2FS1A

Solution structure of psd-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
MEAVDANSLAQAKEAAIKELKQYGIGDYYIKLINNAKTVEGVESLKNEILKALPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSD-1
publication title Structure, dynamics, and stability variation in bacterial albumin binding modules: implications for species specificity.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328, streptococcus dysgalactiae, streptococcus equi, str
molecule tags Protein binding
total genus 11
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2fs1A00
2JWSA 1GJTA 1GJSA 2MH8A 2VDBB 2N35A 2FS1A 2J5YA 1TF0B 1GABA 2KDLA 2LHCA 2LHGA 1PRBA
chains in the Genus database with same CATH superfamily
1UFZA 2OO9A 1VQ1A 1NY6A 3SATA 2AHMA 3FUUA 2L7HA 1JR3E 3KDSE 4I81A 3KW6A 3KP1E 2UXCM 3EIEA 4DV7M 1MN3A 3GLIB 1FJGM 5ITYA 1WXQA 3KS4A 2QHOB 3HHYA 4REZA 1ZMUA 3GLFA 5FTLA 4TUWA 1J7KA 5KPZA 1V33A 2KRUA 2EKKA 2EUCA 2LBCA 2RRUA 2J7NA 3D8BA 3DOAA 2C99A 2D7HA 1R5LA 2KHHA 4AQYM 2OOAA 5JI3E 3U6DA 3TWKA 5ITQA 1TDZA 1ZV1A 2LHGA 2R46A 1KYIA 2K47A 1JR3D 2ZTCA 4LG2A 3L29A 4LJ7A 5ITRA 2GQFA 4RF0A 4D80A 4IBKA 3BOSA 3VLFB 1Z5CA 2R62A 4RF1A 5C18A 2L09A 2CFOA 2JZ1A 3LVVA 2JZ0A 2E5LM 2HCBA 2YR0A 2DI0A 3GPYA 2KA6B 3DFZA 2R18A 5EXPA 2Z3XA 1Y8GA 4MB7A 2XZUA 1HT2E 3HU3A 4LJ8A 3SASA 3U6OA 3I4VA 1IBMM 2KXEA 5KQ8A 2KNAA 1N34M 3LCUA 5KPRA 2X4AA 2JUJA 3GRUA 1L2BA 2HL7A 3T6PA 1K3XA 2QNJA 2QQ8A 2C5RA 1WR1B 4GHAA 2CRUA 2Y21A 3J80S 3PVSA 3FUTA 3GLFE 1QAQA 4I5SA 4LGMA 4CHTB 1SXJD 3RE8A 4LJ4A 4QNMA 4LGYA 4MGIE 5E26A 3TWMA 1I94M 2QCUA 3L2AA 3FTFA 4LJ6A 1SG9A 1J5EM 1L2CA 1OAIA 2ZANA 3KVWA 1L1TA 2UUBM 1IXSA 4YHHM 1LV7A 1DO2A 2GNOA 3U5ZA 1QAMA 3K9OA 1YSYA 4L15A 5IZ7D 1A5TA 1V34A 1FNNA 1WIVA 1D0KA 1Q39A 2EO2A 2QP9X 3HJSA 3PFIA 4QOSA 1JQJC 2XF3A 4KHPM 2EJSA 3U60A 1DV0A 2LVPC 4CIZA 1PJTA 3VDPA 2EKFA 5BPVA 3THGA 1K82A 1XNRM 3TQSA 3U61A 4QNRA 4K0KM 3KSJA 3UGJA 4G4QA 3GP1A 2Q2EB 1E32A 1YLAA 2JWSA 3DA1A 3GRRA 3J27B 3Q8XA 2XFTA 4GITA 4D81A 3L26A 4R71A 2RKOA 4DUZM 1R2YA 1NNJA 1L1ZA 1GO5A 1HR0M 1XNQM 4JI5M 1PM5A 1IY2A 4MM3B 1R4GA 1VDDA 2F5NA 2HKJA 2KNZA 4XGIA 