2FS1A

Solution structure of psd-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
MEAVDANSLAQAKEAAIKELKQYGIGDYYIKLINNAKTVEGVESLKNEILKALPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, dynamics, and stability variation in bacterial albumin binding modules: implications for species specificity.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328, streptococcus dysgalactiae, streptococcus equi, str
molecule tags Protein binding
molecule keywords PSD-1
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2fs1A00
1PRBA 2LHGA 2LHCA 2N35A 2MH8A 2FS1A 2KDLA 1GABA 1GJTA 2JWSA 2J5YA 2VDBB 1GJSA 1TF0B
chains in the Genus database with same CATH superfamily
2QENA 4YHHM 2JY7A 1DGHB 2ZAMA 4JI6M 3GLHA 4RNAA 2EO2A 1VDLA 3TWLA 3J80S 2DKLA 5ITXE 2FFJA 3GRRA 3U60B 2KHHA 2VF8A 1Z5CA 1NY5A 3AOEA 5EP4A 4B3TM 2JZ0A 3C3EA 1GKIA 4LGYA 2R62A 3DFZA 3RFWA 2LBCA 1G4AE 2JZ1A 3LCVB 4HL4A 4LFCM 1DGBA 1YLAA 1XWIA 2J7NA 4I81A 4LJ8A 2K6BA 3KW6A 1QZMA 1KSFX 4L6V6 1WIVA 5ITXA 4B7FA 3HJ8A 5EXTA 4MB7A 3T6PA 2EJSA 1N32M 2LVOC 4GIPA 3D8BA 4NSRA 1W5SA 1HQYE 3KOZE 1Y8GA 4NC6A 2F5OA 1GO5A 2G3QA 1A5TA 1L1TA 1SXJA 1QDTA 2DZOB 4LRTA 2K0BX 4DR2M 3FTDA 2KDLA 2H1RA 3VDUA 4LF6M 4LFAM 4AQYM 1NNUC 2A5YB 1TF0B 4FWDA 4II7A 4GKKM 3A42A 3NBXX 4FVMA 2JP7A 2L2DA 1QAOA 4Q7JA 3DOAA 4LF4M 2LVPC 2UUBM 3B74A 3EIHA 2C98A 3H4MA 2XSZD 5FTJA 3TE6A 1BVSA 2R45A 3K9OA 3W0LB 3E9SA 2RKOA 3K8ZA 1HJPA 3C58A 2DWNA 1EFUB 5EP3A 2VIIA 3E46A 1JR3E 3VK8A 4I4LA 4FCTA 4MM3B 5KO3A 1PM5A 3BBZA 3FUWA 4XBOA 1KYIA 3SMSA 1V33A 2JY6B 1YSYA 2DHYA 2R4EA 2D7GA 3VLFB 4D80A 3GLFE 4G4QA 2G5GX 4QNRA 3T1YM 4CJ6A 3FYCA 3U6MA 5LMNM 2DZNB 2CEAA 1J09A 4LCBA 4OVZA 1HR0M 3HHXA 2WZJA 1PJIA 3VKGA 3GO8A 3UZUA 1IFYA 1T43A 3GRVA 3J2PB 5GKNA 4LJ4A 4JI3M 1EIJA 3GPXA 4B3SM 3U6EA 3BOSA 2DWMA 1QZEA 2FNAA 4LG2A 2MROB 4AKIA 2L4FA 2KEBA 2QP9X 4GMQA 3GQ4A 1OIPA 4AZFA 4DV4M 2EA0A 2UUAM 4XGIA 1Z5BA 1VEJA 2JY5A 1E32A 4G3OA 4GRIA 4LRSA 3GP1A 1IY1A 1K3WA 2R18A 4CGYB 3T1HM 2DHRA 2ZTDA 4RF0A 4MH0E 1SXJC 5KPTA 2FS1A 3NBIA 4GC9A 2BWEA 1F4IA 2OO9A 2DI0A 4NL4H 2LHCA 4L4UA 3I51A 3CF6E 3W68A 3FTFA 