2FS1A

Solution structure of psd-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
MEAVDANSLAQAKEAAIKELKQYGIGDYYIKLINNAKTVEGVESLKNEILKALPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, dynamics, and stability variation in bacterial albumin binding modules: implications for species specificity.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328, streptococcus dysgalactiae, streptococcus equi, str
molecule tags Protein binding
molecule keywords PSD-1
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2fs1A00
2MH8A 2JWSA 2J5YA 1PRBA 2KDLA 2LHGA 1GABA 2N35A 2FS1A 2VDBB 1TF0B 2LHCA 1GJSA 1GJTA
chains in the Genus database with same CATH superfamily
4G4OA 3K92A 3DZDA 2D7EA 1DGHA 4D81A 1V33A 5ITQA 4AKHA 1IXSA 2EKKA 1IN8A 3CF6E 2DKLA 2P5TA 4GHLA 1IBKM 2LVOC 2ZAMA 5EXTA 2MGWA 2XF3A 3HY5A 2C5RA 1QUTA 2Y21A 2LHCA 4LRTA 5FTMA 1DGFA 3FTCA 2ERCA 3LQRA 4IBGA 3T15A 1OJLA 2BJWA 4CJ6A 4M9ZA 4RF1A 3SYKA 5KPZA 4B3SM 1Q02A 2DAGA 2LVPC 1GKIA 2CWBA 5ITXA 1C7YA 2FOIC 4DBGB 3SHFA 2BWBA 3EIEA 1PM5A 4FD2A 1YLAA 1XXHA 1N75A 1K3WA 5A2QS 2FNAA 3KOZE 1NVMA 2CRUA 1MX0A 3HWSA 3K9OA 3FUXA 3TPZA 4NXMM 2L7HA 2NQ8C 1WHCA 3FUWA 2K9DA 2WZJA 2DNAA 2R62A 4YY3M 2LH0A 5BPVA 1TH4A 3M7GA 5DYIA 4PCZA 5L8RF 1QQWA 4Q7JA 2DZNB 4QOSA 1PJQA 2MR9A 3Q8XA 2J5YA 3QYBA 2KHHA 7CATA 2OPFA 4FCTA 4IBJA 2R6FA 2FFJA 1XXHE 2FS1A 2VIIA 4LJ5A 4JI3M 1YSYA 2DWLA 2XSZA 2R45A 4OW0A 1KFVA 4L8RC 4LF5M 3LQQA 2QZ4A 2DWZB 3GLFB 2G3QA 2JY7A 3GLGE 3U6DA 2HKJA 1MU5A 2BJVA 3I01M 3HX3A 2XH9A 1NY5A 4OVZA 3I4VA 3FKEA 4JI0M 1HT1E 3GQ3A 3QAUA 2R4JA 4DUYM 2X8AA 3K1JA 3TWLA 3VFDA 1IN6A 1QDRA 1ZQ9A 3W0FA 2C9OA 2WSCF 3ZC7B 1WR1B 3GPYA 1IY0A 4GEWA 3U6SA 1VG5A 2UU9M 4JI1M 1E32A 4IBIA 2ZBKB 3A98B 3D8LA 3K2LA 4L16A 5IREB 3GLIA 1R6BX 1X37A 3U6MA 4B7HA 3DFZA 2ZANA 4RKUF 2DHRA 3K8ZA 3FUTA 2EO2A 2QHOB 2QPAA 2K0BX 5JI3E 2A5YB 3F92A 3PNVA 3KP1E 1D0KA 1NJFA 4XGIA 2F5PA 1LV7A 1QUSA 1IN4A 3FTDA 1N78A 4GITA 2KW0A 5FTNA 2UUCM 4LJ4A 3BXWA 4G4RA 3MMPA 4ANRA 2CV2A 1NV9A 2Z7JA 1G59A 3H4MA 1PJJA 2V1CA 4RF0A 1JR3D 2C98A 4JXJA 1NO1A 4Z8XA 5LMNM 1XXHB 4JI4M 4QOZC 2LHGA 3GQ5A 