3R8FA 4DV4M 1TTEA 4OW0A 3D8LA 3B7QA 2DAMA 1KFVA 2ZAMA 1VEJA 3KOWE 3UJNA 3FD9A 2A5YB 3HJQA 2DZLA 2MGWA 3K9PA 3MK6A 5FTKA 1H6UA 5EP4A 4B7GA 2JA2A 2V1CA 3SMPA 1R7RA 4Z8XA 4B3TM 3SFZA 2OOBA 4FVMA 4JI4M 3NWLA 3HX3A 2XGNA 1WJ7A 2KNVA 3A98B 4I8OA 1XMOM 3T1HM 2XEPA 2L4EA 1HT1E 1G41A 3I4YA 3K92A 2APLA 4L6V6 4M9XA 1Q3BA 1QQWA 3CF2A 1R6BX 1TDHA 1N32M 4UN2B 2X8AA 5DFLA 1RU3A 1HNZM 4LF7M 1QZMA 4P17A 1NHGC 3BXWA 1G4AE 4PCZA 2DWZB 2UUAM 3DZDA 2EA0A 1HQYE 1E9RA 3FUWA 3U6MA 3AOEA 2LVNC 4FW9A 2JP7A 5LMNM 4JXJA 4JI8M 1T3TA 1SXJA 3AOGA 4FWHA 4L16A 3U6EA 3VFDA 3IHPA 3B7ZA 4LY6A 3GPUA 3CTWB 1S3SA 4QHSA 4JI3M 3RGSA 1OQYA 2X49A 3A46A 2DHYA 2M5ZA 5ITTA 3AJIB 3NBXX 1N33M 1DGHB 4OVZB 4M0WA 4LJ5A 1IY0A 1IBKM 4JI1M 4LJ9A 1IM2A 1TH3A 1Z5BA 4WW0A 2OQ4A 3SAVA 1ORYB 1XXHB 1BVSA 1OIZA 2KDLA 1J09A 2O01F 4KO8A 4GRIA 4LCBA 4HEOA 2J7OA 4PDGA 1R2ZA 3J7AS 3GLHB 4YY3M 3SAUA 4LF4M 2CHQA 4DBGB 4JN6A 4GC5A 3HWSA 2F5QA 1UM8A 4HLQA 4AZFA 4PD2A 5L8RF 4EIWA 1TR8A 5FSWA 1YUBA 1IN4A 1IN6A 2KW0A 5C1BA 2KEBA 1QAOA 2O25A 1GJSA 1NNUC 4DR3M 2ERCA 2CV2A 3IG5A 2LTUA 2I7PA 2DENA 1VEGA 4XK8F 2DAEA 2LVQD 2QBYA 3CF6E 4AI6A 2FOIC 2R0IA 3QWLA 4FCWA 4LF9M 3JR4A 4LFAM 1OAOC 2O5RA 4LZZA 2XFSA 5DYIA 1CUKA 2K6BA 1SXJE 4ITQA 3HZJA 3FYCA 1N36M 1WHCA 2BJWA 3L28A 5EJCA 2L7IA 3FUXA 3VKGA 5EXTA 3HHZA 3HHWA 3K1JA 1NJGA 3MJ5A 3UMMA 1V92A 4M9ZA 2V1UA 4ANRA 3I04M 4JI6M 3GQ5A 4PT5A 2Z7JA 1MX0A 1GKIA 3J2PB 4FD2A 5E6JA 4CJ6A 1ZMWA 2MR9A 2VQEM 4DV2M 1QUTA 1OKSA 4DV6M 2UXDM 4XBOA 3C3EA 3FRIA 3T15A 4DV3M 2L2DA 3KS8A 3WHLA 4WP2A 1IXRC 1PJJA 3GRVA 3GRYA 1NV8A 3FRHA 3SC3A 4JV5M 1ZQ9A 1IXSB 4CISA 2H5XA 2CP8A 1ZMVA 2ZAOA 3U5ZB 2L6OA 4GKKM 4LJAA 2R65A 2Z4RA 3CGWA 4HL4A 5EP1A 4NRWA 3KFUG 3SYKA 3LCVB 3F92A 2MJ5B 3C58A 4LF8M 1XWIA 3IECA 3J81S 3U60B 2F5OA 2QSFX 2D7GA 4B7FA 3U61B 4QOZC 4D82A 2LVAA 3U6PA 4AW4A 3U6LA 4G3OA 1YE9A 2CUZA 4B08A 1HNWM 2C9CA 5KPTA 1TGUA 3C3DA 2RGOA 2WZJA 1GL7A 3KXEC 1QANA 4NL4H 1Q02A 2HHHM 3GLGA 1NHWC 4MGYE 4PDIA 4G4OA 2LVOC 3M6AA 1K3WA 2KZUA 1N78A 2JNHA 4IJEA 4R7GA 3ZCBB 2Y0TA 3HY5A 3M7GA 4MGZE 3FTCA 3VDUA 1OFHA 1NSFA 1QDTA 2L4FA 2QPAA 2Z4SA 3L27A 3HGIA 