2FS1A

Solution structure of psd-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
b'MEAVDANSLAQAKEAAIKELKQYGIGDYYIKLINNAKTVEGVESLKNEILKALPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSD-1
publication title Structure, dynamics, and stability variation in bacterial albumin binding modules: implications for species specificity.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328, streptococcus dysgalactiae, streptococcus equi, str
molecule tags Protein binding
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2fs1A00
2JWSA 2VDBB 2J5YA 1GJTA 1GJSA 2MH8A 1TF0B 2FS1A 1GABA 2N35A 1PRBA 2KDLA 2LHCA 2LHGA
chains in the Genus database with same CATH superfamily
4REZA 3FRIA 1SXJB 5C18A 3BOSA 3GP1A 3JR4A 3A46A 1OFHA 5KPTA 4LF8M 4LF9M 2J7NA 4GHAA 2FE8A 3B7QA 2YR0A 5ITUA 3HJQA 3KFUG 1DGFA 3KP1E 3W67A 4DV7M 1G8PA 4RF0A 5E6JA 4LZJA 2OPFA 3U6LA 2DVWB 1XXHB 3KVWA 2DAKA 3VK8A 1IN7A 1QANA 2KRKA 1T43A 2Q2EB 3QYBA 2KZUA 3U6CA 3FTEA 5EJCA 2G3QA 4LGYA 3OTOM 4G6ZA 3W0LB 3GLFA 2W82A 5EP2A 2UUBM 2XEPA 1N36M 2YFQA 2ZANA 2LHGA 4GC5A 1R2ZA 1VQ1A 2BNKA 1IXZA 3U6OA 3AJIB 2RGHA 3SC3A 4D80A 2LBCA 2G8LA 4L78A 1JR3A 1JB0F 3PXGA 4PDIA 3GLGA 4OVZA 4GRIA 5DFLA 4GEWA 5EXXA 2BJVA 3J81S 2DZOB 2LVAA 5FTMA 4DR2M 4L8RC 2CHVA 1Q39A 2VIIA 1V33A 2Y0QA 2N35A 4PDGA 1BVSA 1S3SA 2BWEA 3IG8A 2X8AA 3KOYE 3VFDA 2CV1A 1NHWC 3UZUA 4G4OA 1QDTA 2UU9M 3A98B 5FTJA 1SXJA 1ORYB 4QHTA 5LMNM 5FTLA 4LJ4A 4QNRA 4QOZC 4DV0M 3ZC7B 1R5LA 2DAEA 2DAIA 2VF8A 3FKEA 4KLNA 5FTNA 4EIWA 5KQDA 1EE8A 1XHBA 3JR5A 1HNWM 1Q3CA 3SHGB 3KSJA 1Q02A 2D7EA 3K9OA 2EKKA 3E21A 4LZZA 3SAWA 1L1TA 1H6UA 1XXHA 2BJWA 3U6QA 3GPYA 1PM5A 1PJQA 4NXNM 2KZSA 5ITXE 1AUAA 2RKOA 1Z6TA 2C98A 3C58A 2CUZA 1XNRM 3L2AA 1IY2A 3AOEC 2C9CA 1OQYA 4MGHA 1OFIA 4DR6M 1VEJA 3U5ZB 2V1CA 4L16A 4GKJM 4AZFA 4DR7M 2DHRA 4LRTA 4NSOB 3JAMS 3SBJA 2R45A 4LF6M 1XMOM 1X37A 4DV2M 4DV5M 2JXNA 4MGYE 3LVVA 3B74A 1NO1A 1DV0A 2DAMA 2LVPC 1HJPA 3IHPA 2A5YB 4Z6YA 1AIPC 3AOGA 1L2BA 4FCWA 3B7NA 3KP0E 5L8RF 4JI3M 3M6AA 2EA0A 1L2CA 3A45A 4R71A 3BXWA 2F5NA 3SYKA 2P5TA 5LMUM 4KODA 3D8LA 1TDZA 2Y21A 4BB9A 2UXCM 