1K82A 2RGHA 1L1TA 3LVVA 2C96A 3V76A 3GRYA 3WHKA 1D2NA 1NJGA 2B3TA 1VEJA 3IECA 4D82A 4FCVA 1QYRA 3RGPA 3T1YM 2C9CA 3HJQA 3IG5A 3GLHB 3CTWB 2K47A 3ZCBB 3DA1A 3HKPA 2QENA 4B08A 2Z8YM 1TDZA 4LJ8A 3AOEA 2LVQD 5IWAM 3U6OA 1FJGM 1QZMA 4DR7M 3L26A 3L2AA 1HNWM 4JV5M 2XEPA 1HT2E 3FUUA 4FVMA 2JNHA 3HJSA 4IBBA 1TH2A 2W82A 2BWEA 4X62M 4LZZA 3GLFA 3U60B 4RNAA 1YE9A 5FLXS 1WGNA 2I7NA 4IJEA 2HCBA 2JUJA 2Z4RA 2R4EA 3CGWA 3HHWA 3HHYA 3KDSE 3A46A 3C58A 1A5TA 3MK6A 4LJ6A 2DHYA 5EP2A 1VDLA 3LVWA 2DWMA 1XNQM 2KDLA 1XHBA 3VK8A 4B3RM 3LMMA 1NHWC 2F4VM 5EJCA 3L25A 2M5ZA 3GLIB 3GO8A 4LF8M 4LG2A 2VDBB 1SXJA 4F1IA 3NBXX 5EP1A 5JI2E 1VDDA 4MGYE 2KEBA 1R5LA 4MGKE 4MB7A 4F2LA 4LF9M 1JB0F 2Y0QA 2VQFM 3M0EA 4IBEA 1L1ZA 1D0LA 3KVWA 4LFAM 2CV0A 3SMSA 3E21A 2KZSA 3ZH9B 1NSFA 5KO3A 1GJTA 3VDUA 1PJIA 2R0IA 3SC3A 3AJIB 1CUKA 2JA2A 3KSXA 4TUWA 3EIHA 1Z59A 3B9PA 4I4LA 4KO8A 2JZ0A 2R18A 3Q8GA 4FCWA 3UGJA 2WSFF 3GPXA 2XZUA 4LJ7A 3K9PA 2YNMD 4LCBA 1F4IA 2H5XA 3B7NA 3GLIE 3HHZA 3W67A 2Q2EB 4BB9A 3KSJA 2CE7A 1V34A 3GLHA 4II7A 2KRKA 4REZA 4DUZM 4AZFA 1R7RA 4IBFA 2DAMA 2N35A 4PT5A 4DV5M 3VKHA 2QP9X 2XFSA 5IT9S 2KZUA 1VEKA 4LJ9A 4JI2M 2L2DA 2O5RA 5GKNA 5C1BA 4WW0A 4M9XA 2QCUA 1UM8A 2QBYA 1DGGA 4XBOA 1HQCA 3FRHA 4I81A 4LJAA 1QZEA 1HNZM 3J27B 3KFUG 2DAEA 3J7BA 3U60A 1D0MA 1S3SA 2KNAA 1SXJE 1WGLA 4GKJM 3FD9A 4L15A 2APLA 1WJ7A 2OOAA 1Q3BA 1QVRA 3PFIA 3VK7A 4A3VB 1DGHB 5DFLA 4DV0M 4IBKA 3J7AS 1W5SA 2R44A 1E9SA 2RGOA 2Y20A 4P16A 1AUAA 1Z5CA 4DV7M 3A45A 3AKZA 2V1UA 3SHGB 5EXSA 1ZMVA 1ZMUA 3HZJA 5EQTA 4CHTB 4FWGA 4JI8M 4D80A 3J80S 4LGYA 4NSRA 4B3TM 3GRRA 1YUBA 1MN3A 1N32M 3KW6A 1EE8A 3U61B 4GIPA 1EFUB 5IZ7D 2F5QA 4AI6A 5EXXA 3U6LA 8CATA 2XZFA 2F5SA 2ZAOA 3KOXE 3IHPA 4LY6A 4CGYB 5KPTA 1OTRA 1HQYE 2DI0A 4B3MM 4G4QA 3SBJA 1OFIA 3L28A 2L4FA 4DV3M 4Y28F 4LF4M 4IBDA 5ITRA 1I94M 2RRUA 4YHHM 2J7OA 3LCUA 3GPPA 2HHHM 1IXSB 3KS4A 1XWIA 4KODA 2OOBA 4FWDA 1QAQA 1Y8GA 3QYEA 4NRWA 2LVNC 3RGSA 2CHVA 1Z6TA 3B7ZA 3R8FA 4OX9M 2CV1A 4ZPXA 3IG8A 3E9SA 2L6OA 2XFTA 3PNYA 1N77A 3TWKA 3FTFA 3HU2A 2UXCM 2EKFA 3DOAA 3FYCA 4QHTA 3AOGA 2YR0A 3GLGB 1SXJC 2UXDM 4IJFA 3CF0A 