4KT0F 4OU7A 5FLXS 2P5TA 2B3TA 4X62M 3A42A 4G4NA 2HWJA 4JI2M 1TF0B 4FWDA 2UXBM 4P16A 2QZ4A 2G5GX 5F3WA 2Y20A 3QYEA 1IN5A 4L8RC 2DZNB 1QVRA 4B3MM 4KODA 1NY5A 2J5YA 3VK7A 1IN8A 2WSCF 2DHRA 3LVWA 4NXNM 4LFCM 3SAWA 1IXZA 4MGKE 3LW5F 5FTMA 3SMSA 3B9PA 3C9PA 1MJGM 3FYDA 3M0EA 1N75A 4QHTA 1QZEA 1C7YA 2F5SA 5GKNA 4NXMM 2FS1A 5EXSA 2BWEA 4RKUF 2DZOB 3I51A 2UUCM 2DAKA 1KSFX 2VQFM 8CATA 4LRSA 3FTEA 1WGNA 2KZSA 2MH8A 3HU2A 4X66M 3GLGE 4DR1M 3U6QA 4LF6M 3AFHA 1DO0A 1T6OA 4JYAM 2ZTDA 2R45A 1IBLM 4GEWA 1SXJB 3FKEA 4B3SM 1E9SA 5ITXA 4JI7M 1SXJC 3HU1A 4IJFA 2BJVA 3KOYE 4LF5M 3L25A 2K0BX 2R44A 2K9DA 3LQQA 1NV9A 1D0LA 3WHKA 1IQPA 2CHVA 4L78A 1DGFA 3QYBA 1PGYA 2CV0A 4GKJM 2UU9M 2VF7A 1PJIA 4IBEA 1Z6TA 2G3QA 5IREB 1GL6A 4AG6A 2DWMA 1VEKA 2LHCA 1MU5A 1NVMA 3GLFB 2CV1A 3W0LB 1P3QQ 1WGLA 1VG5A 3LMMA 4DV0M 3SHGB 1PJQA 4FWGA 1NO1A 4CGYB 2FNAA 4NOOB 2VDBB 1TH4A 5KO3A 4IBBA 1GVNA 1DGHA 4OVZA 3U6SA 4G4RA 3LQRA 2DWLA 2F5PA 2QBYB 1G3IA 1OIPA 1I4WA 2BNKA 5IT9S 2V6ZM 1XXHA 3PXGA 5KQDA 3GLIA 4MH0E 2R4EA 1OJLA 1QYRA 4DR6M 3ILKA 1GJTA 1QUSA 4I4LA 3GLHA 1JB0F 1D2NA 5ITXE 4JI0M 3JR5A 1HJPA 4DR2M 3ZQJA 4FCVA 4AG5A 2H1RA 4NC6A 2R4JA 2JY7A 4BLCA 4DV5M 5IWAM 2ZM6M 1L2DA 1G59A 4WURA 1PJSA 1HNXM 4M0DA 4A3VB 1E94E 3B74A 3SYLA 2DWNA 2XSZA 2JY6B 2VF8A 3KP0E 4OX9M 1ZAEA 4GIPA 5ITUA 4AKGA 3TE6A 3T38A 4L4UA 1Z59A 2I7NA 2QENA 5FTJA 3E21A 4S12A 1Z5AA 3CF0A 4GC9A 3UK6A 3T1YM 2KRKA 2DAIA 4W5WA 5LMUM 4LZJA 3PNVA 3VK8A 4B3RM 4GHLA 3E4RA 3E46A 1GABA 1IY1A 2WSFF 4GMQA 3SBJA 3GQ4A 2JY5A 1LTMA 1XXHE 2LXEA 4G6ZA 2F4VM 3GLIE 1OFIA 2XH9A 4Y28F 3TL4X 3OTOM 1QDRA 5DNYA 3K2LA 3MMPA 3SARA 2RGHA 2DVWB 3GLHE 2XZFA 1DGBA 4II7A 4F2LA 5H37D 1DGGA 2YFQA 4R3DA 3GPXA 4NRVA 3IG8A 4IBGA 3AKZA 3KSXA 2CE7A 3GLGB 4KLNA 4NSRA 1EIJA 3I01M 3H4JA 4BBAA 3FTDA 5DYGA 3SHFA 2Y0QA 2DXIA 4RNAA 1GLNA 3W68A 3UZUA 5FTNA 4DR5M 4X65M 4GH9A 4LRTA 4MGHA 1XMQM 4X64M 3MHVC 4B7HA 2N35A 5EP3A 1EFUB 3AV0A 2ZBKB 3GQ3A 2HAKA 4DR7M 2JY8A 2W82A 5EXXA 2YQZA 4DUYM 1Q3CA 3RFWA 4DV1M 4IBCA 3QAUA 2M60A 2WSEF 1T43A 5BR8M 4NSOB 4IIWA 3VKHA 2XSZD 2OPFA 1XC8A 3RGPA 1N77A 2YNMD 2BWBA 4F1IA 3W0FA 2CHGA 