1MX0A 1TH3A 2KNZA 4NC6A 4HL4A 4ZPXA 2H5XA 3GO8A 1I94M 3FUUA 3J27B 3HU1A 2RGOA 4DV4M 4DR4M 3M0EA 1C7YA 4NRVA 2XZFA 1DO2A 4FCTA 3J7AS 5E26A 3HGIA 1E94E 1VG5A 1Z59A 4MGIE 4NL4H 1IN4A 1QQWA 2ZAOA 3GPUA 3T38A 2O01F 4WURA 3FUXA 1HNZM 1JR3D 4KO8A 1L8QA 4LY6A 1J5EM 1JQJC 1GO5A 4GITA 4UN2B 1VEKA 1T3TA 4BBAA 2DZNB 3U6EA 2FNAA 2R6FA 3I04M 1J09A 3HY5A 4HLQA 4M9XA 5EQTA 2NQ8C 2UXBM 2F5OA 1HQCA 3DFZA 1IQPA 3M7GA 2BWBA 3I4VA 4QHSA 2GQFA 7CATA 1K3XA 4L4UA 2F5SA 1NY5A 4JI8M 2XSZA 1SXJD 3GRRA 1VDDA 4TUWA 3T1YM 3AV0A 4IBFA 1MJGM 3DZDA 1EFUB 1PGYA 3R9XB 1VEGA 1XMQM 1OIPA 1NHGC 3GLIE 2JZ1A 2DENA 5KO3A 2C5RA 3LMMA 2CE7A 3L28A 2L2DA 4M9ZA 3J80S 2JY8A 3RGSA 2HKJA 3H4JA 3LCUA 4JI2M 4I5SA 3GQ5A 1D2NA 3PFIA 2RRUA 1NNJA 1V34A 4XBOA 1DGBA 1DGHB 1WXQA 3KS4A 3SAVA 4LGMA 2MGWA 3K1JA 1K3WA 2R18A 3DA1A 1FNNA 1TH2A 2CP8A 1HT1E 4IBJA 4WW0A 3LQQA 3FYDA 3TQSA 4LF4M 2JZ0A 3GLHE 2Z7JA 1GVNA 3SAUA 3VK7A 1C1KA 2L09A 1N32M 4P17A 5ITTA 2K9DA 2MJ5B 1CUKA 1OAIA 4IBKA 5EXTA 2C96A 4DR3M 1GLNA 3T1HM 1R2YA 4I4LA 2JA2A 3FTFA 4LJ5A 3RE8A 1D0LA 2LNHC 3B7ZA 3KXEC 5EXSA 3U60A 2DWNA 1QZMA 2L7HA 4FW9A 2LVNC 2WSFF 3TWMA 2DXIA 4I81A 4KHPM 3RGPA 2VQFM 1T6OA 5KQ8A 2UXDM 2Z4SA 4MH0E 3AFHA 3FD9A 4B08A 4R3DA 5IREB 5JI3E 3E4RA 1Z5CA 2YNMD 2I7NA 2VF7A 4ANRA 4LFBM 4GMQA 4IBDA 2KHHA 2ZTCA 3ZCBB 1G4AE 1OAOC 1Q3BA 4CGYB 2XFSA 4AKIA 1WIVA 2MR9A 2QENA 4L6V6 2Y20A 3LW5F 3MHVC 1PJTA 1R4GA 1YE9A 2OOBA 2EJSA 2XLJA 4AI6A 1PRBA 2QHOB 1IBKM 2LTUA 2M60A 3L29A 4AKHA 1DGHA 1ZMWA 3NWLA 2XH9A 3ILKA 2ZTDA 3C3EA 3KSXA 2VQEM 4JN6A 2KA6B 3EIHA 1IM2A 2VDBB 2F5QA 1OIZA 4LJ9A 3HHZA 4GHLA 3K2LA 4X66M 4AW4A 1N77A 2MH8A 3EIEA 2E5LM 3IG5A 3W0FA 4DUYM 2LHCA 2ERCA 2EUCA 2R65A 4JI5M 4OX9M 3HWSA 4JXJA 4IBIA 4DV6M 4B7GA 4B3RM 2X49A 2JP7A 1QUSA 3QWLA 4M0DA 3TL4X 3TWKA 4LF5M 4K0KM 4DR1M 1RU3A 2CV2A 1IXRC 2R4JA 2HL7A 2QSFX 4IJEA 3GRVA 1TDHA 2QQ8A 3KOWE 1OKSA 3C3DA 3QAUA 2FFJA 2JWSA 2XZUA 1N78A 4XGIA 2XSZD 3HU3A 3FUTA 4CISA 1GL6A 1QVRA 3KS8A 4IBGA 2JUJA 1WR1B 3VDUA 2F5PA 3H4MA 1YUBA 3K9PA 2D7GA 2KXEA 3HX3A 1GJTA 2L7IA 1E9SA 1IN8A 1J7KA 2OO9A 3C9PA 4B7HA 4CJ6A 1TH4A 3CF0A 2UUCM 2YQZA 