A 1C8LA 2A58A 4DIEA 2IYSA 5B1DA 2G76A 2QMYA 2WA1A 3HACA 3V2HA 3JAKB 2XE4A 1UQRA 1N7JA 3GF4A 3UOAB 4OMFG 3DPIA 2I6GA 3TRJA 4CF6A 1RYEA 2ZAOA 3QE0A 4F4JA 2CL6X 3F3SA 4K9QA 4YJGB 3SHOA 1F6BA 5SZKB 1RWVA 4JCCA 4OA5A 1PUJA 3O94A 4JBIA 2VIIA 2BP7A 4OL9A 1CEYA 5TLSA 2VP2A 2YZNA 2IYUA 3EDMA 4S2EA 3WB2A 3ECAA 1K7CA 3PHLA 1Z4PX 2HF2A 4GMFA 3RS4A 4NKRA 5IT4A 3U3JA 3PHIA 2L0XA 4A6XA 1F7UA 1T5LA 2P5SA 3X1KA 2AVDA 1GU1A 1LNZA 2B1IA 1A4UA 2DECA 3FIJA 3LDAA 3OOWA 5EHNA 3SOPA 1DAOA 3WGGA 2Q07A 2I4IA 5CXQA 1R5JA 4LHZA 4O4IB 2GTIA 2EIHA 3SEZA 4JXZA 2GKGA 4O6VA 3CC8A 4OM7A 3L41A 2B4TO 2WJ4A 5KOJA 3DM5A 3DOHA 4XZ3A 3N7UA 3VC3A 4LF9B 3KHSA 4CL8A 5SY4A 4C0KA 2EVWX 3H8VA 2CVOA 2E82A 2FW6A 4KC0A 4PBRA 1KBQA 4HTFA 5T3UA 3WG9A 4IDBA 1K2WA 4CHTA 1V2HE 2HYDA 4PSKA 1R9MA 3BMQA 4NFYA 4Q1DA 4XAQA 4WK6A 3QUBA 3NDJA 4M8LA 3TOCA 3BOSA 4C0JA 3H83A 3GNLA 5A2GA 3NOXA 1PR3A 1VCNA 2X19A 2Q6TA 1GNRA 1N0HA 2WE7A 1F8FA 3M2PA 2QL5A 3AJDA 3EXHA 3M5CA 4IJWA 2Z2ZA 1U5BB 1PWEA 1N34B 1YGPA 4IJUA 2J87A 1UC8A 4UTVA 3SXUA 1SUIA 1DNPA 3IODA 2EZTA 2ZRQA 3PWSA 1P1HA 1RKQA 3VX3A 4AKIA 3RYCB 3QTBA 4JJKA 4L0QA 2BD0A 1UKZA 2H1FA 3OIFA 5EPUA 4CIVA 2B2NA 2JGFA 5ILOA 1HNXB 1DXYA 1J39A 4L0CA 4L85A 3AKYA 3PFCA 1H1TA 1K0FA 3M4NA 3FBTA 4WFQA 5H83A 3BHIA 3HRHA 4DYVA 5FLXA 3OEWA 4NDAA 1PI3A 3JQGA 4ZHSA 3PFBA 1M1UA 3GRFA 2Q99A 3N2NA 1OGYA 2C83A 1FS4A 5D2CA 3ZK9A 4EG8A 4B46A 2E7ZA 2IPAB 2Y0CA 1TUEA 5FI1B 1A1VA 4GSLA 5I7VA 1JQ5A 4GXNA 4CQMD 6YASA 3W8NA 3LUAA 1UJ6A 2OILA 3DJFA 3BD9A 2I99A 3Q1KA 3K1JA 2VOEA 3O75A 1GQOA 3HLTA 3GJXC 1LRKA 1VSQA 3KBOA 2GFHA 2VZEA 3O9MA 3B38A 1TADA 2C92A 4JYPA 4PZUA 4X6XA 3QA9A 4TUYA 5B2EA 4O0LA 1U3VA 2J31A 5G4LA 4YDSA 3I28A 3ZQJA 2PUEA 4BRUA 1N33B 4BQIA 1JA9A 2CJWA 3KYCB 4TLAA 1SBZA 1RT9A 3GP5A 2FFBA 3OM0A 4RMIA 4AKSA 4TVSA 5JQGA 3KKZA 3OHSX 3QVVA 4XIJA 1P7PA 5KWEA 1TOAA 2ZZKA 3FZGA 1Z2DA 3HU2A 4FWBA 4RPJA 1ZM7A 3ME5A 1E63A 2X4GA 3HKDB 4MVJP 2PR2A 2OP1A 3PGA1 5LBIA 5KEIA 4LYFA 1VL8A 2IHZA 2LIPA 2PLWA 2BMEA 2YIDA 4YCSA 8GPBA 4H0FA 5E4JA 1LBSA 1F20A 1JWBB 2YJ4A 2QVZX 4MMZB 3ITNA 4MW6A 1IHXA 1P5HA 2WF8A 3EXEB 1IRIA 2ZYRA 3N6VA 4UJ5A 5E2IA 1GTRA 4LF4B 1Z0KA 5DI3A 4DLKA 4IRMA 3OAAA 4I55B 2XUIA 1U1DA 1JAXA 2NM0A 4IZIA 1KEZA 3LRXA 3MLBA 5EE1A 2GN6A 2DQKA 1WMSA 1B0ZA 1M73E 4RK5A 4PGHA 1N4AA 3VGPA 4QNNA 3G1TA 4MV0A 1NP3A 1YRYE 3CCBA 3EOBI 4GAEA 3WZMA 5I7OA 2C9ZA 2NQ2C 3BVPA 4XQGA 5CVVA 2CNOA 3CGGA 3WK5A 4OY3A 4FONA 1WHSA 3VDXA 1J2TA 5C51B 1S3GA 1SY7A 3VNSA 3HVHA 3W05A 2IXEA 4DRXB 4JJAA 4YRTA 3AQ4A 1ZRHA 4JI7B 2GZAA 2JJ1A 3RV3A 4CCWA 1P60A 3IAS1 2BEUA 4YREA 1LGYA 4D4LA 2A7QA 3BGSA 3LYLA 5AMXA 2PT5A 2H9AA 4GM4A 2R62A 1ZD5A 4HLCA 2VBGA 4KYIB 5DCYA 4PG8A 5LP6A 1UP7A 1UBGA 1UR5A 5AQ1A 1FRVA 3G2IA 3PWTA 1JDBB 2EZUA 2QAIA 1Q6ZA 4G5OA 4KCGA 3ZU3A 2ENWA 1L4HA 1YONA 3KIPA 1CRPA 1R0ZA 3KOMA 3WB9A 2H18A 2XMGA 2H4FA 2VTBB 4YQZA 1JAHA 2X8LA 5K8JB 2CUTA 1UBLS 1JPUA 1XEWX 2X8AA 1YB4A 1VRCA 4HSGA 4L9SA 4BVGA 3OZFA 1LI7A 3RWOA 5K0SA 1RJWA 1JEOA 2H17A 1ZWLA 2P9BA 1ZGBA 3K1YA 1RFLA 1N6OA 3ZDFA 1SUCA 3CF4G 4X6LA 3AI7A 3EVCA 4E30A 4XQEA 1NYTA 3PR1A 4ZMSA 3GQVA 5A4DA 2B5OA 1GLNA 3Q5DA 5CVUA 1X7ZB 4CMEC 4CJXA 5CITA 7MHTA 5AVTA 3ZCRA 1OTYA 3R3YA 1N3BA 2BJWA 2DPXA 1C4OA 4JL6A 1EB8A 2AN5A 4MKHA 4QDZA 1DKOA 3WLNA 2HYIC 2ACWA 3WJ7A 1K0UA 3QSYA 2QP4A 1KWGA 1AIPA 2FEMA 4RY9A 1DPGA 2F3UA 1SB9A 3TRFA 3ZHTA 5DGXA 4QRDA 4YS6A 5TEVA 4Q03A 2R97A 5GINE 4KAJA 5JU6A 3NRCA 2YVLA 5CEJA 3FN4A 4Q1AA 2I4RA 3A70A 4CMAA 4U5QA 2A0WA 2HCJB 2WHRA 4O4LA 1M5RA 3L0ZA 4WLEA 1WDMA 2N0SA 3LLSA 3S2SA 3SCZA 3FKSA 1J8DA 3DKKA 3PLRA 4RSGA 2BC9A 4ML3A 4A6DA 4E7OA 3LPDA 1QX3A 1EVYA 1ZXXA 2EQBA 3PNPA 1PJAA 3BMCB 4R1LA 5ICSA 4ZA2A 4GKKB 1T8RA 1RHKA 3G0BA 3UWMA 3ZDRA 3QQ5A 4DDUA 3U7HB 3JZFA 4FEAA 1KMHB 1EBUA 1TLLA 3OOHA 4ON9A 4GRDA 1RM5A 3GY0A 4MV6A 3TW6A 4UMVA 4UASA 4CYMA 3IAEA 4ENTA 5EMHA 1DQYA 4AWAA 3EN0A 1VECA 2VC2B 3O38A 1X1RA 2INGX 4ZQGA 2ONYA 5C37A 3UF0A 4LHXA 3WDMA 2FU5C 4HNAB 4MDHA 