3ZH9B 3K8ZA 3Q8GA 4Q7JA 3HKPA 2XLJA 3HJ8A 3U6CA 2R6FA 4DR4M 3KOXE 4LFBM 1TH2A 2NQ8C 2LNHC 2G8LA 1W5TA 3W67A 3KOZE 2CWBA 3TPZA 1IFYA 1JR3A 3EIHA 5JI2E 2DKLA 3AOEC 2JXNA 4Z6YA 2D7EA 1AIPC 3NBIA 3V76A 1G71A 4ZPXA 3FUVA 3A45A 1W5SA 2C9OA 1X37A 4IBFA 5A2QS 1XB2B 4IBIA 2C98A 3GPPA 2DNAA 4IBDA 1OTRA 4M9SA 1F4IA 1D0MA 1HQCA 2DAGA 3R9XB 3PNYA 4AKIA 2LH0A 1NJFA 2MROB 2FE8A 4IBJA 7CATA 1IN7A 3B89A 3J7BA 3ZC7B 3GO8A 2LWXA 3TWLA 5EP2A 3AL0C 3FE3A 1XHBA 5EQTA 4FCTA 4AKHA 1PRBA 1AUAA 1L8QA 2CEAA 2FH0A 2VIIA 3E9SA 1EE8A 3HHXA 3B7NA 3JAMS 2Z8YM 1G8PA 2C96A 3BBZA 3H4MA 4BB9A 2FFJA 1VDLA 1C1KA
chains in the Genus database with same CATH topology
2JWSA 1GJTA 1GJSA 2MH8A 2VDBB 2N35A 2FS1A 2J5YA 1TF0B 1GABA 2KDLA 2LHCA 2LHGA 1PRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWS A;  1GJT A;  1GJS A;  2MH8 A;  2VDB B;  2N35 A;  2FS1 A;  2J5Y A;  1TF0 B;  1GAB A;  2KDL A;  2LHC A;  2LHG A;  1PRB A; 
#chains in the Genus database with same CATH topology
 1UFZ A;  2OO9 A;  1VQ1 A;  1NY6 A;  3SAT A;  2AHM A;  3FUU A;  2L7H A;  1JR3 E;  3KDS E;  4I81 A;  3KW6 A;  3KP1 E;  2UXC M;  3EIE A;  4DV7 M;  1MN3 A;  3GLI B;  1FJG M;  5ITY A;  1WXQ A;  3KS4 A;  2QHO B;  3HHY A;  4REZ A;  1ZMU A;  3GLF A;  5FTL A;  4TUW A;  1J7K A;  5KPZ A;  1V33 A;  2KRU A;  2EKK A;  2EUC A;  2LBC A;  2RRU A;  2J7N A;  3D8B A;  3DOA A;  2C99 A;  2D7H A;  1R5L A;  2KHH A;  4AQY M;  2OOA A;  5JI3 E;  3U6D A;  3TWK A;  5ITQ A;  1TDZ A;  1ZV1 A;  2LHG A;  2R46 A;  1KYI A;  2K47 A;  1JR3 D;  2ZTC A;  4LG2 A;  3L29 A;  4LJ7 A;  5ITR A;  2GQF A;  4RF0 A;  4D80 A;  4IBK A;  3BOS A;  3VLF B;  1Z5C A;  2R62 A;  4RF1 A;  5C18 A;  2L09 A;  2CFO A;  2JZ1 A;  3LVV A;  2JZ0 A;  2E5L M;  2HCB A;  2YR0 A;  2DI0 A;  3GPY A;  2KA6 B;  3DFZ A;  2R18 A;  5EXP A;  2Z3X A;  1Y8G A;  4MB7 A;  2XZU A;  1HT2 E;  3HU3 A;  4LJ8 A;  3SAS A;  3U6O A;  3I4V A;  1IBM M;  2KXE A;  5KQ8 A;  2KNA A;  1N34 M;  3LCU A;  5KPR A;  2X4A A;  2JUJ A;  3GRU A;  1L2B A;  2HL7 A;  3T6P A;  1K3X A;  2QNJ A;  2QQ8 A;  2C5R A;  1WR1 B;  4GHA A;  2CRU A;  2Y21 A;  3J80 S;  3PVS A;  3FUT