2FSAA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the h3(1-15)k4me2 bound state
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
168
Chain Sequence
b'DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 50
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2fsaA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2fsaA01
4N4HA 4Z1SA 1RMDA 2RNXA 2UZGA 3HMEA 5HRVA 5DKCA 5COIA 1WILA 3N9MA 5EWVA 2G45A 2DKWA 4F3IA 3NG2A 3NXBA 5FE8A 3UV2A 4O71A 1ZBDB 2NXBA 3KV6A 5E3DA 2RNWA 4MEQA 5FE4A 4Z6HA 4QEWA 4J0SA 4QSXA 5D3JA 5ENJA 4AKNA 5HQ6A 1WEOA 3O70A 5D26A 5AD2A 2LRIC 4GNGA 2GRCA 1N87A 4FJCA 4HXNA 4QUUA 4F52B 5LKXA 5AMEA 4HXLA 2JMJA 4NQMA 5E9VA 5TDWA 2N9GA 4NR4A 5CUBA 4CL9A 1WEMA 4YADA 5I83A 3RPGB 5H1TA 3UVXA 4LKAA 2R0VA 5AITA 1VD4A 2KYUA 5DLZA 4CCGX 2KR4A 4QEUA 4HXPA 4LR6A 4C67A 5KTXA 2I8NA 3N9PA 5TBNA 4TT4A 4O74A 5FG5A 5HJCA 1XWHA 4UP0A 2ZETC 5EWCA 3U5KA 2YUCA 3LQHA 4UIWA 1WEQA 3G0LA 4NXJA 4QY4A 4HXOA 3MQMA 4CA1A 4LZSA 2VP7A 2KWJA 4FO9A 4KV1A 4NUDA 4N4IA 4YBMA 4V3LC 2M1RA 4HXRA 2G4AA 1WUGA 3SVGA 4WHWA 4LC2A 2LV9A 3GL6A 4QB3A 1JSPB 5I7YA 3RTRB 4HBYA 5LVRA 4IC3A 5CU8A 5FFWA 2L85A 4TTEA 3HCSA 5HFQA 5DYUA 4N3WA 4YY4A 5HLSA 4ALHA 3HTKC 3ZPVE 1HYIA 2MNZA 5CUCA 3SOWA 5KHMA 4A9JA 4AP4A 5HQ7A 5FE5A 2ECNA 2FSAA 2ECJA 2JMIA 4Z1QA 3ZVYA 4QSVA 5F25A 3UV4A 4A9HA 1WGMA 2MT5A 3V43A 5B8DA 5IG6A 4CFKA 3SVFA 4LYIA 4IR5A 4CUUA 4ZQLA 5KTUA 2ECIA 5DYAA 3M63A 4QSUA 3QZVA 2YW8A 3MB4A 5H1VA 5AIUA 2I50A 5ACYA 5IGNA 2CKLA 4TT2A 4O77A 5FE0A 4GNFA 1Z2QA 1VYXA 3P1FA 4QR3A 4NRCA 5IGMA 4A9KA 5D3HA 4UYHA 4L7XA 4QR4A 3O37A 3RPGC 3MB3A 3EB5A 4BHWA 5TRBA 4A9LA 3P1DA 4YK0A 4WIVA 4R2YA 1WENA 4O64A 5D3LA 5FH7A 1G25A 4O72A 2R10A 4YBSA 4NUEA 5IIDA 3U5NA 1WIMA 1X4UA 4Z6IA 5DBMA 3DPLR 5EISA 4PCIA 2YQMA 5EQ1A 5HENA 3HMFA 5LJ1A 4NUCA 3N9NA 4UI9B 5JI8A 5A82A 5EI4A 4A9IA 4FIPA 1HYJA 4MR6A 1X4IA 4O7CA 2QJ0A 5C13A 5E9MA 5L97A 4GB0A 5D3PA 5KH7A 5F3AA 2OXQC 4LLBA 3GV4A 5LKTA 2KWOA 5EP7A 2DATA 4LK9A 1Z60A 2E3KA 4HXKA 2M85A 5HFRA 5L8TA 2KGGA 5A81A 5IGKA 3MHHA 2VJFB 4NYXA 4WZ2A 3MULA 4LYWA 4UITA 2WP1A 2VJEA 2KFTA 3MHSA 4S3OC 4N4GA 4UIUA 4YYGA 5CY9A 5LUUA 2L43A 4UP5A 4P5OB 5DX4A 3EB6A 5KH9A 3N9QA 1WUMA 5BT5A 4UIZA 5CS8A 4CUSA 5EWHA 4XYAA 4QC1A 5D24A 2I7KA 2HDPA 4MEOA 5FE7A 4PY6A 5DKHA 4QZSA 4QYLA 4OGIA 4CUTA 4MEPA 4IR3A 5CQAA 5KH3A 2L0BA 2YQLA 5B75A 5C8GA 3JVMA 5I3LA 4YH4A 3ONIA 5CQ5A 5FERA 5FH8A 5A5OA 4WZ0A 4QC3A 2YYRA 4LADB 4LJNA 3ZYUA 1EQFA 3LXJA 4CURA 2OSSA 1WEVA 2C2VS 5I1QA 3HCUA 1WEWA 3LRQA 3I3JA 4IORA 2RNYA 4YYMA 1WE9A 2YT5A 2L80A 2YHOA 4N4FA 5C89A 5E74A 5ENGA 5EPSA 2ECGA 4NR7A 1WESA 4NS5A 3S91A 4QBMA 3C5KA 5B76A 2VPDA 5CRMA 2CKLB 5EPBA 5D0CA 5C11A 2QICA 5L99A 4HXMA 5HQ5A 3ZYQA 5TDRA 3IU6A 4TQNA 5AMFA 5B79A 5KU3A 4AYCA 4UIVA 2L75A 2K17A 2YU4A 4YYHA 4A9FA 5HRXA 1MM3A 5ENCA 4B7YC 5CUDA 2E7OA 4O70A 5B77A 3O33A 2CSYA 3U5LA 5E0RA 2YYNA 5G4SA 3KNVA 5BT3A 2L84A 5FE6A 1E6IA 5ENIA 5I7XA 5DKAA 5I80A 4AVXA 5G0FA 3MXFA 5F5ZA 1V87A 2LN0A 4LRGA 2YEKA 1F68A 4HBVA 3DAIA 4ZC9A 5ETBA 3I2DA 5EGUA 4BW3A 3SVHA 2YSMA 5DW2A 4Q0OA 4CFLA 5CQ7A 2H0DA 3ZPV1 1JM7B 2YELA 5EWDA 2LXHC 2KWKA 3KV5A 5CQ3A 5IBNA 4LYSA 4QNSA 3G0JA 4AUQB 1BORA 3GG3A 4O7EA 4A9NA 5ETDA 4YYNA 2IDAA 3HCTA 5C4QA 4QEVA 2KIZA 5EYAF 5FFYA 2YEMA 5HRWA 5BT4A 5D25A 5C87A 3DQVR 2DVQA 4C66A 5D1LB 4HBWA 3QZSA 3HMHA 3UW9A 5CUAA 4J1PA 2DVSA 4CLBA 2RO1A 2RFJA 4UYFB 4BW1A 4O76A 5LKZA 5L98A 5HEMA 1X4JA 3DWYA 3SHBA 5LKUA 5E3GA 5EICA 4QYDA 5I89A 5HM0A 4X2IA 2QIZA 4NR8A 5IGLA 5D7XA 4ZW1A 5I86A 5EPRA 1U6GB 2PUYA 1ZS5A 3UV5A 4ZUXU 5DYCA 4A0CD 5EVAA 2RSDA 3O35A 5E9YA 5FH6A 4IOQA 4Q0NA 4YAXA 4NYVA 2F6NA 2ECWA 2XEUA 3FKMX 4PCEA 3L1ZB 3O7AA 3KQIA 4PPEA 4TT6A 5TABA 4E96A 1JOCA 4HXSA 5A5PA 2E7NA 4TS8A 2LGLA 3C6WA 5DW1A 5LCWB 5HCLA 2FUUA 4TZ8A 4UYGA 4TYLA 3M99A 4WHUA 2MJVB 4MR3A 5A7CA 3JVLA 5DLXA 4J3IA 5DFCA 1JM4B 3RCWA 4KCXA 5D1KB 5A5QA 4TU6A 5LJ2A 4AYCB 4BW4A 5CPEA 4B86C 2DWWA 3UVYA 2JRJA 4TZ2A 5ENEA 5FB0A 4NR9A 4QSWA 2R0YA 5EA1A 4QSSA 2H60A 4QSQA 4YH3A 3AQAA 2M6MA 5CQ6A 2D9EA 2YW5A 4A9OA 5C7NA 5F60A 4LZ2A 5I40A 2CSZA 3TLPA 5EV9A 4A4BA 4Y03A 2LGVA 5E9IA 2LGGA 5LVQA 1FBVA 4GNEA 5JG6A 1LDJB 5H9MA 4NYWA 2K4DA 5JWMA 3P1EA 4DONA 2MA6A 2VPGA 2KTBB 3P5OA 2C2LA 3D7CA 2EODA 4J0RA 2K16A 5D3TA 4YABA 4NR5A 3L1XA 5LJ0A 2DVVA 1DVPA 3P1CA 4TKPB 2DX8A 3S92A 2HYED 4NRAA 5CTLA 4X3GA 2WP2A 4O7BA 4CUPA 5A5SA 1LDKC 5F1HA 5ENBA 2JMDA 5FE1A 3UVWA 2MNYA 3ASLA 2MIQA 5E9LA 1CHCA 5CP5A 2OO1A 3UVDA 3JVKA 5G04B 5D1MB 4O78A 1F62A 4YYDA 4XY9A 4YC9A 5EM3A 5J0DA 5F63A 5CGPA 4LDFA 5C85A 4IOOA 4A4CA 4RVRA 2L5EA 1IYMA 4YYIA 2PNXA 3T7LA 4XI1A 5F62A 5II1A 5A5RA 4XY8A 5AD3A 4QSPA 1MM2A 4OUFA 4QUTA 5CFWA 2MA5A 4UIYA 3M62A 4LZRA 3MUKA 2G43A 4IR4A 4GPJA 3VK6A 4Z93A 2VJFA 2Y1NA 3U5MA 3JVJA 3LQIA 5A5NA 5I29A 4I7BA 4MSXA 2EA6A 4YYJA 4FLPA 4PS5A 5L8UA 4WA6A 5CQ4A 2LSPB 5II2A 3U5JA 4I7CA 4NRBA 4TU4A 2M3HA 4QR5A 3N9OA 5FE9A 5J3XA 5G05B 5EU1A 5E7DA 4NQNA 2YSJA 4O7FA 2VPEA 3T6RA 5D3RA 4Q6FA 2RI7A 1Z6UA 3QZTA 5FE3A 3O34A 1WEEA 5EK9A 5CUEA 4O7AA 5FB1A 2EGPA 5FDZA 5DKDA 2E6RA 5CQTA 5HELA 2VJEB 4PTBA 5FFVA 1K2FA 2YREA 3L11A 4NR6A 5DY7A 2G6QA 4S3OB 4HBXA 2VPBA 5FE2A 2LDRA 5B78A 1WFKA 2MUMA 3Q2EA 1T1HA 1WEPA 2Y43A 3LQJA 4A9EA 2E6SA 4XUBA 4YBTA 2KU3A 3U5OA 4QF3A 4UIXA 4W4UA 2KREA 2OUOA 4QSRA 2DVRA 4MR4A 2Y1MA 2R0SA 4IR6A 4UYDA 4BBQA 4KV4A 4MENA 5F2PA 3ZVZB 2FUIA 4PKLA 2BAYA 4OGJA 4ALGA 2F42A 5K29A 3ZTGA 4UYEA 5E73A 4IC2A 3Q2FA 2YDWA 5F61A 2KWNA 4V3KC 5DYXA 3PHDA 2D8SA 4ZDTA 4L58A 2AN6A 4YY6A 3SOUA 3PURA 2ECTA 4C9ZA 4YYKA 5DINA 5H85A 5CZGA 2CT2A 5DFDA 2LXPC 5H1UA 4A49A 2RS9B 3IHPA 4BW2A 4QF2A 3ZNIA 4MVTA 5I88A 2F6JA 4O75A 1VFYA 2XB1A 4XUAA 4QSTA 5CRZA 3SOXA 2ECVA 2LGKA 5CUGA 2K1JA 1JM7A 1WEUA 3IU5A 4YATA 5D3NA 5FG6A 2YURA 5FEYA 5F1LA 3AADA 4I7DA 5A83A 4WZ3B 2KE1A 5ENHA 5D3SA 4NN2A 4R8PK 4GNDA 5TCMA 4MR5A 3FL2A 5KTWA 4R7EA 2NAAA 3K2JA 1FP0A 4A9MA 5EWWA 2LQ6A 2MD7B 5FBXA 2VNFA 1N72A 2YHNA 5E9KA 5DFBA 3LJWA 5KO4A 2L5UA 4FK5A 5FG4A 5A85A 5TB6A 3U5PA 5F36A 2MD8C 5ENFA 4BJXA 2KGIA 3PUQA 2D82A 5L96A 3O36A 4CUQA 2H0DB 1E4UA 3N9LA 1X0JA 5G4RA 4UYFA 2YQDA 5CQ8A