3GPUA 2O25A 1UM8A 2P5TA 1N78A 3SAUA 1DV0A 2HWJA 2VQFM 3MJ5A 1OTRA 2BJWA 3FYDA 2FOIC 2R6FA 3KOXE 4I8OA 5ITTA 4AW4A 3AOEC 4LF9M 1WXQA 4X66M 1R2ZA 1LV7A 2JWSA 3J7AS 1C1KA 2Q2EB 3FUTA 3HHWA 1OKSA 4DV6M 1QAMA 1AIPC 3SYLA 1FJGM 2QSFX 5ITRA 3IG8A 3KS8A 3AKZA 4A3VB 1V92A 1H6UA 4M9XA 5IZ7D 3ZCBB 2LH0A 2WSEF 2X49A 4IJFA 4PT5A 1NJGA 3B9PA 5F3WA 1L2DA 2D7HA 1IBLM 1JQJC 5DYGA 2EUCA 4IBGA 2XZFA 4F2LA 3VK7A 2MJ5B 4LFBM 3BXWA 2DAEA 3I01M 2ZANA 4G4OA 1TH2A 4M0WA 1DGGA 4LJ5A 1QVRA 1MN3A 3UMMA 3GLHB 4MGIE 1DO2A 4X64M 5FTMA 4NXMM 1GABA 2WSCF 2HCBA 1PRBA 4B3MM 2R65A 2HHHM 1TR8A 4MGYE 1NY6A 3AJIB 3GRUA 1JB0F 3KDSE 2CRUA 1DGFA 5ITYA 4ZPXA 1NO1A 3JR4A 1SXJD 3KS4A 2OQ4A 3IHPA 1FNNA 2L6OA 4BBAA 2GQFA 5JI3E 2C99A 4NOOB 1ZAEA 3R9XB 2Z7JA 2DAGA 3GLIA 3CTWB 4R3DA 2KA6B 5LMUM 1HT2E 1IQPA 8CATA 2M60A 2Y20A 3I4YA 3MK6A 1D0MA 5EQTA 3CGWA 1ZQ9A 3AFHA 3D8LA 4IBKA 3SFZA 2UUCM 4EIWA 4AG6A 3UGJA 2XFTA 2QNJA 3E21A 4JV5M 1XXHE 3M6AA 3HGIA 2HAKA 2Z4RA 4RKUF 1IM2A 1NJFA 2HL7A 3SC3A 4TUWA 4IBFA 2R0IA 2F4VM 3LVWA 2OOBA 1HNXM 1PJSA 3LQQA 4AKHA 1E9RA 3U60A 1Q39A 2LVNC 5FTKA 4LF5M 3KP0E 4QOZC 4DR7M 2Y0TA 1ZMVA 4M9ZA 5BPVA 1IY0A 2JXNA 2JA2A 5ITUA 4LZZA 3SASA 1E9SA 2JUJA 4G4NA 4GEWA 4Z6YA 2JNHA 1RU3A 5BR8M 1YUBA 1K82A 4FD2A 2K47A 4HEOA 4FCVA 3EIEA 2DAMA 4K0KM 4GKJM 2R46A 3ILKA 3MMPA 1D2NA 1IXZA 3LQRA 5C18A 2Y0QA 2KZSA 4B7HA 3K1JA 3L25A 2QBYA 3VDPA 5JI2E 2DNAA 2LXEA 1Z59A 2DXIA 3M7GA 3Q8GA 4IIWA 2YQZA 2RRUA 2XH9A 3GLIB 1TH3A 4IBEA 4ITQA 3KVWA 3QYEA 1XMQM 2HKJA 5IWAM 2MH8A 4P17A 1OFIA 3QWLA 5DYIA 2CWBA 4R71A 3RGSA 1NVMA 2D7EA 4QHTA 3GLFB 4UN2B 4DUZM 1N36M 4JN6A 4P16A 4D81A 2XSZA 2QQ8A 1GL6A 1G71A 4NSOB 1XC8A 2CE7A 1WR1B 4RF1A 2QCUA 3U61B 1L1ZA 4PD2A 5EXPA 1SG9A 1TGUA 3HHYA 1SXJE 1T3TA 4CHTB 1JR3A 3DA1A 1IBMM 2BJVA 3NWLA 1P3QQ 2DVWB 3CF2A 4M0DA 1OAIA 2OOAA 3HHZA 1OQYA 2FH0A 2MR9A 3PXGA 4FW9A 4FCWA 2XLJA 1PJQA 1HNWM 2CP8A 2L7IA 2KNZA 3HJSA 3PNVA 2H5XA 3QYBA 4FWHA 4JI8M 3F92A 5ITQA 2KRKA 2LWXA 4WP2A 1GL7A 5FTLA 2F5SA 3GQ5A 4MGZE 3AL0C 3KFUG 2UXDM 2I7NA 2EKFA 3FE3A 3LVVA 1K3XA 4L15A 3C9PA 4M9SA 1Z5AA 4QHSA 3A45A 3KXEC 1IN8A 4GH9A 3FTEA 3HX3A 