2ZBKB 3U61B 4LCBA 3D8BA 2DZLA 4DV3M 2L4FA 3THGA 3FUWA 3GPPA 4DBGB 1HR0M 1N34M 3E46A 5ITXA 1TR8A 1QDRA 2KNAA 2WSEF 3PNVA 2R62A 4II7A 3DOAA 4IBEA 3NBIA 4Y28F 3LVWA 4S12A 3I4YA 2WZJA 5ITYA 1MN3A 3FRHA 4PD2A 3AKZA 4BLCA 2OOAA 4M0WA 4D81A 2O5RA 3J7BA 2DWZB 2K0BX 2WSCF 5EP3A 1E9RA 3R8FA 4JI6M 2QCUA 4G4NA 3WHKA 1OTRA 1PJSA 1KSFX 3L26A 3SMPA 4KT0F 1XB2B 3UMMA 2R44A 4OW0A 5A2QS 2CFOA 3U60B 4JI4M 4GH9A 4OU7A 2D7HA 1SXJC 2L4EA 2XFTA 3K8ZA 1LTMA 3HJ8A 2QZ4A 3VKGA 4MM3B 5FTKA 3VDPA 3GRUA 2DWMA 1XNQM 1GL7A 2FOIC 1ZMVA 4IIWA 5DYIA 3T6PA 3GLFE 4JYAM 2ZM6M 3NBXX 4DV1M 3PVSA 3VKHA 1WGLA 4M9SA 3HZJA 2CEAA 3GLIB 1IXSB 3ZH9B 2O25A 4X62M 4AG6A 3A42A 1IN6A 2DHYA 4G4QA 3U61A 1NJGA 2EO2A 3AOEA 3T15A 3GLGE 4LG2A 5ITRA 2LH0A 3TWLA 2F4VM 2OQ4A 1HT2E 4B3TM 5KPRA 2J5YA 4PT5A 3KOZE 4LJ7A 4CHTB 3MK6A 4FCVA 1YSYA 2ZAMA 3SYLA 4B7FA 3GLHB 2LWXA 1SXJE 4RKUF 4Z8XA 3SARA 2JY5A 1G3IA 1W5TA 2J7OA 4D82A 2Y0TA 1G59A 1IBLM 1NNUC 2CHGA 4F2LA 2B3TA 4R7GA 4PCZA 5FLXS 1YLAA 3B89A 4HEOA 4YHHM 2LXEA 2EKFA 1WHCA 1XXHE 5GKNA 2Z3XA 2DKLA 2KRUA 1DO0A 1NV9A 3FTDA 2C9OA 3CF2A 2HCBA 4GC9A 2KNVA 4G3OA 1IFYA 5BR8M 4W5WA 3SMSA 3MMPA 3HKPA 3WHLA 4X65M 1IY0A 2DAGA 1HQYE 3GLIA 2G5GX 1PJJA 3L25A 1IXSA 1N33M 3HU2A 5EP1A 3FYCA 1EIJA 1DGGA 1ZAEA 4LF7M 3KOXE 2M5ZA 2R0IA 2K47A 4IBCA 1I4WA 3KW6A 1NVMA 3Q8XA 1KFVA 2V1UA 4DUZM 4NOOB 1P3QQ 1G71A 2JNHA 3E9SA 3W68A 2CRUA 2JY7A 3FTCA 3TE6A 8CATA 1A5TA 1L1ZA 4NSRA 1F4IA 4MB7A 4I8OA 4GIPA 3CTWB 3HHWA 3GLHA 3IECA 3I01M 4NRWA 1NV8A 1ZQ9A 5F3WA 2DWLA 3HJSA 4MGKE 1GKIA 5H37D 1FJGM 1IY1A 1NSFA 3U6PA 2H1RA 3SATA 4JI7M 3TPZA 1HNXM 3FE3A 4G4RA 1QAOA 3LCVB 2I7PA 1G41A 3Q8GA 3UJNA 4X64M 2XGNA 3GRYA 1D0MA 4FWGA 4QOSA 3LQRA 1TGUA 4AQYM 5JI2E 1K82A 2AHMA 1R6BX 1UFZA 1Z5AA 2DI0A 4A3VB 3GQ3A 1XC8A 2QBYB 2CV0A 5IZ7D 3I51A 2LVQD 4F1IA 4JI1M 1Z5BA 2HAKA 1KYIA 1NY6A 2Z4RA 3HHXA 4LJAA 5EP4A 4FWDA 2UUAM 4WP2A 4DR5M 1GJSA 2HWJA 2QNJA 1VDLA 2DNAA 3U6DA 1QZEA 1IN5A 1Y8GA 1ZMUA 1ZV1A 4FVMA 3SFZA 3RFWA 4AKGA 2C99A 2FS1A 2R46A 2KDLA 2HHHM 4LFAM 1E32A 4XK8F 3MJ5A 3B9PA 1N75A 2XF3A 3L27A 4MGZE 2CWBA 5IT9S 1WJ7A 4QNMA 3U6SA 4LJ8A 4NXMM 3VLFB 