2FS1A

Solution structure of psd-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
b'MEAVDANSLAQAKEAAIKELKQYGIGDYYIKLINNAKTVEGVESLKNEILKALPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSD-1
molecule tags Protein binding
source organism Finegoldia magna atcc 29328, streptococcus dysgalactiae, streptococcus equi, str
publication title Structure, dynamics, and stability variation in bacterial albumin binding modules: implications for species specificity.
pubmed doi rcsb
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2fs1A00
1GJTA 2LHGA 1GABA 2VDBB 1GJSA 2J5YA 2JWSA 1TF0B 2N35A 2FS1A 1PRBA 2MH8A 2LHCA 2KDLA
chains in the Genus database with same CATH superfamily
4NSOB 1J7KA 2JZ1A 4PDGA 1L1TA 1XHBA 4LY6A 1KFVA 3KS4A 2Y0QA 1R7RA 3KOXE 3FE3A 3QWLA 4MH0E 1Z5BA 1AIPC 4G4NA 4M0DA 1PJSA 5EP4A 3UJNA 4LJ6A 3AL0C 4R71A 4DV2M 2Q2EB 1N78A 3WHLA 3H4MA 4GITA 2ZBKB 3KDSE 1JQJC 5EXTA 5IZ7D 3U6LA 1ZMUA 4L78A 1IN5A 5E6JA 4DV5M 1L8QA 3BXWA 2L4EA 1QQWA 4QOSA 4RF0A 2LBCA 3CF6E 3DZDA 3GO8A 5F3WA 3TL4X 2XH9A 3FTEA 3KFUG 1QUTA 3W0LB 2ZAMA 3ILKA 4IBJA 3UK6A 2C98A 4AI6A 2KNZA 4JI2M 4D82A 5FTMA 4ZPXA 2QSFX 2K47A 1IN4A 1IY1A 2R4EA 3L28A 2HAKA 3W0FA 3FTFA 2F5OA 3R9XB 3SYLA 3HJSA 4LF7M 2L6OA 3GQ4A 3L2AA 4QOZC 4GRIA 2LH0A 4G6ZA 3U6PA 2XSZD 1Z6TA 2N35A 3KSJA 4FW9A 3VDPA 2R65A 1ZV1A 4OVZB 3KOWE 3VDUA 4X65M 1SXJD 3LVWA 3GLFA 2XGNA 1G59A 4P17A 3V76A 4F2LA 1XNRM 2JY7A 2CV2A 4A3VB 2L7IA 3Q8GA 1GABA 4B3SM 2QQ8A 4PCZA 4X62M 2CEAA 3IHPA 3MHVC 4EIWA 3SYKA 1WGLA 3SASA 2KHHA 2WSEF 2L09A 4DV1M 4NRVA 3T38A 2BJVA 1GL7A 2DWNA 4GHLA 3HWSA 4FVMA 3KVWA 2V6ZM 2XZFA 4DR5M 3AOGA 1UM8A 5EXSA 2OOBA 5JI3E 2QBYB 1V34A 2DWZB 2XFTA 2MROB 2DKLA 2ERCA 3AFHA 4LZJA 3TQSA 1TH4A 5ITTA 4DV0M 3LVVA 1H6UA 4DR1M 4GMQA 1JB0F 2C9OA 2MJ5B 3GRYA 4IBKA 1FJGM 3NBXX 3TWLA 3TWMA 2FH0A 2WSCF 5FTJA 1HJPA 4LF5M 4JV5M 5FLXS 4M9ZA 5C1BA 1HNXM 1PJJA 1VG5A 2R6FA 1EFUB 1NHGC 4LZZA 1K3WA 1G3IA 1NY6A 3HKPA 3KP1E 2JA2A 4GC5A 2J7NA 3HZJA 3FRHA 1S3SA 2UXBM 2LXEA 3FTDA 4NL4H 4RF1A 1SXJB 1TH3A 3HHZA 4AQYM 2XZUA 1IN7A 4AKGA 2Z8YM 4MGZE 4MB7A 3TWKA 2W82A 1IXZA 1IBLM 