A;  3GLF E;  1QAQ A;  4I5S A;  4LGM A;  4CHT B;  1SXJ D;  3RE8 A;  4LJ4 A;  4QNM A;  4LGY A;  4MGI E;  5E26 A;  3TWM A;  1I94 M;  2QCU A;  3L2A A;  3FTF A;  4LJ6 A;  1SG9 A;  1J5E M;  1L2C A;  1OAI A;  2ZAN A;  3KVW A;  1L1T A;  2UUB M;  1IXS A;  4YHH M;  1LV7 A;  1DO2 A;  2GNO A;  3U5Z A;  1QAM A;  3K9O A;  1YSY A;  4L15 A;  5IZ7 D;  1A5T A;  1V34 A;  1FNN A;  1WIV A;  1D0K A;  1Q39 A;  2EO2 A;  2QP9 X;  3HJS A;  3PFI A;  4QOS A;  1JQJ C;  2XF3 A;  4KHP M;  2EJS A;  3U60 A;  1DV0 A;  2LVP C;  4CIZ A;  1PJT A;  3VDP A;  2EKF A;  5BPV A;  3THG A;  1K82 A;  1XNR M;  3TQS A;  3U61 A;  4QNR A;  4K0K M;  3KSJ A;  3UGJ A;  4G4Q A;  3GP1 A;  2Q2E B;  1E32 A;  1YLA A;  2JWS A;  3DA1 A;  3GRR A;  3J27 B;  3Q8X A;  2XFT A;  4GIT A;  4D81 A;  3L26 A;  4R71 A;  2RKO A;  4DUZ M;  1R2Y A;  1NNJ A;  1L1Z A;  1GO5 A;  1HR0 M;  1XNQ M;  4JI5 M;  1PM5 A;  1IY2 A;  4MM3 B;  1R4G A;  1VDD A;  2F5N A;  2HKJ A;  2KNZ A;  4XGI A;  3R8F A;  4DV4 M;  1TTE A;  4OW0 A;  3D8L A;  3B7Q A;  2DAM A;  1KFV A;  2ZAM A;  1VEJ A;  3KOW E;  3UJN A;  3FD9 A;  2A5Y B;  3HJQ A;  2DZL A;  2MGW A;  3K9P A;  3MK6 A;  5FTK A;  1H6U A;  5EP4 A;  4B7G A;  2JA2 A;  2V1C A;  3SMP A;  1R7R A;  4Z8X A;  4B3T M;  3SFZ A;  2OOB A;  4FVM A;  4JI4 M;  3NWL A;  3HX3 A;  2XGN A;  1WJ7 A;  2KNV A;  3A98 B;  4I8O A;  1XMO M;  3T1H M;  2XEP A;  2L4E A;  1HT1 E;  1G41 A;  3I4Y A;  3K92 A;  2APL A;  4L6V 6;  4M9X A;  1Q3B A;  1QQW A;  3CF2 A;  1R6B X;  1TDH A;  1N32 M;  4UN2 B;  2X8A A;  5DFL A;  1RU3 A;  1HNZ M;  4LF7 M;  1QZM A;  4P17 A;  1NHG C;  3BXW A;  1G4A E;  4PCZ A;  2DWZ B;  2UUA M;  3DZD A;  2EA0 A;  1HQY E;  1E9R A;  3FUW A;  3U6M A;  3AOE A;  2LVN C;  4FW9 A;  2JP7 A;  5LMN M;  4JXJ A;  4JI8 M;  1T3T A;  1SXJ A;  3AOG A;  4FWH A;  4L16 A;  3U6E A;  3VFD A;  3IHP A;  3B7Z A;  4LY6 A;  3GPU A;  3CTW B;  1S3S A;  4QHS A;  4JI3 M;  3RGS A;  1OQY A;  2X49 A;  3A46 A;  2DHY A;  2M5Z A;  5ITT A;  3AJI B;  3NBX X;  1N33 M;  1DGH B;  4OVZ B;  4M0W A;  4LJ5 A;  1IY0 A;  1IBK M;  4JI1 M;  4LJ9 A;  1IM2 A;  1TH3 A;  1Z5B A;  4WW0 A;  2OQ4 A;  3SAV