2F5QA 3B89A 1IN4A 4KHPM 4Y28F 3TPZA 3B7QA 3U6OA 1Q3BA 2C9CA 2L09A 2Z3XA 2XEPA 2CHVA 2R4JA 3K9PA 3R8FA 5KQDA 1VDDA 2ZAOA 5EXXA 3LCUA 4IBIA 3L26A 1IXSB 3U6CA 4LJ9A 4YY3M 3FTCA 4XK8F 3J7BA 2UXBM 3GLHE 1E94E 3FUVA 5EXSA 3FUUA 2XF3A 5KPRA 4LJ7A 5E6JA 1N34M 3PFIA 1QAQA 3AV0A 4LF8M 4JI0M 3GLGB 2X4AA 4OW0A 1ORYB 2LVQD 3PVSA 3T15A 4DR1M 4GITA 2X8AA 1TDHA 1VEKA 2LTUA 2RGHA 3GRYA 3HKPA 1AUAA 4PCZA 3OTOM 4PDIA 1R5LA 1PJJA 1NV9A 1ZV1A 3U6PA 1G3IA 3PNYA 1QDRA 1G41A 3HU1A 2K9DA 2LVAA 2QZ4A 3M0EA 4LJ6A 4DUYM 2O5RA 5EP1A 3JAMS 4KODA 2ZM6M 5IREB 4I5SA 4B3RM 3KSXA 4LJAA 5KQ8A 4LF7M 3GLFA 4Z8XA 3TWKA 2KNAA 1NNJA 2C96A 3HJQA 4AG5A 3TL4X 2KZUA 1L2CA 2LHGA 3GLGA 2YNMD 1IBKM 4B08A 4JYAM 3SYKA 2BNKA 2J5YA 4LY6A 2YR0A 3U6LA 1GLNA 2CHQA 2LNHC 1QYRA 1QANA 2F5PA 4DV7M 3FKEA 1UFZA 4GC5A 3A98B 1KFVA 1Q02A 4QOSA 4AI6A 2VQEM 1XMOM 4KO8A 3GPPA 1R4GA 3VFDA 4OX9M 3FUXA 2J7OA 3THGA 1N77A 1N33M 1GJTA 4F1IA 1XHBA 4L16A 1GJSA 1IN5A 4DR4M 2XZUA 2DAKA 3J27B 3KOYE 1L8QA 2CUZA 4IBDA 4AKGA 3L2AA 4CIZA 2E5LM 1XXHB 4B7GA 4JI4M 1ZMWA 4NRVA 1TTEA 4MGHA 3L28A 2QHOB 2L4EA 2KW0A 1OJLA 2ZBKB 2ZTCA 3SAWA 1C7YA 1VG5A 2DENA 3LW5F 1R2YA 3TWMA 3SBJA 3GPYA 5EP2A 1S3SA 4G4RA 2EKKA 1IXRC 2APLA 2BWBA 4NXNM 4DV0M 2GNOA 1XB2B 3WHLA 3GQ3A 4JI2M 3L27A 5DNYA 1Q3CA 2AHMA 4BLCA 3GLIE 2YFQA 3J81S 2FE8A 1HNZM 3AOGA 2MGWA 3UJNA 7CATA 1G59A 1DGHA 1W5TA 2DWZB 2VF7A 1V34A 1LTMA 2CFOA 2CV0A 2KXEA 3ZC7B 1WHCA 1YE9A 1VEGA 2RGOA 3B7ZA 3RE8A 5KPZA 3T38A 4CISA 2Z8YM 1G8PA 4JXJA 3FRHA 3MHVC 5IT9S 4JI1M 1EE8A 4W5WA 4IJEA 4IBCA 1HQCA 1HT1E 3KSJA 2CV2A 4OVZB 2M5ZA 3C3DA 4KT0F 1WGNA 1JR3D 1I94M 4GHAA 1D0KA 2NQ8C 4KLNA 4LZJA 2C9OA 3ZH9B 5FLXS 2KNVA 4S12A 2QBYB 3Q8XA 4GHLA 2VDBB 2WSFF 3DZDA 2CV1A 3ZQJA 3FD9A 5C1BA 4HLQA 1T6OA 1N75A 2N35A 1R7RA 3HU2A 2KRUA 4FWGA 1NSFA 1PGYA 4X65M 3SMPA 1X37A 4QNMA 3H4JA 3SARA 1NV8A 1DO0A 3V76A 3CF0A 4DV5M 3QAUA 1D0LA 3RGPA 4DV1M 3I4VA 1OIZA 5H37D 3E4RA 3A46A 4DV3M 4PDGA 2I7PA 4WURA 4G6ZA 3W67A 3HY5A 1TH4A 1WJ7A 2G8LA 1GVNA 2DAIA 4L78A 4JI7M 2QPAA 3U61A 4REZA 3SHFA 2DWLA 3U6SA 1QQWA 2UXCM 1NHWC 1OAOC 4L8RC 4IBBA 4DV2M 1J7KA 1IN7A 1XXHA 