3C9PA 4GIPA 1TGUA 2XEPA 2AHMA 2FE8A 4MGKE 1QYRA 1YUBA 3WHKA 2C5RA 2O25A 1KSFX 2JP7A 3U5ZB 1XC8A 4B7GA 2DWMA 5IT9S 1YE9A 3K9PA 2BWBA 4GHAA 5EP3A 1NY5A 3FYCA 5FTNA 2UXCM 2LHGA 3D8BA 3TPZA 2G5GX 4WW0A 4NRWA 3THGA 5ITQA 2LWXA 1MN3A 2R44A 1I94M 1XXHE 2P5TA 3CTWB 3W67A 1L2BA 4MGYE 2UU9M 1XB2B 5DYGA 1X37A 2KXEA 4K0KM 3E9SA 3T1HM 3GLFB 1Q02A 3QYEA 4S12A 1IXRC 1SG9A 4CIZA 4OX9M 2A5YB 1QVRA 2YQZA 3AV0A 4LCBA 4IBDA 1W5TA 3LQQA 4HL4A 4HEOA 3GLIE 3LCVB 1NJFA 3H4JA 4OVZA 1R2ZA 4KT0F 1N36M 2F5NA 3T1YM 3J81S 2LNHC 3E21A 2DZOB 3I4VA 3GLGE 1T43A 3I04M 1PM5A 3VK8A 2K0BX 3MMPA 4LRSA 3J27B 2CP8A 4JYAM 1WIVA 3VKGA 4XK8F 3M7GA 2LVNC 3U6MA 2DNAA 4GC9A 2R18A 5E26A 1ZAEA 3GRRA 1NJGA 3U6OA 4IJFA 4P16A 4IBGA 1OKSA 3RGSA 2LVAA 4UN2B 2X4AA 1WHCA 3I01M 3J7AS 4B3RM 3B7ZA 5FTKA 1OAOC 1V33A 3DA1A 2FNAA 2JY8A 1IY0A 3I51A 5H37D 5JI2E 1HT1E 3GP1A 3GLHA 3JAMS 2H5XA 2Y21A 3QAUA 2KRKA 3FUWA 4MGIE 2J5YA 1VDLA 4LJ8A 2DVWB 2Y0TA 3GRVA 1OFIA 1OIPA 5EP1A 3SBJA 1P3QQ 2CHVA 1GVNA 3M0EA 1AUAA 1TDHA 1VEJA 3SMSA 1NV8A 2LTUA 4JXJA 4MM3B 1DO0A 3KSXA 1TDZA 2JY6B 4OU7A 2CRUA 3E46A 5IWAM 3CF0A 1R5LA 4ANRA 1SXJC 4CHTB 3KOYE 1VEGA 2QCUA 3KXEC 4I5SA 5BPVA 1HNZM 4AZFA 2YFQA 1HQCA 4F1IA 1PGYA 2KA6B 3KOZE 4B7FA 1D0LA 2Z7JA 2L4FA 3K92A 2BJWA 4XGIA 1N77A 1Q3CA 2D7EA 4Z8XA 1IQPA 2J7OA 1N32M 4X66M 1Q39A 1MU5A 4II7A 1QZEA 3ZH9B 3AJIB 3B7NA 1TTEA 3JR4A 3L27A 2OQ4A 4CGYB 1DGHA 4B3MM 4JI5M 1CUKA 1E9RA 3AOEA 4AKIA 1WR1B 4KO8A 1GKIA 3HX3A 1XWIA 4D81A 1ORYB 3IG8A 3B74A 4LG2A 4W5WA 2G3QA 2V1UA 1A5TA 1C1KA 1NO1A 1R4GA 4IBIA 4NSRA 4JI0M 3VFDA 3U6QA 1GJSA 1W5SA 3B89A 3VK7A 3U5ZA 3C3DA 3U60A 3C3EA 1D0MA 1NNUC 2JWSA 2K6BA 4PT5A 3GRUA 4DV7M 1OIZA 1R6BX 3K9OA 1T3TA 3RE8A 1K3XA 2X49A 1D2NA 3PNYA 3HU1A 2QHOB 4DR4M 3M6AA 2F5PA 2HCBA 3LCUA 1TH2A 3RGPA 3VKHA 5GKNA 4B7HA 5KO3A 1UFZA 2JNHA 2L7HA 3C58A 2EA0A 3SC3A 2DZNB 3IG5A 4AG6A 3GPPA 2VIIA 4Y28F 2MH8A 3U61B 1IN6A 2YNMD 4LRTA 5KPTA 2C9CA 2KEBA 3U6SA 1DGGA 2RGOA 4IBBA 2FS1A 1E9SA 1OFHA 2XLJA 3PXGA 2CE7A 4B08A 2QENA 4BLCA 1DGBA 5IREB 3DOAA 3HU3A 3GPXA 1NVMA 2DWLA 4LF8M 1C7YA 3EIEA 3LW5F 4IJEA 2EKKA 2MGWA 4DBGB 3KW6A 1J5EM 