4GHAA 4GC5A 2X4AA 3FRIA 2QBYB 2HAKA 1L2CA 4M0DA 3JR4A 1XMOM 2CFOA 1QANA 4ITQA 3GP1A 4WP2A 5LMUM 3BOSA 1HNXM 3TWMA 3GPUA 1OQYA 3AOEC 5BR8M 2LVAA 4L6V6 4DR5M 2E5LM 4JI5M 3A42A 3SMPA 4NOOB 3KXEC 4AKGA 4UN2B 1Z5AA 1IFYA 4FWHA 2R46A 3MHVC 2YFQA 5KQ8A 1N36M 2L7IA 2G5GX 3JAMS 2H1RA 1QAMA 2FH0A 1LTMA 2VF7A 5H37D 3T6PA 5EP3A 1AIPC 1G3IA 1R4GA 4M9SA 4MGIE 3U6EA 4CISA 1IQPA 1PJSA 4DV4M 2CHQA 3PVSA 1IBMM 1OAIA 3NBIA 5F3WA 3TQSA 3LCVB 3B89A 4DR3M 1T6OA 2GNOA 2LBCA 4NC6A 5DYGA 2UUBM 3R9XB 1IY2A 1OFHA 1L8QA 4GRIA 1WIVA 1TH3A 1ZV1A 3B74A 4OVZB 4GC9A 3U61A 3FE3A 3HHXA 3T38A 2JWSA 2DXIA 2JZ1A 4HL4A 5DNYA 3FYDA 2WSEF 3I51A 2LWXA 2KA6B 3HGIA 1OKSA 1IY1A 2DZOB 1KSFX 3B7QA 2MJ5B 4JI6M 5FTJA 4B7GA 1RU3A 2Z4SA 3AV0A 2EA0A 1XMQM 4LF7M 2DAIA 3E46A 2KXEA 3H4JA 3GRUA 1GJSA 2C99A 2EUCA 3SATA 1GO5A 3U6PA 5EP4A 1K3XA 1QAOA 3TL4X 2Z3XA 1NY6A 3M6AA 1Q39A 4WURA 5KPRA 2JY5A 3KOWE 4R3DA 2DWNA 1Z5BA 1GL6A 1BVSA 2ZTDA 4HEOA 4KT0F 1P3QQ 1FNNA 2OO9A 5FTLA 1IM2A 3RE8A 3D8BA 1G41A 3MJ5A 3ZQJA 3GLFE 2D7GA 2GQFA 2XGNA 5ITXE 4L78A 4OU7A 1R2YA 2DVWB 4PDGA 4AKIA 5EXPA 5FTKA 2JXNA 2F5NA 4NXNM 4L4UA 3FUVA 1IN7A 2F5OA 1T3TA 1I4WA 1MJGM 3SASA 4DV1M 2BNKA 4AG6A 4JYAM 3U5ZA 3TE6A 1PJTA 3GQ4A 1DO0A 4QHSA 2L4EA 4G6ZA 1R2ZA 1V92A 1JR3A 1QDTA 1GVNA 3OTOM 4LZJA 2K6BA 4LFBM 4X66M 1OIPA 2CHGA 4QNRA 2Y0TA 1OAOC 1GLNA 1SXJB 4I5SA 3VDPA 1DO2A 3J81S 1XC8A 3VKGA 4X65M 3SYLA 3KP0E 3RFWA 1VEGA 3W68A 2L09A 1NNUC 1UFZA 1DV0A 2MROB 4IIWA 2UXBM 2CUZA 3VLFB 1WXQA 3T1HM 3KS8A 1N34M 2G8LA 1L2DA 1JQJC 2R65A 2QQ8A 4MH0E 2LXEA 5KQDA 2EJSA 2CP8A 2DZLA 2O01F 1OIZA 1VQ1A 3GLGA 4KHPM 4PD2A 1H6UA 4R7GA 4BBAA 2XLJA 2VF8A 2JY6B 5C18A 4BLCA 3SAVA 3U6QA 4LFCM 2D7HA 2FE8A 1ORYB 3SFZA 3I04M 2JP7A 2MH8A 1J5EM 1XB2B 4NL4H 3SARA 2KNZA 3JR5A 2ZTCA 3C3DA 1GL7A 1SXJD 3HU1A 1IN5A 3LW5F 1PGYA 4R71A 4NSOB 4DR6M 3J2PB 1NHGC 3UK6A 4DR1M 2HWJA 4P17A 1ZMWA 2OQ4A 1TGUA 2JY8A 1DGBA 1J09A 3C9PA 3HU3A 4NRVA 4CIZA 1TTEA 4MGZE 2J7NA 1IXZA 2YQZA 3E4RA 1T43A 5ITYA 1C1KA 1N33M 2M60A 1J7KA 4GKKM 2QNJA 5E6JA 3CF2A 4FW9A 4W5WA 1TDHA 3I4YA 3U6CA 1HR0M 2X49A 3UZUA 4DR2M 4M0WA 2HL7A 2O25A 4IBCA 1IBLM 