1OFHA 4X62M 4ANRA 2UU9M 2XFSA 2F5NA 1MJGM 3FRIA 4DR5M 2R44A 3L29A 3TQSA 3KP1E 3W0FA 4D82A 1TDZA 1MX0A 3GLGE 2JY8A 5DFLA 5A2QS 3KOWE 4DR3M 2Y21A 5L8RF 1L2BA 2V1CA 1IY2A 3U5ZA 3WHKA 1WGLA 1ZMUA 5FSWA 3K2LA 3IG5A 3SATA 3HU3A 4NRWA 3U5ZB 1CUKA 2O01F 3SHGB 1QUSA 3UK6A 2ERCA 3HZJA 4LGMA 4OU7A 5EJCA 1Z6TA 3K92A 5E26A 4DBGB 3SAVA 2V1UA 4IBJA 2XGNA 1J5EM 4DR6M 2B3TA 3I04M 1XNRM 3HWSA 3U6QA 1IN6A 2W82A 1MU5A 1SXJB 1PJTA 4MGKE 3JR5A 1XNQM 1VQ1A 2L7HA 1I4WA 1NHGC 5FTNA 2CHGA 1QUTA 4JI5M 4BB9A 3B7NA 2OPFA 3VKHA 2V6ZM 2C5RA 3IECA 4R7GA 3U6DA 4WW0A 1IXSA 2DZLA 3LMMA 1R6BX 2Z4SA
chains in the Genus database with same CATH topology
1PRBA 2LHGA 2LHCA 2N35A 2MH8A 2FS1A 2KDLA 1GABA 1GJTA 2JWSA 2J5YA 2VDBB 1GJSA 1TF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRB A;  2LHG A;  2LHC A;  2N35 A;  2MH8 A;  2FS1 A;  2KDL A;  1GAB A;  1GJT A;  2JWS A;  2J5Y A;  2VDB B;  1GJS A;  1TF0 B; 
#chains in the Genus database with same CATH topology
 2QEN A;  4YHH M;  2JY7 A;  1DGH B;  2ZAM A;  4JI6 M;  3GLH A;  4RNA A;  2EO2 A;  1VDL A;  3TWL A;  3J80 S;  2DKL A;  5ITX E;  2FFJ A;  3GRR A;  3U60 B;  2KHH A;  2VF8 A;  1Z5C A;  1NY5 A;  3AOE A;  5EP4 A;  4B3T M;  2JZ0 A;  3C3E A;  1GKI A;  4LGY A;  2R62 A;  3DFZ A;  3RFW A;  2LBC A;  1G4A E;  2JZ1 A;  3LCV B;  4HL4 A;  4LFC M;  1DGB A;  1YLA A;  1XWI A;  2J7N A;  4I81 A;  4LJ8 A;  2K6B A;  3KW6 A;  1QZM A;  1KSF X;  4L6V 6;  1WIV A;  5ITX A;  4B7F A;  3HJ8 A;  5EXT A;  4MB7 A;  3T6P A;  2EJS A;  1N32 M;  2LVO C;  4GIP A;  3D8B A;  4NSR A;  1W5S A;  1HQY E;  3KOZ E;  1Y8G A;  4NC6 A;  2F5O A;  1GO5 A;  2G3Q A;  1A5T A;  1L1T A;  1SXJ A;  1QDT A;  2DZO B;  4LRT A;  2K0B X;  4DR2 M;  3FTD A;  2KDL A;  2H1R A;  3VDU A;  4LF6 M;  4LFA M;  4AQY M;  1NNU C;  2A5Y B;  1TF0 B;  4FWD A;  4II7 A;  4GKK M;  3A42 A;  3NBX X;  4FVM A;  2JP7 A;  2L2D A;  1QAO A;  4Q7J A;  3DOA A;  4LF4 M;  2LVP C;  2UUB M;  3B74 A;  3EIH A;  2C98 A;  3H4M A;  2XSZ D;  5FTJ A;  3TE6 A;  1BVS A;  2R45 A;  3K9O A;  3W0L B;  3E9S A;  2RKO A;  3K8Z A;  1HJP A;  3C58 A;  2DWN A;  1EFU B;  5EP3 A;  2VII