2FSAA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the h3(1-15)k4me2 bound state
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
168
Chain Sequence
DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords bromodomain PHD finger transcription factor
total genus 50
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2fsaA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2fsaA01
1WEMA 4QSQA 5DW2A 5AD3A 1WEWA 3G0LA 4OGJA 5ETBA 3TLPA 2DVSA 5HRXA 5KH9A 3SOWA 4TTEA 2WP2A 4ZC9A 5CQ7A 4ZW1A 4QR5A 5JI8A 2VJFA 3VK6A 4LZ2A 1ZBDB 2YSJA 2MD7B 5LVQA 5HQ5A 4Z1QA 5COIA 5F5ZA 5B75A 4BJXA 4NR6A 2R0SA 5CQ4A 4A0CD 5EM3A 5LJ1A 4NXJA 5EPBA 5EQ1A 4A9OA 5CPEA 5D25A 2E3KA 4LYIA 3PUQA 4UIVA 3KNVA 5DW1A 5ENEA 4MENA 1WEOA 1Z60A 3HMEA 3AADA 4QSRA 5CQ8A 3SOXA 4J0RA 4O7BA 5FG5A 4S3OC 1IYMA 5DX4A 4YC9A 3MHSA 4KV1A 4YY6A 2M85A 5KU3A 5H9MA 1WEEA 4UIWA 5EWWA 4BW2A 4QSPA 5E3GA 3M62A 2MA5A 4IORA 4XY9A 4ZUXU 5AD2A 5H1TA 5B78A 5CQ5A 3SVHA 2YQMA 3JVKA 4HXKA 5I1QA 4QR4A 5ENJA 4F3IA 4GNFA 2Y43A 2H0DA 5D3LA 5IGKA 5E9LA 1WGMA 3LQHA 2MUMA 1F62A 2YW5A 5C89A 4RVRA 5LJ0A 4PCIA 2LQ6A 4IR6A 2ECWA 2OO1A 5EGUA 5JWMA 5G04B 2YSMA 5CQ6A 5E9MA 5I29A 4GNGA 4R2YA 4UYEA 5CP5A 4YYJA 2BAYA 5FH7A 2RSDA 4PS5A 4YBMA 5C85A 5CUBA 2K16A 3UVDA 4XI1A 2YQDA 3N9QA 3LJWA 2ECGA 5KH3A 4O64A 3O35A 3N9OA 4C66A 2PNXA 2KE1A 3IU5A 4MEPA 1WIMA 5B8DA 5E9YA 5CY9A 1Z6UA 4O75A 4QSWA 3HMFA 1K2FA 5HQ7A 2CKLA 3T7LA 4AUQB 2JMJA 5FE9A 5D1MB 5FFWA 4HXSA 1MM2A 5FE7A 5KTWA 4NR9A 2KIZA 5HM0A 4WZ2A 2RO1A 4A9HA 5EP7A 4QEUA 5ETDA 5II2A 3LQIA 3JVLA 4UIXA 4WZ3B 2KU3A 2VJFB 5I88A 5FG6A 5D1KB 2VPBA 2RFJA 4UYDA 4ALGA 4AYCB 4W4UA 5EYAF 2I7KA 5E0RA 4UITA 4YATA 5I7XA 3I2DA 4HBXA 5LUUA 4YADA 2R0VA 1CHCA 5A7CA 2HYED 4Q0OA 2K17A 4C9ZA 5FERA 2NAAA 2YHOA 4MR4A 4QZSA 4A9FA 5B79A 4IR5A 4YYDA 3EB5A 4QYDA 4CUQA 1JM7A 4V3KC 5DKCA 2EA6A 4Z6HA 4FO9A 3KV6A 2H0DB 3MULA 4GPJA 4FLPA 3P1FA 4I7BA 3PHDA 2Y1NA 5EVAA 3U5LA 3NG2A 4LLBA 5J3XA 3Q2FA 2YELA 4N4IA 3HMHA 5D3TA 4R7EA 4HBYA 2K4DA 3MQMA 2MJVB 4MEOA 4CL9A 1VD4A 5FG4A 5HQ6A 2QJ0A 4PCEA 2E6SA 5TDRA 4A9IA 5H1UA 2G4AA 5HENA 4UP0A 4A49A 3N9NA 3I3JA 4XUAA 2VJEB 4Y03A 2DX8A 2IDAA 4WHWA 5LKTA 2YU4A 5KTXA 2XEUA 4TU4A 3GV4A 1HYJA 5E9KA 5CTLA 4O7AA 4YK0A 2M6MA 5L8TA 5C7NA 4UYFB 5D26A 2KFTA 4GNEA 5DYXA 4IR3A 4S3OB 4NR5A 2YT5A 3IHPA 5ENCA 4PTBA 2EGPA 5E3DA 5DY7A 2MT5A 2DVRA 4UIYA 2MD8C 4F52B 2R0YA 4QY4A 4LZSA 2I50A 5IGMA 3K2JA 3M63A 3U5KA 4NRBA 3UV2A 2KREA 4UIZA 2RNYA 3NXBA 5HELA 4QSTA 5EV9A 2MIQA 3DQVR 5DYUA 4A9LA 4KV4A 1X4UA 5ENHA 5FB0A 5TDWA 5L98A 4MR6A 1LDKC 5KO4A 5CFWA 5IBNA 2YREA 5FE5A 4A9KA 1DVPA 2CSYA 5IGLA 2KWKA 2L75A 3IU6A 5CQ3A 4J0SA 3RCWA 5EWHA 3ZNIA 2K1JA 5DYCA 5F60A 4LRGA 1F68A 2YW8A 4HBVA 4PKLA 4WA6A 2KWJA 5BT3A 5CGPA 5DLXA 2Y1MA 5LKXA 1X4IA 2KGGA 2E6RA 5DKAA 2LXPC 4O78A 1XWHA 3P1CA 2KGIA 4QNSA 4NQNA 3U5PA 5C8GA 2CKLB 3ZPVE 2DKWA 2F6JA 5D24A 3P5OA 5I80A 5A5RA 4HBWA 4MR5A 5F3AA 5D1LB 4N4FA 5BT4A 4QC3A 2E7NA 3N9MA 5TB6A 4YY4A 3ZVYA 3MUKA 5DINA 4CUSA 4J1PA 3FL2A 3L1ZB 2VP7A 5CRMA 2FUUA 5G0FA 4YYMA 5K29A 4CUTA 2VJEA 5F63A 3SVGA 4XUBA 5C11A 2R10A 5LVRA 4TT4A 5D0CA 4CFKA 2PUYA 5CRZA 4QC1A 5BT5A 4O71A 2LGKA 1V87A 2HDPA 2L0BA 5CUAA 5F36A 4IOOA 4PY6A 3C6WA 5A5SA 2YYRA 1HYIA 4UYGA 4BBQA 5CUCA 4YYIA 3EB6A 4MR3A 5FH6A 1ZS5A 3O37A 4O77A 4X3GA 2VPDA 4Q0NA 4HXNA 5KTUA 4BW1A 3JVMA 3LRQA 4Q6FA 4NRAA 5ACYA 5CUDA 5I83A 1G25A 2YYNA 5FDZA 5FE1A 4ZQLA 3G0JA 5IG6A 2YDWA 4BW4A 4I7DA 4UYHA 4NQMA 2YQLA 4CURA 4L7XA 5FH8A 2QICA 3UVYA 3RPGB 3ONIA 5F25A 3GL6A 2L85A 4NYVA 3GG3A 2NXBA 2G6QA 3MXFA 5CS8A 4QSXA 5A5QA 5A5OA 1WESA 2VNFA 4AYCA 2ECTA 5FE8A 5D3HA 2F6NA 3N9PA 1T1HA 2KYUA 2H60A 3LXJA 4NYXA 2EODA 5L96A 2MA6A 4BW3A 2RNWA 5E73A 1WENA 2L84A 4NR4A 4HXOA 4O76A 4E96A 5C87A 5DKDA 3O7AA 4O72A 4MEQA 4DONA 2DATA 5DFDA 1JM7B 3U5OA 3ZYQA 4N3WA 5LJ2A 5L97A 4FIPA 1JM4B 1WE9A 3M99A 3D7CA 5IIDA 1LDJB 2XB1A 2YURA 5B76A 5FFVA 1Z2QA 4A9NA 2ECIA 5HFQA 3PURA 3O70A 2RNXA 2N9GA 5CUEA 5ENGA 5FB1A 5FE4A 4A9MA 2RI7A 4B7YC 3P1EA 5F62A 3QZSA 4WIVA 3UW9A 2MNZA 5JG6A 4UYFA 2D82A 4LC2A 1EQFA 5TABA 5G05B 2LXHC 5AITA 3KV5A 2AN6A 4TKPB 5HRWA 5HRVA 5CU8A 5A82A 3S91A 4TYLA 2JMIA 4NS5A 1E6IA 5ENFA 3SHBA 3HTKC 4CA1A 1U6GB 1WUGA 4Z6IA 5J0DA 1N87A 5D3NA 5F1HA 5H85A 5DFBA 2L80A 5EK9A 5IGNA 5I3LA 4NRCA 2DVQA 2DWWA 3MB3A 1X0JA 2I8NA 4NUCA 5FE0A 2CT2A 5TRBA 4QUUA 3FKMX 4HXPA 4TZ8A 5I40A 2YHNA 5EPSA 4IR4A 5D3SA 5EWDA 4LK9A 3T6RA 5EISA 2CSZA 4AKNA 5I89A 4QUTA 1FBVA 4O74A 3O34A 2OSSA 5HJCA 3P1DA 2RS9B 1X4JA 5E9IA 3HCTA 5D7XA 3O33A 4QSVA 4A4CA 4B86C 3V43A 5F61A 4OGIA 4N4GA 5EICA 4NR7A 4QYLA 1WEPA 2C2VS 4PPEA 4YH4A 2KWOA 3HCSA 1BORA 1VYXA 2VPEA 4HXLA 5DLZA 2GRCA 4YBTA 5DKHA 5D3JA 4YYHA 4LJNA 4QF3A 2KTBB 2L5EA 4QR3A 5EU1A 2UZGA 3UV5A 2YUCA 2LN0A 2MNYA 5FE2A 5F1LA 4NN2A 5D3RA 3QZVA 4CUPA 4MSXA 5H1VA 4J3IA 5AMEA 5EPRA 2G45A 2KR4A 5FFYA 4P5OB 3JVJA 4YYNA 5HFRA 5A5PA 2OUOA 4QSSA 4ALHA 5I86A 2OXQC 4O7EA 3L1XA 5AIUA 2LRIC 5I7YA 2QIZA 3ZVZB 5L99A 2JMDA 1E4UA 3DAIA 5G4RA 1VFYA 3UV4A 4Z1SA 5DFCA 4LZRA 2FSAA 4LKAA 3QZTA 5AMFA 5CQTA 5EWCA 4QSUA 2FUIA 2LDRA 3ASLA 4LR6A 4GB0A 2LGVA 4UIUA 5DYAA 1N72A 3DWYA 4LYWA 4OUFA 3ZYUA 3ZTGA 4KCXA 3UVXA 4UI9B 4FK5A 5A81A 4CFLA 4TS8A 5HEMA 5A85A 4YABA 5EI4A 5G4SA 4AVXA 5FE6A 3O36A 4QB3A 4WHUA 2LSPB 5ENBA 5LCWB 4YYGA 1JSPB 3N9LA 4QEVA 4XYAA 5DBMA 4WZ0A 2C2LA 3HCUA 4IC2A 4YAXA 5E7DA 4LDFA 4R8PK 5LKUA 5B77A 4TQNA 2ECNA 5LKZA 3S92A 2JRJA 4O7FA 3LQJA 5E74A 1WFKA 3U5MA 4QF2A 4YH3A 2E7OA 4NUEA 3UVWA 2KWNA 5CQAA 5L8UA 5FE3A 5EA1A 4LYSA 4TZ2A 4LADB 4CLBA 4FJCA 1WILA 1FP0A 5F2PA 2ECVA 5A5NA 4MVTA 4C67A 3AQAA 1RMDA 5HLSA 3RPGC 3MB4A 4O70A 3SVFA 4CUUA 2G43A 5C13A 2WP1A 4NUDA 4NR8A 3KQIA 5A83A 4QBMA 4XY8A 4I7CA 4TU6A 2YEMA 2LGLA 4QEWA 5E9VA 3C5KA 5ENIA 4BHWA 3DPLR 5CZGA 4CCGX 2ZETC 5TCMA 3RTRB 2YEKA 2VPGA 4GNDA 4ZDTA 2L5UA 2ECJA 4IC3A 4A4BA 4V3LC 3U5NA 4Z93A 4AP4A 1WEUA 4HXRA 5KHMA 4A9EA 4X2IA 3ZPV1 2LV9A 4YYKA 4TT2A 5D3PA 4N4HA 1WEQA 2LGGA 5EWVA 4A9JA 4L58A 4NYWA 2D9EA 4HXMA 5C4QA 2M1RA 5FEYA 5HCLA 3SOUA 3U5JA 2L43A 3L11A 5KH7A 5TBNA 1MM3A 2DVVA 4YBSA 2F42A 2M3HA 1WUMA 4O7CA 5CUGA 4TT6A 2D8SA 3Q2EA 4UP5A 4IOQA 3MHHA 1WEVA 5FBXA 1JOCA 5II1A