1XXHB 2Y20A 4CISA 1IY2A 4DR7M 2R46A 2DXIA 2KZSA 2FFJA 3ZCBB 2VDBB 4FCVA 4D80A 3HJQA 3CF2A 1E94E 4FCWA 3U6CA 3J7BA 4LF6M 2DI0A 2JZ0A 3FUUA 3K2LA 5DYIA 4WURA 3GLIB 1VDDA 4DV4M 2L2DA 2M60A 2GNOA 3I4YA 2EKFA 4L15A 2UUBM 4TUWA 1G41A 1LTMA 5EQTA 4LJ9A 1DGHB 4GKKM 2D7HA 2R62A 4FWDA 4G3OA 1NNJA 1PJQA 3RFWA 4G4QA 4JI6M 1N75A 1WGNA 2KNAA 1N33M 3Q8XA 2CWBA 2JXNA 4QNMA 1BVSA 3KP0E 1OTRA 3AOEC 3E4RA 2CFOA 2OO9A 3SATA 4BB9A 3FUXA 1QDRA 2APLA 1YSYA 1Z59A 2I7PA 4G4OA 4WP2A 3U6EA 3L25A 2HL7A 5BR8M 4LFCM 3TE6A 2KDLA 2V1CA 1JR3A 1MX0A 3B7QA 2DHRA 3QYBA 2UUAM 3T15A 3F92A 1N34M 1QUSA 4DR2M 1ZMWA 3U6DA 3A45A 2LVPC 1IM2A 1NV9A 3EIHA 1SXJA 2CHGA 3J2PB 4JI4M 1YLAA 4QHTA 1OJLA 2WZJA 3GLHB 2LVOC 1I4WA 3IECA 4GKJM 4L16A 1R2YA 4DR6M 1XNQM 2DZLA 4LGMA 3ZQJA 5FSWA 4R7GA 2CV1A 4AW4A 4AKHA 1IFYA 2ZM6M 2DAEA 2LVQD 1QANA 1L1ZA 1GL6A 3LMMA 4L8RC 1SXJE 4QHSA 3HU2A 3K1JA 4YHHM 4NXMM 2CV0A 4M0WA 1IXSB 1QDTA 4Q7JA 5LMNM 3A98B 4GEWA 1V92A 4CJ6A 1GLNA 1NSFA 1QAMA 1QAQA 1J09A 2X8AA 2C96A 3VLFB 3GQ5A 5KQ8A 4IBFA 3SAUA 2R0IA 4LF9M 2UUCM 2ZTCA 1QAOA 4JI3M 3A46A 2BNKA 2VQFM 4OW0A 4M9SA 3J80S 3GPUA 3D8LA 3KS8A 3OTOM 4KHPM 1OQYA 7CATA 4GH9A 4LFAM 1XMQM 2K9DA 2NQ8C 4JN6A 2VQEM 3GLIA 1PRBA 3K8ZA 2RRUA 4BBAA 2RGHA 1HNWM 2RKOA 3R8FA 1HT2E 5LMUM 5ITXE 4LF4M 3A42A 3JR5A 2KZUA 2XSZA 4X64M 5L8RF 2I7NA 4M9XA 1GO5A 5FTLA 2DAKA 2E5LM 3SHGB 4IIWA 2KNVA 4L4UA 4NXNM 2QPAA 4FWGA 3HHYA 2JUJA 3NWLA 5ITXA 2Z3XA 1EIJA 1L2CA 2F4VM 1PJIA 2R4JA 1WJ7A 2DAIA 3HHWA 3HY5A 4I8OA 3UGJA 4DUZM 5KPRA 2GQFA 2H1RA 2G8LA 4Z6YA 4PD2A 1XMOM 3FUVA 3SFZA 2ZTDA 1IBKM 3GLFE 1D0KA 2EJSA 3HHXA 3NBIA 4LJAA 1HR0M 2UXDM 1Z5CA 2D7GA 3FYDA 2OOAA 3HGIA 3U61A 2QNJA 2QZ4A 4R3DA 4REZA 1GJTA 3MK6A 3GLGB 2O5RA 5KQDA 2XF3A 3FD9A 3FRIA 5C18A 1K82A 1G71A 4AG5A 2HWJA 2VF7A 2EO2A 4FCTA 2DENA 2ZANA 1MJGM 4DUYM 2M5ZA 1IXSA 4QNRA 3AKZA 1EE8A 4LGYA 3SMPA 1Y8GA 1IN8A 1E32A 1OAIA 1PJTA 2DAMA 3FUTA 4I81A 1T6OA 2WSFF 4JI7M 4FD2A 2JY5A 3T6PA 2HHHM 3ZC7B 2KRUA 2Z4SA 3U60B 2YR0A 5EJCA 2BWEA 4LJ7A 4DR3M 3L29A 2VF8A 1TF0B 4FWHA 5EXXA 5DNYA 2MR9A 1DGFA 2Z4RA 3FTCA 2F5QA 1VEKA 4DV6M 2EUCA 4HLQA 2DHYA 4G4RA 