1CX9B 1H3FA 2P4HX 3FWZA 3LY5A 4RFSB 1T8YA 1ZGZA 1EK6A 2Y76A 3NHUA 3G9XA 2FZWA 3QPUA 3K09A 4MINA 2WTMA 2QW0X 2WYWA 3FBGA 3FRHA 4I3FA 4XD2A 2Y93A 3MRXA 4ATNA 4XTCS 4NH0A 1CJKC 2PWPA 1KI6B 2PWZA 4KFSA 4O3FA 4P32A 5IJAA 2OYCA 1GRNA 2BMFA 4TMZA 1W4BA 3KJEA 5DRYA 5AUPB 1SKYB 1SZJG 1UBEA 4NULA 1C7JA 1JLKA 3FPSA 2VT6A 4GICA 4P36A 1O95A 4Q4AB 1K8QA 3DUWA 4WWHA 1R0SA 1DKQA 1I30A 5AM2A 3WMRA 3BUSA 4EG6A 3IEKA 5EL0A 3R77A 4P38A 3PRYA 2XTJA 1XTSA 2J0EA 3T5GA 2CJFA 1TMOA 1WS6A 2OMKA 3EODA 3C0KA 1TK2A 4GBJA 2IPOA 1ZOIA 2ONJA 2PEYA 4V1CA 3LHKA 3HYCA 4URFA 2FNAA 4X95A 3DKIA 2WQ6A 1MX1A 2C5EA 5A4JA 3AR7A 3GCXA 3U4DA 1KSFX 4IV8A 3H1PA 4L5CA 4RFLA 1TVMA 1WXDA 4QOGA 1KGSA 4MKXA 1XNJA 1CDEA 4DC1A 3KD3A 2GWRA 3VVLA 2WKRA 3DOJA 4TMFA 2EDCA 3NWEA 2NMVA 1BG6A 5KOHA 2GF0A 2FW1A 3GDHA 3L6EA 3PNLA 2BT4A 4QYSA 3W4JA 2C2OA 4OO3A 3L1JA 4KVFA 4M87A 4MICA 1XZDA 1JEQA 2WT4A 5A6SB 1T6ZA 1WHSB 4OQPA 4F1KA 3EXHC 4HAUA 2EWMA 3E6AA 2LPMA 3ESDA 3B51X 4C4RA 3BMXA 1YKFA 3CRQA 4HEA1 4FVTA 1TYBE 1LKZA 1DRUA 3KZNA 5EE3A 3G9UA 3JAKA 2ZUUA 1UEJA 3AONB 2R11A 1COWA 3A4VA 1SVWA 4PINA 5J59A 3IR7A 2XA2A 4LXUA 3P9RA 1E0JA 5EYPA 1A4IA 4DLUA 4EPXA 1L5ZA 4TT3A 3D6FA 5AKIA 1T1JA 5H1YA 5J9FA 5K2MA 1X1SA 5DEOA 4CODB 2PNJA 1KYVA 3KXIA 3R0XA 4GLFA 4M0PA 4BNXA 3B1YA 5HF8A 5KSPA 1WY5A 2PQ6A 5IFKA 1XLVA 3HCBA 1NQXA 1YL6A 1QC5B 3UKOA 4ESOA 2NP6A 3FXAA 1CJMA 3Q8XB 5IM4F 1DKLA 5I7EA 2IYVA 5IDVA 1CLEA 3I9MA 4H3KB 3SBOA 3QU4A 2QVCA 2VXOA 4D43A 1TEHA 3LX5A 3IO5A 4QUDA 2AEFA 4AZ3A 4MULA 1B8PA 4D8UA 4HMQA 3H1EA 2Z4RA 2Q8QA 1S3FA 1JU3A 4JI3B 2XNJA 4AJEA 3B9RA 3CH6A 3UWSA 1RRVA 1RADA 3Q87B 1V8ZA 4N0DA 1MB3A 2XMRA 3BRWD 3GJ3A 4PONA 1T9CA 3WYCA 2QS9A 4AYWA 1C30A 1ST2A 3HKCB 2HHAA 3OHMA 3TSYA 2IDJA 2W93A 1TEZA 1CEXA 1UINA 2O3UA 1N9GA 3BE6A 4NU6A 3UJAA 3ZGXA 3GUCA 1D6JA 1SH7A 2MINB 4XOIA 5IDXA 2J9FB 3WWCA 1OJLA 1VA4A 4BFZA 3R3HA 3PEYA 3VSBA 1QHXA 3ZIDA 1X80A 3CLTD 3DDZX 3DLCA 1KETA 1HRKA 1TEVA 1E3LA 1KZ1A 4IFBA 5DM60 4CCYB 4KIJA 3KK0A 1P73A 1WKVA 2RI0A 2PUWA 1QOZA 2ZBVA 3AIKA 3JASB 4HG2A 3HZRA 3BWMA 3OEHD 4YAUA 4PG5A 1SO8A 4Y0AA 5FFNA 1G8AA 1Q1BA 2JJ2D 3VOAA 3PUYA 3DMYA 4K46A 3VJLA 4FEYA 4QE3A 3OOEA 1RXCA 1Y8RB 1MOPA 5DGHA 4CQMA 1H4QA 4CM1A 3CKKA 3VOBA 3ZHOA 3L0YA 3VO1A 3UA3A 3FPJA 4KYUA 1P9WA 1IFXA 1UADA 2F00A 2D3TA 1NE7A 2VQ3A 2UZ3A 2RBGA 1JI0A 1WE2A 2F2TA 3LUDA 5LBUA 2YS6A 4U0JA 1W76A 3GD7A 1MC8A 2QRGA 1I94B 1YBMA 2FEAA 2FI1A 1DAFA 1NW6A 1Q3TA 2F48A 1RJDA 1UT8A 3DEJA 3I53A 1L7OA 3F6PA 5CDUA 3TG2A 1UPBA 5BXQC 3AESB 1OTXA 3MVEA 3D7NA 3SQXA 1UT5A 4LQDA 1YI1A 2NG1A 3PIDA 4LJLA 3TQFA 4WV3A 3EEOA 3QEKA 4BVHA 5EQDA 1ZNZA 4UUOA 3L2OB 3VVCA 4IXTA 4D97A 1SHUX 2Q45A 1N8KA 3IC5A 1WMDA 5CGZA 4B47A 4U39A 3GLTA 4PZLA 3CWQA 4PAMA 1PQYA 3ZVNA 3U16A 1L4NA 2JI9A 5JHHB 2WJHA 4MV8A 3MFQA 1WMAA 3TB4A 1AO0A 3O8LA 4HQKA 2CDBA 2CXPA 4JVLA 3UMVA 4MV9A 2D00A 2HWWA 3EIUA 5EIBC 5SICE 4JFAA 1YZGA 4RJLA 1RQRA 2ZT7A 5CA0A 3HI6A 4JKOA 4Y98A 1XZLA 1LVUA 2V5AA 3HNRA 1JMKC 2AG8A 2NUTA 4G0QA 3S5JA 4CL0A 4Z1OA 3KEGA 1DIAA 4LGCA 3UFBA 5K0ZA 2ZIXB 1EFHA 2O2JA 4KX5A 4I9UA 3OFNA 4PZEA 1PEYA 4LXXA 4PTYA 2QTMA 3AHIA 1FL9A 3X44A 1URPA 3PQ7A 5GONB 3EZLA 1CZUA 4GG1A 1PT8A 3L4JA 3EF3A 3HHPA 4LGVA 4QGAA 3WMFA 4U2KA 1I7PA 3C87A 4WD3A 5ALLA 3L0OA 3LNCA 4EGFA 4YRAA 3R3ZA 4YRBA 2RKWA 3F6CA 4L5BA 5HJ5A 2WAYA 3QGMA 4B3IA 2IOFK 2G9VA 3HL4A 2W4QA 3HXLA 4BB5A 3GFOA 1ULUA 5AKJA 4KO4S 5IF3A 3I58A 3T7RA 1Y5RA 4WHMA 4ZGWA 1T2EA 1ZM4A 4RA6B 1SCNE 4FS3A 2IH4A 4Q9JA 1XLTA 2QM3A 3TCKA 2I3BA 2VJBA 2UVPA 3NFYA 4UHEA 5EIAA 4TMVA 2V7GA 1T1SA 1L6RA 3MA0A 1S2DA 1KEUA 2ERXA 2X0JA 4BMVA 3NATA 2GGSA 3COJA 1D3AA 3M4YA 2PWBA 4AZTA 4WBNB 1O4WA 3DVQX 3QVSA 1SZCA 4S1VA 6Q21A 4FTWA 1NVUQ 3LKBA 3O8QA 3QWBA 3EGOA 5CNJA 3AF6A 5B4TA 2QQEA 5K45A 1JG6A 1Z07A 4X90A 1XZHA 1JYEA 2ONCA 2NU8B 4JLMA 1KI7A 1E3DA 3VJRA 2H2AA 1AF7A 3NGXA 4NICA 4AI6A 3DFMA 3NHZA 5F23A 2WNHA 3ZDDA 1T4GA 4H1VA 4KQJA 1VLZA 1H23A 1M2NA 1WXIA 4MYCA 4Q4HA 1GRQA 