chains in the Genus database with same CATH superfamily
4N4HA 4Z1SA 1RMDA 2RNXA 2UZGA 3HMEA 5HRVA 5DKCA 5COIA 1WILA 3N9MA 5EWVA 2G45A 2DKWA 4F3IA 3NG2A 3NXBA 5FE8A 3UV2A 4O71A 1ZBDB 2D8UA 2NXBA 3KV6A 5E3DA 2RNWA 4MEQA 5FE4A 4Z6HA 4QEWA 4J0SA 4QSXA 5D3JA 5ENJA 4AKNA 5HQ6A 1WEOA 3FM8C 3O70A 5D26A 5AD2A 2LRIC 4GNGA 2GRCA 1N87A 4FJCA 4HXNA 4QUUA 4F52B 5LKXA 5AMEA 2FFWA 4HXLA 2JMJA 4NQMA 5E9VA 5TDWA 2N9GA 4NR4A 5CUBA 4CL9A 1WEMA 4YADA 5I83A 3RPGB 5H1TA 3UVXA 4LKAA 2R0VA 5AITA 1VD4A 2KYUA 5DLZA 4CCGX 2KR4A 4QEUA 4HXPA 4LR6A 4C67A 5KTXA 2I8NA 3N9PA 5TBNA 4TT4A 4OGCA 4O74A 5FG5A 5HJCA 1XWHA 3D1DA 2ZETC 4UP0A 5EWCA 3U5KA 2YUCA 3LQHA 4UIWA 1WEQA 3G0LA 4NXJA 4QY4A 4HXOA 3MQMA 4CA1A 4LZSA 2VP7A 2KWJA 4FO9A 4KV1A 4NUDA 4N4IA 4YBMA 4V3LC 2M1RA 4HXRA 2G4AA 3DWDA 1WUGA 3SVGA 4WHWA 4LC2A 2LV9A 3GL6A 4QB3A 1JSPB 5I7YA 3RTRB 4HBYA 5LVRA 4IC3A 5CU8A 5FFWA 2L85A 4TTEA 3HCSA 5HFQA 5DYUA 4N3WA 4YY4A 5HLSA 4ALHA 3HTKC 3ZPVE 1HYIA 2MNZA 5CUCA 3SOWA 2EGMA 5KHMA 4A9JA 2XOZA 4AP4A 5HQ7A 5FE5A 2ECNA 2FSAA 2ECJA 2JMIA 4Z1QA 3ZVYA 4QSVA 5F25A 3UV4A 4A9HA 1WGMA 2MT5A 3V43A 5B8DA 5IG6A 4CFKA 3SVFA 4LYIA 4IR5A 4CUUA 4ZQLA 5KTUA 2ECIA 5DYAA 3M63A 4QSUA 3QZVA 2YW8A 3MB4A 5H1VA 5AIUA 2I50A 5ACYA 5IGNA 2CKLA 4TT2A 4O77A 5FE0A 4GNFA 1Z2QA 1VYXA 3P1FA 4QR3A 4NRCA 5IGMA 4A9KA 1MBMA 5D3HA 4UYHA 4L7XA 4QR4A 3O37A 3RPGC 3MB3A 3EB5A 4BHWA 5SVXA 5TRBA 4A9LA 3P1DA 4YK0A 3LVQE 4WIVA 4R2YA 1WENA 4O64A 5D3LA 2M13A 5FH7A 1G25A 4O72A 2R10A 4YBSA 4NUEA 5IIDA 3U5NA 1WIMA 1X4UA 2MKEA 4Z6IA 5DBMA 3DPLR 5EISA 4PCIA 2YQMA 5EQ1A 5HENA 3HMFA 5LJ1A 4NUCA 4AKGA 3N9NA 5JI8A 5A82A 4UI9B 5EI4A 4A9IA 4FIPA 3VKHA 1HYJA 4MR6A 1X4IA 3H7HA 4O7CA 2QJ0A 5C13A 5E9MA 5L97A 3FJUB 5D3PA 4GB0A 5KH7A 5F3AA 2OXQC 4LLBA 2DSMA 3GV4A 5LKTA 2KWOA 5EP7A 2DATA 4LK9A 1Z60A 2E3KA 4HXKA 2M85A 5HFRA 5L8TA 2KGGA 5A81A 5IGKA 3MHHA 2VJFB 4NYXA 4WZ2A 3MULA 4LYWA 4UITA 2WP1A 2VJEA 2KFTA 3MHSA 4S3OC 4N4GA 4UIUA 4YYGA 5CY9A 5LUUA 2L43A 4UP5A 4P5OB 5DX4A 3EB6A 5KH9A 3N9QA 5SVIA 1WUMA 5BT5A 4UIZA 5CS8A 4CUSA 5EWHA 4XYAA 4QC1A 5D24A 2I7KA 2HDPA 4MEOA 5FE7A 4PY6A 5DKHA 4QZSA 2EXUA 4QYLA 1DCQA 4OGIA 4CUTA 4MEPA 4IR3A 5CQAA 5KH3A 2L0BA 2YQLA 5B75A 5C8GA 3JVMA 2CONA 5I3LA 4YH4A 3ONIA 5CQ5A 3FANA 5FERA 5FH8A 5A5OA 4WZ0A 4QC3A 2YYRA 4LADB 4LJNA 3ZYUA 1EQFA 3LXJA 4CURA 2OSSA 1WEVA 2C2VS 5I1QA 3HCUA 1WEWA 3LRQA 3I3JA 4IORA 2RNYA 4YYMA 1WE9A 2YT5A 2L80A 2YHOA 4N4FA 5C89A 3LJUX 5E74A 5ENGA 5EPSA 2ECGA 4NR7A 2YVRA 1WESA 4NS5A 3S91A 4QBMA 3C5KA 5B76A 2VPDA 5CRMA 2CKLB 5EPBA 5D0CA 4F1PA 5C11A 2KKYA 2QICA 3FAOA 5L99A 4HXMA 5HQ5A 3ZYQA 5TDRA 3MDBC 3IU6A 4TQNA 5AMFA 5B79A 5KU3A 4AYCA 4UIVA 2L75A 2K17A 2YU4A 4YYHA 4A9FA 5HRXA 1MM3A 5ENCA 4B7YC 5CUDA 2E7OA 4O70A 5B77A 3O33A 2CSYA 3U5LA 5E0RA 2YYNA 5G4SA 3KNVA 5BT3A 2L84A 5FE6A 1E6IA 5ENIA 5I7XA 5DKAA 2IQJA 5I80A 4AVXA 5G0FA 5K3QA 3MXFA 5F5ZA 1V87A 2LN0A 4O62A 4LRGA 2YEKA 4AI6A 1F68A 4HBVA 3DAIA 4ZC9A 5ETBA 3I2DA 5EGUA 4BW3A 3SVHA 2YSMA 5DW2A 4Q0OA 4CFLA 5CQ7A 2H0DA 2P57A 3ZPV1 1JM7B 2YELA 5EWDA 2LXHC 2KWKA 3KV5A 5CQ3A 4Z0RA 5IBNA 4LYSA 4QNSA 3G0JA 2XP0A 4AUQB 1BORA 3GG3A 4O7EA 4A9NA 5ETDA 4YYNA 2IDAA 4AKHA 2CSVA 5C4QA 4QEVA 2KIZA 3HCTA 5FFYA 2YEMA 5HRWA 5BT4A 5EYAF 5D25A 3T9KA 5C87A 3DQVR 2DVQA 4C66A 5D1LB 4HBWA 4H9DA 3QZSA 3HMHA 3UW9A 5CUAA 4J1PA 2DVSA 4CLBA 2RO1A 2RFJA 4UYFB 4BW1A 4O76A 5LKZA 5L98A 5HEMA 1X4JA 3DWYA 3SHBA 5LKUA 5E3GA 5EICA 4QYDA 5I89A 5HM0A 4X2IA 2QIZA 4NR8A 5IGLA 3PLWA 5D7XA 4ZW1A 5I86A 5EPRA 1U6GB 2PUYA 1ZS5A 2DJAA 3UV5A 4ZUXU 5DYCA 3SUBA 4A0CD 5EVAA 2RSDA 3O35A 5E9YA 5FH6A 3VKGA 4IOQA 4Q0NA 4YAXA 4NYVA 2RR4A 2F6NA 2ECWA 2XOCA 2XEUA 3DDTA 3FKMX 4PCEA 3L1ZB 3O7AA 3KQIA 4PPEA 4TT6A 5TABA 4E96A 1JOCA 4HXSA 2KKXA 5A5PA 2E7NA 4TS8A 2LGLA 3C6WA 5DW1A 5LCWB 5HCLA 2FUUA 3LVRE 4TZ8A 4UYGA 4TYLA 3M99A 3Q1DA 4WHUA 2MJVB 4MR3A 5A7CA 3JVLA 5DLXA 4J3IA 5DFCA 1JM4B 3RCWA 4KCXA 5D1KB 5A5QA 4TU6A 5LJ2A 2L7PA 4BW4A 5CPEA 4AYCB 2DWWA 4B86C 3UVYA 4QQ4A 2JRJA 3JUEA 4TZ2A 5ENEA 5FB0A 4NR9A 4QSWA 2R0YA 5EA1A 4QSSA 2H60A 4QSQA 4OGEA 4YH3A 3AQAA 2M6MA 5CQ6A 2D9EA 2YW5A 4A9OA 5C7NA 5F60A 2EJNA 4LZ2A 5I40A 3TLPA 5EV9A 2CSZA 4A4BA 4Y03A 2LGVA 5E9IA 2LGGA 5LVQA 1FBVA 4GNEA 5JG6A 1LDJB 5H9MA 4NYWA 4AKIA 2K4DA 5JWMA 3P1EA 4DONA 2MA6A 2VPGA 2KTBB 3P5OA 2OWAA 2C2LA 3D7CA 2EODA 4J0RA 2K16A 5D3TA 4YABA 4NR5A 3L1XA 5LJ0A 2FD4A 2DVVA 1DVPA 3P1CA 4TKPB 2DX8A 3S92A 2HYED 4NRAA 5CTLA 4X3GA 2WP2A 4O7BA 4CUPA 5A5SA 1LDKC 3D1BA 3O47A 5F1HA 5ENBA 2JMDA 5FE1A 3UVWA 2MNYA 3ASLA 2MIQA 5E9LA 1CHCA 5CP5A 3KDEC 2OO1A 3UVDA 3JVKA 5G04B 5D1MB 4O78A 1F62A 4YYDA 4XY9A 4YC9A 5EM3A 5J0DA 5F63A 5CGPA 4LDFA 5C85A 4IOOA 4A4CA 4RVRA 2L5EA 1IYMA 4YYIA 2PNXA 4Z0OA 3T7LA 4XI1A 5F62A 5II1A 3ERRA 5A5RA 4XY8A 5AD3A 4QSPA 1MM2A 4OUFA 5SVYA 4QUTA 5CFWA 2MA5A 4UIYA 3E2DA 3M62A 4LZRA 3MUKA 2G43A 4IR4A 4GPJA 2JM3A 3VK6A 4Z93A 2VJFA 2Y1NA 3U5MA 3JVJA 3LQIA 5A5NA 3LDYA 5I29A 4I7BA 4MSXA 2EA6A 4YYJA 4FLPA 4PS5A 5L8UA 4WA6A 5CQ4A 2LSPB 5II2A 3U5JA 4I7CA 4NRBA 4TU4A 2M3HA 4QR5A 3N9OA 5FE9A 5J3XA 5G05B 5EU1A 5E7DA 4NQNA 2YSJA 4O7FA 2VPEA 3T6RA 5D3RA 4Q6FA 2RI7A 1Z6UA 3QZTA 5FE3A 3O34A 1WEEA 5EK9A 2XOYA 5CUEA 