chains in the Genus database with same CATH superfamily
1WEMA 4QSQA 5DW2A 5AD3A 1WEWA 3G0LA 4OGJA 5ETBA 3TLPA 2DVSA 5HRXA 4Z0OA 5KH9A 3SOWA 4TTEA 2WP2A 4ZC9A 5CQ7A 4ZW1A 4QR5A 5JI8A 2VJFA 3VK6A 4LZ2A 1ZBDB 2YSJA 2MD7B 5LVQA 5HQ5A 4AKIA 4Z1QA 5COIA 5F5ZA 5B75A 4BJXA 4NR6A 2XOZA 2R0SA 5CQ4A 4A0CD 5EM3A 5LJ1A 4NXJA 5EPBA 5EQ1A 4A9OA 5CPEA 5D25A 2E3KA 4LYIA 3PUQA 3Q1DA 4UIVA 2E61A 5DW1A 5ENEA 3KNVA 4MENA 1WEOA 1Z60A 3HMEA 3AADA 4QSRA 5CQ8A 3SOXA 4J0RA 4O7BA 5FG5A 4S3OC 1IYMA 5DX4A 4YC9A 3MHSA 3SUBA 4KV1A 4YY6A 2M85A 5KU3A 5H9MA 1WEEA 4UIWA 5EWWA 4BW2A 4QSPA 5E3GA 3M62A 2MA5A 4IORA 4XY9A 4ZUXU 5AD2A 5H1TA 5B78A 5CQ5A 3SVHA 2CONA 3JVKA 2YQMA 4HXKA 5I1QA 4QR4A 5ENJA 4F3IA 3PLWA 4GNFA 2Y43A 2H0DA 5D3LA 5IGKA 5E9LA 1WGMA 3LQHA 2MUMA 1F62A 2YW5A 5C89A 2LAUA 4RVRA 5LJ0A 4PCIA 2LQ6A 4IR6A 2ECWA 2OO1A 5EGUA 5JWMA 5G04B 2YSMA 5CQ6A 5E9MA 5I29A 4GNGA 4R2YA 4UYEA 5CP5A 4YYJA 2BAYA 5FH7A 2RSDA 4PS5A 4YBMA 5C85A 5CUBA 2K16A 3UVDA 4XI1A 2YQDA 3N9QA 3LJWA 2ECGA 5KH3A 4O64A 3O35A 3N9OA 4C66A 2PNXA 2KE1A 3IU5A 4MEPA 1WIMA 5B8DA 5E9YA 5CY9A 1Z6UA 4O75A 4QSWA 3HMFA 1K2FA 5HQ7A 2CKLA 3T7LA 4AUQB 2JMJA 5FE9A 5D1MB 5FFWA 2CRWA 4HXSA 1MM2A 5FE7A 5KTWA 4NR9A 2KIZA 5HM0A 3O47A 2RO1A 4A9HA 4WZ2A 5EP7A 4QEUA 5ETDA 5II2A 3JVLA 3LQIA 4UIXA 4WZ3B 2KU3A 2VJFB 5I88A 5FG6A 5D1KB 2VPBA 2RFJA 4UYDA 4ALGA 4H9DA 4AYCB 4W4UA 5EYAF 2I7KA 5E0RA 5SVXA 4UITA 4YATA 5I7XA 3I2DA 4HBXA 5LUUA 2DSMA 4YADA 2R0VA 1CHCA 5A7CA 2HYED 4Q0OA 2K17A 4C9ZA 5FERA 2NAAA 2YHOA 4MR4A 4QZSA 4A9FA 5B79A 4IR5A 4YYDA 3EB5A 4QYDA 4CUQA 1JM7A 4V3KC 5DKCA 2EA6A 4Z6HA 4FO9A 3KV6A 2H0DB 3MULA 4GPJA 4FLPA 3P1FA 4I7BA 3PHDA 2Y1NA 5EVAA 3U5LA 3NG2A 4LLBA 5J3XA 3Q2FA 2YELA 4N4IA 3HMHA 3KDEC 5D3TA 4R7EA 4HBYA 3LJUX 2K4DA 3MQMA 2MJVB 4MEOA 4CL9A 1VD4A 5FG4A 5HQ6A 2QJ0A 4PCEA 2E6SA 5TDRA 4A9IA 5H1UA 2G4AA 5HENA 4UP0A 4A49A 3N9NA 3I3JA 4XUAA 2VJEB 4Y03A 2DX8A 2IDAA 4WHWA 5LKTA 2YU4A 3FANA 5KTXA 3E2DA 2CRRA 2XEUA 4TU4A 3GV4A 1HYJA 5E9KA 5CTLA 4O7AA 4YK0A 2M6MA 5L8TA 5C7NA 4UYFB 5D26A 2KFTA 4GNEA 5DYXA 4QQ4A 4IR3A 4S3OB 4NR5A 1PUOA 2YT5A 3IHPA 5ENCA 4PTBA 2EGPA 5E3DA 4OGEA 5DY7A 2MT5A 2DVRA 4UIYA 2MD8C 4F52B 2R0YA 4QY4A 4LZSA 2I50A 5IGMA 3K2JA 3M63A 3U5KA 4NRBA 3UV2A 2KREA 4UIZA 2RNYA 3NXBA 5HELA 4QSTA 5EV9A 2MIQA 3DQVR 5DYUA 4A9LA 4KV4A 1X4UA 5ENHA 5FB0A 5TDWA 3M7KA 5L98A 4MR6A 1LDKC 5KO4A 5CFWA 5IBNA 2YREA 5FE5A 4A9KA 1DVPA 2CSYA 5IGLA 2KWKA 2L75A 3IU6A 3VKGA 2YVRA 5CQ3A 4AKHA 4J0SA 3RCWA 5EWHA 3ZNIA 2K1JA 5DYCA 5F60A 4LRGA 1F68A 2YW8A 4HBVA 4PKLA 4WA6A 2KWJA 5BT3A 5CGPA 5DLXA 2Y1MA 2OWAA 5LKXA 1X4IA 2FD4A 2KGGA 2E6RA 5DKAA 2LXPC 4O78A 3ERRA 1XWHA 3P1CA 2KGIA 4QNSA 4NQNA 3U5PA 5C8GA 2CKLB 3ZPVE 5K3QA 2DKWA 3JUEA 2F6JA 5D24A 3P5OA 5I80A 5A5RA 4HBWA 4MR5A 5F3AA 5D1LB 4N4FA 5BT4A 4QC3A 2E7NA 3N9MA 5TB6A 4YY4A 3ZVYA 3MUKA 5DINA 4CUSA 4F1PA 4J1PA 3FL2A 3L1ZB 2VP7A 5CRMA 2FUUA 5G0FA 4YYMA 5SVYA 5K29A 2EJNA 4CUTA 2VJEA 5F63A 3SVGA 4XUBA 5C11A 2R10A 5LVRA 4TT4A 5D0CA 4CFKA 2PUYA 5CRZA 4QC1A 5BT5A 4O71A 2LGKA 1V87A 2HDPA 2L0BA 5CUAA 5F36A 4IOOA 4PY6A 3C6WA 5A5SA 2YYRA 1HYIA 4UYGA 4BBQA 5CUCA 4YYIA 3EB6A 4MR3A 5FH6A 2XOCA 1ZS5A 3O37A 4O77A 4X3GA 2VPDA 4Q0NA 4HXNA 5KTUA 4BW1A 3JVMA 3LRQA 1DCQA 4Q6FA 4NRAA 5ACYA 5CUDA 5I83A 1G25A 2YYNA 5FDZA 5FE1A 4ZQLA 3G0JA 5IG6A 2YDWA 4BW4A 3DWDA 4I7DA 4UYHA 4NQMA 2YQLA 4CURA 4L7XA 5FH8A 2QICA 3UVYA 3RPGB 3ONIA 5F25A 3GL6A 2L85A 4NYVA 3VKHA 2JM3A 3GG3A 2NXBA 2G6QA 3MXFA 5CS8A 4QSXA 5A5QA 5A5OA 1WESA 2VNFA 4AYCA 2ECTA 5FE8A 5D3HA 2F6NA 3N9PA 1T1HA 3T9KA 2JUNA 2KYUA 2H60A 3LXJA 4NYXA 2CSVA 2EODA 3D1BA 5L96A 2MA6A 4BW3A 2RNWA 5E73A 1WENA 2L84A 2RR4A 4NR4A 4O62A 4HXOA 4O76A 4E96A 5C87A 5DKDA 3O7AA 4O72A 4MEQA 4DONA 2DATA 5DFDA 1JM7B 2EXUA 3U5OA 3ZYQA 4N3WA 5LJ2A 5L97A 4FIPA 1JM4B 1WE9A 2XP0A 1ZKRA 3M99A 3D7CA 5IIDA 1LDJB 2XB1A 2YURA 5B76A 5FFVA 1Z2QA 4A9NA 2ECIA 5HFQA 3PURA 3O70A 2RNXA 2N9GA 5CUEA 5ENGA 5FB1A 5FE4A 4A9MA 2RI7A 4B7YC 3P1EA 5F62A 3QZSA 4WIVA 3UW9A 2MNZA 2MKEA 5JG6A 4UYFA 2D82A 4LC2A 1EQFA 5TABA 5G05B 2LXHC 5AITA 3KV5A 2AN6A 4TKPB 5HRWA 5HRVA 5CU8A 5A82A 1MBMA 3S91A 4TYLA 2IQJA 2JMIA 4NS5A 1E6IA 5ENFA 3LVQE 3SHBA 3HTKC 4CA1A 1U6GB 1WUGA 4Z6IA 5J0DA 1N87A 5D3NA 5F1HA 3FJUB 5H85A 5DFBA 2L80A 5EK9A 5IGNA 5I3LA 4NRCA 2DVQA 2DWWA 3MB3A 1X0JA 2I8NA 4NUCA 5FE0A 2CT2A 5TRBA 4QUUA 3FKMX 4HXPA 4TZ8A 5I40A 2YHNA 5EPSA 4IR4A 5D3SA 5EWDA 4AKGA 4LK9A 3T6RA 5EISA 2CSZA 4AKNA 5I89A 4QUTA 1FBVA 4O74A 3O34A 2OSSA 5HJCA 3P1DA 2RS9B 1X4JA 5E9IA 3HCTA 4Z0RA 2EGMA 5D7XA 3O33A 4QSVA 4A4CA 4B86C 3V43A 5F61A 4OGIA 4N4GA 5EICA 4NR7A 4QYLA 1WEPA 2C2VS 4PPEA 4YH4A 2KWOA 3HCSA 1BORA 1VYXA 2FFWA 2VPEA 4HXLA 5DLZA 2GRCA 4YBTA 2KKYA 5DKHA 5D3JA 3FEHA 3FM8C 4YYHA 4LJNA 4QF3A 2KTBB 2L5EA 4QR3A 5EU1A 2UZGA 3UV5A 2YUCA 2LN0A 2MNYA 5FE2A 5F1LA 4NN2A 5D3RA 3QZVA 4CUPA 4MSXA 5H1VA 4J3IA 3LVRE 5AMEA 5EPRA 2G45A 2KR4A 5FFYA 4P5OB 3JVJA 4YYNA 5HFRA 5A5PA 2OUOA 4QSSA 4ALHA 2B0OE 5I86A 5SVIB 2OXQC 4O7EA 3L1XA 5AIUA 2LRIC 5I7YA 2QIZA 3ZVZB 5L99A 2JMDA 1E4UA 3DAIA 5G4RA 1VFYA 3UV4A 4Z1SA 5DFCA 3D1DA 4LZRA 2FSAA 4LKAA 3QZTA 5AMFA 5CQTA 5EWCA 