4EL5A 5HQ3B 1JKMA 3K15A 1GG2A 1NOKA 4D4MA 4GL4A 1T9GS 1TZCA 4ZMBA 2DFTA 5TXGA 5I9MA 4YRZA 4OBBA 4Q7EA 1U0HC 4NU5A 3CX3A 4JI0B 4AJNA 1Z7WA 3BBPA 2H4YA 3KO8A 1NDHA 3LGAA 1ADGA 1EVEA 4OG2A 4WGGA 4RKRA 5JS7A 3RVNA 2QMHA 3Q9UA 2OP0A 4WCDA 4Q7QA 3W0LB 2QTBA 2ZRMA 3AV0B 1DUSA 3O31A 2CJYA 2YXEA 4CIBA 3KU1A 2ZSBA 4D26A 3VDMA 3UUEA 2ABWA 3VVBA 2C5HA 3PF8A 2I2WA 4IXMA 4IX9A 4RNCA 4RCZA 4IGAA 5FBRB 4QGFA 2HGSA 1QWOA 1MB4A 4IEIA 5CFMA 4QYMA 3G0GA 1U2QA 1KTVA 2KW5A 1EINA 3DZJA 4OXQA 3UMMA 1EU1A 3QXJA 5K6AA 3CEMA 4UM9B 5BW8A 1KYXA 1W1UA 2Z5VA 4GOND 4M9ZA 1R4ZA 4QATA 3WDSA 2TMYA 4Q5IA 4OJMX 5AW5A 1Z37A 1M2OB 5JD3A 5EWJA 2IF0A 4X66B 3EIQA 1N9GB 1O03A 1YBFA 2FKAA 5F1PA 2AN9A 4XQCA 3THRA 3ICWA 4N40A 5CDYA 4DEVA 3OP4A 1AMOA 2C82A 2C2KA 3GUZA 4FKMA 4BB6A 3P27A 3UBMA 1XUOA 4NF2A 5GGYA 4ZYLA 2W6OA 5REQA 3FFTA 4X3PA 3QXGA 2ZULA 1PWHA 3LFTA 4FD2A 4QQKA 3UK7A 5IHPA 3CO5A 3SE0A 2XNKA 2J5XA 1MV8A 3ANSA 4NLLA 1YK0A 4Q12A 3U4MA 2DLCX 9MHTA 5IZCC 1PCXA 2EBHX 1ISMA 1ND5A 5IPFA 3D2CA 2UXCB 3R0JA 1GP2A 3JQRA 3H9GA 4BB9A 5GTDA 1KRXA 2BM8A 4DM7A 1SCDA 3TSZA 3BCRA 5J2UA 1F0KA 3WKBA 2BMJA 4QPDA 1VLQA 3FMVA 2J9GA 3RT7A 2JW5A 3CSSA 4CPDA 3LRTA 3BH0A 4G85A 4KAXA 3K6SB 2HNAA 1F3OA 4KLCA 3C4QA 2ALJA 4BX8A 4PGGA 4EJSB 2L82A 2GS9A 1WOMA 2E18A 2I6UA 5A9SB 2AW5A 4JYCA 2WF7A 1T35A 1SC6A 4XM1A 2XYGA 2QE6A 4MQFB 4PQYA 5E6UB 2F3QA 3RV4A 1Z4MA 2FV8A 4I9FA 1QHGA 4FHCA 3NT5A 5I7WA 1DEXA 1P7WA 2AG1A 4G9EA 2QR5A 3TK1A 4NAUA 1JG2A 2YJ6A 4ILEA 3RG2A 5LMNB 1YR7A 1ZM9A 2MMCA 2QU7A 3PK0A 3CINA 4M3NA 4WA8A 5DV9A 3IH5A 4JQZA 3Q7PA 5DFAA 3RH0A 2GRAA 5HX7A 3IKVA 2YMQA 1TJNA 1RPNA 3EUAA 3N28A 2EQAA 2OCDA 2QSYA 1S2NA 3E9EA 3S6JA 3DQQA 5KVSA 2FYTA 1E1CA 1AUPA 1P2GA 2C2GA 3N2EA 3FSGA 3MJVA 4L7VA 4NDNE 5L3SB 5L51A 1DAEA 3T7KA 3HR8A 1PGOA 1OIXA 5LA6F 4M7OA 4IDQA 4LJ6A 5D3MB 1C9KA 3G9TA 1OZHA 5DLYA 3KYBA 3L84A 3IESA 2IZ6A 5ER6A 5ULLA 3RARA 5TQ0A 2VTBA 1THGA 4DLPA 1UOPA 1K75A 2Q4RA 2ZWIA 4H60A 4TL8A 3OZCA 2ZI3A 4AKHA 1RXWA 3FVQA 4ZO4A 5C5DA 1DAGA 1KEKA 4L51A 1T1EA 1NX6A 3K0CC 1JEQB 4DOMA 2IYOA 4JELA 1XPOA 3F5DA 4RD6A 1EBFA 2OLEA 1GPMA 3F2IA 3O74A 5AKHA 5HCIA 3VR3D 5K7SA 2G70A 2AE1A 1NPTO 1UF9A 4LMRA 4JLOA 4LMAA 2XWBF 2ZTMA 3DHWC 3IGFA 3R4CA 1PSWA 3RR2A 2X9LA 4CV0A 2NZ8A 4HNSA 4G37A 4PGAA 4DYHA 5CK4A 1L5HB 1E92A 3AW9A 4CV2A 4DSNA 3IAM6 4S1NA 2FPPA 1DLJA 2FQYA 2AYXA 2M1ZA 1JQJC 5AH0A 1L8AA 4X7BA 3PNKA 3RKRA 4C9BA 2C61A 3DLHA 2OK8A 4L22A 2QMUA 1ADJA 3GT3A 4UNIA 4JLBA 1OX6A 3VR5D 2O07A 1ADBA 2O23A 3K32A 3CG4A 1B2RA 2B4QA 13PKA 1TIKA 2I33A 2RHOA 3PL1A 5EXXA 4ZI7B 1QRSA 4KRFA 2GD6A 2WWHA 1ZUIA 2DCUA 2WJJA 3VU0A 2C2WA 4HVTA 1JNXX 3SYTA 3K6JA 1T6YA 1Y3AA 2X7XA 4Q18A 1OWPA 1QE5A 2WE8A 1GKIA 1E1QA 1KJQA 1KOLA 2CGEA 2PFKA 2IU3A 3R9IA 1YRWA 3JRNA 1F2DA 1AQYA 3NRJA 3QTTA 2QRPA 1HLDA 1GPJA 1R0YA 4LTMA 2PJUA 5FO1A 4M49A 4YUVA 1M5UA 3N3AC 1UP4A 1KQOA 3RDPA 3VU9B 1SXHA 3OCVA 1QIIA 3UH1A 4RELA 1T5OA 2ECOA 5DYNA 1I2MA 4YT4A 1ZISA 3RYFA 2I7XA 4YAKA 3KSBC 1LFAA 3TIGA 2CSXA 3RODA 1QYVA 2E37A 3RGWS 1EQAA 1JFRA 2IZ1A 3GNTA 4HEHA 4LDQA 1RYBA 3THSA 3F4BA 1OILA 1T34A 4RVSA 5GIOE 1ZOPA 5FD8A 1O9HA 1OLXB 5HHTA 2SKEA 3N1UA 2E0IA 1WY7A 1LPSA 2IYPA 1KI3A 3AEUB 2HLHA 4JU8A 4WCVA 3B1FA 5BQXA 4OX9Y 2QL9A 3DLBA 3C4JA 3EOAI 4HL6A 4BNMA 3OICA 3JQQA 1L1RA 1QNLA 1QAOA 2GZDA 4OUKX 4ZVKA 5CLHA 1H93A 3NWPA 3W8FA 2FPKA 3UV3A 3WGJA 4DDKA 1IOVA 4R3NA 4RDCA 1K5HA 4RVFA 4YPOA 4MVCA 1D5CA 2OV4A 1D0SA 3B48A 1SBYA 3JQCA 1CEQA 2REBA 4K8RB 1MTOA 2W71A 4PBTA 4TXHA 2G9NA 1H05A 4I3GA 3T3PB 4U8GA 4EJSC 1OC2A 1Q0TA 4KDRA 1W9HA 2C95A 4K6GA 1BC5A 2OK7A 4BNZA 4PC1A 2BUCA 3FPLA 1NUUA 3OE1A 4R2XA 4R0NA 2DFNA 3BHJA 2X14A 3ZTWA 5HDBB 1KQGA 1CCWA 1KEEA 4X93A 2Z1MA 3I04A 4KMOA 5G02A 1RBMA 1VP3A 4FOSA 1QIMA 4KFTA 4MTCA 1U2TA 3KZOA 4PIVA 2Z6UA 1TT5A 5EP3A 4F4DA 1WQ4A 4L0DA 4YDHB 4RORA 2VP5A 3NQ41 5C32A 4M1KA 4CN9A 1CP2A 3SLKA 1H9CA 1WSDA 3KB8A 3WB0A 4P31A 3ADCA 4KUEA 3DOFA 2ID4A 5HFAA 4HWPA 4RVOA 2PUHA 2QTWB 3L3BA 