A;  1ORY B;  1XXH B;  1BVS A;  1OIZ A;  2KDL A;  1J09 A;  2O01 F;  4KO8 A;  4GRI A;  4LCB A;  4HEO A;  2J7O A;  4PDG A;  1R2Z A;  3J7A S;  3GLH B;  4YY3 M;  3SAU A;  4LF4 M;  2CHQ A;  4DBG B;  4JN6 A;  4GC5 A;  3HWS A;  2F5Q A;  1UM8 A;  4HLQ A;  4AZF A;  4PD2 A;  5L8R F;  4EIW A;  1TR8 A;  5FSW A;  1YUB A;  1IN4 A;  1IN6 A;  2KW0 A;  5C1B A;  2KEB A;  1QAO A;  2O25 A;  1GJS A;  1NNU C;  4DR3 M;  2ERC A;  2CV2 A;  3IG5 A;  2LTU A;  2I7P A;  2DEN A;  1VEG A;  4XK8 F;  2DAE A;  2LVQ D;  2QBY A;  3CF6 E;  4AI6 A;  2FOI C;  2R0I A;  3QWL A;  4FCW A;  4LF9 M;  3JR4 A;  4LFA M;  1OAO C;  2O5R A;  4LZZ A;  2XFS A;  5DYI A;  1CUK A;  2K6B A;  1SXJ E;  4ITQ A;  3HZJ A;  3FYC A;  1N36 M;  1WHC A;  2BJW A;  3L28 A;  5EJC A;  2L7I A;  3FUX A;  3VKG A;  5EXT A;  3HHZ A;  3HHW A;  3K1J A;  1NJG A;  3MJ5 A;  3UMM A;  1V92 A;  4M9Z A;  2V1U A;  4ANR A;  3I04 M;  4JI6 M;  3GQ5 A;  4PT5 A;  2Z7J A;  1MX0 A;  1GKI A;  3J2P B;  4FD2 A;  5E6J A;  4CJ6 A;  1ZMW A;  2MR9 A;  2VQE M;  4DV2 M;  1QUT A;  1OKS A;  4DV6 M;  2UXD M;  4XBO A;  3C3E A;  3FRI A;  3T15 A;  4DV3 M;  2L2D A;  3KS8 A;  3WHL A;  4WP2 A;  1IXR C;  1PJJ A;  3GRV A;  3GRY A;  1NV8 A;  3FRH A;  3SC3 A;  4JV5 M;  1ZQ9 A;  1IXS B;  4CIS A;  2H5X A;  2CP8 A;  1ZMV A;  2ZAO A;  3U5Z B;  2L6O A;  4GKK M;  4LJA A;  2R65 A;  2Z4R A;  3CGW A;  4HL4 A;  5EP1 A;  4NRW A;  3KFU G;  3SYK A;  3LCV B;  3F92 A;  2MJ5 B;  3C58 A;  4LF8 M;  1XWI A;  3IEC A;  3J81 S;  3U60 B;  2F5O A;  2QSF X;  2D7G A;  4B7F A;  3U61 B;  4QOZ C;  4D82 A;  2LVA A;  3U6P A;  4AW4 A;  3U6L A;  4G3O A;  1YE9 A;  2CUZ A;  4B08 A;  1HNW M;  2C9C A;  5KPT A;  1TGU A;  3C3D A;  2RGO A;  2WZJ A;  1GL7 A;  3KXE C;  1QAN A;  4NL4 H;  1Q02 A;  2HHH M;  3GLG A;  1NHW C;  4MGY E;  4PDI A;  4G4O A;  2LVO C;  3M6A A;  1K3W A;  2KZU A;  1N78 A;  2JNH A;  4IJE A;  4R7G A;  3ZCB B;  2Y0T A;  3HY5 A;  3M7G A;  4MGZ E;  3FTC A;  3VDU A;  1OFH A;  1NSF A;  1QDT A;  2L4F A;  2QPA A;  2Z4S A;  3L27 A;  3HGI A;  4KT0 F;  4OU7 A;  5FLX S;  2P5T A;  2B3T A;  4X62 M;  3A42 A;  4G4N A;  2HWJ A;  4JI2 M;  