A;  3E46 A;  1JR3 E;  3VK8 A;  4I4L A;  4FCT A;  4MM3 B;  5KO3 A;  1PM5 A;  3BBZ A;  3FUW A;  4XBO A;  1KYI A;  3SMS A;  1V33 A;  2JY6 B;  1YSY A;  2DHY A;  2R4E A;  2D7G A;  3VLF B;  4D80 A;  3GLF E;  4G4Q A;  2G5G X;  4QNR A;  3T1Y M;  4CJ6 A;  3FYC A;  3U6M A;  5LMN M;  2DZN B;  2CEA A;  1J09 A;  4LCB A;  4OVZ A;  1HR0 M;  3HHX A;  2WZJ A;  1PJI A;  3VKG A;  3GO8 A;  3UZU A;  1IFY A;  1T43 A;  3GRV A;  3J2P B;  5GKN A;  4LJ4 A;  4JI3 M;  1EIJ A;  3GPX A;  4B3S M;  3U6E A;  3BOS A;  2DWM A;  1QZE A;  2FNA A;  4LG2 A;  2MRO B;  4AKI A;  2L4F A;  2KEB A;  2QP9 X;  4GMQ A;  3GQ4 A;  1OIP A;  4AZF A;  4DV4 M;  2EA0 A;  2UUA M;  4XGI A;  1Z5B A;  1VEJ A;  2JY5 A;  1E32 A;  4G3O A;  4GRI A;  4LRS A;  3GP1 A;  1IY1 A;  1K3W A;  2R18 A;  4CGY B;  3T1H M;  2DHR A;  2ZTD A;  4RF0 A;  4MH0 E;  1SXJ C;  5KPT A;  2FS1 A;  3NBI A;  4GC9 A;  2BWE A;  1F4I A;  2OO9 A;  2DI0 A;  4NL4 H;  2LHC A;  4L4U A;  3I51 A;  3CF6 E;  3W68 A;  3FTF A;  3GPU A;  2O25 A;  1UM8 A;  2P5T A;  1N78 A;  3SAU A;  1DV0 A;  2HWJ A;  2VQF M;  3MJ5 A;  1OTR A;  2BJW A;  3FYD A;  2FOI C;  2R6F A;  3KOX E;  4I8O A;  5ITT A;  4AW4 A;  3AOE C;  4LF9 M;  1WXQ A;  4X66 M;  1R2Z A;  1LV7 A;  2JWS A;  3J7A S;  1C1K A;  2Q2E B;  3FUT A;  3HHW A;  1OKS A;  4DV6 M;  1QAM A;  1AIP C;  3SYL A;  1FJG M;  2QSF X;  5ITR A;  3IG8 A;  3KS8 A;  3AKZ A;  4A3V B;  1V92 A;  1H6U A;  4M9X A;  5IZ7 D;  3ZCB B;  2LH0 A;  2WSE F;  2X49 A;  4IJF A;  4PT5 A;  1NJG A;  3B9P A;  5F3W A;  1L2D A;  2D7H A;  1IBL M;  1JQJ C;  5DYG A;  2EUC A;  4IBG A;  2XZF A;  4F2L A;  3VK7 A;  2MJ5 B;  4LFB M;  3BXW A;  2DAE A;  3I01 M;  2ZAN A;  4G4O A;  1TH2 A;  4M0W A;  1DGG A;  4LJ5 A;  1QVR A;  1MN3 A;  3UMM A;  3GLH B;  4MGI E;  1DO2 A;  4X64 M;  5FTM A;  4NXM M;  1GAB A;  2WSC F;  2HCB A;  1PRB A;  4B3M M;  2R65 A;  2HHH M;  1TR8 A;  4MGY E;  1NY6 A;  3AJI B;  3GRU A;  1JB0 F;  3KDS E;  2CRU A;  1DGF A;  5ITY A;  4ZPX A;  1NO1 A;  3JR4 A;  1SXJ D;  3KS4 A;  2OQ4 A;  3IHP A;  1FNN A;  2L6O A;  4BBA A;  2GQF A;  5JI3 E;  2C99 A;  4NOO B;  1ZAE A;  3R9X B;  2Z7J A;  