5K99A 3UG6A 2HMWA 3FW1A 5FUXA 2WUWE 4R69A 1VGRA 5IC4A 1X70A 2YTZA 1C1DA 3ZDZB 1JVSA 3FZNA 1V8BA 4MARA 1BQ4A 1GADO 1ISHA 1OJ7A 2ZJOA 4R84A 1P75A 2W8ZA 3LW8A 1LFDB 1RFGE 4TSKA 4EEXA 1UBMS 5FP0A 4F3NA 1EFDN 2E3JA 1IQUA 1JQEA 2QVXX 2JLQA 1K4YA 3HDYA 3GPCA 1T8WA 4K1XA 1II9A 2BEWA 4JVSB 4HXYA 2J0UA 2I55A 5IAKA 5AW3A 3IV7A 4QUHA 1IWPB 3ECSA 4MUHA 2XB8A 2PUBA 2DC1A 1DDGA 4GE3A 4YQFA 3COVA 2FSHA 1WTCA 1WXEA 4JT9A 3W79A 3HXQA 1MW8X 2WYUA 3VV3A 1E62A 1RLIA 4DNQA 2BFFA 2FSFA 1Z17A 3DTTA 4P4SA 5AW9A 3P8ZA 1NZJA 2Y1DA 2NVUB 1QONA 1ZD2P 3SVZA 4NAHA 4C29A 2PKQP 4G26A 3DR5A 2ZYVX 4UKDA 2A5YB 3TLAA 3O8CA 1D0VA 1K6XA 1ZBDA 1I32A 2O8VA 3I2IA 3WIVA 1O5OA 3PEFA 4DT1A 5B4UA 5JDIA 1HK7A 1B15A 4DUYB 1N0UA 4BFYA 2H16A 3EF0A 5LLSA 4HFMA 4NCBA 3RS0A 4DHEA 2ETVA 2XOKD 1DAKA 1Q20A 4MI6A 1QRDA 3IOYA 1E7SA 2J9RA 4HDCA 4HWTA 5TB5A 5TJHA 1WZUA 3DE4X 3GWGA 2V0CA 2N46A 3Q85A 3LS2A 4ZEWA 4AIIA 1WHTA 1QVRA 3HUEA 4LRSB 1ONNA 3PQFA 4YFVA 1NVXQ 2Z8ZA 4QL3A 2HSJA 3LYUA 4H0CA 3KJGA 2BGNA 4R8RA 4GWLA 4XFDA 3E22B 5FUBA 2GYWA 2IYEA 2ZE8A 3H6KA 3OJFA 5C31A 1SKYE 1FQOA 1KYTA 2YOFA 3WLIA 2IIQA 3LVRE 2FEPA 5JADA 5LQJA 2I5PO 2ODBA 3E35A 3A6LA 1LF5A 4NYJQ 5LJIA 3HWWA 4HX5A 4BQFA 1D4AA 4UOQA 1JDVA 3RYIA 1JEEA 5HIAA 3PC4A 1DZ3A 1IHOA 2RHLA 2YUIA 1EFRA 1W0CA 2VRWA 4DVJA 2AR7A 5JS8A 1SPXA 3FF4A 1BYIA 2GAAA 4OLAA 5A5FA 4L78A 2YWDA 2FJPA 1D2MA 3RO7A 3V7YA 3V9PA 3VAYA 4F3CA 3NXKA 4BE4A 4NBRA 1AS0A 4K9OA 1M2WA 1ISGA 4DY6A 4Q9DA 2NQ8A 4YQYA 4IDFA 4DBLC 3U56A 2C00A 3T9EA 3D8TA 4NCJA 3LSTA 5D00A 2Q7XA 5LQUA 1YVDA 5AT1A 3GJZA 1P1BA 1V16A 3HBAA 4UBIA 4EQZA 1Y8ZA 1DBSA 4MW9A 3T0IA 3L6RA 4X54A 5EZQA 4AK9A 3FNQA 3WTCA 1JKFA 3L1HA 4WBSA 3OQBA 4G3XA 5DTJA 5D5PA 1JQDA 2IIBA 3QK7A 3W77A 4GVXA 4ZEVA 5CA1B 5JRJA 1SOWA 3QU5A 1WHTB 4LTNA 4DMUB 1HRDA 1MC5A 1W6UA 4Y0NA 2O8FA 1BRMA 4RXTA 3TXXA 3QLJA 4HXGA 2D8AA 4JOCA 1JIQA 4EYEA 2WDPA 2A67A 2H63A 3SHTA 3QLUC 5LNK6 3IKTA 3RYCA 3AZPA 2HADA 5FT9A 4RK0A 3HCFA 4I5DA 1S8FA 3HLKA 2F3RA 3U7JA 1J6UA 1W85B 3MRTA 4B5KA 1E6UA 1HDIA 3VYUB 1C2TA 1E1YA 2J3HA 1L5YA 4AD8A 2OZLB 1U5CA 4ZEMA 2GYVA 4A6PA 3MERA 1EM8A 1R50A 3LBYA 1TKCA 1PR5A 2COKA 1AKEA 1Q14A 2P62A 3W2EA 1VMEA 4Y9UA 1X8JA 1IWOA 1UM8A 2CDNA 2XDAA 4OBXA 2FUKA 4NHOA 3SJ7A 3W3AA 1O57A 1KFJB 2NN3C 3TLGB 3PI7A 1XLUA 1AKRA 1Q0RA 2WJ3A 3LIIA 4LE1A 3HEMA 4BQRA 3AF2A 5JZMA 2XYHA 1XA4A 1LI5A 5TQ0B 1DTWB 1C7QA 1OLOA 3E7FA 1ISJA 1OXKB 4QEKA 4R05A 3OLWA 3T8YA 1R6BX 5JT1A 1KRWA 3FHOA 1DZIA 3CVWA 1VCHA 4CEHB 3S8YA 2JI7A 1V8FA 3QELA 2AMLA 1NZDA 3G8YA 4E4RA 4JH0A 1SUAA 1L1EA 3BXFA 4PX5A 4BFUA 5A5DA 5FWXB 3WGIA 2ODEA 3V46A 1JHZA 3HWX1 3VYTB 4BV3A 5ADUS 4IJQA 3TSCA 2FZLA 4HLUA 4LFCB 1R8XA 5BR1A 3MILA 2Q3JA 5FDFA 3RB8A 5LIPA 3U60B 1PEKE 1VE5A 2JGDA 4PNPA 1GQFA 3GEIA 1DHRA 4KI7A 4O02B 5LZ8A 3QEBZ 1DQRA 1ECGA 4FFVA 3P9IA 2QZZA 1SPBS 3FCEA 4DADA 1KEWA 3TNJA 4IVQA 2R44A 2D7JA 5KJ6A 1HA3A 4QWWA 3CTMA 4FFMA 1MP0A 3BE4A 4Q7LA 3AM4A 3AY0A 1K5DA 4G8CA 1KF0A 2KMLA 3TOSA 4ITUA 4DG8A 4N9WA 4N12A 1CR6A 1J5EB 2P40A 3RNLA 1KO5A 5FUVA 4EPVA 1P2VA 1QVZA 3ANTA 1LTQA 2FB9A 3TL6A 3ZVKA 3FH0A 5DO9A 3U13A 2CV2A 1M6EX 2EKPA 3HSYA 4ALJA 3QOFA 2WWTA 3UAOA 5DLEA 2PUAA 2CFRA 3E0QA 5AKKA 3QBTA 4IVPA 1XZQA 2GAJA 1BEZA 1YDMA 2C2BA 3N2LA 4M37A 4C21A 1XHEA 1YCGA 1Z5GA 1QH1A 1RIFA 4NOJA 1OHHA 4DJJA 1O94C 5B1SA 3R5KA 2EZ9A 1YOVA 1N2CA 3GLSA 4QUAA 5DWVA 3KQVA 5F4ZA 5FIUA 4EX6A 3FWKA 4OK3A 4IKPA 4YCJA 3ELYA 3BJIC 3T4EA 2WA2A 1ARZA 3H2JA 1EXNA 1ZDMA 1HURA 3O91A 1XTTA 4TKMA 4GF5A 4XX0A 1YQ9A 5JAZA 5C7YA 2ZE5A 3V7UA 2ZIGA 2XR1A 3P2EA 5DIZA 4XIGS 1C9DB 2ZR9A 1N92A 4HWRA 4ZCTA 3SJUA 4AF8A 5IT9A 1S5PA 1K4KA 1MOZA 3TX6A 3UXMA 4C78A 2FFQA 1ZI9A 2ISSD 2Q41A 3NEJA 4ZOLA 5E9AA 3W3ZB 5JFGA 4DCMA 1T13A 3AVXA 1LUAA 2JIRA 4NP6A 2PGJA 3C85A 1BMFA 2ZW9A 1MTZA 5CHYA 3VZDA 1DIRA 1JFFB 1R27A 1NFFA 1W30A 2NU9A 3CLSD 3DWGA 4KLZA 4Q3CA 3ROKA 3Q40A 4FQ8A 3LPNA 4BX2A 4F8YA 4OI0A 3VU9A 4FI3F 2ZR7A 1VBKA 2A6PA 2CMFA 1BXRA 3BYZA 3L82B 2EAUA 