4O7AA 5FB1A 2EGPA 5FDZA 2B0OE 5DKDA 2E6RA 5CQTA 5HELA 2VJEB 4PTBA 5FFVA 1K2FA 2YREA 3L11A 4NR6A 5DY7A 2G6QA 4S3OB 4HBXA 2CRRA 2VPBA 5FE2A 2LDRA 5SVIB 5B78A 1WFKA 2MUMA 3Q2EA 1T1HA 1WEPA 2Y43A 3LQJA 4A9EA 2E6SA 4XUBA 4YBTA 2KU3A 2LAUA 3U5OA 4QF3A 4UIXA 4W4UA 2KREA 2OUOA 4QSRA 2DVRA 4MR4A 2Y1MA 2R0SA 4IR6A 4UYDA 4BBQA 1ZKRA 4KV4A 4MENA 2CRWA 5F2PA 3ZVZB 2FUIA 4PKLA 2BAYA 4OGJA 4ALGA 2F42A 5K29A 3ZTGA 4UYEA 5E73A 4IC2A 3Q2FA 2YDWA 5F61A 2KWNA 4V3KC 5DYXA 3PHDA 2D8SA 4ZDTA 4L58A 2AN6A 4YY6A 3SOUA 3PURA 1PUOA 2ECTA 3FEHA 4C9ZA 4YYKA 5DINA 5H85A 5CZGA 2CT2A 5DFDA 2LXPC 5H1UA 4A49A 2RS9B 3IHPA 4BW2A 4QF2A 3ZNIA 2JUNA 4MVTA 5I88A 2F6JA 4O75A 1VFYA 2XB1A 4XUAA 4QSTA 5CRZA 3SOXA 2ECVA 2LGKA 3M7KA 5CUGA 2K1JA 1JM7A 1WEUA 3IU5A 4YATA 5D3NA 5FG6A 2YURA 5FEYA 5F1LA 3AADA 4I7DA 5A83A 4WZ3B 2KE1A 5ENHA 5D3SA 4NN2A 4R8PK 4GNDA 5TCMA 4MR5A 3FL2A 5KTWA 4R7EA 2NAAA 3K2JA 1FP0A 4A9MA 5EWWA 2LQ6A 2MD7B 5FBXA 2VNFA 1N72A 2YHNA 5E9KA 5DFBA 3LJWA 5KO4A 2L5UA 4FK5A 5FG4A 5A85A 5TB6A 3U5PA 5F36A 2MD8C 5ENFA 4BJXA 2KGIA 2E61A 3PUQA 2D82A 5L96A 3O36A 4CUQA 2H0DB 1E4UA 3N9LA 1X0JA 5G4RA 4UYFA 2YQDA 5CQ8A
chains in the Genus database with same CATH topology
4N4HA 4Z1SA 1RMDA 2RNXA 2UZGA 3HMEA 5HRVA 5DKCA 5COIA 1WILA 3N9MA 5EWVA 2G45A 2DKWA 4F3IA 3NG2A 3NXBA 5FE8A 3UV2A 4O71A 1ZBDB 2NXBA 3KV6A 5E3DA 2RNWA 4MEQA 5FE4A 4Z6HA 4QEWA 4J0SA 4QSXA 5D3JA 5ENJA 4AKNA 5HQ6A 1WEOA 3O70A 5D26A 5AD2A 2LRIC 4GNGA 2GRCA 1N87A 4FJCA 4HXNA 4QUUA 4F52B 5LKXA 5AMEA 4HXLA 2JMJA 4NQMA 5E9VA 5TDWA 2N9GA 4NR4A 5CUBA 4CL9A 1WEMA 4YADA 5I83A 3RPGB 5H1TA 3UVXA 4LKAA 2R0VA 5AITA 1VD4A 2KYUA 5DLZA 4CCGX 2KR4A 4QEUA 4HXPA 4LR6A 4C67A 5KTXA 2I8NA 3N9PA 5TBNA 4TT4A 4O74A 5FG5A 5HJCA 1XWHA 4UP0A 2ZETC 5EWCA 3U5KA 2YUCA 3LQHA 4UIWA 1WEQA 3G0LA 4NXJA 4QY4A 4HXOA 3MQMA 4CA1A 4LZSA 2VP7A 2KWJA 4FO9A 4KV1A 4NUDA 4N4IA 4YBMA 4V3LC 2M1RA 4HXRA 2G4AA 1WUGA 3SVGA 4WHWA 4LC2A 2LV9A 3GL6A 4QB3A 1JSPB 5I7YA 3RTRB 4HBYA 5LVRA 4IC3A 5CU8A 5FFWA 2L85A 4TTEA 3HCSA 5HFQA 5DYUA 4N3WA 4YY4A 5HLSA 4ALHA 3HTKC 3ZPVE 1HYIA 2MNZA 5CUCA 3SOWA 5KHMA 4A9JA 4AP4A 5HQ7A 5FE5A 2ECNA 2FSAA 2ECJA 2JMIA 4Z1QA 3ZVYA 4QSVA 5F25A 3UV4A 4A9HA 1WGMA 2MT5A 3V43A 5B8DA 5IG6A 4CFKA 3SVFA 4LYIA 4IR5A 4CUUA 4ZQLA 5KTUA 2ECIA 5DYAA 3M63A 4QSUA 3QZVA 2YW8A 3MB4A 5H1VA 5AIUA 2I50A 5ACYA 5IGNA 2CKLA 4TT2A 4O77A 5FE0A 4GNFA 1Z2QA 1VYXA 3P1FA 4QR3A 4NRCA 5IGMA 4A9KA 5D3HA 4UYHA 4L7XA 4QR4A 3O37A 3RPGC 3MB3A 3EB5A 4BHWA 5TRBA 4A9LA 3P1DA 4YK0A 4WIVA 4R2YA 1WENA 4O64A 5D3LA 5FH7A 1G25A 4O72A 2R10A 4YBSA 4NUEA 5IIDA 3U5NA 1WIMA 1X4UA 4Z6IA 5DBMA 3DPLR 5EISA 4PCIA 2YQMA 5EQ1A 5HENA 3HMFA 5LJ1A 4NUCA 3N9NA 4UI9B 5JI8A 5A82A 5EI4A 4A9IA 4FIPA 1HYJA 4MR6A 1X4IA 4O7CA 2QJ0A 5C13A 5E9MA 5L97A 4GB0A 5D3PA 5KH7A 5F3AA 2OXQC 4LLBA 3GV4A 5LKTA 2KWOA 5EP7A 2DATA 4LK9A 1Z60A 2E3KA 4HXKA 2M85A 5HFRA 5L8TA 2KGGA 5A81A 5IGKA 3MHHA 2VJFB 4NYXA 4WZ2A 3MULA 4LYWA 4UITA 2WP1A 2VJEA 2KFTA 3MHSA 4S3OC 4N4GA 4UIUA 4YYGA 5CY9A 5LUUA 2L43A 4UP5A 4P5OB 5DX4A 3EB6A 5KH9A 3N9QA 1WUMA 5BT5A 4UIZA 5CS8A 4CUSA 5EWHA 4XYAA 4QC1A 5D24A 2I7KA 2HDPA 4MEOA 5FE7A 4PY6A 5DKHA 4QZSA 4QYLA 4OGIA 4CUTA 4MEPA 4IR3A 5CQAA 5KH3A 2L0BA 2YQLA 5B75A 5C8GA 3JVMA 5I3LA 4YH4A 3ONIA 5CQ5A 5FERA 5FH8A 5A5OA 4WZ0A 4QC3A 2YYRA 4LADB 4LJNA 3ZYUA 1EQFA 3LXJA 4CURA 2OSSA 1WEVA 2C2VS 5I1QA 3HCUA 1WEWA 3LRQA 3I3JA 4IORA 2RNYA 4YYMA 1WE9A 2YT5A 2L80A 2YHOA 4N4FA 5C89A 5E74A 5ENGA 5EPSA 2ECGA 4NR7A 1WESA 4NS5A 3S91A 4QBMA 3C5KA 5B76A 2VPDA 5CRMA 2CKLB 5EPBA 5D0CA 5C11A 2QICA 5L99A 4HXMA 5HQ5A 3ZYQA 5TDRA 3IU6A 4TQNA 5AMFA 5B79A 5KU3A 4AYCA 4UIVA 2L75A 2K17A 2YU4A 4YYHA 4A9FA 5HRXA 1MM3A 5ENCA 4B7YC 5CUDA 2E7OA 4O70A 5B77A 3O33A 2CSYA 3U5LA 5E0RA 2YYNA 5G4SA 3KNVA 5BT3A 2L84A 5FE6A 1E6IA 5ENIA 5I7XA 5DKAA 5I80A 4AVXA 5G0FA 3MXFA 5F5ZA 1V87A 2LN0A 4LRGA 2YEKA 1F68A 4HBVA 3DAIA 4ZC9A 5ETBA 3I2DA 5EGUA 4BW3A 3SVHA 2YSMA 5DW2A 4Q0OA 4CFLA 5CQ7A 2H0DA 3ZPV1 1JM7B 2YELA 5EWDA 2LXHC 2KWKA 3KV5A 5CQ3A 5IBNA 4LYSA 4QNSA 3G0JA 4AUQB 1BORA 3GG3A 4O7EA 4A9NA 5ETDA 4YYNA 2IDAA 3HCTA 5C4QA 4QEVA 2KIZA 5EYAF 5FFYA 2YEMA 5HRWA 5BT4A 5D25A 5C87A 3DQVR 2DVQA 4C66A 5D1LB 4HBWA 3QZSA 3HMHA 3UW9A 5CUAA 4J1PA 2DVSA 4CLBA 2RO1A 2RFJA 4UYFB 4BW1A 4O76A 5LKZA 5L98A 5HEMA 1X4JA 3DWYA 3SHBA 5LKUA 5E3GA 5EICA 4QYDA 5I89A 5HM0A 4X2IA 2QIZA 4NR8A 5IGLA 5D7XA 4ZW1A 5I86A 5EPRA 1U6GB 2PUYA 1ZS5A 3UV5A 4ZUXU 5DYCA 4A0CD 5EVAA 2RSDA 3O35A 5E9YA 5FH6A 4IOQA 4Q0NA 4YAXA 4NYVA 2F6NA 2ECWA 2XEUA 3FKMX 4PCEA 3L1ZB 3O7AA 3KQIA 4PPEA 4TT6A 5TABA 4E96A 1JOCA 4HXSA 5A5PA 2E7NA 4TS8A 2LGLA 3C6WA 5DW1A 5LCWB 5HCLA 2FUUA 4TZ8A 4UYGA 4TYLA 3M99A 4WHUA 2MJVB 4MR3A 5A7CA 3JVLA 5DLXA 4J3IA 5DFCA 1JM4B 3RCWA 4KCXA 5D1KB 5A5QA 4TU6A 5LJ2A 4AYCB 4BW4A 5CPEA 4B86C 2DWWA 3UVYA 2JRJA 4TZ2A 5ENEA 5FB0A 4NR9A 4QSWA 2R0YA 5EA1A 4QSSA 2H60A 4QSQA 4YH3A 3AQAA 2M6MA 5CQ6A 2D9EA 2YW5A 4A9OA 5C7NA 5F60A 4LZ2A 5I40A 2CSZA 3TLPA 5EV9A 4A4BA 4Y03A 2LGVA 5E9IA 2LGGA 5LVQA 1FBVA 4GNEA 5JG6A 1LDJB 5H9MA 4NYWA 2K4DA 5JWMA 3P1EA 4DONA 2MA6A 2VPGA 2KTBB 3P5OA 2C2LA 3D7CA 2EODA 4J0RA 2K16A 5D3TA 4YABA 4NR5A 3L1XA 5LJ0A 2DVVA 1DVPA 3P1CA 4TKPB 2DX8A 3S92A 2HYED 4NRAA 5CTLA 4X3GA 2WP2A 4O7BA 4CUPA 5A5SA 1LDKC 5F1HA 5ENBA 2JMDA 5FE1A 3UVWA 2MNYA 3ASLA 2MIQA 5E9LA 1CHCA 5CP5A 2OO1A 3UVDA 3JVKA 5G04B 5D1MB 4O78A 1F62A 4YYDA 4XY9A 4YC9A 5EM3A 5J0DA 5F63A 5CGPA 4LDFA 5C85A 4IOOA 4A4CA 4RVRA 2L5EA 1IYMA 4YYIA 2PNXA 3T7LA 4XI1A 5F62A 5II1A 5A5RA 4XY8A 5AD3A 4QSPA 1MM2A 4OUFA 4QUTA 5CFWA 2MA5A 4UIYA 3M62A 4LZRA 3MUKA 2G43A 4IR4A 4GPJA 3VK6A 4Z93A 2VJFA 2Y1NA 3U5MA 3JVJA 3LQIA 5A5NA 5I29A 