4PDIA 3GLHE 3WHLA 5ITTA 2ZM6M 1E94E 1HJPA 1L2BA 3L29A 4GMQA 4DV6M 4LGMA 2V6ZM 2LNHC 4AW4A 3GRVA 3U5ZB 1GABA 1TR8A 1XNRM 2LTUA 3L27A 1G4AE 2RKOA 1NV8A 3ILKA 4JN6A 3THGA 2XSZD 3FTEA 4XK8F 4EIWA 3HJ8A 4S12A 1PRBA 3SAUA 4I8OA 2KNVA 4GH9A 2DAKA 4LRSA 1ZAEA 1G8PA 1E9RA 1KYIA 1G71A 3C3EA 4MGHA 4KLNA 2KRUA 3UJNA 3W0LB 2QSFX 4HLQA 3AFHA 1Q3CA 3KOYE 2VQEM 3AL0C 4G3OA 3UMMA 3PXGA 2UUAM 2CEAA 4DV2M 3NWLA 4G4NA 1SG9A 1TF0B 4X64M 3QWLA 1NNJA 5ITUA 4LF6M 1EIJA 5E26A 2I7PA 4Z6YA 1W5TA 2AHMA 2DENA 4QNMA 3SAWA 4JI7M 4B7FA 4MM3B 4AQYM 4AG5A 4K0KM 3BBZA 5FSWA 4DR4M 1JR3E 1IXRC
chains in the Genus database with same CATH topology
2MH8A 2JWSA 2J5YA 1PRBA 2KDLA 2LHGA 1GABA 2N35A 2FS1A 2VDBB 1TF0B 2LHCA 1GJSA 1GJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MH8 A;  2JWS A;  2J5Y A;  1PRB A;  2KDL A;  2LHG A;  1GAB A;  2N35 A;  2FS1 A;  2VDB B;  1TF0 B;  2LHC A;  1GJS A;  1GJT A; 
#chains in the Genus database with same CATH topology
 4G4O A;  3K92 A;  3DZD A;  2D7E A;  1DGH A;  4D81 A;  1V33 A;  5ITQ A;  4AKH A;  1IXS A;  2EKK A;  1IN8 A;  3CF6 E;  2DKL A;  2P5T A;  4GHL A;  1IBK M;  2LVO C;  2ZAM A;  5EXT A;  2MGW A;  2XF3 A;  3HY5 A;  2C5R A;  1QUT A;  2Y21 A;  2LHC A;  4LRT A;  5FTM A;  1DGF A;  3FTC A;  2ERC A;  3LQR A;  4IBG A;  3T15 A;  1OJL A;  2BJW A;  4CJ6 A;  4M9Z A;  4RF1 A;  3SYK A;  5KPZ A;  4B3S M;  1Q02 A;  2DAG A;  2LVP C;  1GKI A;  2CWB A;  5ITX A;  1C7Y A;  2FOI C;  4DBG B;  3SHF A;  2BWB A;  3EIE A;  1PM5 A;  4FD2 A;  1YLA A;  1XXH A;  1N75 A;  1K3W A;  5A2Q S;  2FNA A;  3KOZ E;  1NVM A;  2CRU A;  1MX0 A;  3HWS A;  3K9O A;  3FUX A;  3TPZ A;  4NXM M;  2L7H A;  2NQ8 C;  1WHC A;  3FUW A;  2K9D A;  2WZJ A;  2DNA A;  2R62 A;  4YY3 M;  2LH0 A;  5BPV A;  1TH4 A;  3M7G A;  5DYI A;  4PCZ A;  5L8R F;  1QQW A;  4Q7J A;  2DZN B;  4QOS A;  1PJQ A;  2MR9 A;  3Q8X A;  2J5Y A;  3QYB A;  2KHH A;  7CAT A;  2OPF A;  4FCT A;  4IBJ A;  2R6F A;  2FFJ A;  1XXH E;  2FS1 A;  2VII A;  4LJ5 A;  4JI3 M;  1YSY A;  2DWL A;  2XSZ A;  2R45 A;  4OW0 A;  1KFV A;  4L8R C;  4LF5 M;  3LQQ A;  2QZ4 A;  2DWZ B;  3GLF