4RF1A 1L2DA 3GPXA 2L6OA 4LJ6A 3CF6E 4FWHA 4IJFA 4L15A 4CIZA 1QUTA 3FUVA 4Q7JA 4IBBA 3CGWA 1TTEA 3J2PB 1XWIA 2V6ZM 5KPZA 1WGNA 2JY6B 3HHYA 4P16A 3PNYA 3GQ4A 1SG9A 1QAQA 5FSWA 4YY3M 5DNYA 2GNOA 4RNAA 1QYRA 2R4EA 3SHFA 4ITQA 2MROB 1D0KA 2APLA 4LFCM 2LVOC 1OJLA 2QBYA 3GLFB 3AL0C 4GKKM 1PJIA 1W5SA 5BPVA 3ZQJA 2Z8YM 1QAMA 5IWAM 3U5ZA 2FH0A 5C1BA 3SASA 2QPAA 1UM8A 5EXPA 3U6MA 5ITQA 2KW0A 3V76A 2QP9X 4FD2A 1NJFA 1LV7A 3BBZA 4LRSA 4B3MM 3GLGB 2KEBA 3QYEA 1JR3E 1V92A 3F92A 4OVZB 4AG5A 4B3SM 3K92A 4JI0M 5DYGA 1IBMM 2X4AA 4JV5M 3UK6A 1TF0B 2K6BA 1MU5A 3KDSE 3UGJA 1GABA 2CHQA 1R7RA
chains in the Genus database with same CATH topology
2JWSA 2VDBB 2J5YA 1GJTA 1GJSA 2MH8A 1TF0B 2FS1A 1GABA 2N35A 1PRBA 2KDLA 2LHCA 2LHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWS A;  2VDB B;  2J5Y A;  1GJT A;  1GJS A;  2MH8 A;  1TF0 B;  2FS1 A;  1GAB A;  2N35 A;  1PRB A;  2KDL A;  2LHC A;  2LHG A; 
#chains in the Genus database with same CATH topology
 4REZ A;  3FRI A;  1SXJ B;  5C18 A;  3BOS A;  3GP1 A;  3JR4 A;  3A46 A;  1OFH A;  5KPT A;  4LF8 M;  4LF9 M;  2J7N A;  4GHA A;  2FE8 A;  3B7Q A;  2YR0 A;  5ITU A;  3HJQ A;  3KFU G;  1DGF A;  3KP1 E;  3W67 A;  4DV7 M;  1G8P A;  4RF0 A;  5E6J A;  4LZJ A;  2OPF A;  3U6L A;  2DVW B;  1XXH B;  3KVW A;  2DAK A;  3VK8 A;  1IN7 A;  1QAN A;  2KRK A;  1T43 A;  2Q2E B;  3QYB A;  2KZU A;  3U6C A;  3FTE A;  5EJC A;  2G3Q A;  4LGY A;  3OTO M;  4G6Z A;  3W0L B;  3GLF A;  2W82 A;  5EP2 A;  2UUB M;  2XEP A;  1N36 M;  2YFQ A;  2ZAN A;  2LHG A;  4GC5 A;  1R2Z A;  1VQ1 A;  2BNK A;  1IXZ A;  3U6O A;  3AJI B;  2RGH A;  3SC3 A;  4D80 A;  2LBC A;  2G8L A;  4L78 A;  1JR3 A;  1JB0 F;  3PXG A;  4PDI A;  3GLG A;  4OVZ A;  4GRI A;  5DFL A;  4GEW A;  5EXX A;  2BJV A;  3J81 S;  2DZO B;  2LVA A;  5FTM A;  4DR2 M;  4L8R C;  2CHV A;  1Q39 A;  2VII A;  1V33 A;  2Y0Q A;  2N35 A;  4PDG A;  1BVS A;  1S3S A;  2BWE A;  3IG8 A;  2X8A A;  3KOY E;  3VFD A;  2CV1 A;  1NHW C;  3UZU A;  4G4O A;  1QDT A;  2UU9 M;  3A98 B;  5FTJ A;  1SXJ A;  1ORY B;  4QHT A;  5LMN M;  5FTL A;  4LJ4 A;  4QNR A;  4QOZ C;  4DV0 M;  