4I7BA 4MSXA 2EA6A 4YYJA 4FLPA 4PS5A 5L8UA 4WA6A 5CQ4A 2LSPB 5II2A 3U5JA 4I7CA 4NRBA 4TU4A 2M3HA 4QR5A 3N9OA 5FE9A 5J3XA 5G05B 5EU1A 5E7DA 4NQNA 2YSJA 4O7FA 2VPEA 3T6RA 5D3RA 4Q6FA 2RI7A 1Z6UA 3QZTA 5FE3A 3O34A 1WEEA 5EK9A 5CUEA 4O7AA 5FB1A 2EGPA 5FDZA 5DKDA 2E6RA 5CQTA 5HELA 2VJEB 4PTBA 5FFVA 1K2FA 2YREA 3L11A 4NR6A 5DY7A 2G6QA 4S3OB 4HBXA 2VPBA 5FE2A 2LDRA 5B78A 1WFKA 2MUMA 3Q2EA 1T1HA 1WEPA 2Y43A 3LQJA 4A9EA 2E6SA 4XUBA 4YBTA 2KU3A 3U5OA 4QF3A 4UIXA 4W4UA 2KREA 2OUOA 4QSRA 2DVRA 4MR4A 2Y1MA 2R0SA 4IR6A 4UYDA 4BBQA 4KV4A 4MENA 5F2PA 3ZVZB 2FUIA 4PKLA 2BAYA 4OGJA 4ALGA 2F42A 5K29A 3ZTGA 4UYEA 5E73A 4IC2A 3Q2FA 2YDWA 5F61A 2KWNA 4V3KC 5DYXA 3PHDA 2D8SA 4ZDTA 4L58A 2AN6A 4YY6A 3SOUA 3PURA 2ECTA 4C9ZA 4YYKA 5DINA 5H85A 5CZGA 2CT2A 5DFDA 2LXPC 5H1UA 4A49A 2RS9B 3IHPA 4BW2A 4QF2A 3ZNIA 4MVTA 5I88A 2F6JA 4O75A 1VFYA 2XB1A 4XUAA 4QSTA 5CRZA 3SOXA 2ECVA 2LGKA 5CUGA 2K1JA 1JM7A 1WEUA 3IU5A 4YATA 5D3NA 5FG6A 2YURA 5FEYA 5F1LA 3AADA 4I7DA 5A83A 4WZ3B 2KE1A 5ENHA 5D3SA 4NN2A 4R8PK 4GNDA 5TCMA 4MR5A 3FL2A 5KTWA 4R7EA 2NAAA 3K2JA 1FP0A 4A9MA 5EWWA 2LQ6A 2MD7B 5FBXA 2VNFA 1N72A 2YHNA 5E9KA 5DFBA 3LJWA 5KO4A 2L5UA 4FK5A 5FG4A 5A85A 5TB6A 3U5PA 5F36A 2MD8C 5ENFA 4BJXA 2KGIA 3PUQA 2D82A 5L96A 3O36A 4CUQA 2H0DB 1E4UA 3N9LA 1X0JA 5G4RA 4UYFA 2YQDA 5CQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4H A;  4Z1S A;  1RMD A;  2RNX A;  2UZG A;  3HME A;  5HRV A;  5DKC A;  5COI A;  1WIL A;  3N9M A;  5EWV A;  2G45 A;  2DKW A;  4F3I A;  3NG2 A;  3NXB A;  5FE8 A;  3UV2 A;  4O71 A;  1ZBD B;  2NXB A;  3KV6 A;  5E3D A;  2RNW A;  4MEQ A;  5FE4 A;  4Z6H A;  4QEW A;  4J0S A;  4QSX A;  5D3J A;  5ENJ A;  4AKN A;  5HQ6 A;  1WEO A;  3O70 A;  5D26 A;  5AD2 A;  2LRI C;  4GNG A;  2GRC A;  1N87 A;  4FJC A;  4HXN A;  4QUU A;  4F52 B;  5LKX A;  5AME A;  4HXL A;  2JMJ A;  4NQM A;  5E9V A;  5TDW A;  2N9G A;  4NR4 A;  5CUB A;  4CL9 A;  1WEM A;  4YAD A;  5I83 A;  3RPG B;  5H1T A;  3UVX A;  4LKA A;  2R0V A;  5AIT A;  1VD4 A;  2KYU A;  5DLZ A;  4CCG X;  2KR4 A;  4QEU A;  4HXP A;  4LR6 A;  4C67 A;  5KTX A;  2I8N A;  3N9P A;  5TBN A;  4TT4 A;  4O74 A;  5FG5 A;  5HJC A;  1XWH A;  4UP0 A;  2ZET C;  5EWC A;  3U5K A;  2YUC A;  3LQH A;  4UIW A;  1WEQ A;  3G0L A;  4NXJ A;  4QY4 A;  4HXO A;  3MQM A;  4CA1 A;  4LZS A;  2VP7 A;  2KWJ A;  4FO9 A;  4KV1 A;  4NUD A;  4N4I A;  4YBM A;  4V3L C;  2M1R A;  4HXR A;  2G4A A;  1WUG A;  3SVG A;  4WHW A;  4LC2 A;  2LV9 A;  3GL6 A;  4QB3 A;  1JSP B;  5I7Y A;  3RTR B;  4HBY A;  5LVR A;  4IC3 A;  5CU8 A;  5FFW A;  2L85 A;  4TTE A;  3HCS A;  5HFQ A;  5DYU A;  4N3W A;  4YY4 A;  5HLS A;  4ALH A;  3HTK C;  3ZPV E;  1HYI A;  2MNZ A;  5CUC A;  3SOW A;  5KHM A;  4A9J A;  4AP4 A;  5HQ7 A;  5FE5 A;  2ECN A;  2FSA A;  2ECJ A;  2JMI A;  4Z1Q A;  3ZVY A;  4QSV A;  5F25 A;  3UV4 A;  4A9H A;  1WGM A;  2MT5 A;  3V43 A;  5B8D A;  5IG6 A;  4CFK A;  3SVF A;  4LYI A;  4IR5 A;  4CUU A;  4ZQL A;  5KTU A;  2ECI A;  5DYA A;  3M63 A;  4QSU A;  3QZV A;  2YW8 A;  3MB4 A;  5H1V A;  5AIU A;  2I50 A;  5ACY A;  5IGN A;  2CKL A;  4TT2 A;  4O77 A;  5FE0 A;  4GNF A;  1Z2Q A;  1VYX A;  3P1F A;  4QR3 A;  4NRC A;  5IGM A;  4A9K A;  5D3H A;  4UYH A;  4L7X A;  4QR4 A;  3O37 A;  3RPG C;  3MB3 A;  3EB5 A;  4BHW A;  5TRB A;  4A9L A;  3P1D A;  4YK0 A;  4WIV A;  4R2Y A;  1WEN A;  4O64 A;  5D3L A;  5FH7 A;  1G25 A;  4O72 A;  2R10 A;  4YBS A;  4NUE A;  5IID A;  3U5N A;  1WIM A;  1X4U A;  4Z6I A;  5DBM A;  3DPL R;  5EIS A;  4PCI A;  2YQM A;  5EQ1 A;  5HEN A;  3HMF A;  5LJ1 A;  4NUC A;  3N9N A;  4UI9 B;  5JI8 A;  5A82 A;  5EI4 A;  4A9I A;  4FIP A;  1HYJ A;  4MR6 A;  1X4I A;  4O7C A;  2QJ0 A;  5C13 A;  5E9M A;  5L97 A;  4GB0 A;  5D3P A;  5KH7 A;  5F3A A;  2OXQ C;  4LLB A;  3GV4 A;  5LKT A;  2KWO A;  5EP7 A;  2DAT A;  4LK9 A;  1Z60 A;  2E3K A;  4HXK A;  2M85 A;  5HFR A;  5L8T A;  2KGG A;  5A81 A;  5IGK A;  3MHH A;  2VJF B;  4NYX A;  4WZ2 A;  3MUL A;  4LYW A;  4UIT A;  2WP1 A;  2VJE A;  2KFT A;  3MHS A;  4S3O C;  4N4G A;  4UIU A;  4YYG A;  5CY9 A;  5LUU A;  2L43 A;  4UP5 A;  4P5O B;  5DX4 A;  3EB6 A;  5KH9 A;  3N9Q A;  1WUM A;  5BT5 A;  4UIZ A;  5CS8 A;  4CUS A;  5EWH A;  4XYA A;  4QC1 A;  5D24 A;  2I7K A;  2HDP A;  4MEO A;  5FE7 A;  4PY6 A;  5DKH A;  4QZS A;  4QYL A;  4OGI A;  4CUT A;  4MEP A;  4IR3 A;  5CQA A;  5KH3 A;  2L0B A;  2YQL A;  5B75 A;  5C8G A;  3JVM A;  5I3L A;  4YH4 A;  3ONI A;  5CQ5 A;  5FER A;  5FH8 A;  5A5O A;  4WZ0 A;  4QC3 A;  2YYR A;  4LAD B;  4LJN A;  3ZYU A;  1EQF A;  3LXJ A;  4CUR A;  2OSS A;  1WEV A;  2C2V S;  5I1Q A;  3HCU A;  1WEW A;  3LRQ A;  3I3J A;  4IOR A;  2RNY A;  4YYM A;  1WE9 A;  2YT5 A;  2L80 A;  2YHO A;  4N4F A;  5C89 A;  5E74 A;  5ENG A;  5EPS A;  2ECG A;  4NR7 A;  1WES A;  4NS5 A;  3S91 A;  4QBM A;  3C5K A;  5B76 A;  2VPD A;  5CRM A;  2CKL B;  5EPB A;  5D0C A;  5C11 A;  2QIC A;  5L99 A;  4HXM A;  5HQ5 A;  3ZYQ A;  5TDR A;  3IU6 A;  4TQN A;  5AMF A;  5B79 A;  5KU3 A;  4AYC A;  4UIV A;  2L75 A;  2K17 A;  2YU4 A;  4YYH A;  4A9F A;  5HRX A;  1MM3 A;  5ENC A;  4B7Y C;  5CUD A;  2E7O A;  4O70 A;  5B77 A;  3O33 A;  2CSY A;  3U5L A;  5E0R A;  2YYN A;  5G4S A;  3KNV A;  5BT3 A;  2L84 A;  5FE6 A;  1E6I A;  5ENI A;  5I7X A;  5DKA A;  5I80 A;  4AVX A;  5G0F A;  3MXF A;  5F5Z A;  1V87 A;  2LN0 A;  4LRG A;  2YEK A;  1F68 A;  4HBV A;  3DAI A;  4ZC9 A;  5ETB A;  3I2D A;  5EGU A;  4BW3 A;  3SVH A;  2YSM A;  5DW2 A;  4Q0O A;  4CFL A;  5CQ7 A;  2H0D A;  3ZPV 1;  1JM7 B;  2YEL A;  5EWD A;  2LXH C;  2KWK A;  3KV5 A;  5CQ3 A;  5IBN A;  4LYS A;  4QNS A;  3G0J A;  4AUQ B;  1BOR A;  3GG3 A;  