B;  2G3Q A;  2JY7 A;  3GLG E;  3U6D A;  2HKJ A;  1MU5 A;  2BJV A;  3I01 M;  3HX3 A;  2XH9 A;  1NY5 A;  4OVZ A;  3I4V A;  3FKE A;  4JI0 M;  1HT1 E;  3GQ3 A;  3QAU A;  2R4J A;  4DUY M;  2X8A A;  3K1J A;  3TWL A;  3VFD A;  1IN6 A;  1QDR A;  1ZQ9 A;  3W0F A;  2C9O A;  2WSC F;  3ZC7 B;  1WR1 B;  3GPY A;  1IY0 A;  4GEW A;  3U6S A;  1VG5 A;  2UU9 M;  4JI1 M;  1E32 A;  4IBI A;  2ZBK B;  3A98 B;  3D8L A;  3K2L A;  4L16 A;  5IRE B;  3GLI A;  1R6B X;  1X37 A;  3U6M A;  4B7H A;  3DFZ A;  2ZAN A;  4RKU F;  2DHR A;  3K8Z A;  3FUT A;  2EO2 A;  2QHO B;  2QPA A;  2K0B X;  5JI3 E;  2A5Y B;  3F92 A;  3PNV A;  3KP1 E;  1D0K A;  1NJF A;  4XGI A;  2F5P A;  1LV7 A;  1QUS A;  1IN4 A;  3FTD A;  1N78 A;  4GIT A;  2KW0 A;  5FTN A;  2UUC M;  4LJ4 A;  3BXW A;  4G4R A;  3MMP A;  4ANR A;  2CV2 A;  1NV9 A;  2Z7J A;  1G59 A;  3H4M A;  1PJJ A;  2V1C A;  4RF0 A;  1JR3 D;  2C98 A;  4JXJ A;  1NO1 A;  4Z8X A;  5LMN M;  1XXH B;  4JI4 M;  4QOZ C;  2LHG A;  3GQ5 A;  1K82 A;  2RGH A;  1L1T A;  3LVV A;  2C96 A;  3V76 A;  3GRY A;  3WHK A;  1D2N A;  1NJG A;  2B3T A;  1VEJ A;  3IEC A;  4D82 A;  4FCV A;  1QYR A;  3RGP A;  3T1Y M;  2C9C A;  3HJQ A;  3IG5 A;  3GLH B;  3CTW B;  2K47 A;  3ZCB B;  3DA1 A;  3HKP A;  2QEN A;  4B08 A;  2Z8Y M;  1TDZ A;  4LJ8 A;  3AOE A;  2LVQ D;  5IWA M;  3U6O A;  1FJG M;  1QZM A;  4DR7 M;  3L26 A;  3L2A A;  1HNW M;  4JV5 M;  2XEP A;  1HT2 E;  3FUU A;  4FVM A;  2JNH A;  3HJS A;  4IBB A;  1TH2 A;  2W82 A;  2BWE A;  4X62 M;  4LZZ A;  3GLF A;  3U60 B;  4RNA A;  1YE9 A;  5FLX S;  1WGN A;  2I7N A;  4IJE A;  2HCB A;  2JUJ A;  2Z4R A;  2R4E A;  3CGW A;  3HHW A;  3HHY A;  3KDS E;  3A46 A;  3C58 A;  1A5T A;  3MK6 A;  4LJ6 A;  2DHY A;  5EP2 A;  1VDL A;  3LVW A;  2DWM A;  1XNQ M;  2KDL A;  1XHB A;  3VK8 A;  4B3R M;  3LMM A;  1NHW C;  2F4V M;  5EJC A;  3L25 A;  2M5Z A;  3GLI B;  3GO8 A;  4LF8 M;  4LG2 A;  2VDB B;  1SXJ A;  4F1I A;  3NBX X;  5EP1 A;  5JI2 E;  1VDD A;  4MGY E;  2KEB A;  1R5L A;  4MGK E;  4MB7 A;  4F2L A;  4LF9 M;  1JB0 F;  2Y0Q A;  2VQF M;  3M0E A;  4IBE A;  1L1Z A;  1D0L A;  3KVW A;  4LFA M;  2CV0 A;  