2DAG A;  3GLI A;  3CTW B;  4R3D A;  2KA6 B;  5LMU M;  1HT2 E;  1IQP A;  8CAT A;  2M60 A;  2Y20 A;  3I4Y A;  3MK6 A;  1D0M A;  5EQT A;  3CGW A;  1ZQ9 A;  3AFH A;  3D8L A;  4IBK A;  3SFZ A;  2UUC M;  4EIW A;  4AG6 A;  3UGJ A;  2XFT A;  2QNJ A;  3E21 A;  4JV5 M;  1XXH E;  3M6A A;  3HGI A;  2HAK A;  2Z4R A;  4RKU F;  1IM2 A;  1NJF A;  2HL7 A;  3SC3 A;  4TUW A;  4IBF A;  2R0I A;  2F4V M;  3LVW A;  2OOB A;  1HNX M;  1PJS A;  3LQQ A;  4AKH A;  1E9R A;  3U60 A;  1Q39 A;  2LVN C;  5FTK A;  4LF5 M;  3KP0 E;  4QOZ C;  4DR7 M;  2Y0T A;  1ZMV A;  4M9Z A;  5BPV A;  1IY0 A;  2JXN A;  2JA2 A;  5ITU A;  4LZZ A;  3SAS A;  1E9S A;  2JUJ A;  4G4N A;  4GEW A;  4Z6Y A;  2JNH A;  1RU3 A;  5BR8 M;  1YUB A;  1K82 A;  4FD2 A;  2K47 A;  4HEO A;  4FCV A;  3EIE A;  2DAM A;  4K0K M;  4GKJ M;  2R46 A;  3ILK A;  3MMP A;  1D2N A;  1IXZ A;  3LQR A;  5C18 A;  2Y0Q A;  2KZS A;  4B7H A;  3K1J A;  3L25 A;  2QBY A;  3VDP A;  5JI2 E;  2DNA A;  2LXE A;  1Z59 A;  2DXI A;  3M7G A;  3Q8G A;  4IIW A;  2YQZ A;  2RRU A;  2XH9 A;  3GLI B;  1TH3 A;  4IBE A;  4ITQ A;  3KVW A;  3QYE A;  1XMQ M;  2HKJ A;  5IWA M;  2MH8 A;  4P17 A;  1OFI A;  3QWL A;  5DYI A;  2CWB A;  4R71 A;  3RGS A;  1NVM A;  2D7E A;  4QHT A;  3GLF B;  4UN2 B;  4DUZ M;  1N36 M;  4JN6 A;  4P16 A;  4D81 A;  2XSZ A;  2QQ8 A;  1GL6 A;  1G71 A;  4NSO B;  1XC8 A;  2CE7 A;  1WR1 B;  4RF1 A;  2QCU A;  3U61 B;  1L1Z A;  4PD2 A;  5EXP A;  1SG9 A;  1TGU A;  3HHY A;  1SXJ E;  1T3T A;  4CHT B;  1JR3 A;  3DA1 A;  1IBM M;  2BJV A;  3NWL A;  1P3Q Q;  2DVW B;  3CF2 A;  4M0D A;  1OAI A;  2OOA A;  3HHZ A;  1OQY A;  2FH0 A;  2MR9 A;  3PXG A;  4FW9 A;  4FCW A;  2XLJ A;  1PJQ A;  1HNW M;  2CP8 A;  2L7I A;  2KNZ A;  3HJS A;  3PNV A;  2H5X A;  3QYB A;  4FWH A;  4JI8 M;  3F92 A;  5ITQ A;  2KRK A;  2LWX A;  4WP2 A;  1GL7 A;  5FTL A;  2F5S A;  3GQ5 A;  4MGZ E;  3AL0 C;  3KFU G;  2UXD M;  2I7N A;  2EKF A;  3FE3 A;  3LVV A;  1K3X A;  4L15 A;  3C9P A;  4M9S A;  1Z5A A;  4QHS A;  3A45 A;  3KXE C;  1IN8 A;  4GH9 A;  3FTE A;  3HX3 A;  2F5Q A;  3B89 A;  1IN4 A;  4KHP M;  4Y28 F;  3TPZ A;  3B7Q A;  3U6O