2G07A 2QLLA 1W88B 3WMGA 4MV4A 3I6YA 2UYQA 5H0IA 3KKOA 1W73A 4MS3A 3TDNA 4E1AA 1YSCA 5G0SA 2JFPA 1JE1A 1WP4A 2RHRA 1EE2A 5DSZA 2IS2A 3PHHA 1HG1A 3OU7A 1QGUA 2P65A 3WLFA 4Z8XA 3SYRA 2GO7A 4JLJA 1A82A 2NT3A 3R3JA 4N03A 3TLJA 4F6RB 1QBGA 3JQEA 5KJ1A 1XTRA 2BCGY 1IMOA 5BN4A 4B3FX 1ECJA 2HDWA 4OHYA 4GP9A 5LYJF 1DRWA 3DSRA 1RYNA 3UOGA 1X7DA 1O87A 1LW6E 3QF4A 1JU4A 3G2JA 5JG7A 1X8LA 5JH7A 5MGNA 3EHDA 2DHQA 1CJTC 1SRRA 1T29A 1EJ6A 2VAPA 4I6GA 4YBZA 5AI0A 1NQOA 1HQDA 3VZRA 3WR5A 1G6HA 10MHA 5E6RB 4G0VA 2JIPA 1ZK4A 1KIMA 2YWEA 3I9OA 3LH5A 5K0TA 3V3TA 5AUNB 1VBNA 1HWYA 2HA3A 3ZE6A 1OZGA 2E4WA 4A2QA 8AT1A 3ICPA 2VOJA 1CVIA 3BRCA 3TTYA 2Q1XA 1QGYA 3S5UA 4KJXA 2ZDGA 1KK1A 1BDIA 2HJ9A 2LDXA 1E2QA 2UUAB 3KWJA 2DPLA 3OWOA 4RTSA 2W2QA 1PTKA 4LMPA 2QPTA 3MYYA 3NLLA 3PQDA 4MKRA 3I4CA 2YINC 3LWBA 1J1ZA 3RSOA 1R8SA 3WLEA 5LZ9A 3KEQA 1EDZA 2REOA 3A6KA 2ZRNA 4MA4A 3W2TA 4EB6B 1A4XA 4HR7A 4YXWD 3DOIA 5JXHA 2MHCA 4UULA 3ZNNA 1XTKA 1SAYA 4F9FA 3RUCA 5A3RA 1AK2A 1Y81A 1XTVA 2WVGA 4NZYA 1BU5A 3I5UA 1FLNA 1JLHA 1PNOA 1TPYA 2A0KA 3IDSA 5HF5A 4GI3A 1DQPA 4QZVA 3UXHA 1ZGJA 4REOA 3AFNA 1QKJA 3NPAA 2XOXA 4UEOA 4RHTA 1SHJA 3MMXA 1L5RA 4UHDA 4WDRA 5FWDA 2PKWA 1KH1A 2GCGA 3RS7A 1Q12A 2FR8C 1GVHA 4J2HA 4G8JA 3J80A 2I7CA 1L7XA 2HLPA 3IAXA 4G5GA 4BO2A 3T9BA 4HEJA 1MJNA 2HDHA 1PDWA 1PVVA 3RLIA 2HW8A 2JZNA 2GYYA 1QV7A 2XHEA 4LDPA 2OQVA 2VFAA 1Z8HA 3H0KA 1WB4A 1CQXA 4ETIA 1UBRS 4NZOA 5KOIA 1C1HA 1EVZA 4XGQA 2POCA 3HZHA 4WKGA 1BHJA 2JBHA 2FHSA 4RTJA 3RVMA 4J91A 3MGAA 1YV9A 3W6NA 5G0VA 1RRCA 1NXOA 4ENUA 2VCYA 4H2DA 3ZTTA 1IL0A 1PV1A 3FKQA 4PYJA 4MW2A 4W82A 4KN8A 1HSOA 5BUQA 1FYVA 5FL7D 5J2UB 1CLUA 2PH1A 1FZTA 1B0AA 1DCKA 3OQ1A 1OXBB 4MUXA 2WTAA 5HSGA 2G7MC 2NTYC 4KWTA 1P0CA 2OXCA 3Q98A 5EKSA 1XMIA 3MWJA 4QHSA 5FI3A 1TM4E 3ZWKA 1QQ6A 1ZR4A 3HDJA 4HQOA 2GCIA 3CUTA 4GMXA 2B3DA 3PITA 5BVGB 1GPLA 1VG1A 3ESQA 3TZLA 4CT0A 1IQ0A 3ZIUA 3LT4A 3QFRA 3IIIA 1ZCAA 2YXLA 3R7NA 4EVSA 3KC2A 5H80A 2R6ZA 4BTVA 1I3CA 4DZRA 4AY2A 2I9KA 4XYLA 2JF0A 5FNVA 3GHHA 1XMSA 4KAFA 4MUKA 3H19A 4HAZA 3Q8MA 1GNTA 1S6YA 3IHTA 1QE0A 2VJKA 2QAGB 4R3UC 3WGMA 4R9RA 4B6QA 3DO6A 1X7WB 3GEGA 2YYAA 3IQDB 2DT8A 4WVFA 1CQWA 4O59O 1MO4A 3NAZA 4X1OA 2GESA 5JD4A 3M6UA 3RC1A 3R44A 4INJA 3R1IA 3T61A 3QXSA 3H4VA 2HA7A 3E2IA 2WWIA 2MSEB 3EA0A 3CX8A 2FGKA 3MJ4A 3BCUA 3AHEA 1OGIA 2Z2XA 4OXYA 3WTBA 5KPDA 1QVAA 3CVOA 3EISA 4IX1A 3QHPA 1RZ3A 2OR3A 4KH1A 5IS2A 4J6FA 3IOEA 1ELOA 3IIMA 3QYAA 3ZE7A 2VDRB 4INAA 4D96A 1KS9A 5D85A 1E61A 4KNVA 3U44A 1Y7IA 1BMQA 1BWSA 3S44A 3THOA 3WLKX 4EB3A 2EYUA 1BCRB 1BU8A 1K63A 1QZUA 2WYOA 4LOAA 1RZUA 2YYSA 4PPGA 1XTIA 4FWIB 3F0TA 3NV7A 4EYQA 4B4WA 5T7BA 4EGSA 4REQA 1NA5A 1V5FA 2JGNA 4HGYA 4A27A 5T4EA 4HK4A 1XP5A 3UT0A 4TYNA 4NYIR 4RHUA 5LC1A 2XGGA 1PQPA 1XTBA 2CXRA 2HJGA 2IQ5A 1CZNA 2ZP1A 3KZMA 3NCHA 3LQFA 2ZREA 3NYQA 4GZLA 2RJNA 1DPFA 3L8EA 4G1MB 4X7PA 1F4LA 4PN7A 1YDGA 2A4KA 1G8FA 1VL1A 1G8MA 1ZITA 1MN6A 3URKA 4BV9A 4ES6A 1L4GA 2A94A 5EGNA 1S89A 2HBQA 1M72A 3TBKA 5I8PA 3TVDA 1LJLA 1KYYA 2P27A 1V11A 1N5KA 2HCRA 5EJGA 3HYSA 5EHIA 2ZJYA 3B1XA 3NBUA 3LPAA 1JAZA 3SS8A 4B4KA 1KYQA 4ENQA 2GK4A 2VR1A 4RXUA 3T35A 2C0QA 1C1YA 3ZE1B 1Z5VA 3W7AA 1N2OA 3UVEA 2A86A 2M6LA 1PK9A 1OBVA 1TIBA 1NJ5A 4RVUA 3AR6A 4JKYA 5ILGA 1SXQA 1T9GR 1C9YA 4BV8A 4AO6A 4C5BA 1KAMA 2H57A 1NY6A 3AI1A 5AKYA 4M0EA 3LQQA 3N0RA 2F43A 2WZBA 4D25A 4V1CB 1J23A 2JLVA 4FUQA 4BMYA 5GMOA 3RJ5A 3NIWA 4YAIA 5DK4A 1J7KA 1Y5MA 2ONZA 2OV8A 1TU4A 5DNEA 5FYQA 5TC4A 2LXNA 1CUDA 4WNIA 4COKA 3UV6A 5HCNA 4ZVPA 4C0LA 4X44A 1QIKA 3IMKA 4BYMA 4GC9A 5CFLA 3OPYI 1PG5A 2BR4A 3Q5EA 2UDPA 3H18A 3LX6A 3FDXA 5ER9A 3RFFA 4E5SA 4KODA 1D9XA 1LJ8A 2QR3A 1GRCA 1M0TA 2W6JD 4RSHA 4YRFA 3RCBA 1XQWA 3U2QA 4DQ0A 4A36A 3LAWA 1R6UA 3WXBA 3BK1A 4KRGA 3U4GA 1KU6A 2WQ7A 2FVXA 3DZ8A 1U2SA 2Y27A 4WOPA 1MQ8B 3K16A 3EFOA 3EWSA 1RQ7A 3ENQA 3JWPA 4DLBA 4JQYA 3SZGA 3CVJA 4L8LA 4FJ0A 3IPYA 4AJJA 5K8VA 3FUTA 4DQVA 1FLAA 4TTIA 4AJKA 3GX1A 