4O7E A;  4A9N A;  5ETD A;  4YYN A;  2IDA A;  3HCT A;  5C4Q A;  4QEV A;  2KIZ A;  5EYA F;  5FFY A;  2YEM A;  5HRW A;  5BT4 A;  5D25 A;  5C87 A;  3DQV R;  2DVQ A;  4C66 A;  5D1L B;  4HBW A;  3QZS A;  3HMH A;  3UW9 A;  5CUA A;  4J1P A;  2DVS A;  4CLB A;  2RO1 A;  2RFJ A;  4UYF B;  4BW1 A;  4O76 A;  5LKZ A;  5L98 A;  5HEM A;  1X4J A;  3DWY A;  3SHB A;  5LKU A;  5E3G A;  5EIC A;  4QYD A;  5I89 A;  5HM0 A;  4X2I A;  2QIZ A;  4NR8 A;  5IGL A;  5D7X A;  4ZW1 A;  5I86 A;  5EPR A;  1U6G B;  2PUY A;  1ZS5 A;  3UV5 A;  4ZUX U;  5DYC A;  4A0C D;  5EVA A;  2RSD A;  3O35 A;  5E9Y A;  5FH6 A;  4IOQ A;  4Q0N A;  4YAX A;  4NYV A;  2F6N A;  2ECW A;  2XEU A;  3FKM X;  4PCE A;  3L1Z B;  3O7A A;  3KQI A;  4PPE A;  4TT6 A;  5TAB A;  4E96 A;  1JOC A;  4HXS A;  5A5P A;  2E7N A;  4TS8 A;  2LGL A;  3C6W A;  5DW1 A;  5LCW B;  5HCL A;  2FUU A;  4TZ8 A;  4UYG A;  4TYL A;  3M99 A;  4WHU A;  2MJV B;  4MR3 A;  5A7C A;  3JVL A;  5DLX A;  4J3I A;  5DFC A;  1JM4 B;  3RCW A;  4KCX A;  5D1K B;  5A5Q A;  4TU6 A;  5LJ2 A;  4AYC B;  4BW4 A;  5CPE A;  4B86 C;  2DWW A;  3UVY A;  2JRJ A;  4TZ2 A;  5ENE A;  5FB0 A;  4NR9 A;  4QSW A;  2R0Y A;  5EA1 A;  4QSS A;  2H60 A;  4QSQ A;  4YH3 A;  3AQA A;  2M6M A;  5CQ6 A;  2D9E A;  2YW5 A;  4A9O A;  5C7N A;  5F60 A;  4LZ2 A;  5I40 A;  2CSZ A;  3TLP A;  5EV9 A;  4A4B A;  4Y03 A;  2LGV A;  5E9I A;  2LGG A;  5LVQ A;  1FBV A;  4GNE A;  5JG6 A;  1LDJ B;  5H9M A;  4NYW A;  2K4D A;  5JWM A;  3P1E A;  4DON A;  2MA6 A;  2VPG A;  2KTB B;  3P5O A;  2C2L A;  3D7C A;  2EOD A;  4J0R A;  2K16 A;  5D3T A;  4YAB A;  4NR5 A;  3L1X A;  5LJ0 A;  2DVV A;  1DVP A;  3P1C A;  4TKP B;  2DX8 A;  3S92 A;  2HYE D;  4NRA A;  5CTL A;  4X3G A;  2WP2 A;  4O7B A;  4CUP A;  5A5S A;  1LDK C;  5F1H A;  5ENB A;  2JMD A;  5FE1 A;  3UVW A;  2MNY A;  3ASL A;  2MIQ A;  5E9L A;  1CHC A;  5CP5 A;  2OO1 A;  3UVD A;  3JVK A;  5G04 B;  5D1M B;  4O78 A;  1F62 A;  4YYD A;  4XY9 A;  4YC9 A;  5EM3 A;  5J0D A;  5F63 A;  5CGP A;  4LDF A;  5C85 A;  4IOO A;  4A4C A;  4RVR A;  2L5E A;  1IYM A;  4YYI A;  2PNX A;  3T7L A;  4XI1 A;  5F62 A;  5II1 A;  5A5R A;  4XY8 A;  5AD3 A;  4QSP A;  1MM2 A;  4OUF A;  4QUT A;  5CFW A;  2MA5 A;  4UIY A;  3M62 A;  4LZR A;  3MUK A;  2G43 A;  4IR4 A;  4GPJ A;  3VK6 A;  4Z93 A;  2VJF A;  2Y1N A;  3U5M A;  3JVJ A;  3LQI A;  5A5N A;  5I29 A;  4I7B A;  4MSX A;  2EA6 A;  4YYJ A;  4FLP A;  4PS5 A;  5L8U A;  4WA6 A;  5CQ4 A;  2LSP B;  5II2 A;  3U5J A;  4I7C A;  4NRB A;  4TU4 A;  2M3H A;  4QR5 A;  3N9O A;  5FE9 A;  5J3X A;  5G05 B;  5EU1 A;  5E7D A;  4NQN A;  2YSJ A;  4O7F A;  2VPE A;  3T6R A;  5D3R A;  4Q6F A;  2RI7 A;  1Z6U A;  3QZT A;  5FE3 A;  3O34 A;  1WEE A;  5EK9 A;  5CUE A;  4O7A A;  5FB1 A;  2EGP A;  5FDZ A;  5DKD A;  2E6R A;  5CQT A;  5HEL A;  2VJE B;  4PTB A;  5FFV A;  1K2F A;  2YRE A;  3L11 A;  4NR6 A;  5DY7 A;  2G6Q A;  4S3O B;  4HBX A;  2VPB A;  5FE2 A;  2LDR A;  5B78 A;  1WFK A;  2MUM A;  3Q2E A;  1T1H A;  1WEP A;  2Y43 A;  3LQJ A;  4A9E A;  2E6S A;  4XUB A;  4YBT A;  2KU3 A;  3U5O A;  4QF3 A;  4UIX A;  4W4U A;  2KRE A;  2OUO A;  4QSR A;  2DVR A;  4MR4 A;  2Y1M A;  2R0S A;  4IR6 A;  4UYD A;  4BBQ A;  4KV4 A;  4MEN A;  5F2P A;  3ZVZ B;  2FUI A;  4PKL A;  2BAY A;  4OGJ A;  4ALG A;  2F42 A;  5K29 A;  3ZTG A;  4UYE A;  5E73 A;  4IC2 A;  3Q2F A;  2YDW A;  5F61 A;  2KWN A;  4V3K C;  5DYX A;  3PHD A;  2D8S A;  4ZDT A;  4L58 A;  2AN6 A;  4YY6 A;  3SOU A;  3PUR A;  2ECT A;  4C9Z A;  4YYK A;  5DIN A;  5H85 A;  5CZG A;  2CT2 A;  5DFD A;  2LXP C;  5H1U A;  4A49 A;  2RS9 B;  3IHP A;  4BW2 A;  4QF2 A;  3ZNI A;  4MVT A;  5I88 A;  2F6J A;  4O75 A;  1VFY A;  2XB1 A;  4XUA A;  4QST A;  5CRZ A;  3SOX A;  2ECV A;  2LGK A;  5CUG A;  2K1J A;  1JM7 A;  1WEU A;  3IU5 A;  4YAT A;  5D3N A;  5FG6 A;  2YUR A;  5FEY A;  5F1L A;  3AAD A;  4I7D A;  5A83 A;  4WZ3 B;  2KE1 A;  5ENH A;  5D3S A;  4NN2 A;  4R8P K;  4GND A;  5TCM A;  4MR5 A;  3FL2 A;  5KTW A;  4R7E A;  2NAA A;  3K2J A;  1FP0 A;  4A9M A;  5EWW A;  2LQ6 A;  2MD7 B;  5FBX A;  2VNF A;  1N72 A;  2YHN A;  5E9K A;  5DFB A;  3LJW A;  5KO4 A;  2L5U A;  4FK5 A;  5FG4 A;  5A85 A;  5TB6 A;  3U5P A;  5F36 A;  2MD8 C;  5ENF A;  4BJX A;  2KGI A;  3PUQ A;  2D82 A;  5L96 A;  3O36 A;  4CUQ A;  2H0D B;  1E4U A;  3N9L A;  1X0J A;  5G4R A;  4UYF A;  2YQD A;  5CQ8 A; 
#chains in the Genus database with same CATH topology
 4N4H A;  4Z1S A;  1RMD A;  2RNX A;  2UZG A;  3HME A;  5HRV A;  5DKC A;  5COI A;  1WIL A;  3N9M A;  5EWV A;  2G45 A;  2DKW A;  4F3I A;  3NG2 A;  3NXB A;  5FE8 A;  3UV2 A;  4O71 A;  1ZBD B;  2D8U A;  2NXB A;  3KV6 A;  5E3D A;  2RNW A;  4MEQ A;  5FE4 A;  4Z6H A;  4QEW A;  4J0S A;  4QSX A;  5D3J A;  5ENJ A;  4AKN A;  5HQ6 A;  1WEO A;  3FM8 C;  3O70 A;  5D26 A;  5AD2 A;  2LRI C;  4GNG A;  2GRC A;  1N87 A;  4FJC A;  4HXN A;  4QUU A;  4F52 B;  5LKX A;  5AME A;  2FFW A;  4HXL A;  2JMJ A;  4NQM A;  5E9V A;  5TDW A;  2N9G A;  4NR4 A;  5CUB A;  4CL9 A;  1WEM A;  4YAD A;  5I83 A;  3RPG B;  5H1T A;  3UVX A;  4LKA A;  2R0V A;  5AIT A;  1VD4 A;  2KYU A;  5DLZ A;  4CCG X;  2KR4 A;  4QEU A;  4HXP A;  4LR6 A;  4C67 A;  5KTX A;  2I8N A;  3N9P A;  5TBN A;  4TT4 A;  4OGC A;  4O74 A;  5FG5 A;  5HJC A;  1XWH A;  3D1D A;  2ZET C;  4UP0 A;  5EWC A;  3U5K A;  2YUC A;  3LQH A;  4UIW A;  1WEQ A;  3G0L A;  4NXJ A;  4QY4 A;  4HXO A;  3MQM A;  4CA1 A;  4LZS A;  2VP7 A;  2KWJ A;  4FO9 A;  4KV1 A;  4NUD A;  4N4I A;  4YBM A;  4V3L C;  2M1R A;  4HXR A;  2G4A A;  3DWD A;  1WUG A;  3SVG A;  4WHW A;  4LC2 A;  2LV9 A;  3GL6 A;  4QB3 A;  1JSP B;  5I7Y A;  3RTR B;  4HBY