4QSUA 2FUIA 2LDRA 3ASLA 4LR6A 4GB0A 2LGVA 4UIUA 5DYAA 1N72A 3DWYA 4LYWA 4OUFA 3ZYUA 3ZTGA 4KCXA 3DDTA 2L7PA 3UVXA 4UI9B 4FK5A 5A81A 2M13A 4CFLA 3MDBC 4TS8A 2DJAA 5HEMA 5A85A 5SVIA 4YABA 5EI4A 5G4SA 4AVXA 5FE6A 3O36A 4QB3A 4WHUA 2LSPB 5ENBA 5LCWB 4YYGA 1JSPB 3N9LA 4QEVA 4XYAA 5DBMA 4WZ0A 2C2LA 3HCUA 4IC2A 4YAXA 5E7DA 4LDFA 4R8PK 5LKUA 5B77A 4TQNA 2ECNA 5LKZA 3S92A 2JRJA 4O7FA 2KKXA 3LQJA 5E74A 1WFKA 3U5MA 4QF2A 4YH3A 2E7OA 4NUEA 3UVWA 2KWNA 5CQAA 5L8UA 5FE3A 5EA1A 4LYSA 4TZ2A 4LADB 4CLBA 4FJCA 1WILA 1FP0A 5F2PA 2ECVA 5A5NA 4MVTA 4C67A 3AQAA 1RMDA 5HLSA 3RPGC 3MB4A 4O70A 3SVFA 4CUUA 2G43A 5C13A 2WP1A 4NUDA 4NR8A 3KQIA 5A83A 4QBMA 4XY8A 4I7CA 4TU6A 2YEMA 2LGLA 4QEWA 5E9VA 3C5KA 5ENIA 4BHWA 3DPLR 5CZGA 4CCGX 2ZETC 5TCMA 3RTRB 2YEKA 2VPGA 4GNDA 4ZDTA 2L5UA 2ECJA 4IC3A 4A4BA 4V3LC 3U5NA 4Z93A 4AP4A 2P57A 1WEUA 4HXRA 4OGCA 5KHMA 4A9EA 4X2IA 3ZPV1 2XOYA 2LV9A 4YYKA 4TT2A 5D3PA 4N4HA 1WEQA 2LGGA 5EWVA 4A9JA 4L58A 4NYWA 3FAOA 2D9EA 4HXMA 5C4QA 2M1RA 2D8UA 5FEYA 5HCLA 3SOUA 3LDYA 3U5JA 2L43A 3L11A 5KH7A 5TBNA 1MM3A 2DVVA 4YBSA 2F42A 2M3HA 1WUMA 4O7CA 5CUGA 4TT6A 2D8SA 3Q2EA 4UP5A 4IOQA 4AI6A 1WEVA 3H7HA 3MHHA 5FBXA 1JOCA 5II1A
chains in the Genus database with same CATH topology
1WEMA 4QSQA 5DW2A 5AD3A 1WEWA 3G0LA 4OGJA 5ETBA 3TLPA 2DVSA 5HRXA 5KH9A 3SOWA 4TTEA 2WP2A 4ZC9A 5CQ7A 4ZW1A 4QR5A 5JI8A 2VJFA 3VK6A 4LZ2A 1ZBDB 2YSJA 2MD7B 5LVQA 5HQ5A 4Z1QA 5COIA 5F5ZA 5B75A 4BJXA 4NR6A 2R0SA 5CQ4A 4A0CD 5EM3A 5LJ1A 4NXJA 5EPBA 5EQ1A 4A9OA 5CPEA 5D25A 2E3KA 4LYIA 3PUQA 4UIVA 3KNVA 5DW1A 5ENEA 4MENA 1WEOA 1Z60A 3HMEA 3AADA 4QSRA 5CQ8A 3SOXA 4J0RA 4O7BA 5FG5A 4S3OC 1IYMA 5DX4A 4YC9A 3MHSA 4KV1A 4YY6A 2M85A 5KU3A 5H9MA 1WEEA 4UIWA 5EWWA 4BW2A 4QSPA 5E3GA 3M62A 2MA5A 4IORA 4XY9A 4ZUXU 5AD2A 5H1TA 5B78A 5CQ5A 3SVHA 2YQMA 3JVKA 4HXKA 5I1QA 4QR4A 5ENJA 4F3IA 4GNFA 2Y43A 2H0DA 5D3LA 5IGKA 5E9LA 1WGMA 3LQHA 2MUMA 1F62A 2YW5A 5C89A 4RVRA 5LJ0A 4PCIA 2LQ6A 4IR6A 2ECWA 2OO1A 5EGUA 5JWMA 5G04B 2YSMA 5CQ6A 5E9MA 5I29A 4GNGA 4R2YA 4UYEA 5CP5A 4YYJA 2BAYA 5FH7A 2RSDA 4PS5A 4YBMA 5C85A 5CUBA 2K16A 3UVDA 4XI1A 2YQDA 3N9QA 3LJWA 2ECGA 5KH3A 4O64A 3O35A 3N9OA 4C66A 2PNXA 2KE1A 3IU5A 4MEPA 1WIMA 5B8DA 5E9YA 5CY9A 1Z6UA 4O75A 4QSWA 3HMFA 1K2FA 5HQ7A 2CKLA 3T7LA 4AUQB 2JMJA 5FE9A 5D1MB 5FFWA 4HXSA 1MM2A 5FE7A 5KTWA 4NR9A 2KIZA 5HM0A 4WZ2A 2RO1A 4A9HA 5EP7A 4QEUA 5ETDA 5II2A 3LQIA 3JVLA 4UIXA 4WZ3B 2KU3A 2VJFB 5I88A 5FG6A 5D1KB 2VPBA 2RFJA 4UYDA 4ALGA 4AYCB 4W4UA 5EYAF 2I7KA 5E0RA 4UITA 4YATA 5I7XA 3I2DA 4HBXA 5LUUA 4YADA 2R0VA 1CHCA 5A7CA 2HYED 4Q0OA 2K17A 4C9ZA 5FERA 2NAAA 2YHOA 4MR4A 4QZSA 4A9FA 5B79A 4IR5A 4YYDA 3EB5A 4QYDA 4CUQA 1JM7A 4V3KC 5DKCA 2EA6A 4Z6HA 4FO9A 3KV6A 2H0DB 3MULA 4GPJA 4FLPA 3P1FA 4I7BA 3PHDA 2Y1NA 5EVAA 3U5LA 3NG2A 4LLBA 5J3XA 3Q2FA 2YELA 4N4IA 3HMHA 5D3TA 4R7EA 4HBYA 2K4DA 3MQMA 2MJVB 4MEOA 4CL9A 1VD4A 5FG4A 5HQ6A 2QJ0A 4PCEA 2E6SA 5TDRA 4A9IA 5H1UA 2G4AA 5HENA 4UP0A 4A49A 3N9NA 3I3JA 4XUAA 2VJEB 4Y03A 2DX8A 2IDAA 4WHWA 5LKTA 2YU4A 5KTXA 2XEUA 4TU4A 3GV4A 1HYJA 5E9KA 5CTLA 4O7AA 4YK0A 2M6MA 5L8TA 5C7NA 4UYFB 5D26A 2KFTA 4GNEA 5DYXA 4IR3A 4S3OB 4NR5A 2YT5A 3IHPA 5ENCA 4PTBA 2EGPA 5E3DA 5DY7A 2MT5A 2DVRA 4UIYA 2MD8C 4F52B 2R0YA 4QY4A 4LZSA 2I50A 5IGMA 3K2JA 3M63A 3U5KA 4NRBA 3UV2A 2KREA 4UIZA 2RNYA 3NXBA 5HELA 4QSTA 5EV9A 2MIQA 3DQVR 5DYUA 4A9LA 4KV4A 1X4UA 5ENHA 5FB0A 5TDWA 5L98A 4MR6A 1LDKC 5KO4A 5CFWA 5IBNA 2YREA 5FE5A 4A9KA 1DVPA 2CSYA 5IGLA 2KWKA 2L75A 3IU6A 5CQ3A 4J0SA 3RCWA 5EWHA 3ZNIA 2K1JA 5DYCA 5F60A 4LRGA 1F68A 2YW8A 4HBVA 4PKLA 4WA6A 2KWJA 5BT3A 5CGPA 5DLXA 2Y1MA 5LKXA 1X4IA 2KGGA 2E6RA 5DKAA 2LXPC 4O78A 1XWHA 3P1CA 2KGIA 4QNSA 4NQNA 3U5PA 5C8GA 2CKLB 3ZPVE 2DKWA 2F6JA 5D24A 3P5OA 5I80A 5A5RA 4HBWA 4MR5A 5F3AA 5D1LB 4N4FA 5BT4A 4QC3A 2E7NA 3N9MA 5TB6A 4YY4A 3ZVYA 3MUKA 5DINA 4CUSA 4J1PA 3FL2A 3L1ZB 2VP7A 5CRMA 2FUUA 5G0FA 4YYMA 5K29A 4CUTA 2VJEA 5F63A 3SVGA 4XUBA 5C11A 2R10A 5LVRA 4TT4A 5D0CA 4CFKA 2PUYA 5CRZA 4QC1A 5BT5A 4O71A 2LGKA 1V87A 2HDPA 2L0BA 5CUAA 5F36A 4IOOA 4PY6A 3C6WA 5A5SA 2YYRA 1HYIA 4UYGA 4BBQA 5CUCA 4YYIA 3EB6A 4MR3A 5FH6A 1ZS5A 3O37A 4O77A 4X3GA 2VPDA 4Q0NA 4HXNA 5KTUA 4BW1A 3JVMA 3LRQA 4Q6FA 4NRAA 5ACYA 5CUDA 5I83A 1G25A 2YYNA 5FDZA 5FE1A 4ZQLA 3G0JA 5IG6A 2YDWA 4BW4A 4I7DA 4UYHA 4NQMA 2YQLA 4CURA 4L7XA 5FH8A 2QICA 3UVYA 3RPGB 3ONIA 5F25A 3GL6A 2L85A 4NYVA 3GG3A 2NXBA 2G6QA 3MXFA 5CS8A 4QSXA 5A5QA 5A5OA 1WESA 2VNFA 4AYCA 2ECTA 5FE8A 5D3HA 2F6NA 3N9PA 1T1HA 2KYUA 2H60A 3LXJA 4NYXA 2EODA 5L96A 2MA6A 4BW3A 2RNWA 5E73A 1WENA 2L84A 4NR4A 4HXOA 4O76A 4E96A 5C87A 5DKDA 3O7AA 4O72A 4MEQA 4DONA 2DATA 5DFDA 1JM7B 3U5OA 3ZYQA 4N3WA 5LJ2A 5L97A 4FIPA 1JM4B 1WE9A 3M99A 3D7CA 5IIDA 1LDJB 2XB1A 2YURA 5B76A 5FFVA 1Z2QA 4A9NA 2ECIA 5HFQA 3PURA 3O70A 2RNXA 2N9GA 5CUEA 5ENGA 5FB1A 5FE4A 4A9MA 2RI7A 4B7YC 3P1EA 5F62A 3QZSA 4WIVA 3UW9A 2MNZA 5JG6A 4UYFA 2D82A 4LC2A 1EQFA 5TABA 5G05B 2LXHC 5AITA 3KV5A 2AN6A 4TKPB 5HRWA 5HRVA 5CU8A 5A82A 3S91A 4TYLA 2JMIA 4NS5A 1E6IA 5ENFA 3SHBA 3HTKC 4CA1A 1U6GB 1WUGA 4Z6IA 5J0DA 1N87A 5D3NA 5F1HA 5H85A 5DFBA 2L80A 5EK9A 5IGNA 5I3LA 4NRCA 2DVQA 2DWWA 3MB3A 1X0JA 2I8NA 4NUCA 5FE0A 2CT2A 5TRBA 4QUUA 3FKMX 4HXPA 4TZ8A 5I40A 2YHNA 5EPSA 4IR4A 5D3SA 5EWDA 4LK9A 3T6RA 5EISA 2CSZA 4AKNA 5I89A 4QUTA 1FBVA 4O74A 3O34A 2OSSA 5HJCA 3P1DA 2RS9B 1X4JA 5E9IA 3HCTA 5D7XA 3O33A 4QSVA 4A4CA 4B86C 3V43A 5F61A 4OGIA 4N4GA 5EICA 4NR7A 4QYLA 1WEPA 2C2VS 4PPEA 4YH4A 2KWOA 3HCSA 1BORA 1VYXA 2VPEA 4HXLA 5DLZA 2GRCA 4YBTA 5DKHA 5D3JA 4YYHA 4LJNA 4QF3A 2KTBB 2L5EA 4QR3A 5EU1A 2UZGA 3UV5A 2YUCA 2LN0A 2MNYA 5FE2A 5F1LA 4NN2A 5D3RA 3QZVA 4CUPA 