3UMMA 4IBCA 4NOOB 1FNNA 4PDIA 2F5SA 1DV0A 5ITUA 3MJ5A 3SARA 3PNVA 1Z5AA 1IBMM 3SAVA 2QP9X 1Q3BA 2KW0A 2CUZA 5A2QS 4DV3M 3FKEA 4B3TM 3GQ3A 4LFBM 1HQYE 2LHCA 1ZQ9A 3GLHE 5ITRA 2OPFA 5EP2A 3L26A 3SAWA 4I4LA 3BBZA 3PVSA 1DO2A 4JI1M 2DAGA 3B9PA 3W68A 3GPYA 4KLNA 1RU3A 3HJ8A 1L2DA 5DFLA 4XBOA 2B3TA 4IBEA 1NHWC 1ZMVA 4ITQA 2CHQA 4YY3M 4RNAA 1G4AE 2XFSA 4NC6A 2FOIC 1QZMA 2ZAOA 3PFIA 1F4IA 4LJ4A 1JR3D 3SHFA 2C99A 3GLGA 5KPZA 1KYIA 2O01F 4KODA 1TR8A 4JI8M 3CGWA 2HKJA 2R45A 4MGHA 4LJ5A 1VQ1A 1JR3E 2QBYA 3UZUA 4L6V6 1G8PA 4RKUF 8CATA 5EXPA 3LQRA 3BOSA 3DFZA 5ITYA 1XXHA 1WXQA 1LV7A
chains in the Genus database with same CATH topology
1GJTA 2LHGA 1GABA 2VDBB 1GJSA 2J5YA 2JWSA 1TF0B 2N35A 2FS1A 1PRBA 2MH8A 2LHCA 2KDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJT A;  2LHG A;  1GAB A;  2VDB B;  1GJS A;  2J5Y A;  2JWS A;  1TF0 B;  2N35 A;  2FS1 A;  1PRB A;  2MH8 A;  2LHC A;  2KDL A; 
#chains in the Genus database with same CATH topology
 4NSO B;  1J7K A;  2JZ1 A;  4PDG A;  1L1T A;  1XHB A;  4LY6 A;  1KFV A;  3KS4 A;  2Y0Q A;  1R7R A;  3KOX E;  3FE3 A;  3QWL A;  4MH0 E;  1Z5B A;  1AIP C;  4G4N A;  4M0D A;  1PJS A;  5EP4 A;  3UJN A;  4LJ6 A;  3AL0 C;  4R71 A;  4DV2 M;  2Q2E B;  1N78 A;  3WHL A;  3H4M A;  4GIT A;  2ZBK B;  3KDS E;  1JQJ C;  5EXT A;  5IZ7 D;  3U6L A;  1ZMU A;  4L78 A;  1IN5 A;  5E6J A;  4DV5 M;  1L8Q A;  3BXW A;  2L4E A;  1QQW A;  4QOS A;  4RF0 A;  2LBC A;  3CF6 E;  3DZD A;  3GO8 A;  5F3W A;  3TL4 X;  2XH9 A;  3FTE A;  3KFU G;  1QUT A;  3W0L B;  2ZAM A;  3ILK A;  4IBJ A;  3UK6 A;  2C98 A;  4AI6 A;  2KNZ A;  4JI2 M;  4D82 A;  5FTM A;  4ZPX A;  2QSF X;  2K47 A;  1IN4 A;  1IY1 A;  2R4E A;  3L28 A;  2HAK A;  3W0F A;  3FTF A;  2F5O A;  3R9X B;  3SYL A;  3HJS A;  4LF7 M;  2L6O A;  3GQ4 A;  3L2A A;  4QOZ C;  4GRI A;  2LH0 A;  4G6Z A;  3U6P A;  2XSZ D;  1Z6T A;  2N35 A;  3KSJ A;  4FW9 A;  3VDP A;  2R65 A;  1ZV1 A;  4OVZ B;  3KOW E;  3VDU A;  4X65 M;  1SXJ D;  3LVW A;  3GLF A;  2XGN A;  1G59 A;  4P17 A;  3V76 A;  4F2L A;  1XNR M;  2JY7 A;  2CV2 A;  4A3V B;  2L7I A;  3Q8G A;  1GAB A;  4B3S M;  