A;  5LVR A;  4IC3 A;  5CU8 A;  5FFW A;  2L85 A;  4TTE A;  3HCS A;  5HFQ A;  5DYU A;  4N3W A;  4YY4 A;  5HLS A;  4ALH A;  3HTK C;  3ZPV E;  1HYI A;  2MNZ A;  5CUC A;  3SOW A;  2EGM A;  5KHM A;  4A9J A;  2XOZ A;  4AP4 A;  5HQ7 A;  5FE5 A;  2ECN A;  2FSA A;  2ECJ A;  2JMI A;  4Z1Q A;  3ZVY A;  4QSV A;  5F25 A;  3UV4 A;  4A9H A;  1WGM A;  2MT5 A;  3V43 A;  5B8D A;  5IG6 A;  4CFK A;  3SVF A;  4LYI A;  4IR5 A;  4CUU A;  4ZQL A;  5KTU A;  2ECI A;  5DYA A;  3M63 A;  4QSU A;  3QZV A;  2YW8 A;  3MB4 A;  5H1V A;  5AIU A;  2I50 A;  5ACY A;  5IGN A;  2CKL A;  4TT2 A;  4O77 A;  5FE0 A;  4GNF A;  1Z2Q A;  1VYX A;  3P1F A;  4QR3 A;  4NRC A;  5IGM A;  4A9K A;  1MBM A;  5D3H A;  4UYH A;  4L7X A;  4QR4 A;  3O37 A;  3RPG C;  3MB3 A;  3EB5 A;  4BHW A;  5SVX A;  5TRB A;  4A9L A;  3P1D A;  4YK0 A;  3LVQ E;  4WIV A;  4R2Y A;  1WEN A;  4O64 A;  5D3L A;  2M13 A;  5FH7 A;  1G25 A;  4O72 A;  2R10 A;  4YBS A;  4NUE A;  5IID A;  3U5N A;  1WIM A;  1X4U A;  2MKE A;  4Z6I A;  5DBM A;  3DPL R;  5EIS A;  4PCI A;  2YQM A;  5EQ1 A;  5HEN A;  3HMF A;  5LJ1 A;  4NUC A;  4AKG A;  3N9N A;  5JI8 A;  5A82 A;  4UI9 B;  5EI4 A;  4A9I A;  4FIP A;  3VKH A;  1HYJ A;  4MR6 A;  1X4I A;  3H7H A;  4O7C A;  2QJ0 A;  5C13 A;  5E9M A;  5L97 A;  3FJU B;  5D3P A;  4GB0 A;  5KH7 A;  5F3A A;  2OXQ C;  4LLB A;  2DSM A;  3GV4 A;  5LKT A;  2KWO A;  5EP7 A;  2DAT A;  4LK9 A;  1Z60 A;  2E3K A;  4HXK A;  2M85 A;  5HFR A;  5L8T A;  2KGG A;  5A81 A;  5IGK A;  3MHH A;  2VJF B;  4NYX A;  4WZ2 A;  3MUL A;  4LYW A;  4UIT A;  2WP1 A;  2VJE A;  2KFT A;  3MHS A;  4S3O C;  4N4G A;  4UIU A;  4YYG A;  5CY9 A;  5LUU A;  2L43 A;  4UP5 A;  4P5O B;  5DX4 A;  3EB6 A;  5KH9 A;  3N9Q A;  5SVI A;  1WUM A;  5BT5 A;  4UIZ A;  5CS8 A;  4CUS A;  5EWH A;  4XYA A;  4QC1 A;  5D24 A;  2I7K A;  2HDP A;  4MEO A;  5FE7 A;  4PY6 A;  5DKH A;  4QZS A;  2EXU A;  4QYL A;  1DCQ A;  4OGI A;  4CUT A;  4MEP A;  4IR3 A;  5CQA A;  5KH3 A;  2L0B A;  2YQL A;  5B75 A;  5C8G A;  3JVM A;  2CON A;  5I3L A;  4YH4 A;  3ONI A;  5CQ5 A;  3FAN A;  5FER A;  5FH8 A;  5A5O A;  4WZ0 A;  4QC3 A;  2YYR A;  4LAD B;  4LJN A;  3ZYU A;  1EQF A;  3LXJ A;  4CUR A;  2OSS A;  1WEV A;  2C2V S;  5I1Q A;  3HCU A;  1WEW A;  3LRQ A;  3I3J A;  4IOR A;  2RNY A;  4YYM A;  1WE9 A;  2YT5 A;  2L80 A;  2YHO A;  4N4F A;  5C89 A;  3LJU X;  5E74 A;  5ENG A;  5EPS A;  2ECG A;  4NR7 A;  2YVR A;  1WES A;  4NS5 A;  3S91 A;  4QBM A;  3C5K A;  5B76 A;  2VPD A;  5CRM A;  2CKL B;  5EPB A;  5D0C A;  4F1P A;  5C11 A;  2KKY A;  2QIC A;  3FAO A;  5L99 A;  4HXM A;  5HQ5 A;  3ZYQ A;  5TDR A;  3MDB C;  3IU6 A;  4TQN A;  5AMF A;  5B79 A;  5KU3 A;  4AYC A;  4UIV A;  2L75 A;  2K17 A;  2YU4 A;  4YYH A;  4A9F A;  5HRX A;  1MM3 A;  5ENC A;  4B7Y C;  5CUD A;  2E7O A;  4O70 A;  5B77 A;  3O33 A;  2CSY A;  3U5L A;  5E0R A;  2YYN A;  5G4S A;  3KNV A;  5BT3 A;  2L84 A;  5FE6 A;  1E6I A;  5ENI A;  5I7X A;  5DKA A;  2IQJ A;  5I80 A;  4AVX A;  5G0F A;  5K3Q A;  3MXF A;  5F5Z A;  1V87 A;  2LN0 A;  4O62 A;  4LRG A;  2YEK A;  4AI6 A;  1F68 A;  4HBV A;  3DAI A;  4ZC9 A;  5ETB A;  3I2D A;  5EGU A;  4BW3 A;  3SVH A;  2YSM A;  5DW2 A;  4Q0O A;  4CFL A;  5CQ7 A;  2H0D A;  2P57 A;  3ZPV 1;  1JM7 B;  2YEL A;  5EWD A;  2LXH C;  2KWK A;  3KV5 A;  5CQ3 A;  4Z0R A;  5IBN A;  4LYS A;  4QNS A;  3G0J A;  2XP0 A;  4AUQ B;  1BOR A;  3GG3 A;  4O7E A;  4A9N A;  5ETD A;  4YYN A;  2IDA A;  4AKH A;  2CSV A;  5C4Q A;  4QEV A;  2KIZ A;  3HCT A;  5FFY A;  2YEM A;  5HRW A;  5BT4 A;  5EYA F;  5D25 A;  3T9K A;  5C87 A;  3DQV R;  2DVQ A;  4C66 A;  5D1L B;  4HBW A;  4H9D A;  3QZS A;  3HMH A;  3UW9 A;  5CUA A;  4J1P A;  2DVS A;  4CLB A;  2RO1 A;  2RFJ A;  4UYF B;  4BW1 A;  4O76 A;  5LKZ A;  5L98 A;  5HEM A;  1X4J A;  3DWY A;  3SHB A;  5LKU A;  5E3G A;  5EIC A;  4QYD A;  5I89 A;  5HM0 A;  4X2I A;  2QIZ A;  4NR8 A;  5IGL A;  3PLW A;  5D7X A;  4ZW1 A;  5I86 A;  5EPR A;  1U6G B;  2PUY A;  1ZS5 A;  2DJA A;  3UV5 A;  4ZUX U;  5DYC A;  3SUB A;  4A0C D;  5EVA A;  2RSD A;  3O35 A;  5E9Y A;  5FH6 A;  3VKG A;  4IOQ A;  4Q0N A;  4YAX A;  4NYV A;  2RR4 A;  2F6N A;  2ECW A;  2XOC A;  2XEU A;  3DDT A;  3FKM X;  4PCE A;  3L1Z B;  3O7A A;  3KQI A;  4PPE A;  4TT6 A;  5TAB A;  4E96 A;  1JOC A;  4HXS A;  2KKX A;  5A5P A;  2E7N A;  4TS8 A;  2LGL A;  3C6W A;  5DW1 A;  5LCW B;  5HCL A;  2FUU A;  3LVR E;  4TZ8 A;  4UYG A;  4TYL A;  3M99 A;  3Q1D A;  4WHU A;  2MJV B;  4MR3 A;  5A7C A;  3JVL A;  5DLX A;  4J3I A;  5DFC A;  1JM4 B;  3RCW A;  4KCX A;  5D1K B;  5A5Q A;  4TU6 A;  5LJ2 A;  2L7P A;  4BW4 A;  5CPE A;  4AYC B;  2DWW A;  4B86 C;  3UVY A;  4QQ4 A;  2JRJ A;  3JUE A;  4TZ2 A;  5ENE A;  5FB0 A;  4NR9 A;  4QSW A;  2R0Y A;  5EA1 A;  4QSS A;  2H60 A;  4QSQ A;  4OGE A;  4YH3 A;  3AQA A;  2M6M A;  5CQ6 A;  2D9E A;  2YW5 A;  4A9O A;  5C7N A;  5F60 A;  2EJN A;  4LZ2 A;  5I40 A;  3TLP A;  5EV9 A;  2CSZ A;  4A4B A;  4Y03 A;  2LGV A;  5E9I A;  2LGG A;  5LVQ A;  1FBV A;  4GNE A;  5JG6 A;  1LDJ B;  5H9M A;  4NYW A;  4AKI A;  2K4D A;  5JWM A;  3P1E A;  4DON A;  2MA6 A;  2VPG A;  2KTB B;  3P5O A;  2OWA A;  2C2L A;  3D7C A;  2EOD A;  4J0R A;  2K16 A;  5D3T A;  4YAB A;  4NR5 A;  3L1X A;  5LJ0 A;  2FD4 A;  2DVV A;  1DVP A;  3P1C A;  4TKP B;  2DX8 A;  3S92 A;  2HYE D;  4NRA A;  5CTL A;  4X3G A;  2WP2 A;  4O7B A;  4CUP A;  5A5S A;  1LDK C;  3D1B A;  3O47 A;  5F1H A;  5ENB A;  2JMD A;  5FE1 A;  3UVW A;  2MNY A;  3ASL A;  2MIQ A;  5E9L A;  1CHC A;  5CP5 A;  3KDE C;  2OO1 A;  3UVD A;  3JVK A;  5G04 B;  5D1M B;  4O78 A;  1F62 A;  4YYD A;  4XY9 A;  4YC9 A;  5EM3 A;  5J0D A;  5F63 