4MSXA 5H1VA 4J3IA 5AMEA 5EPRA 2G45A 2KR4A 5FFYA 4P5OB 3JVJA 4YYNA 5HFRA 5A5PA 2OUOA 4QSSA 4ALHA 5I86A 2OXQC 4O7EA 3L1XA 5AIUA 2LRIC 5I7YA 2QIZA 3ZVZB 5L99A 2JMDA 1E4UA 3DAIA 5G4RA 1VFYA 3UV4A 4Z1SA 5DFCA 4LZRA 2FSAA 4LKAA 3QZTA 5AMFA 5CQTA 5EWCA 4QSUA 2FUIA 2LDRA 3ASLA 4LR6A 4GB0A 2LGVA 4UIUA 5DYAA 1N72A 3DWYA 4LYWA 4OUFA 3ZYUA 3ZTGA 4KCXA 3UVXA 4UI9B 4FK5A 5A81A 4CFLA 4TS8A 5HEMA 5A85A 4YABA 5EI4A 5G4SA 4AVXA 5FE6A 3O36A 4QB3A 4WHUA 2LSPB 5ENBA 5LCWB 4YYGA 1JSPB 3N9LA 4QEVA 4XYAA 5DBMA 4WZ0A 2C2LA 3HCUA 4IC2A 4YAXA 5E7DA 4LDFA 4R8PK 5LKUA 5B77A 4TQNA 2ECNA 5LKZA 3S92A 2JRJA 4O7FA 3LQJA 5E74A 1WFKA 3U5MA 4QF2A 4YH3A 2E7OA 4NUEA 3UVWA 2KWNA 5CQAA 5L8UA 5FE3A 5EA1A 4LYSA 4TZ2A 4LADB 4CLBA 4FJCA 1WILA 1FP0A 5F2PA 2ECVA 5A5NA 4MVTA 4C67A 3AQAA 1RMDA 5HLSA 3RPGC 3MB4A 4O70A 3SVFA 4CUUA 2G43A 5C13A 2WP1A 4NUDA 4NR8A 3KQIA 5A83A 4QBMA 4XY8A 4I7CA 4TU6A 2YEMA 2LGLA 4QEWA 5E9VA 3C5KA 5ENIA 4BHWA 3DPLR 5CZGA 4CCGX 2ZETC 5TCMA 3RTRB 2YEKA 2VPGA 4GNDA 4ZDTA 2L5UA 2ECJA 4IC3A 4A4BA 4V3LC 3U5NA 4Z93A 4AP4A 1WEUA 4HXRA 5KHMA 4A9EA 4X2IA 3ZPV1 2LV9A 4YYKA 4TT2A 5D3PA 4N4HA 1WEQA 2LGGA 5EWVA 4A9JA 4L58A 4NYWA 2D9EA 4HXMA 5C4QA 2M1RA 5FEYA 5HCLA 3SOUA 3U5JA 2L43A 3L11A 5KH7A 5TBNA 1MM3A 2DVVA 4YBSA 2F42A 2M3HA 1WUMA 4O7CA 5CUGA 4TT6A 2D8SA 3Q2EA 4UP5A 4IOQA 3MHHA 1WEVA 5FBXA 1JOCA 5II1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEM A;  4QSQ A;  5DW2 A;  5AD3 A;  1WEW A;  3G0L A;  4OGJ A;  5ETB A;  3TLP A;  2DVS A;  5HRX A;  5KH9 A;  3SOW A;  4TTE A;  2WP2 A;  4ZC9 A;  5CQ7 A;  4ZW1 A;  4QR5 A;  5JI8 A;  2VJF A;  3VK6 A;  4LZ2 A;  1ZBD B;  2YSJ A;  2MD7 B;  5LVQ A;  5HQ5 A;  4Z1Q A;  5COI A;  5F5Z A;  5B75 A;  4BJX A;  4NR6 A;  2R0S A;  5CQ4 A;  4A0C D;  5EM3 A;  5LJ1 A;  4NXJ A;  5EPB A;  5EQ1 A;  4A9O A;  5CPE A;  5D25 A;  2E3K A;  4LYI A;  3PUQ A;  4UIV A;  3KNV A;  5DW1 A;  5ENE A;  4MEN A;  1WEO A;  1Z60 A;  3HME A;  3AAD A;  4QSR A;  5CQ8 A;  3SOX A;  4J0R A;  4O7B A;  5FG5 A;  4S3O C;  1IYM A;  5DX4 A;  4YC9 A;  3MHS A;  4KV1 A;  4YY6 A;  2M85 A;  5KU3 A;  5H9M A;  1WEE A;  4UIW A;  5EWW A;  4BW2 A;  4QSP A;  5E3G A;  3M62 A;  2MA5 A;  4IOR A;  4XY9 A;  4ZUX U;  5AD2 A;  5H1T A;  5B78 A;  5CQ5 A;  3SVH A;  2YQM A;  3JVK A;  4HXK A;  5I1Q A;  4QR4 A;  5ENJ A;  4F3I A;  4GNF A;  2Y43 A;  2H0D A;  5D3L A;  5IGK A;  5E9L A;  1WGM A;  3LQH A;  2MUM A;  1F62 A;  2YW5 A;  5C89 A;  4RVR A;  5LJ0 A;  4PCI A;  2LQ6 A;  4IR6 A;  2ECW A;  2OO1 A;  5EGU A;  5JWM A;  5G04 B;  2YSM A;  5CQ6 A;  5E9M A;  5I29 A;  4GNG A;  4R2Y A;  4UYE A;  5CP5 A;  4YYJ A;  2BAY A;  5FH7 A;  2RSD A;  4PS5 A;  4YBM A;  5C85 A;  5CUB A;  2K16 A;  3UVD A;  4XI1 A;  2YQD A;  3N9Q A;  3LJW A;  2ECG A;  5KH3 A;  4O64 A;  3O35 A;  3N9O A;  4C66 A;  2PNX A;  2KE1 A;  3IU5 A;  4MEP A;  1WIM A;  5B8D A;  5E9Y A;  5CY9 A;  1Z6U A;  4O75 A;  4QSW A;  3HMF A;  1K2F A;  5HQ7 A;  2CKL A;  3T7L A;  4AUQ B;  2JMJ A;  5FE9 A;  5D1M B;  5FFW A;  4HXS A;  1MM2 A;  5FE7 A;  5KTW A;  4NR9 A;  2KIZ A;  5HM0 A;  4WZ2 A;  2RO1 A;  4A9H A;  5EP7 A;  4QEU A;  5ETD A;  5II2 A;  3LQI A;  3JVL A;  4UIX A;  4WZ3 B;  2KU3 A;  2VJF B;  5I88 A;  5FG6 A;  5D1K B;  2VPB A;  2RFJ A;  4UYD A;  4ALG A;  4AYC B;  4W4U A;  5EYA F;  2I7K A;  5E0R A;  4UIT A;  4YAT A;  5I7X A;  3I2D A;  4HBX A;  5LUU A;  4YAD A;  2R0V A;  1CHC A;  5A7C A;  2HYE D;  4Q0O A;  2K17 A;  4C9Z A;  5FER A;  2NAA A;  2YHO A;  4MR4 A;  4QZS A;  4A9F A;  5B79 A;  4IR5 A;  4YYD A;  3EB5 A;  4QYD A;  4CUQ A;  1JM7 A;  4V3K C;  5DKC A;  2EA6 A;  4Z6H A;  4FO9 A;  3KV6 A;  2H0D B;  3MUL A;  4GPJ A;  4FLP A;  3P1F A;  4I7B A;  3PHD A;  2Y1N A;  5EVA A;  3U5L A;  3NG2 A;  4LLB A;  5J3X A;  3Q2F A;  2YEL A;  4N4I A;  3HMH A;  5D3T A;  4R7E A;  4HBY A;  2K4D A;  3MQM A;  2MJV B;  4MEO A;  4CL9 A;  1VD4 A;  5FG4 A;  5HQ6 A;  2QJ0 A;  4PCE A;  2E6S A;  5TDR A;  4A9I A;  5H1U A;  2G4A A;  5HEN A;  4UP0 A;  4A49 A;  3N9N A;  3I3J A;  4XUA A;  2VJE B;  4Y03 A;  2DX8 A;  2IDA A;  4WHW A;  5LKT A;  2YU4 A;  5KTX A;  2XEU A;  4TU4 A;  3GV4 A;  1HYJ A;  5E9K A;  5CTL A;  4O7A A;  4YK0 A;  2M6M A;  5L8T A;  5C7N A;  4UYF B;  5D26 A;  2KFT A;  4GNE A;  5DYX A;  4IR3 A;  4S3O B;  4NR5 A;  2YT5 A;  3IHP A;  5ENC A;  4PTB A;  2EGP A;  5E3D A;  5DY7 A;  2MT5 A;  2DVR A;  4UIY A;  2MD8 C;  4F52 B;  2R0Y A;  4QY4 A;  4LZS A;  2I50 A;  5IGM A;  3K2J A;  3M63 A;  3U5K A;  4NRB A;  3UV2 A;  2KRE A;  4UIZ A;  2RNY A;  3NXB A;  5HEL A;  4QST A;  5EV9 A;  2MIQ A;  3DQV R;  5DYU A;  4A9L A;  4KV4 A;  1X4U A;  5ENH A;  5FB0 A;  5TDW A;  5L98 A;  4MR6 A;  1LDK C;  5KO4 A;  5CFW A;  5IBN A;  2YRE A;  5FE5 A;  4A9K A;  1DVP A;  2CSY A;  5IGL A;  2KWK A;  2L75 A;  3IU6 A;  5CQ3 A;  4J0S A;  3RCW A;  5EWH A;  3ZNI A;  2K1J A;  5DYC A;  5F60 A;  4LRG A;  1F68 A;  2YW8 A;  4HBV A;  4PKL A;  4WA6 A;  2KWJ A;  5BT3 A;  5CGP A;  5DLX A;  2Y1M A;  5LKX A;  1X4I A;  2KGG A;  2E6R A;  5DKA A;  2LXP C;  4O78 A;  1XWH A;  3P1C A;  2KGI A;  4QNS A;  4NQN A;  3U5P A;  5C8G A;  2CKL B;  3ZPV E;  2DKW A;  2F6J A;  5D24 A;  3P5O A;  5I80 A;  5A5R A;  4HBW A;  4MR5 A;  5F3A A;  5D1L B;  4N4F A;  5BT4 A;  4QC3 A;  2E7N A;  3N9M A;  5TB6 A;  4YY4 A;  3ZVY A;  3MUK A;  5DIN A;  4CUS A;  4J1P A;  3FL2 A;  3L1Z B;  2VP7 A;  5CRM A;  2FUU A;  5G0F A;  4YYM A;  5K29 A;  4CUT A;  2VJE A;  5F63 A;  3SVG A;  4XUB A;  5C11 A;  2R10 A;  5LVR A;  4TT4 A;  5D0C A;  4CFK A;  2PUY A;  5CRZ A;  4QC1 A;  5BT5 A;  4O71 A;  2LGK A;  1V87 A;  2HDP A;  2L0B A;  5CUA A;  5F36 A;  4IOO A;  4PY6 A;  3C6W A;  5A5S A;  2YYR