3ZC7 B;  1R5L A;  2DAE A;  2DAI A;  2VF8 A;  3FKE A;  4KLN A;  5FTN A;  4EIW A;  5KQD A;  1EE8 A;  1XHB A;  3JR5 A;  1HNW M;  1Q3C A;  3SHG B;  3KSJ A;  1Q02 A;  2D7E A;  3K9O A;  2EKK A;  3E21 A;  4LZZ A;  3SAW A;  1L1T A;  1H6U A;  1XXH A;  2BJW A;  3U6Q A;  3GPY A;  1PM5 A;  1PJQ A;  4NXN M;  2KZS A;  5ITX E;  1AUA A;  2RKO A;  1Z6T A;  2C98 A;  3C58 A;  2CUZ A;  1XNR M;  3L2A A;  1IY2 A;  3AOE C;  2C9C A;  1OQY A;  4MGH A;  1OFI A;  4DR6 M;  1VEJ A;  3U5Z B;  2V1C A;  4L16 A;  4GKJ M;  4AZF A;  4DR7 M;  2DHR A;  4LRT A;  4NSO B;  3JAM S;  3SBJ A;  2R45 A;  4LF6 M;  1XMO M;  1X37 A;  4DV2 M;  4DV5 M;  2JXN A;  4MGY E;  3LVV A;  3B74 A;  1NO1 A;  1DV0 A;  2DAM A;  2LVP C;  1HJP A;  3IHP A;  2A5Y B;  4Z6Y A;  1AIP C;  3AOG A;  1L2B A;  4FCW A;  3B7N A;  3KP0 E;  5L8R F;  4JI3 M;  3M6A A;  2EA0 A;  1L2C A;  3A45 A;  4R71 A;  3BXW A;  2F5N A;  3SYK A;  2P5T A;  5LMU M;  4KOD A;  3D8L A;  1TDZ A;  2Y21 A;  4BB9 A;  2UXC M;  1MX0 A;  1TH3 A;  2KNZ A;  4NC6 A;  4HL4 A;  4ZPX A;  2H5X A;  3GO8 A;  1I94 M;  3FUU A;  3J27 B;  3HU1 A;  2RGO A;  4DV4 M;  4DR4 M;  3M0E A;  1C7Y A;  4NRV A;  2XZF A;  1DO2 A;  4FCT A;  3J7A S;  5E26 A;  3HGI A;  1E94 E;  1VG5 A;  1Z59 A;  4MGI E;  4NL4 H;  1IN4 A;  1QQW A;  2ZAO A;  3GPU A;  3T38 A;  2O01 F;  4WUR A;  3FUX A;  1HNZ M;  1JR3 D;  4KO8 A;  1L8Q A;  4LY6 A;  1J5E M;  1JQJ C;  1GO5 A;  4GIT A;  4UN2 B;  1VEK A;  1T3T A;  4BBA A;  2DZN B;  3U6E A;  2FNA A;  2R6F A;  3I04 M;  1J09 A;  3HY5 A;  4HLQ A;  4M9X A;  5EQT A;  2NQ8 C;  2UXB M;  2F5O A;  1HQC A;  3DFZ A;  1IQP A;  3M7G A;  2BWB A;  3I4V A;  4QHS A;  2GQF A;  7CAT A;  1K3X A;  4L4U A;  2F5S A;  1NY5 A;  4JI8 M;  2XSZ A;  1SXJ D;  3GRR A;  1VDD A;  4TUW A;  3T1Y M;  3AV0 A;  4IBF A;  1MJG M;  3DZD A;  1EFU B;  1PGY A;  3R9X B;  1VEG A;  1XMQ M;  1OIP A;  1NHG C;  3GLI E;  2JZ1 A;  2DEN A;  5KO3 A;  2C5R A;  3LMM A;  2CE7 A;  3L28 A;  2L2D A;  4M9Z A;  3J80 S;  2JY8 A;  3RGS A;  2HKJ A;  3H4J A;  3LCU A;  4JI2 M;  4I5S A;  3GQ5 A;  1D2N A;  3PFI A;  2RRU A;  1NNJ A;  1V34 A;  4XBO A;  1DGB A;  1DGH B;  