3WK9A 1CY8A 2FN8A 1E9CA 1E1DA 1PWXA 1DOAA 4JJIA 5H59A 1XA0A 3VXKA 4IDAA 5EE5B 1QG6A 2HTFA 4KPEC 1V39A 4GBED 2QM7A 3DTVA 1MIOA 2DP4E 1USIA 1GA4A 5DRTA 5JYBA 3OZIA 2G09A 1Y5NA 1SVIA 3N76A 4AMUA 5KTKA 4AG3A 1R0KA 4WJLA 3V9AA 3WYBA 4ER7A 2QROA 2IYAA 1TD9A 3DHEA 4F97A 4OXRA 1E0SA 1TIPA 3PQCA 4JT4A 1HC7A 3CNOA 4KL8S 4QLAA 4ZRDA 5EMJA 4TL9A 4OFWA 1D03A 3TGWA 2JIMA 4EZBA 3H65A 1CUGA 1VKHA 2I80A 1PDOA 2NPOA 4P1ZA 1DVRA 1AT1A 3RAFC 2C99A 3P0EA 1N6RA 2MWMA 2X8JB 4PFQA 2L17A 3LM8A 4O0MA 5JPCA 5GZ6A 4MP6A 2CLKB 2XXBA 4P3XA 2O8DB 4F72A 4BKPA 3ET4A 1V16B 2FWNA 4K2AA 3BL5A 1CR2A 3H5OA 4J8PA 4RPCA 1U2DA 3L5OA 2IYLD 2ZS9A 3GD5A 4NBWA 3HA2A 4JR0A 5JAHA 5JAUA 1BH6A 3L01A 2CZQA 1QYIA 4QVIA 2HQ1A 2NTEA 2EYQA 3K31A 1NVDA 1QGUB 3DFKA 3FOWA 3DV0A 4J43A 4BVLA 1M6WA 4CFZA 1O96A 1M2VB 3PRKE 2N1MA 2ZUWA 3L02A 2DCMA 2V9ZA 3IUJA 3LC2O 3QEMB 4CMHA 2Z9BA 2FETA 1SVNA 1HPLA 4MRNA 4LYJA 4MWBA 4RQAA 2Y0EA 4BNFA 2BSQA 5EJFA 1F2TA 5AVXA 3U7FB 3NIGB 4OJNA 4OXNA 3ZJ4A 1XCOA 3AVYA 5JMOA 1W2WB 2JZOA 4KGZA 2W0MA 3OSZA 1H6CA 4B6PA 4EPYA 2MMGA 5B7NA 4I3HA 3PQ6A 4PYNA 1EM6A 4ZAYA 3AUXA 1E6MA 1PYDA 4Y9DA 1K7XB 1OV4A 3OLCX 2NTNA 1U0JA 2Z3ZA 2CL5A 2K7ZA 2DFDA 3SQMA 3WGUA 5KNBH 1AQNA 3NTVA 3EPJA 1JEJA 4YJDA 2ODWA 3MWLA 4MRVA 3UMJA 2HT6A 3V33A 2Y68A 4J7XA 4QJ4A 3E9RA 4WY2A 4YK7A 5EEHA 3BORA 5H3CA 2UZ1B 2VUIB 4DCUA 1MD9A 2QN9A 4V03A 4ND1A 5IJXA 1PT5A 3QLVA 4WERA 5CLGA 4PVDA 1EWKA 4PAGA 3TRKA 3ZCXA 4OEHA 1IQRA 4QPPA 3F7MA 3TTUA 4Z54A 5C5CA 1OVGA 5JLJA 2CT8A 3ES9A 3SG0A 4A0SA 1SRQA 3WFJA 1KDVA 4AZ0A 2C9YA 1WJGA 3AIMA 3HXTA 3BJEA 4I66A 3QVKA 4LZOA 2BHTA 4C6HA 5IAAA 3W5CA 2V7PA 4Y2VA 5IANA 3GYBA 4EMTA 3NVDA 2VRCA 4L4RA 1JMYA 3A3OA 1US8B 4OQEA 3VSDA 2DH6A 3QVGB 4FYIA 1A7UA 1PF7E 2YJNA 1QGZA 1TM3E 1JHOA 3BJMA 4OQYA 2LWIA 4DEXA 3OQHA 3VYWA 4KFRA 3JPYA 3JYNA 1Y98A 2H48A 1X1AA 3H16A 2I91A 3EVFA 2IE8A 5F2KA 4XWOA 5ABPA 4TQAA 1GZHB 1R37A 2IOYA 3G23A 4MB6A 5EIBD 2Q1TA 2I8CA 5TMPA 4AQ7A 2FZ4A 4MPDA 1XRRA 1MZPA 1V3TA 2YHAA 3GRCA 3GZNA 1TM7E 2IHKA 1DFHA 4C43A 1DXHA 1X7YA 4AG6A 1NL3A 1VYUA 4KIWA 1T2NA 4N39A 3MJCA 1J20A 3SIWA 2QN1A 1YTLA 1Z15A 4YO8A 1DTEA 5E38A 3HPRA 3M6XA 3Q0EA 2I7DA 3EY4A 4MRPA 4DS3A 4GKAA 4TVKA 2RHHA 2B21A 1T6XA 3OEYA 1AA6A 1KNQA 2XKJE 3H87A 3HCRA 4TT3D 4Q1FA 4F1JA 2ID7A 5I5EA 2DETA 2IS4A 4G5FA 4F06A 4PYQA 5SZHB 4ICIA 4L28A 4UNRA 2C8VA 3MTGA 4DSTA 1V71A 4GOKA 3OZTA 1G3MA 3QIVA 4NPHA 2RC6A 3KJXA 3PCRB 4EITA 3KPJA 1Q5PA 3PIIA 4O2BF 2BMDA 3HHEA 4WT7A 1DRVA 4JZYA 4L50A 5AVJA 1G4HA 2BVNA 5SZIA 3VO2A 3W90A 4F9EA 4JI2B 3MGGA 4W5OA 1UFKA 3DOEA 3BWCA 3W5AA 4QFDA 4I9HA 4FLMA 2ZJ8A 4LQ4A 4K9KA 2BR3A 3PC2A 5HILA 2BGKA 5CH3A 4ZVOA 2WHEA 1T25A 3AR5A 4RQTA 1F0PA 3R9KA 1QPBA 3K9CA 4EX7A 2R8PA 3CB4A 4FX2A 4AX4A 4YV0A 2UUPA 1NF9A 1E2DA 2GEVA 3EEQA 3HKDA 2ZTUA 4IYJA 4JUBA 4QXAA 3SZUA 1G2OA 4B79A 5KWIA 4GVLA 3E9CA 4BXOA 2IEYA 3NUGA 4LUCA 2BHLA 1IYZA 3OQIB 4IHJF 1E1NA 3DOCA 3GGOA 3H11A 4KR0A 4KQEA 2WFAA 2EDAA 1E5QA 2ORYA 2NUPB 3ORHA 4BVFA 4KO1S 1JSXA 1YO6A 5BXYA 3MNFA 4CBVA 4QM6A 2WIBA 2V6FA 3PEUA 2GPSA 1A1SA 4N3NA 3U6BA 1U0NA 2PUJA 2P7HA 4JXKA 4BLRA 4ACBA 1O6FA 2PKXA 2OHOA 2VHZA 3JQFC 3QKSB 4RWZA 5AIBA 2EFGA 4L4SA 1GV0A 4JT2A 4RX1A 4MZXA 3HFJA 2YKGA 4XCVA 1U2PA 4ZC1A 2HU7A 3ZX4A 5BV2P 1RI1A 5K8IA 3KYDB 4TXNA 3UQYS 2IU0A 2JFBA 5AI5A 3W8EA 2DPYA 1LVHA 3RM3A 4YMVA 1RNLA 2QRVA 1C3LA 1C9MA 4CLXA 2ZB3A 1TPZA 2BF7A 4GP6A 5JEEA 4GWKA 4RZUA 1ZICA 4MVYA 4DV0B 4LOIA 1QO7A 2UAGA 3HKBA 2DPHA 3DDNA 3O21A 1EP3B 4U5XA 2FQQA 4P33A 5BT9A 1L5NA 3LFUA 4YN3A 3KAKA 2C4MA 1GSIA 4DWVA 2WZCA 2QZJA 2YV5A 2PGXA 2VLIA 4CF7A 4TPKA 2ZUEA 5LWHA 4DMKA 4ZPXA 3IPRA 2I29A 4YJ3F 2YFYA 3NHYA 1M66A 2QNBA 2UUBB 5AJZA 1MNQA 2C2HA 3GFQA 5HPYB 2Z58A 3IE0A 3OUUA 4Q37A 4KNYA 1H0SA 3H2HA 3SM9A 4EA9A 4NU8X 4E33A 1AZSC 1YGYA 16PKA 1E9FA 1PGNA 2R47A 3KDPA 4EBBA 2WR8A 1EDBA 3COZA 4R54A 2DU8A 1N8SA 4GMGA 3RS9A 4YC7A 5A4MS 1TKAA 3RSFA 1TZ2A 1DIBA 1TZBA 2J0VA 1OQAA 1CZHA 3H9BA 3MMPA 3NTUA 1B8OA 