A;  1HYI A;  4UYG A;  4BBQ A;  5CUC A;  4YYI A;  3EB6 A;  4MR3 A;  5FH6 A;  1ZS5 A;  3O37 A;  4O77 A;  4X3G A;  2VPD A;  4Q0N A;  4HXN A;  5KTU A;  4BW1 A;  3JVM A;  3LRQ A;  4Q6F A;  4NRA A;  5ACY A;  5CUD A;  5I83 A;  1G25 A;  2YYN A;  5FDZ A;  5FE1 A;  4ZQL A;  3G0J A;  5IG6 A;  2YDW A;  4BW4 A;  4I7D A;  4UYH A;  4NQM A;  2YQL A;  4CUR A;  4L7X A;  5FH8 A;  2QIC A;  3UVY A;  3RPG B;  3ONI A;  5F25 A;  3GL6 A;  2L85 A;  4NYV A;  3GG3 A;  2NXB A;  2G6Q A;  3MXF A;  5CS8 A;  4QSX A;  5A5Q A;  5A5O A;  1WES A;  2VNF A;  4AYC A;  2ECT A;  5FE8 A;  5D3H A;  2F6N A;  3N9P A;  1T1H A;  2KYU A;  2H60 A;  3LXJ A;  4NYX A;  2EOD A;  5L96 A;  2MA6 A;  4BW3 A;  2RNW A;  5E73 A;  1WEN A;  2L84 A;  4NR4 A;  4HXO A;  4O76 A;  4E96 A;  5C87 A;  5DKD A;  3O7A A;  4O72 A;  4MEQ A;  4DON A;  2DAT A;  5DFD A;  1JM7 B;  3U5O A;  3ZYQ A;  4N3W A;  5LJ2 A;  5L97 A;  4FIP A;  1JM4 B;  1WE9 A;  3M99 A;  3D7C A;  5IID A;  1LDJ B;  2XB1 A;  2YUR A;  5B76 A;  5FFV A;  1Z2Q A;  4A9N A;  2ECI A;  5HFQ A;  3PUR A;  3O70 A;  2RNX A;  2N9G A;  5CUE A;  5ENG A;  5FB1 A;  5FE4 A;  4A9M A;  2RI7 A;  4B7Y C;  3P1E A;  5F62 A;  3QZS A;  4WIV A;  3UW9 A;  2MNZ A;  5JG6 A;  4UYF A;  2D82 A;  4LC2 A;  1EQF A;  5TAB A;  5G05 B;  2LXH C;  5AIT A;  3KV5 A;  2AN6 A;  4TKP B;  5HRW A;  5HRV A;  5CU8 A;  5A82 A;  3S91 A;  4TYL A;  2JMI A;  4NS5 A;  1E6I A;  5ENF A;  3SHB A;  3HTK C;  4CA1 A;  1U6G B;  1WUG A;  4Z6I A;  5J0D A;  1N87 A;  5D3N A;  5F1H A;  5H85 A;  5DFB A;  2L80 A;  5EK9 A;  5IGN A;  5I3L A;  4NRC A;  2DVQ A;  2DWW A;  3MB3 A;  1X0J A;  2I8N A;  4NUC A;  5FE0 A;  2CT2 A;  5TRB A;  4QUU A;  3FKM X;  4HXP A;  4TZ8 A;  5I40 A;  2YHN A;  5EPS A;  4IR4 A;  5D3S A;  5EWD A;  4LK9 A;  3T6R A;  5EIS A;  2CSZ A;  4AKN A;  5I89 A;  4QUT A;  1FBV A;  4O74 A;  3O34 A;  2OSS A;  5HJC A;  3P1D A;  2RS9 B;  1X4J A;  5E9I A;  3HCT A;  5D7X A;  3O33 A;  4QSV A;  4A4C A;  4B86 C;  3V43 A;  5F61 A;  4OGI A;  4N4G A;  5EIC A;  4NR7 A;  4QYL A;  1WEP A;  2C2V S;  4PPE A;  4YH4 A;  2KWO A;  3HCS A;  1BOR A;  1VYX A;  2VPE A;  4HXL A;  5DLZ A;  2GRC A;  4YBT A;  5DKH A;  5D3J A;  4YYH A;  4LJN A;  4QF3 A;  2KTB B;  2L5E A;  4QR3 A;  5EU1 A;  2UZG A;  3UV5 A;  2YUC A;  2LN0 A;  2MNY A;  5FE2 A;  5F1L A;  4NN2 A;  5D3R A;  3QZV A;  4CUP A;  4MSX A;  5H1V A;  4J3I A;  5AME A;  5EPR A;  2G45 A;  2KR4 A;  5FFY A;  4P5O B;  3JVJ A;  4YYN A;  5HFR A;  5A5P A;  2OUO A;  4QSS A;  4ALH A;  5I86 A;  2OXQ C;  4O7E A;  3L1X A;  5AIU A;  2LRI C;  5I7Y A;  2QIZ A;  3ZVZ B;  5L99 A;  2JMD A;  1E4U A;  3DAI A;  5G4R A;  1VFY A;  3UV4 A;  4Z1S A;  5DFC A;  4LZR A;  2FSA A;  4LKA A;  3QZT A;  5AMF A;  5CQT A;  5EWC A;  4QSU A;  2FUI A;  2LDR A;  3ASL A;  4LR6 A;  4GB0 A;  2LGV A;  4UIU A;  5DYA A;  1N72 A;  3DWY A;  4LYW A;  4OUF A;  3ZYU A;  3ZTG A;  4KCX A;  3UVX A;  4UI9 B;  4FK5 A;  5A81 A;  4CFL A;  4TS8 A;  5HEM A;  5A85 A;  4YAB A;  5EI4 A;  5G4S A;  4AVX A;  5FE6 A;  3O36 A;  4QB3 A;  4WHU A;  2LSP B;  5ENB A;  5LCW B;  4YYG A;  1JSP B;  3N9L A;  4QEV A;  4XYA A;  5DBM A;  4WZ0 A;  2C2L A;  3HCU A;  4IC2 A;  4YAX A;  5E7D A;  4LDF A;  4R8P K;  5LKU A;  5B77 A;  4TQN A;  2ECN A;  5LKZ A;  3S92 A;  2JRJ A;  4O7F A;  3LQJ A;  5E74 A;  1WFK A;  3U5M A;  4QF2 A;  4YH3 A;  2E7O A;  4NUE A;  3UVW A;  2KWN A;  5CQA A;  5L8U A;  5FE3 A;  5EA1 A;  4LYS A;  4TZ2 A;  4LAD B;  4CLB A;  4FJC A;  1WIL A;  1FP0 A;  5F2P A;  2ECV A;  5A5N A;  4MVT A;  4C67 A;  3AQA A;  1RMD A;  5HLS A;  3RPG C;  3MB4 A;  4O70 A;  3SVF A;  4CUU A;  2G43 A;  5C13 A;  2WP1 A;  4NUD A;  4NR8 A;  3KQI A;  5A83 A;  4QBM A;  4XY8 A;  4I7C A;  4TU6 A;  2YEM A;  2LGL A;  4QEW A;  5E9V A;  3C5K A;  5ENI A;  4BHW A;  3DPL R;  5CZG A;  4CCG X;  2ZET C;  5TCM A;  3RTR B;  2YEK A;  2VPG A;  4GND A;  4ZDT A;  2L5U A;  2ECJ A;  4IC3 A;  4A4B A;  4V3L C;  3U5N A;  4Z93 A;  4AP4 A;  1WEU A;  4HXR A;  5KHM A;  4A9E A;  4X2I A;  3ZPV 1;  2LV9 A;  4YYK A;  4TT2 A;  5D3P A;  4N4H A;  1WEQ A;  2LGG A;  5EWV A;  4A9J A;  4L58 A;  4NYW A;  2D9E A;  4HXM A;  5C4Q A;  2M1R A;  5FEY A;  5HCL A;  3SOU A;  3U5J A;  2L43 A;  3L11 A;  5KH7 A;  5TBN A;  1MM3 A;  2DVV A;  4YBS A;  2F42 A;  2M3H A;  1WUM A;  4O7C A;  5CUG A;  4TT6 A;  2D8S A;  3Q2E A;  4UP5 A;  4IOQ A;  3MHH A;  1WEV A;  5FBX A;  1JOC A;  5II1 A; 
#chains in the Genus database with same CATH topology
 1WEM A;  4QSQ A;  5DW2 A;  5AD3 A;  1WEW A;  3G0L A;  4OGJ A;  5ETB A;  3TLP A;  2DVS A;  5HRX A;  4Z0O A;  5KH9 A;  3SOW A;  4TTE A;  2WP2 A;  4ZC9 A;  5CQ7 A;  4ZW1 A;  4QR5 A;  5JI8 A;  2VJF A;  3VK6 A;  4LZ2 A;  1ZBD B;  2YSJ A;  2MD7 B;  5LVQ A;  5HQ5 A;  4AKI A;  4Z1Q A;  5COI A;  5F5Z A;  5B75 A;  4BJX A;  4NR6 A;  2XOZ A;  2R0S A;  5CQ4 A;  4A0C D;  5EM3 A;  5LJ1 A;  4NXJ A;  5EPB A;  5EQ1 A;  4A9O A;  5CPE A;  5D25 A;  2E3K A;  4LYI A;  3PUQ A;  3Q1D A;  4UIV A;  2E61 A;  5DW1 A;  5ENE A;  3KNV A;  4MEN A;  1WEO A;  1Z60 A;  3HME A;  3AAD A;  4QSR A;  5CQ8 A;  3SOX A;  4J0R A;  4O7B A;  5FG5 A;  4S3O C;  1IYM A;  5DX4 A;  4YC9 A;  3MHS A;  3SUB A;  4KV1 A;  4YY6 A;  2M85 A;  5KU3 A;  5H9M A;  1WEE A;  4UIW A;  5EWW A;  4BW2 A;  4QSP A;  5E3G A;  3M62 A;  2MA5 A;  4IOR A;  4XY9 A;  4ZUX U;  5AD2 A;  5H1T A;  5B78 A;  5CQ5 A;  3SVH A;  2CON A;  3JVK A;  2YQM A;  4HXK A;  5I1Q A;  4QR4 A;  5ENJ A;  4F3I A;  3PLW A;  4GNF A;  2Y43 A;  2H0D A;  5D3L A;  5IGK A;  5E9L A;  1WGM A;  3LQH A;  2MUM A;  1F62 A;  2YW5 A;  5C89 A;  2LAU A;  4RVR A;  5LJ0 A;  4PCI A;  2LQ6 A;  4IR6 A;  2ECW A;  2OO1 A;  5EGU A;  