2QQ8 A;  4PCZ A;  4X62 M;  2CEA A;  3IHP A;  3MHV C;  4EIW A;  3SYK A;  1WGL A;  3SAS A;  2KHH A;  2WSE F;  2L09 A;  4DV1 M;  4NRV A;  3T38 A;  2BJV A;  1GL7 A;  2DWN A;  4GHL A;  3HWS A;  4FVM A;  3KVW A;  2V6Z M;  2XZF A;  4DR5 M;  3AOG A;  1UM8 A;  5EXS A;  2OOB A;  5JI3 E;  2QBY B;  1V34 A;  2DWZ B;  2XFT A;  2MRO B;  2DKL A;  2ERC A;  3AFH A;  4LZJ A;  3TQS A;  1TH4 A;  5ITT A;  4DV0 M;  3LVV A;  1H6U A;  4DR1 M;  4GMQ A;  1JB0 F;  2C9O A;  2MJ5 B;  3GRY A;  4IBK A;  1FJG M;  3NBX X;  3TWL A;  3TWM A;  2FH0 A;  2WSC F;  5FTJ A;  1HJP A;  4LF5 M;  4JV5 M;  5FLX S;  4M9Z A;  5C1B A;  1HNX M;  1PJJ A;  1VG5 A;  2R6F A;  1EFU B;  1NHG C;  4LZZ A;  1K3W A;  1G3I A;  1NY6 A;  3HKP A;  3KP1 E;  2JA2 A;  4GC5 A;  2J7N A;  3HZJ A;  3FRH A;  1S3S A;  2UXB M;  2LXE A;  3FTD A;  4NL4 H;  4RF1 A;  1SXJ B;  1TH3 A;  3HHZ A;  4AQY M;  2XZU A;  1IN7 A;  4AKG A;  2Z8Y M;  4MGZ E;  4MB7 A;  3TWK A;  2W82 A;  1IXZ A;  1IBL M;  3C9P A;  4GIP A;  1TGU A;  2XEP A;  2AHM A;  2FE8 A;  4MGK E;  1QYR A;  1YUB A;  3WHK A;  2C5R A;  2O25 A;  1KSF X;  2JP7 A;  3U5Z B;  1XC8 A;  4B7G A;  2DWM A;  5IT9 S;  1YE9 A;  3K9P A;  2BWB A;  4GHA A;  5EP3 A;  1NY5 A;  3FYC A;  5FTN A;  2UXC M;  2LHG A;  3D8B A;  3TPZ A;  2G5G X;  4WW0 A;  4NRW A;  3THG A;  5ITQ A;  2LWX A;  1MN3 A;  2R44 A;  1I94 M;  1XXH E;  2P5T A;  3CTW B;  3W67 A;  1L2B A;  4MGY E;  2UU9 M;  1XB2 B;  5DYG A;  1X37 A;  2KXE A;  4K0K M;  3E9S A;  3T1H M;  3GLF B;  1Q02 A;  3QYE A;  4S12 A;  1IXR C;  1SG9 A;  4CIZ A;  4OX9 M;  2A5Y B;  1QVR A;  2YQZ A;  3AV0 A;  4LCB A;  4IBD A;  1W5T A;  3LQQ A;  4HL4 A;  4HEO A;  3GLI E;  3LCV B;  1NJF A;  3H4J A;  4OVZ A;  1R2Z A;  4KT0 F;  1N36 M;  2F5N A;  3T1Y M;  3J81 S;  2LNH C;  3E21 A;  2DZO B;  3I4V A;  3GLG E;  1T43 A;  3I04 M;  1PM5 A;  3VK8 A;  2K0B X;  3MMP A;  4LRS A;  3J27 B;  2CP8 A;  4JYA M;  1WIV A;  3VKG A;  4XK8 F;  3M7G A;  2LVN C;  3U6M A;  2DNA A;  4GC9 A;  2R18 A;  5E26 A;  1ZAE A;  3GRR A;  1NJG A;  3U6O A;  4IJF A;  4P16 A;  4IBG A;  1OKS A;  3RGS A;  2LVA A;  4UN2 B;  2X4A A;  1WHC A;  3I01 