A;  1Q3B A;  2C9C A;  2L09 A;  2Z3X A;  2XEP A;  2CHV A;  2R4J A;  3K9P A;  3R8F A;  5KQD A;  1VDD A;  2ZAO A;  5EXX A;  3LCU A;  4IBI A;  3L26 A;  1IXS B;  3U6C A;  4LJ9 A;  4YY3 M;  3FTC A;  4XK8 F;  3J7B A;  2UXB M;  3GLH E;  1E94 E;  3FUV A;  5EXS A;  3FUU A;  2XF3 A;  5KPR A;  4LJ7 A;  5E6J A;  1N34 M;  3PFI A;  1QAQ A;  3AV0 A;  4LF8 M;  4JI0 M;  3GLG B;  2X4A A;  4OW0 A;  1ORY B;  2LVQ D;  3PVS A;  3T15 A;  4DR1 M;  4GIT A;  2X8A A;  1TDH A;  1VEK A;  2LTU A;  2RGH A;  3GRY A;  3HKP A;  1AUA A;  4PCZ A;  3OTO M;  4PDI A;  1R5L A;  1PJJ A;  1NV9 A;  1ZV1 A;  3U6P A;  1G3I A;  3PNY A;  1QDR A;  1G41 A;  3HU1 A;  2K9D A;  2LVA A;  2QZ4 A;  3M0E A;  4LJ6 A;  4DUY M;  2O5R A;  5EP1 A;  3JAM S;  4KOD A;  2ZM6 M;  5IRE B;  4I5S A;  4B3R M;  3KSX A;  4LJA A;  5KQ8 A;  4LF7 M;  3GLF A;  4Z8X A;  3TWK A;  2KNA A;  1NNJ A;  2C96 A;  3HJQ A;  4AG5 A;  3TL4 X;  2KZU A;  1L2C A;  2LHG A;  3GLG A;  2YNM D;  1IBK M;  4B08 A;  4JYA M;  3SYK A;  2BNK A;  2J5Y A;  4LY6 A;  2YR0 A;  3U6L A;  1GLN A;  2CHQ A;  2LNH C;  1QYR A;  1QAN A;  2F5P A;  4DV7 M;  3FKE A;  1UFZ A;  4GC5 A;  3A98 B;  1KFV A;  1Q02 A;  4QOS A;  4AI6 A;  2VQE M;  1XMO M;  4KO8 A;  3GPP A;  1R4G A;  3VFD A;  4OX9 M;  3FUX A;  2J7O A;  3THG A;  1N77 A;  1N33 M;  1GJT A;  4F1I A;  1XHB A;  4L16 A;  1GJS A;  1IN5 A;  4DR4 M;  2XZU A;  2DAK A;  3J27 B;  3KOY E;  1L8Q A;  2CUZ A;  4IBD A;  4AKG A;  3L2A A;  4CIZ A;  2E5L M;  1XXH B;  4B7G A;  4JI4 M;  1ZMW A;  4NRV A;  1TTE A;  4MGH A;  3L28 A;  2QHO B;  2L4E A;  2KW0 A;  1OJL A;  2ZBK B;  2ZTC A;  3SAW A;  1C7Y A;  1VG5 A;  2DEN A;  3LW5 F;  1R2Y A;  3TWM A;  3SBJ A;  3GPY A;  5EP2 A;  1S3S A;  4G4R A;  2EKK A;  1IXR C;  2APL A;  2BWB A;  4NXN M;  4DV0 M;  2GNO A;  1XB2 B;  3WHL A;  3GQ3 A;  4JI2 M;  3L27 A;  5DNY A;  1Q3C A;  2AHM A;  4BLC A;  3GLI E;  2YFQ A;  3J81 S;  2FE8 A;  1HNZ M;  3AOG A;  2MGW A;  3UJN A;  7CAT A;  1G59 A;  1DGH A;  1W5T A;  2DWZ B;  2VF7 A;  1V34 A;  1LTM A;  2CFO A;  2CV0 A;  2KXE A;  3ZC7 B;  1WHC A;  1YE9 A;  1VEG A;  2RGO A;  3B7Z A;  3RE8 A;  5KPZ A;  