1WXQ A;  3KS4 A;  3SAV A;  4LGM A;  2MGW A;  3K1J A;  1K3W A;  2R18 A;  3DA1 A;  1FNN A;  1TH2 A;  2CP8 A;  1HT1 E;  4IBJ A;  4WW0 A;  3LQQ A;  3FYD A;  3TQS A;  4LF4 M;  2JZ0 A;  3GLH E;  2Z7J A;  1GVN A;  3SAU A;  3VK7 A;  1C1K A;  2L09 A;  1N32 M;  4P17 A;  5ITT A;  2K9D A;  2MJ5 B;  1CUK A;  1OAI A;  4IBK A;  5EXT A;  2C96 A;  4DR3 M;  1GLN A;  3T1H M;  1R2Y A;  4I4L A;  2JA2 A;  3FTF A;  4LJ5 A;  3RE8 A;  1D0L A;  2LNH C;  3B7Z A;  3KXE C;  5EXS A;  3U60 A;  2DWN A;  1QZM A;  2L7H A;  4FW9 A;  2LVN C;  2WSF F;  3TWM A;  2DXI A;  4I81 A;  4KHP M;  3RGP A;  2VQF M;  1T6O A;  5KQ8 A;  2UXD M;  2Z4S A;  4MH0 E;  3AFH A;  3FD9 A;  4B08 A;  4R3D A;  5IRE B;  5JI3 E;  3E4R A;  1Z5C A;  2YNM D;  2I7N A;  2VF7 A;  4ANR A;  4LFB M;  4GMQ A;  4IBD A;  2KHH A;  2ZTC A;  3ZCB B;  1G4A E;  1OAO C;  1Q3B A;  4CGY B;  2XFS A;  4AKI A;  1WIV A;  2MR9 A;  2QEN A;  4L6V 6;  2Y20 A;  3LW5 F;  3MHV C;  1PJT A;  1R4G A;  1YE9 A;  2OOB A;  2EJS A;  2XLJ A;  4AI6 A;  1PRB A;  2QHO B;  1IBK M;  2LTU A;  2M60 A;  3L29 A;  4AKH A;  1DGH A;  1ZMW A;  3NWL A;  2XH9 A;  3ILK A;  2ZTD A;  3C3E A;  3KSX A;  2VQE M;  4JN6 A;  2KA6 B;  3EIH A;  1IM2 A;  2VDB B;  2F5Q A;  1OIZ A;  4LJ9 A;  3HHZ A;  4GHL A;  3K2L A;  4X66 M;  4AW4 A;  1N77 A;  2MH8 A;  3EIE A;  2E5L M;  3IG5 A;  3W0F A;  4DUY M;  2LHC A;  2ERC A;  2EUC A;  2R65 A;  4JI5 M;  4OX9 M;  3HWS A;  4JXJ A;  4IBI A;  4DV6 M;  4B7G A;  4B3R M;  2X49 A;  2JP7 A;  1QUS A;  3QWL A;  4M0D A;  3TL4 X;  3TWK A;  4LF5 M;  4K0K M;  4DR1 M;  1RU3 A;  2CV2 A;  1IXR C;  2R4J A;  2HL7 A;  2QSF X;  4IJE A;  3GRV A;  1TDH A;  2QQ8 A;  3KOW E;  1OKS A;  3C3D A;  3QAU A;  2FFJ A;  2JWS A;  2XZU A;  1N78 A;  4XGI A;  2XSZ D;  3HU3 A;  3FUT A;  4CIS A;  1GL6 A;  1QVR A;  3KS8 A;  4IBG A;  2JUJ A;  1WR1 B;  3VDU A;  2F5P A;  3H4M A;  1YUB A;  3K9P A;  2D7G A;  2KXE A;  3HX3 A;  1GJT A;  2L7I A;  1E9S A;  1IN8 A;  1J7K A;  2OO9 A;  3C9P A;  4B7H A;  4CJ6 A;  1TH4 A;  3CF0 A;  2UUC M;  2YQZ A;  2ZBK B;  3U61 B;  4LCB A;  3D8B A;  2DZL A;  4DV3 M;  2L4F A;  3THG A;  3FUW A;  3GPP