3ABIA 2GBIA 4R98A 2JEYA 3DYBA 1PU2A 2QYOA 2B37A 3PX2A 1L1QA 5CM9C 5JTUA 4NMLA 1UC9A 4IIXA 4E08A 2HV8A 3N8IA 4TV9A 4IZ6A 5HFNA 4EFNA 4DAOA 4O29A 3JVVA 1ZR2A 2YR0A 1NXVA 2I1QA 4N6NA 2BFDB 3ZCSA 5I7RA 2R8ZA 3JALA 3AKEA 3KTFA 4Q0MA 3ZE0B 4TV8F 2WSYB 2VK1A 3V8EA 1T43A 2NZUG 4NQRA 4OVKA 1PJQA 1DQZA 2UVDA 3EQ9A 3ZWVA 2OHGA 3ZQ6A 1P9NA 4TGLA 4NECA 4G0PA 2W2NA 4O5OA 5DULA 1QZXA 2YW9A 3NVAA 5EY5B 5FUQA 4ZOEA 3TW4A 1UAYA 3UICA 3KQQA 1JDBC 1M0WA 2FSGA 5ALFA 2B8NA 3X2EA 5ES4B 4FZVA 4HDQB 1LLFA 3QVGA 3G8BA 2VAXA 3N7TA 4EZIA 1UT6A 1ZXBA 5AVRA 3S2YA 4RGQA 2G88A 4Z99A 3CN7A 2DJ5A 1YZNA 2ZCUA 1Y42X 5U9CA 2OCXA 3EBLA 3IB3A 4CLHA 2CXSA 1UP6A 4MMYB 3I2HA 1UL1X 1RLUA 4FJ1A 1TTHA 5E95A 3IELA 4CW7A 1VKNA 3RLFA 1N2CE 5KVAA 3B6IA 2BBSA 2VPIA 2Y1KA 2PE5A 2X9QA 1NONA 3VPSA 2PX0A 3K72B 3RE1A 3S8EA 3OQVA 3GUHA 1C1XA 3IHKA 1HUQA 1HH4A 4QREA 1KOFA 1J25A 1DQSA 1ZS9A 2AKYA 2C3MA 4ND2A 2QTVA 4QOHA 4DPMA 2W90A 4JEIA 3EAQA 3S40A 1XZBA 2A14A 4BJ1A 4E2YA 1KJYA 5HUQA 2GFIA 2OHIA 1TRHA 4R6WA 4U2EA 4MQEA 3WY9A 1QQBA 5ITZB 4ETMA 1G42A 2H51A 4RM2A 5LD2B 3ZHBA 4U6QA 3I5XA 5CDGA 2JGAA 5KMGA 4TYYA 2ADFA 2JAXA 4Q47A 5CNMA 1RC1A 3QTLA 3RG8A 4LGYA 5CIWA 1SUDA 1V5WA 2IY8A 1J2YA 1T0HB 1MENA 2QUHA 1B8NA 3RRFA 5B58C 2VDWB 4JGIA 5WRFA 3OM9A 5EZYF 3ROQA 4JZKA 4MPPA 3ZZ0A 2IUFA 5KCZA 1ACJA 1YCHA 4MWZA 1KVSA 2OO7A 3A2MA 3KT6A 3RABA 3KQHA 1Q0UA 4DJAA 2CHFA 1H1DA 4KR6A 4WL0A 5REQB 2Z56A 5KTYA 4QSMA 1SIWA 1KTIA 2E2WA 3ERCA 5J4VA 4HLUC 5F5NA 4MO9A 4KW7A 1E94E 4M54A 4NOKA 1FPMA 1IY1A 4LC1A 2CVHA 4RA9B 3N8GA 3N86A 3VR6D 1B3RA 1FTSA 3EDOA 1YQTA 4XUDA 4GQBA 3A3PA 4P53A 5IKMA 1XD2B 1MRSA 5FBWB 3KOOA 2OOSA 1XVUA 2BDEA 1Z16A 2QRHA 4LHWA 3IDAA 2MU1A 4UEJA 4WN3A 3RPEA 3TMYA 2C98A 4WCFC 1FBTA 4CDRA 2BFPA 2FXVA 3A1DA 1RHRA 2ATEA 4GOJA 5BNTA 5LQDA 3G2MA 1JYFA 5JPIA 5K6AC 3Q3GE 1Q7RA 3PPIA 4JLNA 3VC1A 4G2NA 2N75A 4MGYR 2WJIA 3VPGA 4RPIA 4REMA 5K09A 1P5RA 3P4UA 2WB4A 4Q3LA 3TQOA 1N2ZA 4QVGA 1X8KA 4N41A 3L0IB 4YCMA 3WSVA 2C4VA 3O3CA 4HRAA 2OE2A 4QEZA 3UHOA 2H5EA 3U80A 3IUNA 1FTWA 4BATA 4D4GA 1FFDA 1N3LA 2O2DA 5KQLA 2BEKA 2W8BA 4C7JA 4LNAA 1PV2A 4Q6WA 4BUJA 2MSDB 1XI2A 2AXNA 1HTWA 1R5OA 1ZIDA 5K01A 1NKVA 3UWPA 5IJ9A 1UDWA 3AINA 4HXEB 3UFXB 5C4MA 1UMCA 2OO5A 4KYVA 1CYEA 5JLAA 2R5NA 1BEEA 5BSRA 3L0CA 4JEHA 4ZAFA 2M32A 2P67A 4UFOA 4OH7A 2BM1A 1OFVA 5CAEB 1XQXA 1YFZA 2VWPA 1YOBA 1A8PA 3C6KA 3NNSA 2IV3A 4CI0B 2ZI5A 1EGVB 2XECA 3QBEA 1XTZA 1G0OA 3VR4A 3K6RA 4Q24A 1QYXA 4ZQEA 4FGLA 3I37X 4KXMA 3ZLTA 2PS1A 4XLLA 5AVQA 3CJTA 4OU5A 1O8BA 3OY7A 1P18A 2DUWA 2VSYA 4UE3S 5K0CA 1S8NA 1HE1C 5KNBD 1YRQA 2ZYAA 3RFUA 2FR0A 5DTRA 2PTHA 3HSSA 1O54A 3N75A 2IEDA 3DB2A 3OJEA 3DXFA 2NU8A 4CM8B 1Z75A 1JHRA 1M7BA 1T0BA 2GAOA 2GASA 2OUIA 4DKXA 1IK6A 1DT3A 2RHTA 4DV4B 3BWVA 4RH0A 1JF8A 3KT3A 4CM7A 4LSZA 3ONFA 3GA5A 2ZBGA 1VJCA 1GTMA 3EOZA 1AGPA 1RU3A 1KDOA 1X39A 1FP2A 1SKQA 3D1VA 5AM0A 5T8KA 5KSWB 1N6KA 1NNLA 1BWPA 4INPA 4B71A 4JQSA 5LKAA 4GO1A 3SQNA 4BX3A 3H1FA 3RS5A 4B31A 2LIVA 4C6TA 1U63A 1JDZA 3BF8A 1M76A 8LDHA 3KLPX 3FSJX 4K87A 3S2GA 2ZB7A 1E9BA 3FHCB 1A9SA 3I9V6 1TFRA 2V7QA 3SJCA 1AB6A 1NQVA 3ZZTA 2WIAA 6REQB 1FIUA 3NYRA 4KQXA 3VR5A 3IIEA 4LF8B 4UPVA 1JJBA 3G17A 4D9EA 1LEHA 3MZ0A 2G1PA 3GEBA 5DYYA 5K3AA 4UQLA 3SS7X 3S4YA 4W5RA 1HG0A 4MB0A 4OATA 4ZHQF 1L7MA 4M88A 1A9XB 1VHJA 5CT8A 4C0QC 2CNBA 3NDPA 2ZBQA 4HV4A 1WLSA 3PXUA 3KQMA 5K4GA 3BT7A 3ITDA 6ADHA 3UGQA 4RANA 3MJRA 3TAXA 4OI2A 4WUTA 3GN2A 4TKVA 4NMWA 3EPHA 4KSYA 2H4HA 4JYBA 4BBPA 3EGXB 2R68A 4LA4A 3SSOA 2YY6A 2ERYA 5JQGF 4MITA 4R5MA 1NFRA 4GXQA 4ARUA 5BMVA 1QKKA 4MVJD 4OXXA 1V6SA 3QU2A 4Z3DA 2IP4A 3T95A 4HGQA 4HFJA 1KU0A 2AT1A 4MWDA 2ZDHA 1NHGA 1TJ4A 2JJMA 2OHXA 3H2KA 3I1FA 4H4DA 1S3SA 1XZNA 3MC1A 2FZCA 3C8HA 3IUMA 3ON5A 4MUFA 2QTGA 1S4MA 4FKZA 4KQWA 2ZJ5A 4FE4A 1LLQA 1RYDA 1VHLA 1JKIA 2IKSA 2ZI6A 2XDQA 1MOSA 3EDCA 3ZHYA 3BWDD 2VPTA 4D46A 1XMJA 3PNSA 1GNVA 3L7MA 3TJMA 3L7KA 4G4GA 4TSFD 4RACA 1EXVA 1K7YA 1QVVA 3DBRB 4F96A 