M;  3J7A S;  4B3R M;  3B7Z A;  5FTK A;  1OAO C;  1V33 A;  3DA1 A;  2FNA A;  2JY8 A;  1IY0 A;  3I51 A;  5H37 D;  5JI2 E;  1HT1 E;  3GP1 A;  3GLH A;  3JAM S;  2H5X A;  2Y21 A;  3QAU A;  2KRK A;  3FUW A;  4MGI E;  2J5Y A;  1VDL A;  4LJ8 A;  2DVW B;  2Y0T A;  3GRV A;  1OFI A;  1OIP A;  5EP1 A;  3SBJ A;  1P3Q Q;  2CHV A;  1GVN A;  3M0E A;  1AUA A;  1TDH A;  1VEJ A;  3SMS A;  1NV8 A;  2LTU A;  4JXJ A;  4MM3 B;  1DO0 A;  3KSX A;  1TDZ A;  2JY6 B;  4OU7 A;  2CRU A;  3E46 A;  5IWA M;  3CF0 A;  1R5L A;  4ANR A;  1SXJ C;  4CHT B;  3KOY E;  1VEG A;  2QCU A;  3KXE C;  4I5S A;  5BPV A;  1HNZ M;  4AZF A;  2YFQ A;  1HQC A;  4F1I A;  1PGY A;  2KA6 B;  3KOZ E;  4B7F A;  1D0L A;  2Z7J A;  2L4F A;  3K92 A;  2BJW A;  4XGI A;  1N77 A;  1Q3C A;  2D7E A;  4Z8X A;  1IQP A;  2J7O A;  1N32 M;  4X66 M;  1Q39 A;  1MU5 A;  4II7 A;  1QZE A;  3ZH9 B;  3AJI B;  3B7N A;  1TTE A;  3JR4 A;  3L27 A;  2OQ4 A;  4CGY B;  1DGH A;  4B3M M;  4JI5 M;  1CUK A;  1E9R A;  3AOE A;  4AKI A;  1WR1 B;  4KO8 A;  1GKI A;  3HX3 A;  1XWI A;  4D81 A;  1ORY B;  3IG8 A;  3B74 A;  4LG2 A;  4W5W A;  2G3Q A;  2V1U A;  1A5T A;  1C1K A;  1NO1 A;  1R4G A;  4IBI A;  4NSR A;  4JI0 M;  3VFD A;  3U6Q A;  1GJS A;  1W5S A;  3B89 A;  3VK7 A;  3U5Z A;  3C3D A;  3U60 A;  3C3E A;  1D0M A;  1NNU C;  2JWS A;  2K6B A;  4PT5 A;  3GRU A;  4DV7 M;  1OIZ A;  1R6B X;  3K9O A;  1T3T A;  3RE8 A;  1K3X A;  2X49 A;  1D2N A;  3PNY A;  3HU1 A;  2QHO B;  4DR4 M;  3M6A A;  2F5P A;  2HCB A;  3LCU A;  1TH2 A;  3RGP A;  3VKH A;  5GKN A;  4B7H A;  5KO3 A;  1UFZ A;  2JNH A;  2L7H A;  3C58 A;  2EA0 A;  3SC3 A;  2DZN B;  3IG5 A;  4AG6 A;  3GPP A;  2VII A;  4Y28 F;  2MH8 A;  3U61 B;  1IN6 A;  2YNM D;  4LRT A;  5KPT A;  2C9C A;  2KEB A;  3U6S A;  1DGG A;  2RGO A;  4IBB A;  2FS1 A;  1E9S A;  1OFH A;  2XLJ A;  3PXG A;  2CE7 A;  4B08 A;  2QEN A;  4BLC A;  1DGB A;  5IRE B;  3DOA A;  3HU3 A;  3GPX A;  1NVM A;  2DWL A;  4LF8 M;  1C7Y A;  3EIE A;  3LW5 F;  4IJE A;  2EKK A;  2MGW A;  4DBG B;  3KW6 A;  1J5E M;  1XXH B;  2Y20 A;  4CIS A;  1IY2 A;  4DR7 M;  2R46 A;  2DXI A;  2KZS A;  2FFJ A;  3ZCB