3SMS A;  3E21 A;  2KZS A;  3ZH9 B;  1NSF A;  5KO3 A;  1GJT A;  3VDU A;  1PJI A;  2R0I A;  3SC3 A;  3AJI B;  1CUK A;  2JA2 A;  3KSX A;  4TUW A;  3EIH A;  1Z59 A;  3B9P A;  4I4L A;  4KO8 A;  2JZ0 A;  2R18 A;  3Q8G A;  4FCW A;  3UGJ A;  2WSF F;  3GPX A;  2XZU A;  4LJ7 A;  3K9P A;  2YNM D;  4LCB A;  1F4I A;  2H5X A;  3B7N A;  3GLI E;  3HHZ A;  3W67 A;  2Q2E B;  4BB9 A;  3KSJ A;  2CE7 A;  1V34 A;  3GLH A;  4II7 A;  2KRK A;  4REZ A;  4DUZ M;  4AZF A;  1R7R A;  4IBF A;  2DAM A;  2N35 A;  4PT5 A;  4DV5 M;  3VKH A;  2QP9 X;  2XFS A;  5IT9 S;  2KZU A;  1VEK A;  4LJ9 A;  4JI2 M;  2L2D A;  2O5R A;  5GKN A;  5C1B A;  4WW0 A;  4M9X A;  2QCU A;  1UM8 A;  2QBY A;  1DGG A;  4XBO A;  1HQC A;  3FRH A;  4I81 A;  4LJA A;  1QZE A;  1HNZ M;  3J27 B;  3KFU G;  2DAE A;  3J7B A;  3U60 A;  1D0M A;  1S3S A;  2KNA A;  1SXJ E;  1WGL A;  4GKJ M;  3FD9 A;  4L15 A;  2APL A;  1WJ7 A;  2OOA A;  1Q3B A;  1QVR A;  3PFI A;  3VK7 A;  4A3V B;  1DGH B;  5DFL A;  4DV0 M;  4IBK A;  3J7A S;  1W5S A;  2R44 A;  1E9S A;  2RGO A;  2Y20 A;  4P16 A;  1AUA A;  1Z5C A;  4DV7 M;  3A45 A;  3AKZ A;  2V1U A;  3SHG B;  5EXS A;  1ZMV A;  1ZMU A;  3HZJ A;  5EQT A;  4CHT B;  4FWG A;  4JI8 M;  4D80 A;  3J80 S;  4LGY A;  4NSR A;  4B3T M;  3GRR A;  1YUB A;  1MN3 A;  1N32 M;  3KW6 A;  1EE8 A;  3U61 B;  4GIP A;  1EFU B;  5IZ7 D;  2F5Q A;  4AI6 A;  5EXX A;  3U6L A;  8CAT A;  2XZF A;  2F5S A;  2ZAO A;  3KOX E;  3IHP A;  4LY6 A;  4CGY B;  5KPT A;  1OTR A;  1HQY E;  2DI0 A;  4B3M M;  4G4Q A;  3SBJ A;  1OFI A;  3L28 A;  2L4F A;  4DV3 M;  4Y28 F;  4LF4 M;  4IBD A;  5ITR A;  1I94 M;  2RRU A;  4YHH M;  2J7O A;  3LCU A;  3GPP A;  2HHH M;  1IXS B;  3KS4 A;  1XWI A;  4KOD A;  2OOB A;  4FWD A;  1QAQ A;  1Y8G A;  3QYE A;  4NRW A;  2LVN C;  3RGS A;  2CHV A;  1Z6T A;  3B7Z A;  3R8F A;  4OX9 M;  2CV1 A;  4ZPX A;  3IG8 A;  3E9S A;  2L6O A;  2XFT A;  3PNY A;  1N77 A;  3TWK A;  3FTF A;  3HU2 A;  2UXC M;  2EKF A;  3DOA A;  3FYC A;  4QHT A;  3AOG A;  2YR0 A;  3GLG B;  1SXJ C;  2UXD M;  4IJF A;  3CF0 A;  4GHA A;  4GC5 A;  2X4A A;  3FRI A;  2QBY B;  2HAK A;  1L2C A;  4M0D