5JWM A;  5G04 B;  2YSM A;  5CQ6 A;  5E9M A;  5I29 A;  4GNG A;  4R2Y A;  4UYE A;  5CP5 A;  4YYJ A;  2BAY A;  5FH7 A;  2RSD A;  4PS5 A;  4YBM A;  5C85 A;  5CUB A;  2K16 A;  3UVD A;  4XI1 A;  2YQD A;  3N9Q A;  3LJW A;  2ECG A;  5KH3 A;  4O64 A;  3O35 A;  3N9O A;  4C66 A;  2PNX A;  2KE1 A;  3IU5 A;  4MEP A;  1WIM A;  5B8D A;  5E9Y A;  5CY9 A;  1Z6U A;  4O75 A;  4QSW A;  3HMF A;  1K2F A;  5HQ7 A;  2CKL A;  3T7L A;  4AUQ B;  2JMJ A;  5FE9 A;  5D1M B;  5FFW A;  2CRW A;  4HXS A;  1MM2 A;  5FE7 A;  5KTW A;  4NR9 A;  2KIZ A;  5HM0 A;  3O47 A;  2RO1 A;  4A9H A;  4WZ2 A;  5EP7 A;  4QEU A;  5ETD A;  5II2 A;  3JVL A;  3LQI A;  4UIX A;  4WZ3 B;  2KU3 A;  2VJF B;  5I88 A;  5FG6 A;  5D1K B;  2VPB A;  2RFJ A;  4UYD A;  4ALG A;  4H9D A;  4AYC B;  4W4U A;  5EYA F;  2I7K A;  5E0R A;  5SVX A;  4UIT A;  4YAT A;  5I7X A;  3I2D A;  4HBX A;  5LUU A;  2DSM A;  4YAD A;  2R0V A;  1CHC A;  5A7C A;  2HYE D;  4Q0O A;  2K17 A;  4C9Z A;  5FER A;  2NAA A;  2YHO A;  4MR4 A;  4QZS A;  4A9F A;  5B79 A;  4IR5 A;  4YYD A;  3EB5 A;  4QYD A;  4CUQ A;  1JM7 A;  4V3K C;  5DKC A;  2EA6 A;  4Z6H A;  4FO9 A;  3KV6 A;  2H0D B;  3MUL A;  4GPJ A;  4FLP A;  3P1F A;  4I7B A;  3PHD A;  2Y1N A;  5EVA A;  3U5L A;  3NG2 A;  4LLB A;  5J3X A;  3Q2F A;  2YEL A;  4N4I A;  3HMH A;  3KDE C;  5D3T A;  4R7E A;  4HBY A;  3LJU X;  2K4D A;  3MQM A;  2MJV B;  4MEO A;  4CL9 A;  1VD4 A;  5FG4 A;  5HQ6 A;  2QJ0 A;  4PCE A;  2E6S A;  5TDR A;  4A9I A;  5H1U A;  2G4A A;  5HEN A;  4UP0 A;  4A49 A;  3N9N A;  3I3J A;  4XUA A;  2VJE B;  4Y03 A;  2DX8 A;  2IDA A;  4WHW A;  5LKT A;  2YU4 A;  3FAN A;  5KTX A;  3E2D A;  2CRR A;  2XEU A;  4TU4 A;  3GV4 A;  1HYJ A;  5E9K A;  5CTL A;  4O7A A;  4YK0 A;  2M6M A;  5L8T A;  5C7N A;  4UYF B;  5D26 A;  2KFT A;  4GNE A;  5DYX A;  4QQ4 A;  4IR3 A;  4S3O B;  4NR5 A;  1PUO A;  2YT5 A;  3IHP A;  5ENC A;  4PTB A;  2EGP A;  5E3D A;  4OGE A;  5DY7 A;  2MT5 A;  2DVR A;  4UIY A;  2MD8 C;  4F52 B;  2R0Y A;  4QY4 A;  4LZS A;  2I50 A;  5IGM A;  3K2J A;  3M63 A;  3U5K A;  4NRB A;  3UV2 A;  2KRE A;  4UIZ A;  2RNY A;  3NXB A;  5HEL A;  4QST A;  5EV9 A;  2MIQ A;  3DQV R;  5DYU A;  4A9L A;  4KV4 A;  1X4U A;  5ENH A;  5FB0 A;  5TDW A;  3M7K A;  5L98 A;  4MR6 A;  1LDK C;  5KO4 A;  5CFW A;  5IBN A;  2YRE A;  5FE5 A;  4A9K A;  1DVP A;  2CSY A;  5IGL A;  2KWK A;  2L75 A;  3IU6 A;  3VKG A;  2YVR A;  5CQ3 A;  4AKH A;  4J0S A;  3RCW A;  5EWH A;  3ZNI A;  2K1J A;  5DYC A;  5F60 A;  4LRG A;  1F68 A;  2YW8 A;  4HBV A;  4PKL A;  4WA6 A;  2KWJ A;  5BT3 A;  5CGP A;  5DLX A;  2Y1M A;  2OWA A;  5LKX A;  1X4I A;  2FD4 A;  2KGG A;  2E6R A;  5DKA A;  2LXP C;  4O78 A;  3ERR A;  1XWH A;  3P1C A;  2KGI A;  4QNS A;  4NQN A;  3U5P A;  5C8G A;  2CKL B;  3ZPV E;  5K3Q A;  2DKW A;  3JUE A;  2F6J A;  5D24 A;  3P5O A;  5I80 A;  5A5R A;  4HBW A;  4MR5 A;  5F3A A;  5D1L B;  4N4F A;  5BT4 A;  4QC3 A;  2E7N A;  3N9M A;  5TB6 A;  4YY4 A;  3ZVY A;  3MUK A;  5DIN A;  4CUS A;  4F1P A;  4J1P A;  3FL2 A;  3L1Z B;  2VP7 A;  5CRM A;  2FUU A;  5G0F A;  4YYM A;  5SVY A;  5K29 A;  2EJN A;  4CUT A;  2VJE A;  5F63 A;  3SVG A;  4XUB A;  5C11 A;  2R10 A;  5LVR A;  4TT4 A;  5D0C A;  4CFK A;  2PUY A;  5CRZ A;  4QC1 A;  5BT5 A;  4O71 A;  2LGK A;  1V87 A;  2HDP A;  2L0B A;  5CUA A;  5F36 A;  4IOO A;  4PY6 A;  3C6W A;  5A5S A;  2YYR A;  1HYI A;  4UYG A;  4BBQ A;  5CUC A;  4YYI A;  3EB6 A;  4MR3 A;  5FH6 A;  2XOC A;  1ZS5 A;  3O37 A;  4O77 A;  4X3G A;  2VPD A;  4Q0N A;  4HXN A;  5KTU A;  4BW1 A;  3JVM A;  3LRQ A;  1DCQ A;  4Q6F A;  4NRA A;  5ACY A;  5CUD A;  5I83 A;  1G25 A;  2YYN A;  5FDZ A;  5FE1 A;  4ZQL A;  3G0J A;  5IG6 A;  2YDW A;  4BW4 A;  3DWD A;  4I7D A;  4UYH A;  4NQM A;  2YQL A;  4CUR A;  4L7X A;  5FH8 A;  2QIC A;  3UVY A;  3RPG B;  3ONI A;  5F25 A;  3GL6 A;  2L85 A;  4NYV A;  3VKH A;  2JM3 A;  3GG3 A;  2NXB A;  2G6Q A;  3MXF A;  5CS8 A;  4QSX A;  5A5Q A;  5A5O A;  1WES A;  2VNF A;  4AYC A;  2ECT A;  5FE8 A;  5D3H A;  2F6N A;  3N9P A;  1T1H A;  3T9K A;  2JUN A;  2KYU A;  2H60 A;  3LXJ A;  4NYX A;  2CSV A;  2EOD A;  3D1B A;  5L96 A;  2MA6 A;  4BW3 A;  2RNW A;  5E73 A;  1WEN A;  2L84 A;  2RR4 A;  4NR4 A;  4O62 A;  4HXO A;  4O76 A;  4E96 A;  5C87 A;  5DKD A;  3O7A A;  4O72 A;  4MEQ A;  4DON A;  2DAT A;  5DFD A;  1JM7 B;  2EXU A;  3U5O A;  3ZYQ A;  4N3W A;  5LJ2 A;  5L97 A;  4FIP A;  1JM4 B;  1WE9 A;  2XP0 A;  1ZKR A;  3M99 A;  3D7C A;  5IID A;  1LDJ B;  2XB1 A;  2YUR A;  5B76 A;  5FFV A;  1Z2Q A;  4A9N A;  2ECI A;  5HFQ A;  3PUR A;  3O70 A;  2RNX A;  2N9G A;  5CUE A;  5ENG A;  5FB1 A;  5FE4 A;  4A9M A;  2RI7 A;  4B7Y C;  3P1E A;  5F62 A;  3QZS A;  4WIV A;  3UW9 A;  2MNZ A;  2MKE A;  5JG6 A;  4UYF A;  2D82 A;  4LC2 A;  1EQF A;  5TAB A;  5G05 B;  2LXH C;  5AIT A;  3KV5 A;  2AN6 A;  4TKP B;  5HRW A;  5HRV A;  5CU8 A;  5A82 A;  1MBM A;  3S91 A;  4TYL A;  2IQJ A;  2JMI A;  4NS5 A;  1E6I A;  5ENF A;  3LVQ E;  3SHB A;  3HTK C;  4CA1 A;  1U6G B;  1WUG A;  4Z6I A;  5J0D A;  1N87 A;  5D3N A;  5F1H A;  3FJU B;  5H85 A;  5DFB A;  2L80 A;  5EK9 A;  5IGN A;  5I3L A;  4NRC A;  2DVQ A;  2DWW A;  3MB3 A;  1X0J A;  2I8N A;  4NUC A;  5FE0 A;  2CT2 A;  5TRB A;  4QUU A;  3FKM X;  4HXP A;  4TZ8 A;  5I40 A;  2YHN A;  5EPS A;  4IR4 A;  5D3S A;  5EWD A;  4AKG A;  4LK9 A;  3T6R A;  5EIS A;  2CSZ A;  4AKN A;  5I89 A;  4QUT A;  1FBV A;  4O74 A;  3O34 A;  2OSS A;  5HJC A;  3P1D A;  2RS9 B;  1X4J A;  5E9I A;  3HCT A;  4Z0R A;  2EGM A;  5D7X A;  3O33 A;  4QSV A;  4A4C A;  4B86 C;  3V43 A;  5F61 A;  4OGI A;  4N4G A;  5EIC A;  4NR7 A;  4QYL A;  1WEP A;  2C2V S;  4PPE A;  