3T38 A;  4CIS A;  2Z8Y M;  1G8P A;  4JXJ A;  3FRH A;  3MHV C;  5IT9 S;  4JI1 M;  1EE8 A;  4W5W A;  4IJE A;  4IBC A;  1HQC A;  1HT1 E;  3KSJ A;  2CV2 A;  4OVZ B;  2M5Z A;  3C3D A;  4KT0 F;  1WGN A;  1JR3 D;  1I94 M;  4GHA A;  1D0K A;  2NQ8 C;  4KLN A;  4LZJ A;  2C9O A;  3ZH9 B;  5FLX S;  2KNV A;  4S12 A;  2QBY B;  3Q8X A;  4GHL A;  2VDB B;  2WSF F;  3DZD A;  2CV1 A;  3ZQJ A;  3FD9 A;  5C1B A;  4HLQ A;  1T6O A;  1N75 A;  2N35 A;  1R7R A;  3HU2 A;  2KRU A;  4FWG A;  1NSF A;  1PGY A;  4X65 M;  3SMP A;  1X37 A;  4QNM A;  3H4J A;  3SAR A;  1NV8 A;  1DO0 A;  3V76 A;  3CF0 A;  4DV5 M;  3QAU A;  1D0L A;  3RGP A;  4DV1 M;  3I4V A;  1OIZ A;  5H37 D;  3E4R A;  3A46 A;  4DV3 M;  4PDG A;  2I7P A;  4WUR A;  4G6Z A;  3W67 A;  3HY5 A;  1TH4 A;  1WJ7 A;  2G8L A;  1GVN A;  2DAI A;  4L78 A;  4JI7 M;  2QPA A;  3U61 A;  4REZ A;  3SHF A;  2DWL A;  3U6S A;  1QQW A;  2UXC M;  1NHW C;  1OAO C;  4L8R C;  4IBB A;  4DV2 M;  1J7K A;  1IN7 A;  1XXH A;  1OFH A;  4X62 M;  4ANR A;  2UU9 M;  2XFS A;  2F5N A;  1MJG M;  3FRI A;  4DR5 M;  2R44 A;  3L29 A;  3TQS A;  3KP1 E;  3W0F A;  4D82 A;  1TDZ A;  1MX0 A;  3GLG E;  2JY8 A;  5DFL A;  5A2Q S;  3KOW E;  4DR3 M;  2Y21 A;  5L8R F;  1L2B A;  2V1C A;  1IY2 A;  3U5Z A;  3WHK A;  1WGL A;  1ZMU A;  5FSW A;  3K2L A;  3IG5 A;  3SAT A;  3HU3 A;  4NRW A;  3U5Z B;  1CUK A;  2O01 F;  3SHG B;  1QUS A;  3UK6 A;  2ERC A;  3HZJ A;  4LGM A;  4OU7 A;  5EJC A;  1Z6T A;  3K92 A;  5E26 A;  4DBG B;  3SAV A;  2V1U A;  4IBJ A;  2XGN A;  1J5E M;  4DR6 M;  2B3T A;  3I04 M;  1XNR M;  3HWS A;  3U6Q A;  1IN6 A;  2W82 A;  1MU5 A;  1SXJ B;  1PJT A;  4MGK E;  3JR5 A;  1XNQ M;  1VQ1 A;  2L7H A;  1I4W A;  1NHG C;  5FTN A;  2CHG A;  1QUT A;  4JI5 M;  4BB9 A;  3B7N A;  2OPF A;  3VKH A;  2V6Z M;  2C5R A;  3IEC A;  4R7G A;  3U6D A;  4WW0 A;  1IXS A;  2DZL A;  3LMM A;  1R6B X;  2Z4S A; 
#chains in the Genus database with same CATH homology
 1PRB A;  2LHG A;  2LHC A;  2N35 A;  2MH8 A;  2FS1 A;  2KDL A;  1GAB A;  1GJT A;  2JWS A;  2J5Y A;  2VDB B;  1GJS A;  1TF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...