A;  3JR4 A;  1XMO M;  2CFO A;  1QAN A;  4ITQ A;  3GP1 A;  4WP2 A;  5LMU M;  3BOS A;  1HNX M;  3TWM A;  3GPU A;  1OQY A;  3AOE C;  5BR8 M;  2LVA A;  4L6V 6;  4DR5 M;  2E5L M;  4JI5 M;  3A42 A;  3SMP A;  4NOO B;  3KXE C;  4AKG A;  4UN2 B;  1Z5A A;  1IFY A;  4FWH A;  2R46 A;  3MHV C;  2YFQ A;  5KQ8 A;  1N36 M;  2L7I A;  2G5G X;  3JAM S;  2H1R A;  1QAM A;  2FH0 A;  1LTM A;  2VF7 A;  5H37 D;  3T6P A;  5EP3 A;  1AIP C;  1G3I A;  1R4G A;  4M9S A;  4MGI E;  3U6E A;  4CIS A;  1IQP A;  1PJS A;  4DV4 M;  2CHQ A;  3PVS A;  1IBM M;  1OAI A;  3NBI A;  5F3W A;  3TQS A;  3LCV B;  3B89 A;  4DR3 M;  1T6O A;  2GNO A;  2LBC A;  4NC6 A;  5DYG A;  2UUB M;  3R9X B;  1IY2 A;  1OFH A;  1L8Q A;  4GRI A;  1WIV A;  1TH3 A;  1ZV1 A;  3B74 A;  4OVZ B;  4GC9 A;  3U61 A;  3FE3 A;  3HHX A;  3T38 A;  2JWS A;  2DXI A;  2JZ1 A;  4HL4 A;  5DNY A;  3FYD A;  2WSE F;  3I51 A;  2LWX A;  2KA6 B;  3HGI A;  1OKS A;  1IY1 A;  2DZO B;  1KSF X;  3B7Q A;  2MJ5 B;  4JI6 M;  5FTJ A;  4B7G A;  1RU3 A;  2Z4S A;  3AV0 A;  2EA0 A;  1XMQ M;  4LF7 M;  2DAI A;  3E46 A;  2KXE A;  3H4J A;  3GRU A;  1GJS A;  2C99 A;  2EUC A;  3SAT A;  1GO5 A;  3U6P A;  5EP4 A;  1K3X A;  1QAO A;  3TL4 X;  2Z3X A;  1NY6 A;  3M6A A;  1Q39 A;  4WUR A;  5KPR A;  2JY5 A;  3KOW E;  4R3D A;  2DWN A;  1Z5B A;  1GL6 A;  1BVS A;  2ZTD A;  4HEO A;  4KT0 F;  1P3Q Q;  1FNN A;  2OO9 A;  5FTL A;  1IM2 A;  3RE8 A;  3D8B A;  1G41 A;  3MJ5 A;  3ZQJ A;  3GLF E;  2D7G A;  2GQF A;  2XGN A;  5ITX E;  4L78 A;  4OU7 A;  1R2Y A;  2DVW B;  4PDG A;  4AKI A;  5EXP A;  5FTK A;  2JXN A;  2F5N A;  4NXN M;  4L4U A;  3FUV A;  1IN7 A;  2F5O A;  1T3T A;  1I4W A;  1MJG M;  3SAS A;  4DV1 M;  2BNK A;  4AG6 A;  4JYA M;  3U5Z A;  3TE6 A;  1PJT A;  3GQ4 A;  1DO0 A;  4QHS A;  2L4E A;  4G6Z A;  1R2Z A;  1V92 A;  1JR3 A;  1QDT A;  1GVN A;  3OTO M;  4LZJ A;  2K6B A;  4LFB M;  4X66 M;  1OIP A;  2CHG A;  4QNR A;  2Y0T A;  1OAO C;  1GLN A;  1SXJ B;  4I5S A;  3VDP A;  1DO2 A;  3J81 S;  1XC8 A;  3VKG A;  4X65 M;  3SYL A;  3KP0 E;  3RFW A;  1VEG A;  3W68 A;  2L09 A;  1NNU C;  1UFZ A;  1DV0 A;  2MRO B;  4IIW A;  