4YH4 A;  2KWO A;  3HCS A;  1BOR A;  1VYX A;  2FFW A;  2VPE A;  4HXL A;  5DLZ A;  2GRC A;  4YBT A;  2KKY A;  5DKH A;  5D3J A;  3FEH A;  3FM8 C;  4YYH A;  4LJN A;  4QF3 A;  2KTB B;  2L5E A;  4QR3 A;  5EU1 A;  2UZG A;  3UV5 A;  2YUC A;  2LN0 A;  2MNY A;  5FE2 A;  5F1L A;  4NN2 A;  5D3R A;  3QZV A;  4CUP A;  4MSX A;  5H1V A;  4J3I A;  3LVR E;  5AME A;  5EPR A;  2G45 A;  2KR4 A;  5FFY A;  4P5O B;  3JVJ A;  4YYN A;  5HFR A;  5A5P A;  2OUO A;  4QSS A;  4ALH A;  2B0O E;  5I86 A;  5SVI B;  2OXQ C;  4O7E A;  3L1X A;  5AIU A;  2LRI C;  5I7Y A;  2QIZ A;  3ZVZ B;  5L99 A;  2JMD A;  1E4U A;  3DAI A;  5G4R A;  1VFY A;  3UV4 A;  4Z1S A;  5DFC A;  3D1D A;  4LZR A;  2FSA A;  4LKA A;  3QZT A;  5AMF A;  5CQT A;  5EWC A;  4QSU A;  2FUI A;  2LDR A;  3ASL A;  4LR6 A;  4GB0 A;  2LGV A;  4UIU A;  5DYA A;  1N72 A;  3DWY A;  4LYW A;  4OUF A;  3ZYU A;  3ZTG A;  4KCX A;  3DDT A;  2L7P A;  3UVX A;  4UI9 B;  4FK5 A;  5A81 A;  2M13 A;  4CFL A;  3MDB C;  4TS8 A;  2DJA A;  5HEM A;  5A85 A;  5SVI A;  4YAB A;  5EI4 A;  5G4S A;  4AVX A;  5FE6 A;  3O36 A;  4QB3 A;  4WHU A;  2LSP B;  5ENB A;  5LCW B;  4YYG A;  1JSP B;  3N9L A;  4QEV A;  4XYA A;  5DBM A;  4WZ0 A;  2C2L A;  3HCU A;  4IC2 A;  4YAX A;  5E7D A;  4LDF A;  4R8P K;  5LKU A;  5B77 A;  4TQN A;  2ECN A;  5LKZ A;  3S92 A;  2JRJ A;  4O7F A;  2KKX A;  3LQJ A;  5E74 A;  1WFK A;  3U5M A;  4QF2 A;  4YH3 A;  2E7O A;  4NUE A;  3UVW A;  2KWN A;  5CQA A;  5L8U A;  5FE3 A;  5EA1 A;  4LYS A;  4TZ2 A;  4LAD B;  4CLB A;  4FJC A;  1WIL A;  1FP0 A;  5F2P A;  2ECV A;  5A5N A;  4MVT A;  4C67 A;  3AQA A;  1RMD A;  5HLS A;  3RPG C;  3MB4 A;  4O70 A;  3SVF A;  4CUU A;  2G43 A;  5C13 A;  2WP1 A;  4NUD A;  4NR8 A;  3KQI A;  5A83 A;  4QBM A;  4XY8 A;  4I7C A;  4TU6 A;  2YEM A;  2LGL A;  4QEW A;  5E9V A;  3C5K A;  5ENI A;  4BHW A;  3DPL R;  5CZG A;  4CCG X;  2ZET C;  5TCM A;  3RTR B;  2YEK A;  2VPG A;  4GND A;  4ZDT A;  2L5U A;  2ECJ A;  4IC3 A;  4A4B A;  4V3L C;  3U5N A;  4Z93 A;  4AP4 A;  2P57 A;  1WEU A;  4HXR A;  4OGC A;  5KHM A;  4A9E A;  4X2I A;  3ZPV 1;  2XOY A;  2LV9 A;  4YYK A;  4TT2 A;  5D3P A;  4N4H A;  1WEQ A;  2LGG A;  5EWV A;  4A9J A;  4L58 A;  4NYW A;  3FAO A;  2D9E A;  4HXM A;  5C4Q A;  2M1R A;  2D8U A;  5FEY A;  5HCL A;  3SOU A;  3LDY A;  3U5J A;  2L43 A;  3L11 A;  5KH7 A;  5TBN A;  1MM3 A;  2DVV A;  4YBS A;  2F42 A;  2M3H A;  1WUM A;  4O7C A;  5CUG A;  4TT6 A;  2D8S A;  3Q2E A;  4UP5 A;  4IOQ A;  4AI6 A;  1WEV A;  3H7H A;  3MHH A;  5FBX A;  1JOC A;  5II1 A; 
#chains in the Genus database with same CATH homology
 1WEM A;  4QSQ A;  5DW2 A;  5AD3 A;  1WEW A;  3G0L A;  4OGJ A;  5ETB A;  3TLP A;  2DVS A;  5HRX A;  5KH9 A;  3SOW A;  4TTE A;  2WP2 A;  4ZC9 A;  5CQ7 A;  4ZW1 A;  4QR5 A;  5JI8 A;  2VJF A;  3VK6 A;  4LZ2 A;  1ZBD B;  2YSJ A;  2MD7 B;  5LVQ A;  5HQ5 A;  4Z1Q A;  5COI A;  5F5Z A;  5B75 A;  4BJX A;  4NR6 A;  2R0S A;  5CQ4 A;  4A0C D;  5EM3 A;  5LJ1 A;  4NXJ A;  5EPB A;  5EQ1 A;  4A9O A;  5CPE A;  5D25 A;  2E3K A;  4LYI A;  3PUQ A;  4UIV A;  3KNV A;  5DW1 A;  5ENE A;  4MEN A;  1WEO A;  1Z60 A;  3HME A;  3AAD A;  4QSR A;  5CQ8 A;  3SOX A;  4J0R A;  4O7B A;  5FG5 A;  4S3O C;  1IYM A;  5DX4 A;  4YC9 A;  3MHS A;  4KV1 A;  4YY6 A;  2M85 A;  5KU3 A;  5H9M A;  1WEE A;  4UIW A;  5EWW A;  4BW2 A;  4QSP A;  5E3G A;  3M62 A;  2MA5 A;  4IOR A;  4XY9 A;  4ZUX U;  5AD2 A;  5H1T A;  5B78 A;  5CQ5 A;  3SVH A;  2YQM A;  3JVK A;  4HXK A;  5I1Q A;  4QR4 A;  5ENJ A;  4F3I A;  4GNF A;  2Y43 A;  2H0D A;  5D3L A;  5IGK A;  5E9L A;  1WGM A;  3LQH A;  2MUM A;  1F62 A;  2YW5 A;  5C89 A;  4RVR A;  5LJ0 A;  4PCI A;  2LQ6 A;  4IR6 A;  2ECW A;  2OO1 A;  5EGU A;  5JWM A;  5G04 B;  2YSM A;  5CQ6 A;  5E9M A;  5I29 A;  4GNG A;  4R2Y A;  4UYE A;  5CP5 A;  4YYJ A;  2BAY A;  5FH7 A;  2RSD A;  4PS5 A;  4YBM A;  5C85 A;  5CUB A;  2K16 A;  3UVD A;  4XI1 A;  2YQD A;  3N9Q A;  3LJW A;  2ECG A;  5KH3 A;  4O64 A;  3O35 A;  3N9O A;  4C66 A;  2PNX A;  2KE1 A;  3IU5 A;  4MEP A;  1WIM A;  5B8D A;  5E9Y A;  5CY9 A;  1Z6U A;  4O75 A;  4QSW A;  3HMF A;  1K2F A;  5HQ7 A;  2CKL A;  3T7L A;  4AUQ B;  2JMJ A;  5FE9 A;  5D1M B;  5FFW A;  4HXS A;  1MM2 A;  5FE7 A;  5KTW A;  4NR9 A;  2KIZ A;  5HM0 A;  4WZ2 A;  2RO1 A;  4A9H A;  5EP7 A;  4QEU A;  5ETD A;  5II2 A;  3LQI A;  3JVL A;  4UIX A;  4WZ3 B;  2KU3 A;  2VJF B;  5I88 A;  5FG6 A;  5D1K B;  2VPB A;  2RFJ A;  4UYD A;  4ALG A;  4AYC B;  4W4U A;  5EYA F;  2I7K A;  5E0R A;  4UIT A;  4YAT A;  5I7X A;  3I2D A;  4HBX A;  5LUU A;  4YAD A;  2R0V A;  1CHC A;  5A7C A;  2HYE D;  4Q0O A;  2K17 A;  4C9Z A;  5FER A;  2NAA A;  2YHO A;  4MR4 A;  4QZS A;  4A9F A;  5B79 A;  4IR5 A;  4YYD A;  3EB5 A;  4QYD A;  4CUQ A;  1JM7 A;  4V3K C;  5DKC A;  2EA6 A;  4Z6H A;  4FO9 A;  3KV6 A;  2H0D B;  3MUL A;  4GPJ A;  4FLP A;  3P1F A;  4I7B A;  3PHD A;  2Y1N A;  5EVA A;  3U5L A;  3NG2 A;  4LLB A;  5J3X A;  3Q2F A;  2YEL A;  4N4I A;  3HMH A;  5D3T A;  4R7E A;  4HBY A;  2K4D A;  3MQM A;  2MJV B;  4MEO A;  4CL9 A;  1VD4 A;  5FG4 A;  5HQ6 A;  2QJ0 A;  4PCE A;  2E6S A;  5TDR A;  4A9I A;  5H1U A;  2G4A A;  5HEN A;  4UP0 A;  4A49 A;  3N9N A;  3I3J A;  4XUA A;  2VJE B;  4Y03 A;  2DX8 A;  2IDA A;  4WHW A;  5LKT A;  2YU4 A;  5KTX A;  2XEU A;  4TU4 A;  3GV4 A;  1HYJ A;  5E9K A;  5CTL A;  4O7A A;  4YK0 A;  2M6M A;  5L8T A;  5C7N A;  4UYF B;  5D26 A;  2KFT A;  4GNE A;  5DYX A;  4IR3 A;  4S3O B;  4NR5 A;  2YT5 A;  3IHP A;  5ENC A;  4PTB A;  2EGP A;  5E3D A;  5DY7 A;  2MT5 A;  2DVR A;  4UIY A;  2MD8 C;  4F52 B;  2R0Y A;  4QY4 A;  4LZS A;  2I50 A;  5IGM A;  3K2J A;  3M63 A;  3U5K