2P4UA 2NZWA 5M3BA 3E15A 3ZVRA 5JNLA 2WILA 3SHQA 1IUOA 4IUCS 1DG3A 2EF1A 5T8KC 5B64A 4Y6OA 4J1TA 1SBIA 2VK4A 1WXFA 5KYUA 4OQZA 1SK8A 1MAUA 2KHZA 3L1VA 3Q2IA 4C3ZA 4PYKA 1FX0A 3CFYA 3L7DA 3MUNA 3JWIA 3N7AA 4WAUA 1K27A 1JXQA 4FYMA 3EQ2A 3WAJA 4MPRA 1JHAA 5FR2A 1WBJB 3X2FA 1JIUA 1TA4A 2OZPA 5D3ZA 1P4GA 1MU0A 1RPAA 3D4NA 2OD7A 3LQ4A 5FTMA 3WA6A 2EL7A 3IX7A 4IPTA 4EFLA 1NY5A 2G77B 4NBLA 5DM1A 3D8BA 4EVRA 5C5IA 2ZJ4A 3L4SO 2HZ7A 3C7DB 3TIFA 2KBFA 3PQ2A 3COSA 4HH4A 4JI4B 1KPIA 1UBUS 2C2XA 3K4PA 1MXFA 5E8RA 1BWQA 3B7GA 2JCYA 3H7IA 5JC1A 4QULA 1II8B 4ZCQA 2D1QA 5F1YA 4L5JA 1JQ3A 4FINA 1PGJA 3RHFA 3WQBA 4EECA 4J9VA 4BE7B 1I7LA 2PVCA 2RHGB 1ZOOA 3URMA 1N2EA 4DJEC 1DV1A 3O2QB 4XLTA 3BH7A 1H0HA 3NHSA 4NYMR 1BMTA 3NOOA 2YVQA 2C4HA 4XYEA 1DLIA 1FSFA 3NP7A 3VO9A 4ALMA 4E7PA 2VQEB 1L5QA 2WLSA 5EIFA 1EX6A 1YXMA 4HO1X 5AK5A 1WLYA 1QJCA 3EGVA 4M99A 2Q4EA 2PVPA 4CKEB 3ICVA 1YR6A 3FWPA 1ZCFA 5KPJA 4QQRA 3VUEA 1NQWA 3PYXA 4ARAA 5F1KA 1NVKA 4WNCA 2FWBA 4TKUA 2SHKA 4I81A 3O8BA 3LWNA 5TX7A 3OKAA 4W8GA 1GQQA 1ZAKA 4L4YA 1M1NB 5TQVA 4UVIA 3ZWAA 2X0IA 3OJLA 4FPXA 1RVV1 1L2TA 2OM6A 2AZMA 5CLQA 4MQEB 3QLEA 4L73A 2QR2A 1PL7A 5NULA 5GADl 1P74A 2R6GA 2YWBA 2PZFA 4OAQA 3V42A 1SOUA 2WAMA 1L3BA 1ISFA 4BNYA 3KFLA 3U7RA 5DYGA 2H07A 2H1LA 3S7TA 1FFXB 3R7FA 1KSHA 4E15A 4EKNB 3G6KA 3KE9A 3R0ZA 5ERXA 3ZDBA 3GG2A 3W2FA 3GJYA 2JH9A 4R2HA 2J85A 4C30A 1YMVA 5JI3E 3GK3A 1Z4NA 3V6MA 4ZIRB 4OGKA 1T4MA 3HDVA 2GTHA 1RI4A 1ZAYA 2FUG6 5LQAA 4L8FA 2D1SA 1R66A 4OJQA 4E1BA 3GVPA 5B1IA 4QDTA 5BNFA 4OX9B 1FVXA 1IULA 1NFQA 5IC6A 3BMCA 3RT1A 4CG1A 5ETJA 2GXUA 2C9BA 2BKAA 1UBOS 3JAWB 3PP8A 2PG3A 2D5BA 1EA7A 5JS6A 1MO5A 3FPBA 3VNRA 1TU0A 1CTQA 4KEAA 1OH7A 9GPBA 3ACDA 1CPYA 4R8LA 1SWVA 3R24A 2PXHA 4PC2A 1Q92A 2QM0A 1GUDA 1PO7A 2HAEA 2PV0A 4HUTA 3DW1X 3WNCA 2NXWA 4AO8A 1CP3A 4ZDIA 1M8FA 3QWIA 1ZMTA 3RIGA 4X00A 1QIGA 2XMQA 2VYCA 3K30A 4D9IA 1PJLA 1ZNXA 1WABA 1RYYA 4HNAA 1W4CA 1XQ9A 3VR6A 4B3JA 4BEWA 5FTLA 2JLUA 1N78A 2X13A 4UE2A 1HYBA 1Q0QA 2CHGA 2GO1A 2REQB 3G82C 2YV2A 2EFCB 3JQAA 1X7GA 3Q15C 4LYAA 2JJ8A 5IN5A 3TTTA 1YVPA 2VEDA 1HLGA 1X77A 4XX0B 2Q7DA 3P97A 5CU7A 3OZGA 1E9AA 5F2EA 4H3SA 1YNOA 4J1NA 3DCNA 4JQCA 2Q5IA 1XQ1A 1OI4A 3FGNA 2I4OA 2G40A 2QD3A 4M36A 1PN3A 3TLEA 1X15A 5JVDF 1T26A 4NMMA 4LK2A 3WHPA 1OXSC 3A1EA 4EG3A 3H9UA 5BQ5A 3EIXA 5EKXA 1XJWA 4UNQA 1DJNA 1E5TA 3KYJB 2QRUA 2HRQA 4Y9SA 2VF5X 4M0LA 1STOA 1T0PA 3R41A 1KFKB 2XTZA 4YWHA 3CE9A 3CPJB 3HUFA 5SYNA 4UU8A 2WQZA 5IEBA 3D8UA 5LQMA 1KC3A 2SCUB 1XC7A 4NWIA 4IZHA 4ARZA 4TTAA 3NAMA 4IGIA 3C1AA 1KYZA 1T8UA 1N5MA 1V47A 1KVTA 2RDMA 3OOSA 1ZUNB 5HKBA 2DT5A 1ZK3A 1J2UA 2F1OA 3KTAA 5E2AA 1O94D 4ZWNA 5K6RA 3PE3A 3M7IA 2IBTA 3WJ1A 1UUFA 3H4IA 4DPLA 1GZSA 2J59A 2ZTVA 3Q72A 2CWDA 1WBDA 4Q21A 4II2A 2OSVA 3Q6NA 2HFKA 1CT9A 5K3OA 3RK0A 3TZCA 2D06A 2VLBA 2WJGA 2FPWA 4F86A 3OC0A 2C7RA 3CZAA 3AEQA 4BMSA 4DLAA 5AOVA 1KP2A 1XDZA 3A9WA 4BLOA 3L9WA 5KQGA 3FNIA 4XDYA 3ROTA 2J3MA 3EA5A 3R0IA 4HDRA 4R9SA 3HPQA 4UUBA 5HOQA 5ESXA 2C84A 2CYCA 1QFZA 3IDQA 4MHSA 5I6DA 3TRDA 3ENNA 5K0EA 4YB8A 2JIBA 4UZSA 5HEKA 1NC3A 4CMCA 4CEJB 3C48A 2SECE 1II8A 1XRMA 4Y2HA 5DLPA 3BMNA 4ZCMA 1UPAA 3PXAA 3R7SA 5HGXA 2HUNA 3PQ8A 1IXZA 1UFVA 1XELA 3DF9A 3RKSA 1C4WA 4LN1A 5HCUA 2E1RA 1W8DA 3IYLW 3ZKWB 2P2CA 3CX6A 3HH8A 4PG6A 1A5ZA 3F9RA 2G9RA 4R0VA 4BC1A 3U4QB 4XSVA 3VR2A 2QK4A 2F8MA 1L8XA 4D8TA 4X71A 1RD4A 3EGDB 1MJGM 2P2GA 4EG4A 1D4OA 5HIKA 1XALA 4BGVA 5B1HA 2Q2OA 1YMQA 3N07A 3DVLA 3OE7D 5AO9A 2WWRA 3NYIA 3ETNA 4MGHA 3ZV7A 1HNNA 5FUWA 3QPWA 1CVLA 1VI5A 2AJBA 3K9QO 3KKQA 4KVAA 4V0KA 5FAXA 1Z4IA 2P35A 3A2KA 4TKUB 4U8HA 3OE7A 1X1TA 4GI7A 4JX9A 1M9NA 3N8KA 3M4ZA 2WWXA 2X1LA 2VDKB 1ZA1A 4MQBA 2J1LA 2DEUA 2C8JA 3V3KA 2HRZA 4GZ3A 3VI3B 2RBEA 5BWNA 3HGTA 1UDCA 4CIYA 4L8GA 3ZI0A 1QM5A 4N01A 4OTZA 4R83A 1VI2A 1FFHA 2Z09A 2GBCA 3A37A 5BUZA 1YDFA 1Z4QA 5ARDA 1WPGA 3C3WA 3MSCA 4Y6GB 2ZI7A 2GXAA 1CUAA 1KC1A 1DC3A 1PS0A 1IN8A 3CLRC 3EDRA 4MYTA