2UXB M;  2CUZ A;  3VLF B;  1WXQ A;  3T1H M;  3KS8 A;  1N34 M;  2G8L A;  1L2D A;  1JQJ C;  2R65 A;  2QQ8 A;  4MH0 E;  2LXE A;  5KQD A;  2EJS A;  2CP8 A;  2DZL A;  2O01 F;  1OIZ A;  1VQ1 A;  3GLG A;  4KHP M;  4PD2 A;  1H6U A;  4R7G A;  4BBA A;  2XLJ A;  2VF8 A;  2JY6 B;  5C18 A;  4BLC A;  3SAV A;  3U6Q A;  4LFC M;  2D7H A;  2FE8 A;  1ORY B;  3SFZ A;  3I04 M;  2JP7 A;  2MH8 A;  1J5E M;  1XB2 B;  4NL4 H;  3SAR A;  2KNZ A;  3JR5 A;  2ZTC A;  3C3D A;  1GL7 A;  1SXJ D;  3HU1 A;  1IN5 A;  3LW5 F;  1PGY A;  4R71 A;  4NSO B;  4DR6 M;  3J2P B;  1NHG C;  3UK6 A;  4DR1 M;  2HWJ A;  4P17 A;  1ZMW A;  2OQ4 A;  1TGU A;  2JY8 A;  1DGB A;  1J09 A;  3C9P A;  3HU3 A;  4NRV A;  4CIZ A;  1TTE A;  4MGZ E;  2J7N A;  1IXZ A;  2YQZ A;  3E4R A;  1T43 A;  5ITY A;  1C1K A;  1N33 M;  2M60 A;  1J7K A;  4GKK M;  2QNJ A;  5E6J A;  3CF2 A;  4FW9 A;  4W5W A;  1TDH A;  3I4Y A;  3U6C A;  1HR0 M;  2X49 A;  3UZU A;  4DR2 M;  4M0W A;  2HL7 A;  2O25 A;  4IBC A;  1IBL M;  4PDI A;  3GLH E;  3WHL A;  5ITT A;  2ZM6 M;  1E94 E;  1HJP A;  1L2B A;  3L29 A;  4GMQ A;  4DV6 M;  4LGM A;  2V6Z M;  2LNH C;  4AW4 A;  3GRV A;  3U5Z B;  1GAB A;  1TR8 A;  1XNR M;  2LTU A;  3L27 A;  1G4A E;  2RKO A;  1NV8 A;  3ILK A;  4JN6 A;  3THG A;  2XSZ D;  3FTE A;  4XK8 F;  4EIW A;  3HJ8 A;  4S12 A;  1PRB A;  3SAU A;  4I8O A;  2KNV A;  4GH9 A;  2DAK A;  4LRS A;  1ZAE A;  1G8P A;  1E9R A;  1KYI A;  1G71 A;  3C3E A;  4MGH A;  4KLN A;  2KRU A;  3UJN A;  3W0L B;  2QSF X;  4HLQ A;  3AFH A;  1Q3C A;  3KOY E;  2VQE M;  3AL0 C;  4G3O A;  3UMM A;  3PXG A;  2UUA M;  2CEA A;  4DV2 M;  3NWL A;  4G4N A;  1SG9 A;  1TF0 B;  4X64 M;  3QWL A;  1NNJ A;  5ITU A;  4LF6 M;  1EIJ A;  5E26 A;  2I7P A;  4Z6Y A;  1W5T A;  2AHM A;  2DEN A;  4QNM A;  3SAW A;  4JI7 M;  4B7F A;  4MM3 B;  4AQY M;  4AG5 A;  4K0K M;  3BBZ A;  5FSW A;  4DR4 M;  1JR3 E;  1IXR C; 
#chains in the Genus database with same CATH homology
 2MH8 A;  2JWS A;  2J5Y A;  1PRB A;  2KDL A;  2LHG A;  1GAB A;  2N35 A;  2FS1 A;  2VDB B;  1TF0 B;  2LHC A;  1GJS A;  1GJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...