A;  5CGP A;  4LDF A;  5C85 A;  4IOO A;  4A4C A;  4RVR A;  2L5E A;  1IYM A;  4YYI A;  2PNX A;  4Z0O A;  3T7L A;  4XI1 A;  5F62 A;  5II1 A;  3ERR A;  5A5R A;  4XY8 A;  5AD3 A;  4QSP A;  1MM2 A;  4OUF A;  5SVY A;  4QUT A;  5CFW A;  2MA5 A;  4UIY A;  3E2D A;  3M62 A;  4LZR A;  3MUK A;  2G43 A;  4IR4 A;  4GPJ A;  2JM3 A;  3VK6 A;  4Z93 A;  2VJF A;  2Y1N A;  3U5M A;  3JVJ A;  3LQI A;  5A5N A;  3LDY A;  5I29 A;  4I7B A;  4MSX A;  2EA6 A;  4YYJ A;  4FLP A;  4PS5 A;  5L8U A;  4WA6 A;  5CQ4 A;  2LSP B;  5II2 A;  3U5J A;  4I7C A;  4NRB A;  4TU4 A;  2M3H A;  4QR5 A;  3N9O A;  5FE9 A;  5J3X A;  5G05 B;  5EU1 A;  5E7D A;  4NQN A;  2YSJ A;  4O7F A;  2VPE A;  3T6R A;  5D3R A;  4Q6F A;  2RI7 A;  1Z6U A;  3QZT A;  5FE3 A;  3O34 A;  1WEE A;  5EK9 A;  2XOY A;  5CUE A;  4O7A A;  5FB1 A;  2EGP A;  5FDZ A;  2B0O E;  5DKD A;  2E6R A;  5CQT A;  5HEL A;  2VJE B;  4PTB A;  5FFV A;  1K2F A;  2YRE A;  3L11 A;  4NR6 A;  5DY7 A;  2G6Q A;  4S3O B;  4HBX A;  2CRR A;  2VPB A;  5FE2 A;  2LDR A;  5SVI B;  5B78 A;  1WFK A;  2MUM A;  3Q2E A;  1T1H A;  1WEP A;  2Y43 A;  3LQJ A;  4A9E A;  2E6S A;  4XUB A;  4YBT A;  2KU3 A;  2LAU A;  3U5O A;  4QF3 A;  4UIX A;  4W4U A;  2KRE A;  2OUO A;  4QSR A;  2DVR A;  4MR4 A;  2Y1M A;  2R0S A;  4IR6 A;  4UYD A;  4BBQ A;  1ZKR A;  4KV4 A;  4MEN A;  2CRW A;  5F2P A;  3ZVZ B;  2FUI A;  4PKL A;  2BAY A;  4OGJ A;  4ALG A;  2F42 A;  5K29 A;  3ZTG A;  4UYE A;  5E73 A;  4IC2 A;  3Q2F A;  2YDW A;  5F61 A;  2KWN A;  4V3K C;  5DYX A;  3PHD A;  2D8S A;  4ZDT A;  4L58 A;  2AN6 A;  4YY6 A;  3SOU A;  3PUR A;  1PUO A;  2ECT A;  3FEH A;  4C9Z A;  4YYK A;  5DIN A;  5H85 A;  5CZG A;  2CT2 A;  5DFD A;  2LXP C;  5H1U A;  4A49 A;  2RS9 B;  3IHP A;  4BW2 A;  4QF2 A;  3ZNI A;  2JUN A;  4MVT A;  5I88 A;  2F6J A;  4O75 A;  1VFY A;  2XB1 A;  4XUA A;  4QST A;  5CRZ A;  3SOX A;  2ECV A;  2LGK A;  3M7K A;  5CUG A;  2K1J A;  1JM7 A;  1WEU A;  3IU5 A;  4YAT A;  5D3N A;  5FG6 A;  2YUR A;  5FEY A;  5F1L A;  3AAD A;  4I7D A;  5A83 A;  4WZ3 B;  2KE1 A;  5ENH A;  5D3S A;  4NN2 A;  4R8P K;  4GND A;  5TCM A;  4MR5 A;  3FL2 A;  5KTW A;  4R7E A;  2NAA A;  3K2J A;  1FP0 A;  4A9M A;  5EWW A;  2LQ6 A;  2MD7 B;  5FBX A;  2VNF A;  1N72 A;  2YHN A;  5E9K A;  5DFB A;  3LJW A;  5KO4 A;  2L5U A;  4FK5 A;  5FG4 A;  5A85 A;  5TB6 A;  3U5P A;  5F36 A;  2MD8 C;  5ENF A;  4BJX A;  2KGI A;  2E61 A;  3PUQ A;  2D82 A;  5L96 A;  3O36 A;  4CUQ A;  2H0D B;  1E4U A;  3N9L A;  1X0J A;  5G4R A;  4UYF A;  2YQD A;  5CQ8 A; 
#chains in the Genus database with same CATH homology
 4N4H A;  4Z1S A;  1RMD A;  2RNX A;  2UZG A;  3HME A;  5HRV A;  5DKC A;  5COI A;  1WIL A;  3N9M A;  5EWV A;  2G45 A;  2DKW A;  4F3I A;  3NG2 A;  3NXB A;  5FE8 A;  3UV2 A;  4O71 A;  1ZBD B;  2NXB A;  3KV6 A;  5E3D A;  2RNW A;  4MEQ A;  5FE4 A;  4Z6H A;  4QEW A;  4J0S A;  4QSX A;  5D3J A;  5ENJ A;  4AKN A;  5HQ6 A;  1WEO A;  3O70 A;  5D26 A;  5AD2 A;  2LRI C;  4GNG A;  2GRC A;  1N87 A;  4FJC A;  4HXN A;  4QUU A;  4F52 B;  5LKX A;  5AME A;  4HXL A;  2JMJ A;  4NQM A;  5E9V A;  5TDW A;  2N9G A;  4NR4 A;  5CUB A;  4CL9 A;  1WEM A;  4YAD A;  5I83 A;  3RPG B;  5H1T A;  3UVX A;  4LKA A;  2R0V A;  5AIT A;  1VD4 A;  2KYU A;  5DLZ A;  4CCG X;  2KR4 A;  4QEU A;  4HXP A;  4LR6 A;  4C67 A;  5KTX A;  2I8N A;  3N9P A;  5TBN A;  4TT4 A;  4O74 A;  5FG5 A;  5HJC A;  1XWH A;  4UP0 A;  2ZET C;  5EWC A;  3U5K A;  2YUC A;  3LQH A;  4UIW A;  1WEQ A;  3G0L A;  4NXJ A;  4QY4 A;  4HXO A;  3MQM A;  4CA1 A;  4LZS A;  2VP7 A;  2KWJ A;  4FO9 A;  4KV1 A;  4NUD A;  4N4I A;  4YBM A;  4V3L C;  2M1R A;  4HXR A;  2G4A A;  1WUG A;  3SVG A;  4WHW A;  4LC2 A;  2LV9 A;  3GL6 A;  4QB3 A;  1JSP B;  5I7Y A;  3RTR B;  4HBY A;  5LVR A;  4IC3 A;  5CU8 A;  5FFW A;  2L85 A;  4TTE A;  3HCS A;  5HFQ A;  5DYU A;  4N3W A;  4YY4 A;  5HLS A;  4ALH A;  3HTK C;  3ZPV E;  1HYI A;  2MNZ A;  5CUC A;  3SOW A;  5KHM A;  4A9J A;  4AP4 A;  5HQ7 A;  5FE5 A;  2ECN A;  2FSA A;  2ECJ A;  2JMI A;  4Z1Q A;  3ZVY A;  4QSV A;  5F25 A;  3UV4 A;  4A9H A;  1WGM A;  2MT5 A;  3V43 A;  5B8D A;  5IG6 A;  4CFK A;  3SVF A;  4LYI A;  4IR5 A;  4CUU A;  4ZQL A;  5KTU A;  2ECI A;  5DYA A;  3M63 A;  4QSU A;  3QZV A;  2YW8 A;  3MB4 A;  5H1V A;  5AIU A;  2I50 A;  5ACY A;  5IGN A;  2CKL A;  4TT2 A;  4O77 A;  5FE0 A;  4GNF A;  1Z2Q A;  1VYX A;  3P1F A;  4QR3 A;  4NRC A;  5IGM A;  4A9K A;  5D3H A;  4UYH A;  4L7X A;  4QR4 A;  3O37 A;  3RPG C;  3MB3 A;  3EB5 A;  4BHW A;  5TRB A;  4A9L A;  3P1D A;  4YK0 A;  4WIV A;  4R2Y A;  1WEN A;  4O64 A;  5D3L A;  5FH7 A;  1G25 A;  4O72 A;  2R10 A;  4YBS A;  4NUE A;  5IID A;  3U5N A;  1WIM A;  1X4U A;  4Z6I A;  5DBM A;  3DPL R;  5EIS A;  4PCI A;  2YQM A;  5EQ1 A;  5HEN A;  3HMF A;  5LJ1 A;  4NUC A;  3N9N A;  4UI9 B;  5JI8 A;  5A82 A;  5EI4 A;  4A9I A;  4FIP A;  1HYJ A;  4MR6 A;  1X4I A;  4O7C A;  2QJ0 A;  5C13 A;  5E9M A;  5L97 A;  4GB0 A;  5D3P A;  5KH7 A;  5F3A A;  2OXQ C;  4LLB A;  3GV4 A;  5LKT A;  2KWO A;  5EP7 A;  2DAT A;  4LK9 A;  1Z60 A;  2E3K A;  4HXK A;  2M85 A;  5HFR A;  5L8T A;  2KGG A;  5A81 A;  5IGK A;  3MHH A;  2VJF B;  4NYX A;  4WZ2 A;  3MUL A;  4LYW A;  4UIT A;  2WP1 A;  2VJE A;  2KFT A;  3MHS A;  4S3O C;  4N4G A;  4UIU A;  4YYG A;  5CY9 A;  5LUU A;  2L43 A;  4UP5 A;  4P5O B;  5DX4 A;  3EB6 A;  5KH9 A;  3N9Q A;  1WUM A;  5BT5 A;  4UIZ A;  5CS8 A;  4CUS A;  5EWH A;  4XYA A;  4QC1 A;  5D24 A;  2I7K A;  2HDP A;  4MEO A;  5FE7 A;  4PY6 A;  5DKH A;  4QZS A;  4QYL A;  4OGI A;  4CUT A;  4MEP A;  4IR3 A;  5CQA A;  5KH3 A;  2L0B A;  2YQL A;  5B75 A;  5C8G A;  3JVM A;  5I3L A;  