B;  2VDB B;  4FCV A;  4D80 A;  3HJQ A;  3CF2 A;  1E94 E;  4FCW A;  3U6C A;  3J7B A;  4LF6 M;  2DI0 A;  2JZ0 A;  3FUU A;  3K2L A;  5DYI A;  4WUR A;  3GLI B;  1VDD A;  4DV4 M;  2L2D A;  2M60 A;  2GNO A;  3I4Y A;  2EKF A;  4L15 A;  2UUB M;  4TUW A;  1G41 A;  1LTM A;  5EQT A;  4LJ9 A;  1DGH B;  4GKK M;  2D7H A;  2R62 A;  4FWD A;  4G3O A;  1NNJ A;  1PJQ A;  3RFW A;  4G4Q A;  4JI6 M;  1N75 A;  1WGN A;  2KNA A;  1N33 M;  3Q8X A;  2CWB A;  2JXN A;  4QNM A;  1BVS A;  3KP0 E;  1OTR A;  3AOE C;  3E4R A;  2CFO A;  2OO9 A;  3SAT A;  4BB9 A;  3FUX A;  1QDR A;  2APL A;  1YSY A;  1Z59 A;  2I7P A;  4G4O A;  4WP2 A;  3U6E A;  3L25 A;  2HL7 A;  5BR8 M;  4LFC M;  3TE6 A;  2KDL A;  2V1C A;  1JR3 A;  1MX0 A;  3B7Q A;  2DHR A;  3QYB A;  2UUA M;  3T15 A;  3F92 A;  1N34 M;  1QUS A;  4DR2 M;  1ZMW A;  3U6D A;  3A45 A;  2LVP C;  1IM2 A;  1NV9 A;  3EIH A;  1SXJ A;  2CHG A;  3J2P B;  4JI4 M;  1YLA A;  4QHT A;  1OJL A;  2WZJ A;  3GLH B;  2LVO C;  1I4W A;  3IEC A;  4GKJ M;  4L16 A;  1R2Y A;  4DR6 M;  1XNQ M;  2DZL A;  4LGM A;  3ZQJ A;  5FSW A;  4R7G A;  2CV1 A;  4AW4 A;  4AKH A;  1IFY A;  2ZM6 M;  2DAE A;  2LVQ D;  1QAN A;  1L1Z A;  1GL6 A;  3LMM A;  4L8R C;  1SXJ E;  4QHS A;  3HU2 A;  3K1J A;  4YHH M;  4NXM M;  2CV0 A;  4M0W A;  1IXS B;  1QDT A;  4Q7J A;  5LMN M;  3A98 B;  4GEW A;  1V92 A;  4CJ6 A;  1GLN A;  1NSF A;  1QAM A;  1QAQ A;  1J09 A;  2X8A A;  2C96 A;  3VLF B;  3GQ5 A;  5KQ8 A;  4IBF A;  3SAU A;  2R0I A;  4LF9 M;  2UUC M;  2ZTC A;  1QAO A;  4JI3 M;  3A46 A;  2BNK A;  2VQF M;  4OW0 A;  4M9S A;  3J80 S;  3GPU A;  3D8L A;  3KS8 A;  3OTO M;  4KHP M;  1OQY A;  7CAT A;  4GH9 A;  4LFA M;  1XMQ M;  2K9D A;  2NQ8 C;  4JN6 A;  2VQE M;  3GLI A;  1PRB A;  3K8Z A;  2RRU A;  4BBA A;  2RGH A;  1HNW M;  2RKO A;  3R8F A;  1HT2 E;  5LMU M;  5ITX E;  4LF4 M;  3A42 A;  3JR5 A;  2KZU A;  2XSZ A;  4X64 M;  5L8R F;  2I7N A;  4M9X A;  1GO5 A;  5FTL A;  2DAK A;  2E5L M;  3SHG B;  4IIW A;  2KNV A;  4L4U A;  4NXN M;  2QPA A;  4FWG A;  3HHY A;  2JUJ A;  3NWL A;  5ITX A;  2Z3X A;  1EIJ A;  1L2C A;  2F4V M;  1PJI A;  2R4J A;  1WJ7 A;  