A;  4DBG B;  1HR0 M;  1N34 M;  3E46 A;  5ITX A;  1TR8 A;  1QDR A;  2KNA A;  2WSE F;  3PNV A;  2R62 A;  4II7 A;  3DOA A;  4IBE A;  3NBI A;  4Y28 F;  3LVW A;  4S12 A;  3I4Y A;  2WZJ A;  5ITY A;  1MN3 A;  3FRH A;  4PD2 A;  3AKZ A;  4BLC A;  2OOA A;  4M0W A;  4D81 A;  2O5R A;  3J7B A;  2DWZ B;  2K0B X;  2WSC F;  5EP3 A;  1E9R A;  3R8F A;  4JI6 M;  2QCU A;  4G4N A;  3WHK A;  1OTR A;  1PJS A;  1KSF X;  3L26 A;  3SMP A;  4KT0 F;  1XB2 B;  3UMM A;  2R44 A;  4OW0 A;  5A2Q S;  2CFO A;  3U60 B;  4JI4 M;  4GH9 A;  4OU7 A;  2D7H A;  1SXJ C;  2L4E A;  2XFT A;  3K8Z A;  1LTM A;  3HJ8 A;  2QZ4 A;  3VKG A;  4MM3 B;  5FTK A;  3VDP A;  3GRU A;  2DWM A;  1XNQ M;  1GL7 A;  2FOI C;  1ZMV A;  4IIW A;  5DYI A;  3T6P A;  3GLF E;  4JYA M;  2ZM6 M;  3NBX X;  4DV1 M;  3PVS A;  3VKH A;  1WGL A;  4M9S A;  3HZJ A;  2CEA A;  3GLI B;  1IXS B;  3ZH9 B;  2O25 A;  4X62 M;  4AG6 A;  3A42 A;  1IN6 A;  2DHY A;  4G4Q A;  3U61 A;  1NJG A;  2EO2 A;  3AOE A;  3T15 A;  3GLG E;  4LG2 A;  5ITR A;  2LH0 A;  3TWL A;  2F4V M;  2OQ4 A;  1HT2 E;  4B3T M;  5KPR A;  2J5Y A;  4PT5 A;  3KOZ E;  4LJ7 A;  4CHT B;  3MK6 A;  4FCV A;  1YSY A;  2ZAM A;  3SYL A;  4B7F A;  3GLH B;  2LWX A;  1SXJ E;  4RKU F;  4Z8X A;  3SAR A;  2JY5 A;  1G3I A;  1W5T A;  2J7O A;  4D82 A;  2Y0T A;  1G59 A;  1IBL M;  1NNU C;  2CHG A;  4F2L A;  2B3T A;  4R7G A;  4PCZ A;  5FLX S;  1YLA A;  3B89 A;  4HEO A;  4YHH M;  2LXE A;  2EKF A;  1WHC A;  1XXH E;  5GKN A;  2Z3X A;  2DKL A;  2KRU A;  1DO0 A;  1NV9 A;  3FTD A;  2C9O A;  3CF2 A;  2HCB A;  4GC9 A;  2KNV A;  4G3O A;  1IFY A;  5BR8 M;  4W5W A;  3SMS A;  3MMP A;  3HKP A;  3WHL A;  4X65 M;  1IY0 A;  2DAG A;  1HQY E;  3GLI A;  2G5G X;  1PJJ A;  3L25 A;  1IXS A;  1N33 M;  3HU2 A;  5EP1 A;  3FYC A;  1EIJ A;  1DGG A;  1ZAE A;  4LF7 M;  3KOX E;  2M5Z A;  2R0I A;  2K47 A;  4IBC A;  1I4W A;  3KW6 A;  1NVM A;  3Q8X A;  1KFV A;  2V1U A;  4DUZ M;  4NOO B;  1P3Q Q;  1G71 A;  2JNH A;  3E9S A;  3W68 A;  2CRU A;  2JY7 A;  3FTC A;  3TE6 A;  8CAT A;  1A5T A;  1L1Z A;  4NSR A;  1F4I A;  4MB7 A;  4I8O A;  4GIP A;  3CTW B;  3HHW A;  3GLH A;  