1TF0 B;  4FWD A;  2UXB M;  4P16 A;  2QZ4 A;  2G5G X;  5F3W A;  2Y20 A;  3QYE A;  1IN5 A;  4L8R C;  2DZN B;  1QVR A;  4B3M M;  4KOD A;  1NY5 A;  2J5Y A;  3VK7 A;  1IN8 A;  2WSC F;  2DHR A;  3LVW A;  4NXN M;  4LFC M;  3SAW A;  1IXZ A;  4MGK E;  3LW5 F;  5FTM A;  3SMS A;  3B9P A;  3C9P A;  1MJG M;  3FYD A;  3M0E A;  1N75 A;  4QHT A;  1QZE A;  1C7Y A;  2F5S A;  5GKN A;  4NXM M;  2FS1 A;  5EXS A;  2BWE A;  4RKU F;  2DZO B;  3I51 A;  2UUC M;  2DAK A;  1KSF X;  2VQF M;  8CAT A;  4LRS A;  3FTE A;  1WGN A;  2KZS A;  2MH8 A;  3HU2 A;  4X66 M;  3GLG E;  4DR1 M;  3U6Q A;  4LF6 M;  3AFH A;  1DO0 A;  1T6O A;  4JYA M;  2ZTD A;  2R45 A;  1IBL M;  4GEW A;  1SXJ B;  3FKE A;  4B3S M;  1E9S A;  5ITX A;  4JI7 M;  1SXJ C;  3HU1 A;  4IJF A;  2BJV A;  3KOY E;  4LF5 M;  3L25 A;  2K0B X;  2R44 A;  2K9D A;  3LQQ A;  1NV9 A;  1D0L A;  3WHK A;  1IQP A;  2CHV A;  4L78 A;  1DGF A;  3QYB A;  1PGY A;  2CV0 A;  4GKJ M;  2UU9 M;  2VF7 A;  1PJI A;  4IBE A;  1Z6T A;  2G3Q A;  5IRE B;  1GL6 A;  4AG6 A;  2DWM A;  1VEK A;  2LHC A;  1MU5 A;  1NVM A;  3GLF B;  2CV1 A;  3W0L B;  1P3Q Q;  1WGL A;  1VG5 A;  3LMM A;  4DV0 M;  3SHG B;  1PJQ A;  4FWG A;  1NO1 A;  4CGY B;  2FNA A;  4NOO B;  2VDB B;  1TH4 A;  5KO3 A;  4IBB A;  1GVN A;  1DGH A;  4OVZ A;  3U6S A;  4G4R A;  3LQR A;  2DWL A;  2F5P A;  2QBY B;  1G3I A;  1OIP A;  1I4W A;  2BNK A;  5IT9 S;  2V6Z M;  1XXH A;  3PXG A;  5KQD A;  3GLI A;  4MH0 E;  2R4E A;  1OJL A;  1QYR A;  4DR6 M;  3ILK A;  1GJT A;  1QUS A;  4I4L A;  3GLH A;  1JB0 F;  1D2N A;  5ITX E;  4JI0 M;  3JR5 A;  1HJP A;  4DR2 M;  3ZQJ A;  4FCV A;  4AG5 A;  2H1R A;  4NC6 A;  2R4J A;  2JY7 A;  4BLC A;  4DV5 M;  5IWA M;  2ZM6 M;  1L2D A;  1G59 A;  4WUR A;  1PJS A;  1HNX M;  4M0D A;  4A3V B;  1E94 E;  3B74 A;  3SYL A;  2DWN A;  2XSZ A;  2JY6 B;  2VF8 A;  3KP0 E;  4OX9 M;  1ZAE A;  4GIP A;  5ITU A;  4AKG A;  3TE6 A;  3T38 A;  4L4U A;  1Z59 A;  2I7N A;  2QEN A;  5FTJ A;  3E21 A;  4S12 A;  1Z5A A;  3CF0 A;  4GC9 A;  3UK6 A;  3T1Y M;  2KRK A;  2DAI A;  4W5W A;  5LMU M;  4LZJ A;  3PNV A;  3VK8 A;  4B3R M;  4GHL A;  3E4R A;  3E46 A;  