2DAI A;  3HHW A;  3HY5 A;  4I8O A;  3UGJ A;  4DUZ M;  5KPR A;  2GQF A;  2H1R A;  2G8L A;  4Z6Y A;  4PD2 A;  1XMO M;  3FUV A;  3SFZ A;  2ZTD A;  1IBK M;  3GLF E;  1D0K A;  2EJS A;  3HHX A;  3NBI A;  4LJA A;  1HR0 M;  2UXD M;  1Z5C A;  2D7G A;  3FYD A;  2OOA A;  3HGI A;  3U61 A;  2QNJ A;  2QZ4 A;  4R3D A;  4REZ A;  1GJT A;  3MK6 A;  3GLG B;  2O5R A;  5KQD A;  2XF3 A;  3FD9 A;  3FRI A;  5C18 A;  1K82 A;  1G71 A;  4AG5 A;  2HWJ A;  2VF7 A;  2EO2 A;  4FCT A;  2DEN A;  2ZAN A;  1MJG M;  4DUY M;  2M5Z A;  1IXS A;  4QNR A;  3AKZ A;  1EE8 A;  4LGY A;  3SMP A;  1Y8G A;  1IN8 A;  1E32 A;  1OAI A;  1PJT A;  2DAM A;  3FUT A;  4I81 A;  1T6O A;  2WSF F;  4JI7 M;  4FD2 A;  2JY5 A;  3T6P A;  2HHH M;  3ZC7 B;  2KRU A;  2Z4S A;  3U60 B;  2YR0 A;  5EJC A;  2BWE A;  4LJ7 A;  4DR3 M;  3L29 A;  2VF8 A;  1TF0 B;  4FWH A;  5EXX A;  5DNY A;  2MR9 A;  1DGF A;  2Z4R A;  3FTC A;  2F5Q A;  1VEK A;  4DV6 M;  2EUC A;  4HLQ A;  2DHY A;  4G4R A;  3UMM A;  4IBC A;  4NOO B;  1FNN A;  4PDI A;  2F5S A;  1DV0 A;  5ITU A;  3MJ5 A;  3SAR A;  3PNV A;  1Z5A A;  1IBM M;  3SAV A;  2QP9 X;  1Q3B A;  2KW0 A;  2CUZ A;  5A2Q S;  4DV3 M;  3FKE A;  4B3T M;  3GQ3 A;  4LFB M;  1HQY E;  2LHC A;  1ZQ9 A;  3GLH E;  5ITR A;  2OPF A;  5EP2 A;  3L26 A;  3SAW A;  4I4L A;  3BBZ A;  3PVS A;  1DO2 A;  4JI1 M;  2DAG A;  3B9P A;  3W68 A;  3GPY A;  4KLN A;  1RU3 A;  3HJ8 A;  1L2D A;  5DFL A;  4XBO A;  2B3T A;  4IBE A;  1NHW C;  1ZMV A;  4ITQ A;  2CHQ A;  4YY3 M;  4RNA A;  1G4A E;  2XFS A;  4NC6 A;  2FOI C;  1QZM A;  2ZAO A;  3PFI A;  1F4I A;  4LJ4 A;  1JR3 D;  3SHF A;  2C99 A;  3GLG A;  5KPZ A;  1KYI A;  2O01 F;  4KOD A;  1TR8 A;  4JI8 M;  3CGW A;  2HKJ A;  2R45 A;  4MGH A;  4LJ5 A;  1VQ1 A;  1JR3 E;  2QBY A;  3UZU A;  4L6V 6;  1G8P A;  4RKU F;  8CAT A;  5EXP A;  3LQR A;  3BOS A;  3DFZ A;  5ITY A;  1XXH A;  1WXQ A;  1LV7 A; 
#chains in the Genus database with same CATH homology
 1GJT A;  2LHG A;  1GAB A;  2VDB B;  1GJS A;  2J5Y A;  2JWS A;  1TF0 B;  2N35 A;  2FS1 A;  1PRB A;  2MH8 A;  2LHC A;  2KDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...