A;  4NRB A;  3UV2 A;  2KRE A;  4UIZ A;  2RNY A;  3NXB A;  5HEL A;  4QST A;  5EV9 A;  2MIQ A;  3DQV R;  5DYU A;  4A9L A;  4KV4 A;  1X4U A;  5ENH A;  5FB0 A;  5TDW A;  5L98 A;  4MR6 A;  1LDK C;  5KO4 A;  5CFW A;  5IBN A;  2YRE A;  5FE5 A;  4A9K A;  1DVP A;  2CSY A;  5IGL A;  2KWK A;  2L75 A;  3IU6 A;  5CQ3 A;  4J0S A;  3RCW A;  5EWH A;  3ZNI A;  2K1J A;  5DYC A;  5F60 A;  4LRG A;  1F68 A;  2YW8 A;  4HBV A;  4PKL A;  4WA6 A;  2KWJ A;  5BT3 A;  5CGP A;  5DLX A;  2Y1M A;  5LKX A;  1X4I A;  2KGG A;  2E6R A;  5DKA A;  2LXP C;  4O78 A;  1XWH A;  3P1C A;  2KGI A;  4QNS A;  4NQN A;  3U5P A;  5C8G A;  2CKL B;  3ZPV E;  2DKW A;  2F6J A;  5D24 A;  3P5O A;  5I80 A;  5A5R A;  4HBW A;  4MR5 A;  5F3A A;  5D1L B;  4N4F A;  5BT4 A;  4QC3 A;  2E7N A;  3N9M A;  5TB6 A;  4YY4 A;  3ZVY A;  3MUK A;  5DIN A;  4CUS A;  4J1P A;  3FL2 A;  3L1Z B;  2VP7 A;  5CRM A;  2FUU A;  5G0F A;  4YYM A;  5K29 A;  4CUT A;  2VJE A;  5F63 A;  3SVG A;  4XUB A;  5C11 A;  2R10 A;  5LVR A;  4TT4 A;  5D0C A;  4CFK A;  2PUY A;  5CRZ A;  4QC1 A;  5BT5 A;  4O71 A;  2LGK A;  1V87 A;  2HDP A;  2L0B A;  5CUA A;  5F36 A;  4IOO A;  4PY6 A;  3C6W A;  5A5S A;  2YYR A;  1HYI A;  4UYG A;  4BBQ A;  5CUC A;  4YYI A;  3EB6 A;  4MR3 A;  5FH6 A;  1ZS5 A;  3O37 A;  4O77 A;  4X3G A;  2VPD A;  4Q0N A;  4HXN A;  5KTU A;  4BW1 A;  3JVM A;  3LRQ A;  4Q6F A;  4NRA A;  5ACY A;  5CUD A;  5I83 A;  1G25 A;  2YYN A;  5FDZ A;  5FE1 A;  4ZQL A;  3G0J A;  5IG6 A;  2YDW A;  4BW4 A;  4I7D A;  4UYH A;  4NQM A;  2YQL A;  4CUR A;  4L7X A;  5FH8 A;  2QIC A;  3UVY A;  3RPG B;  3ONI A;  5F25 A;  3GL6 A;  2L85 A;  4NYV A;  3GG3 A;  2NXB A;  2G6Q A;  3MXF A;  5CS8 A;  4QSX A;  5A5Q A;  5A5O A;  1WES A;  2VNF A;  4AYC A;  2ECT A;  5FE8 A;  5D3H A;  2F6N A;  3N9P A;  1T1H A;  2KYU A;  2H60 A;  3LXJ A;  4NYX A;  2EOD A;  5L96 A;  2MA6 A;  4BW3 A;  2RNW A;  5E73 A;  1WEN A;  2L84 A;  4NR4 A;  4HXO A;  4O76 A;  4E96 A;  5C87 A;  5DKD A;  3O7A A;  4O72 A;  4MEQ A;  4DON A;  2DAT A;  5DFD A;  1JM7 B;  3U5O A;  3ZYQ A;  4N3W A;  5LJ2 A;  5L97 A;  4FIP A;  1JM4 B;  1WE9 A;  3M99 A;  3D7C A;  5IID A;  1LDJ B;  2XB1 A;  2YUR A;  5B76 A;  5FFV A;  1Z2Q A;  4A9N A;  2ECI A;  5HFQ A;  3PUR A;  3O70 A;  2RNX A;  2N9G A;  5CUE A;  5ENG A;  5FB1 A;  5FE4 A;  4A9M A;  2RI7 A;  4B7Y C;  3P1E A;  5F62 A;  3QZS A;  4WIV A;  3UW9 A;  2MNZ A;  5JG6 A;  4UYF A;  2D82 A;  4LC2 A;  1EQF A;  5TAB A;  5G05 B;  2LXH C;  5AIT A;  3KV5 A;  2AN6 A;  4TKP B;  5HRW A;  5HRV A;  5CU8 A;  5A82 A;  3S91 A;  4TYL A;  2JMI A;  4NS5 A;  1E6I A;  5ENF A;  3SHB A;  3HTK C;  4CA1 A;  1U6G B;  1WUG A;  4Z6I A;  5J0D A;  1N87 A;  5D3N A;  5F1H A;  5H85 A;  5DFB A;  2L80 A;  5EK9 A;  5IGN A;  5I3L A;  4NRC A;  2DVQ A;  2DWW A;  3MB3 A;  1X0J A;  2I8N A;  4NUC A;  5FE0 A;  2CT2 A;  5TRB A;  4QUU A;  3FKM X;  4HXP A;  4TZ8 A;  5I40 A;  2YHN A;  5EPS A;  4IR4 A;  5D3S A;  5EWD A;  4LK9 A;  3T6R A;  5EIS A;  2CSZ A;  4AKN A;  5I89 A;  4QUT A;  1FBV A;  4O74 A;  3O34 A;  2OSS A;  5HJC A;  3P1D A;  2RS9 B;  1X4J A;  5E9I A;  3HCT A;  5D7X A;  3O33 A;  4QSV A;  4A4C A;  4B86 C;  3V43 A;  5F61 A;  4OGI A;  4N4G A;  5EIC A;  4NR7 A;  4QYL A;  1WEP A;  2C2V S;  4PPE A;  4YH4 A;  2KWO A;  3HCS A;  1BOR A;  1VYX A;  2VPE A;  4HXL A;  5DLZ A;  2GRC A;  4YBT A;  5DKH A;  5D3J A;  4YYH A;  4LJN A;  4QF3 A;  2KTB B;  2L5E A;  4QR3 A;  5EU1 A;  2UZG A;  3UV5 A;  2YUC A;  2LN0 A;  2MNY A;  5FE2 A;  5F1L A;  4NN2 A;  5D3R A;  3QZV A;  4CUP A;  4MSX A;  5H1V A;  4J3I A;  5AME A;  5EPR A;  2G45 A;  2KR4 A;  5FFY A;  4P5O B;  3JVJ A;  4YYN A;  5HFR A;  5A5P A;  2OUO A;  4QSS A;  4ALH A;  5I86 A;  2OXQ C;  4O7E A;  3L1X A;  5AIU A;  2LRI C;  5I7Y A;  2QIZ A;  3ZVZ B;  5L99 A;  2JMD A;  1E4U A;  3DAI A;  5G4R A;  1VFY A;  3UV4 A;  4Z1S A;  5DFC A;  4LZR A;  2FSA A;  4LKA A;  3QZT A;  5AMF A;  5CQT A;  5EWC A;  4QSU A;  2FUI A;  2LDR A;  3ASL A;  4LR6 A;  4GB0 A;  2LGV A;  4UIU A;  5DYA A;  1N72 A;  3DWY A;  4LYW A;  4OUF A;  3ZYU A;  3ZTG A;  4KCX A;  3UVX A;  4UI9 B;  4FK5 A;  5A81 A;  4CFL A;  4TS8 A;  5HEM A;  5A85 A;  4YAB A;  5EI4 A;  5G4S A;  4AVX A;  5FE6 A;  3O36 A;  4QB3 A;  4WHU A;  2LSP B;  5ENB A;  5LCW B;  4YYG A;  1JSP B;  3N9L A;  4QEV A;  4XYA A;  5DBM A;  4WZ0 A;  2C2L A;  3HCU A;  4IC2 A;  4YAX A;  5E7D A;  4LDF A;  4R8P K;  5LKU A;  5B77 A;  4TQN A;  2ECN A;  5LKZ A;  3S92 A;  2JRJ A;  4O7F A;  3LQJ A;  5E74 A;  1WFK A;  3U5M A;  4QF2 A;  4YH3 A;  2E7O A;  4NUE A;  3UVW A;  2KWN A;  5CQA A;  5L8U A;  5FE3 A;  5EA1 A;  4LYS A;  4TZ2 A;  4LAD B;  4CLB A;  4FJC A;  1WIL A;  1FP0 A;  5F2P A;  2ECV A;  5A5N A;  4MVT A;  4C67 A;  3AQA A;  1RMD A;  5HLS A;  3RPG C;  3MB4 A;  4O70 A;  3SVF A;  4CUU A;  2G43 A;  5C13 A;  2WP1 A;  4NUD A;  4NR8 A;  3KQI A;  5A83 A;  4QBM A;  4XY8 A;  4I7C A;  4TU6 A;  2YEM A;  2LGL A;  4QEW A;  5E9V A;  3C5K A;  5ENI A;  4BHW A;  3DPL R;  5CZG A;  4CCG X;  2ZET C;  5TCM A;  3RTR B;  2YEK A;  2VPG A;  4GND A;  4ZDT A;  2L5U A;  2ECJ A;  4IC3 A;  4A4B A;  4V3L C;  3U5N A;  4Z93 A;  4AP4 A;  1WEU A;  4HXR A;  5KHM A;  4A9E A;  4X2I A;  3ZPV 1;  2LV9 A;  4YYK A;  4TT2 A;  5D3P A;  4N4H A;  1WEQ A;  2LGG A;  5EWV A;  4A9J A;  4L58 A;  4NYW A;  2D9E A;  4HXM A;  5C4Q A;  2M1R A;  5FEY A;  5HCL A;  3SOU A;  3U5J A;  2L43 A;  3L11 A;  5KH7 A;  5TBN A;  1MM3 A;  2DVV A;  4YBS A;  2F42 A;  2M3H A;  1WUM A;  4O7C A;  5CUG A;  4TT6 A;  2D8S A;  3Q2E A;  4UP5 A;  4IOQ A;  3MHH A;  1WEV A;  5FBX A;  1JOC A;  5II1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...