1GAB A;  1IY1 A;  2WSF F;  4GMQ A;  3SBJ A;  3GQ4 A;  2JY5 A;  1LTM A;  1XXH E;  2LXE A;  4G6Z A;  2F4V M;  3GLI E;  1OFI A;  2XH9 A;  4Y28 F;  3TL4 X;  3OTO M;  1QDR A;  5DNY A;  3K2L A;  3MMP A;  3SAR A;  2RGH A;  2DVW B;  3GLH E;  2XZF A;  1DGB A;  4II7 A;  4F2L A;  5H37 D;  1DGG A;  2YFQ A;  4R3D A;  3GPX A;  4NRV A;  3IG8 A;  4IBG A;  3AKZ A;  3KSX A;  2CE7 A;  3GLG B;  4KLN A;  4NSR A;  1EIJ A;  3I01 M;  3H4J A;  4BBA A;  3FTD A;  5DYG A;  3SHF A;  2Y0Q A;  2DXI A;  4RNA A;  1GLN A;  3W68 A;  3UZU A;  5FTN A;  4DR5 M;  4X65 M;  4GH9 A;  4LRT A;  4MGH A;  1XMQ M;  4X64 M;  3MHV C;  4B7H A;  2N35 A;  5EP3 A;  1EFU B;  3AV0 A;  2ZBK B;  3GQ3 A;  2HAK A;  4DR7 M;  2JY8 A;  2W82 A;  5EXX A;  2YQZ A;  4DUY M;  1Q3C A;  3RFW A;  4DV1 M;  4IBC A;  3QAU A;  2M60 A;  2WSE F;  1T43 A;  5BR8 M;  4NSO B;  4IIW A;  3VKH A;  2XSZ D;  2OPF A;  1XC8 A;  3RGP A;  1N77 A;  2YNM D;  2BWB A;  4F1I A;  3W0F A;  2CHG A;  3ZH9 B;  3K8Z A;  3Q8G A;  4Q7J A;  3HKP A;  2XLJ A;  3HJ8 A;  3U6C A;  2R6F A;  4DR4 M;  3KOX E;  4LFB M;  1TH2 A;  2NQ8 C;  2LNH C;  2G8L A;  1W5T A;  3W67 A;  3KOZ E;  2CWB A;  3TPZ A;  1IFY A;  1JR3 A;  3EIH A;  5JI2 E;  2DKL A;  3AOE C;  2JXN A;  4Z6Y A;  2D7E A;  1AIP C;  3NBI A;  3V76 A;  1G71 A;  4ZPX A;  3FUV A;  3A45 A;  1W5S A;  2C9O A;  1X37 A;  4IBF A;  5A2Q S;  1XB2 B;  4IBI A;  2C98 A;  3GPP A;  2DNA A;  4IBD A;  1OTR A;  4M9S A;  1F4I A;  1D0M A;  1HQC A;  2DAG A;  3R9X B;  3PNY A;  4AKI A;  2LH0 A;  1NJF A;  2MRO B;  2FE8 A;  4IBJ A;  7CAT A;  1IN7 A;  3B89 A;  3J7B A;  3ZC7 B;  3GO8 A;  2LWX A;  3TWL A;  5EP2 A;  3AL0 C;  3FE3 A;  1XHB A;  5EQT A;  4FCT A;  4AKH A;  1PRB A;  1AUA A;  1L8Q A;  2CEA A;  2FH0 A;  2VII A;  3E9S A;  1EE8 A;  3HHX A;  3B7N A;  3JAM S;  2Z8Y M;  1G8P A;  2C96 A;  3BBZ A;  3H4M A;  4BB9 A;  2FFJ A;  1VDL A;  1C1K A; 
#chains in the Genus database with same CATH homology
 2JWS A;  1GJT A;  1GJS A;  2MH8 A;  2VDB B;  2N35 A;  2FS1 A;  2J5Y A;  1TF0 B;  1GAB A;  2KDL A;  2LHC A;  2LHG A;  1PRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...