3IEC A;  3I01 M;  4NRW A;  1NV8 A;  1ZQ9 A;  5F3W A;  2DWL A;  3HJS A;  4MGK E;  1GKI A;  5H37 D;  1FJG M;  1IY1 A;  1NSF A;  3U6P A;  2H1R A;  3SAT A;  4JI7 M;  3TPZ A;  1HNX M;  3FE3 A;  4G4R A;  1QAO A;  3LCV B;  2I7P A;  1G41 A;  3Q8G A;  3UJN A;  4X64 M;  2XGN A;  3GRY A;  1D0M A;  4FWG A;  4QOS A;  3LQR A;  1TGU A;  4AQY M;  5JI2 E;  1K82 A;  2AHM A;  1R6B X;  1UFZ A;  1Z5A A;  2DI0 A;  4A3V B;  3GQ3 A;  1XC8 A;  2QBY B;  2CV0 A;  5IZ7 D;  3I51 A;  2LVQ D;  4F1I A;  4JI1 M;  1Z5B A;  2HAK A;  1KYI A;  1NY6 A;  2Z4R A;  3HHX A;  4LJA A;  5EP4 A;  4FWD A;  2UUA M;  4WP2 A;  4DR5 M;  1GJS A;  2HWJ A;  2QNJ A;  1VDL A;  2DNA A;  3U6D A;  1QZE A;  1IN5 A;  1Y8G A;  1ZMU A;  1ZV1 A;  4FVM A;  3SFZ A;  3RFW A;  4AKG A;  2C99 A;  2FS1 A;  2R46 A;  2KDL A;  2HHH M;  4LFA M;  1E32 A;  4XK8 F;  3MJ5 A;  3B9P A;  1N75 A;  2XF3 A;  3L27 A;  4MGZ E;  2CWB A;  5IT9 S;  1WJ7 A;  4QNM A;  3U6S A;  4LJ8 A;  4NXM M;  3VLF B;  4RF1 A;  1L2D A;  3GPX A;  2L6O A;  4LJ6 A;  3CF6 E;  4FWH A;  4IJF A;  4L15 A;  4CIZ A;  1QUT A;  3FUV A;  4Q7J A;  4IBB A;  3CGW A;  1TTE A;  3J2P B;  1XWI A;  2V6Z M;  5KPZ A;  1WGN A;  2JY6 B;  3HHY A;  4P16 A;  3PNY A;  3GQ4 A;  1SG9 A;  1QAQ A;  5FSW A;  4YY3 M;  5DNY A;  2GNO A;  4RNA A;  1QYR A;  2R4E A;  3SHF A;  4ITQ A;  2MRO B;  1D0K A;  2APL A;  4LFC M;  2LVO C;  1OJL A;  2QBY A;  3GLF B;  3AL0 C;  4GKK M;  1PJI A;  1W5S A;  5BPV A;  3ZQJ A;  2Z8Y M;  1QAM A;  5IWA M;  3U5Z A;  2FH0 A;  5C1B A;  3SAS A;  2QPA A;  1UM8 A;  5EXP A;  3U6M A;  5ITQ A;  2KW0 A;  3V76 A;  2QP9 X;  4FD2 A;  1NJF A;  1LV7 A;  3BBZ A;  4LRS A;  4B3M M;  3GLG B;  2KEB A;  3QYE A;  1JR3 E;  1V92 A;  3F92 A;  4OVZ B;  4AG5 A;  4B3S M;  3K92 A;  4JI0 M;  5DYG A;  1IBM M;  2X4A A;  4JV5 M;  3UK6 A;  1TF0 B;  2K6B A;  1MU5 A;  3KDS E;  3UGJ A;  1GAB A;  2CHQ A;  1R7R A; 
#chains in the Genus database with same CATH homology
 2JWS A;  2VDB B;  2J5Y A;  1GJT A;  1GJS A;  2MH8 A;  1TF0 B;  2FS1 A;  1GAB A;  2N35 A;  1PRB A;  2KDL A;  2LHC A;  2LHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...