4YH4 A;  3ONI A;  5CQ5 A;  5FER A;  5FH8 A;  5A5O A;  4WZ0 A;  4QC3 A;  2YYR A;  4LAD B;  4LJN A;  3ZYU A;  1EQF A;  3LXJ A;  4CUR A;  2OSS A;  1WEV A;  2C2V S;  5I1Q A;  3HCU A;  1WEW A;  3LRQ A;  3I3J A;  4IOR A;  2RNY A;  4YYM A;  1WE9 A;  2YT5 A;  2L80 A;  2YHO A;  4N4F A;  5C89 A;  5E74 A;  5ENG A;  5EPS A;  2ECG A;  4NR7 A;  1WES A;  4NS5 A;  3S91 A;  4QBM A;  3C5K A;  5B76 A;  2VPD A;  5CRM A;  2CKL B;  5EPB A;  5D0C A;  5C11 A;  2QIC A;  5L99 A;  4HXM A;  5HQ5 A;  3ZYQ A;  5TDR A;  3IU6 A;  4TQN A;  5AMF A;  5B79 A;  5KU3 A;  4AYC A;  4UIV A;  2L75 A;  2K17 A;  2YU4 A;  4YYH A;  4A9F A;  5HRX A;  1MM3 A;  5ENC A;  4B7Y C;  5CUD A;  2E7O A;  4O70 A;  5B77 A;  3O33 A;  2CSY A;  3U5L A;  5E0R A;  2YYN A;  5G4S A;  3KNV A;  5BT3 A;  2L84 A;  5FE6 A;  1E6I A;  5ENI A;  5I7X A;  5DKA A;  5I80 A;  4AVX A;  5G0F A;  3MXF A;  5F5Z A;  1V87 A;  2LN0 A;  4LRG A;  2YEK A;  1F68 A;  4HBV A;  3DAI A;  4ZC9 A;  5ETB A;  3I2D A;  5EGU A;  4BW3 A;  3SVH A;  2YSM A;  5DW2 A;  4Q0O A;  4CFL A;  5CQ7 A;  2H0D A;  3ZPV 1;  1JM7 B;  2YEL A;  5EWD A;  2LXH C;  2KWK A;  3KV5 A;  5CQ3 A;  5IBN A;  4LYS A;  4QNS A;  3G0J A;  4AUQ B;  1BOR A;  3GG3 A;  4O7E A;  4A9N A;  5ETD A;  4YYN A;  2IDA A;  3HCT A;  5C4Q A;  4QEV A;  2KIZ A;  5EYA F;  5FFY A;  2YEM A;  5HRW A;  5BT4 A;  5D25 A;  5C87 A;  3DQV R;  2DVQ A;  4C66 A;  5D1L B;  4HBW A;  3QZS A;  3HMH A;  3UW9 A;  5CUA A;  4J1P A;  2DVS A;  4CLB A;  2RO1 A;  2RFJ A;  4UYF B;  4BW1 A;  4O76 A;  5LKZ A;  5L98 A;  5HEM A;  1X4J A;  3DWY A;  3SHB A;  5LKU A;  5E3G A;  5EIC A;  4QYD A;  5I89 A;  5HM0 A;  4X2I A;  2QIZ A;  4NR8 A;  5IGL A;  5D7X A;  4ZW1 A;  5I86 A;  5EPR A;  1U6G B;  2PUY A;  1ZS5 A;  3UV5 A;  4ZUX U;  5DYC A;  4A0C D;  5EVA A;  2RSD A;  3O35 A;  5E9Y A;  5FH6 A;  4IOQ A;  4Q0N A;  4YAX A;  4NYV A;  2F6N A;  2ECW A;  2XEU A;  3FKM X;  4PCE A;  3L1Z B;  3O7A A;  3KQI A;  4PPE A;  4TT6 A;  5TAB A;  4E96 A;  1JOC A;  4HXS A;  5A5P A;  2E7N A;  4TS8 A;  2LGL A;  3C6W A;  5DW1 A;  5LCW B;  5HCL A;  2FUU A;  4TZ8 A;  4UYG A;  4TYL A;  3M99 A;  4WHU A;  2MJV B;  4MR3 A;  5A7C A;  3JVL A;  5DLX A;  4J3I A;  5DFC A;  1JM4 B;  3RCW A;  4KCX A;  5D1K B;  5A5Q A;  4TU6 A;  5LJ2 A;  4AYC B;  4BW4 A;  5CPE A;  4B86 C;  2DWW A;  3UVY A;  2JRJ A;  4TZ2 A;  5ENE A;  5FB0 A;  4NR9 A;  4QSW A;  2R0Y A;  5EA1 A;  4QSS A;  2H60 A;  4QSQ A;  4YH3 A;  3AQA A;  2M6M A;  5CQ6 A;  2D9E A;  2YW5 A;  4A9O A;  5C7N A;  5F60 A;  4LZ2 A;  5I40 A;  2CSZ A;  3TLP A;  5EV9 A;  4A4B A;  4Y03 A;  2LGV A;  5E9I A;  2LGG A;  5LVQ A;  1FBV A;  4GNE A;  5JG6 A;  1LDJ B;  5H9M A;  4NYW A;  2K4D A;  5JWM A;  3P1E A;  4DON A;  2MA6 A;  2VPG A;  2KTB B;  3P5O A;  2C2L A;  3D7C A;  2EOD A;  4J0R A;  2K16 A;  5D3T A;  4YAB A;  4NR5 A;  3L1X A;  5LJ0 A;  2DVV A;  1DVP A;  3P1C A;  4TKP B;  2DX8 A;  3S92 A;  2HYE D;  4NRA A;  5CTL A;  4X3G A;  2WP2 A;  4O7B A;  4CUP A;  5A5S A;  1LDK C;  5F1H A;  5ENB A;  2JMD A;  5FE1 A;  3UVW A;  2MNY A;  3ASL A;  2MIQ A;  5E9L A;  1CHC A;  5CP5 A;  2OO1 A;  3UVD A;  3JVK A;  5G04 B;  5D1M B;  4O78 A;  1F62 A;  4YYD A;  4XY9 A;  4YC9 A;  5EM3 A;  5J0D A;  5F63 A;  5CGP A;  4LDF A;  5C85 A;  4IOO A;  4A4C A;  4RVR A;  2L5E A;  1IYM A;  4YYI A;  2PNX A;  3T7L A;  4XI1 A;  5F62 A;  5II1 A;  5A5R A;  4XY8 A;  5AD3 A;  4QSP A;  1MM2 A;  4OUF A;  4QUT A;  5CFW A;  2MA5 A;  4UIY A;  3M62 A;  4LZR A;  3MUK A;  2G43 A;  4IR4 A;  4GPJ A;  3VK6 A;  4Z93 A;  2VJF A;  2Y1N A;  3U5M A;  3JVJ A;  3LQI A;  5A5N A;  5I29 A;  4I7B A;  4MSX A;  2EA6 A;  4YYJ A;  4FLP A;  4PS5 A;  5L8U A;  4WA6 A;  5CQ4 A;  2LSP B;  5II2 A;  3U5J A;  4I7C A;  4NRB A;  4TU4 A;  2M3H A;  4QR5 A;  3N9O A;  5FE9 A;  5J3X A;  5G05 B;  5EU1 A;  5E7D A;  4NQN A;  2YSJ A;  4O7F A;  2VPE A;  3T6R A;  5D3R A;  4Q6F A;  2RI7 A;  1Z6U A;  3QZT A;  5FE3 A;  3O34 A;  1WEE A;  5EK9 A;  5CUE A;  4O7A A;  5FB1 A;  2EGP A;  5FDZ A;  5DKD A;  2E6R A;  5CQT A;  5HEL A;  2VJE B;  4PTB A;  5FFV A;  1K2F A;  2YRE A;  3L11 A;  4NR6 A;  5DY7 A;  2G6Q A;  4S3O B;  4HBX A;  2VPB A;  5FE2 A;  2LDR A;  5B78 A;  1WFK A;  2MUM A;  3Q2E A;  1T1H A;  1WEP A;  2Y43 A;  3LQJ A;  4A9E A;  2E6S A;  4XUB A;  4YBT A;  2KU3 A;  3U5O A;  4QF3 A;  4UIX A;  4W4U A;  2KRE A;  2OUO A;  4QSR A;  2DVR A;  4MR4 A;  2Y1M A;  2R0S A;  4IR6 A;  4UYD A;  4BBQ A;  4KV4 A;  4MEN A;  5F2P A;  3ZVZ B;  2FUI A;  4PKL A;  2BAY A;  4OGJ A;  4ALG A;  2F42 A;  5K29 A;  3ZTG A;  4UYE A;  5E73 A;  4IC2 A;  3Q2F A;  2YDW A;  5F61 A;  2KWN A;  4V3K C;  5DYX A;  3PHD A;  2D8S A;  4ZDT A;  4L58 A;  2AN6 A;  4YY6 A;  3SOU A;  3PUR A;  2ECT A;  4C9Z A;  4YYK A;  5DIN A;  5H85 A;  5CZG A;  2CT2 A;  5DFD A;  2LXP C;  5H1U A;  4A49 A;  2RS9 B;  3IHP A;  4BW2 A;  4QF2 A;  3ZNI A;  4MVT A;  5I88 A;  2F6J A;  4O75 A;  1VFY A;  2XB1 A;  4XUA A;  4QST A;  5CRZ A;  3SOX A;  2ECV A;  2LGK A;  5CUG A;  2K1J A;  1JM7 A;  1WEU A;  3IU5 A;  4YAT A;  5D3N A;  5FG6 A;  2YUR A;  5FEY A;  5F1L A;  3AAD A;  4I7D A;  5A83 A;  4WZ3 B;  2KE1 A;  5ENH A;  5D3S A;  4NN2 A;  4R8P K;  4GND A;  5TCM A;  4MR5 A;  3FL2 A;  5KTW A;  4R7E A;  2NAA A;  3K2J A;  1FP0 A;  4A9M A;  5EWW A;  2LQ6 A;  2MD7 B;  5FBX A;  2VNF A;  1N72 A;  2YHN A;  5E9K A;  5DFB A;  3LJW A;  5KO4 A;  2L5U A;  4FK5 A;  5FG4 A;  5A85 A;  5TB6 A;  3U5P A;  5F36 A;  2MD8 C;  5ENF A;  4BJX A;  2KGI A;  3PUQ A;  2D82 A;  5L96 A;  3O36 A;  4CUQ A;  2H0D B;  1E4U A;  3N9L A;  1X0J A;  5G4R A;  4UYF A;  2YQD A;  5CQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...