2FSAA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the h3(1-15)k4me2 bound state
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
168
Chain Sequence
DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 50
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2fsaA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2fsaA01
4ALGA 5CTLA 5ENHA 1LDJB 2YSMA 4GB0A 5CUGA 1FBVA 4HBWA 5ENGA 2MD7B 1XWHA 2L80A 5D3JA 2KWJA 2LGVA 5I88A 4ZUXU 4XI1A 4BBQA 2FUUA 2E3KA 4NR8A 4FIPA 2I8NA 3U5NA 5E3GA 1WFKA 2YT5A 5TCMA 5EPRA 3U5MA 5C8GA 2IDAA 4HXMA 4PS5A 3LJWA 5CUDA 5DFCA 3S91A 2JMDA 2JMIA 3HCTA 4GNFA 2LV9A 5DFBA 4LZ2A 1ZBDB 2KWKA 4UYHA 5A82A 1WEWA 1N87A 4BHWA 2PUYA 4QBMA 2F6JA 5TB6A 1FP0A 2LQ6A 5ENCA 1WEEA 4HBYA 2K17A 5E0RA 5ENEA 5HFRA 3VK6A 3G0LA 3GL6A 5FDZA 5LKUA 2WP1A 4HBXA 5FG5A 3DPLR 3KNVA 4IOOA 5L96A 4MR4A 4TZ2A 4NRCA 2LGGA 5FFYA 2VP7A 3L11A 3MB3A 4WA6A 4QB3A 2L75A 4HXLA 2HDPA 2DKWA 5F25A 3UVDA 5F61A 2L5EA 2K16A 2LRIC 4CLBA 1HYIA 1V87A 3HCSA 5COIA 4UIUA 2L43A 2VJEA 2I50A 5EK9A 3Q2EA 1WUGA 4NQNA 1MM2A 4QUTA 5F60A 1WEOA 5H85A 2RNYA 5E7DA 4DONA 5EA1A 5D1KB 2VPGA 5CQTA 2R10A 4MR6A 5A5QA 4UI9B 2D8SA 3SOUA 3ZPVE 4A4CA 2LN0A 5CQ8A 5E74A 3N9MA 3UVYA 4LJNA 4J0SA 4QSQA 4UIZA 3NXBA 5EYAF 5CUAA 2E6RA 2DWWA 3O35A 5FB0A 4N3WA 4NYWA 4N4HA 4TT4A 4LR6A 5LUUA 1VD4A 4GNEA 2H0DA 5ENIA 5CU8A 4A9NA 4QSTA 5EWVA 4HXOA 3JVMA 4PPEA 5F63A 2YELA 5AD3A 4A4BA 5CQ7A 3ZTGA 2KWOA 2RO1A 1G25A 2M85A 3ZPV1 4QEUA 4HXNA 5I83A 5CS8A 5H1VA 2H0DB 3L1ZB 2VPBA 2MJVB 5FH7A 2NAAA 4O71A 5B78A 3G0JA 4IORA 5AD2A 4FLPA 4C67A 1X4JA 2FSAA 4O76A 4TU6A 2Y1NA 2N9GA 4YY4A 2OXQC 4LKAA 4MR3A 5H9MA 5LJ2A 2YW8A 3T6RA 4XY9A 2CKLB 5HCLA 4UIVA 4YH4A 2DVVA 2D9EA 4NRBA 4PY6A 5A85A 4LC2A 5IGNA 3O33A 5CQ6A 4QSSA 3ONIA 4X2IA 3N9NA 3IU5A 2YQDA 4TS8A 4KV1A 5KO4A 2YHOA 4YYJA 2DVRA 4F3IA 4CUUA 2MIQA 3SHBA 2QJ0A 4XUBA 1JOCA 2E7OA 2G6QA 5EP7A 4UYFB 1WEPA 2JMJA 4QF3A 4NUEA 2R0YA 3ZVZB 3HMHA 4LK9A 1F62A 2RNWA 4LZSA 4Q0NA 4ZC9A 5HJCA 4AVXA 3GG3A 4C66A 4O74A 5FFVA 3IU6A 4A9KA 4TTEA 1HYJA 4NR5A 5D26A 3P1FA 2KU3A 5DYCA 3LQJA 4A9JA 2QICA 5D24A 2VJFB 4O77A 3O34A 4YK0A 5I29A 1CHCA 2VPDA 5F2PA 3SVGA 5DLZA 5E3DA 5JWMA 4UYDA 4L7XA 5IBNA 3RPGC 4FK5A 2K1JA 3U5KA 1Z6UA 5L8UA 4UYEA 5LJ1A 2DVQA 2E7NA 5FE9A 5BT4A 5IG6A 5C89A 5HRXA 4YBMA 3MHSA 4V3LC 3P1EA 5LCWB 2L0BA 3JVKA 2VNFA 3IHPA 4AYCA 5EGUA 3S92A 2C2LA 3N9PA 5TABA 4YYHA 4YADA 4O7AA 5HLSA 4IR3A 4BJXA 5F62A 4J0RA 3ZVYA 5LKZA 2L5UA 5EWDA 5TBNA 4QZSA 4GNDA 4N4GA 1WIMA 5EPSA 2L85A 1IYMA 4NRAA 5I1QA 5EVAA 2R0SA 5IIDA 5G0FA 2YU4A 5EISA 4A9IA 3TLPA 1VYXA 2WP2A 4YY6A 3I2DA 4MEQA 4E96A 2VPEA 3ASLA 3C6WA 4TKPB 4PTBA 3MHHA 3ZYUA 1WEVA 2Y43A 3PHDA 1JM7A 2NXBA 4UIWA 5E9VA 5B76A 3EB6A 5K29A 2YEKA 5AIUA 2YREA 3SVHA 2RNXA 4IC3A 4NYXA 5FE1A 4Z6IA 2KFTA 4S3OB 5FE4A 3UV4A 2LDRA 3V43A 2EA6A 5A81A 2RI7A 4YH3A 4CUTA 2KYUA 2M6MA 4TT2A 4P5OB 1T1HA 5H1UA 5A5NA 4R2YA 2CSZA 4NR9A 4ZW1A 4FJCA 3DAIA 2OSSA 4QSXA 4IR4A 2I7KA 5HEMA 4Z6HA 3U5LA 4C9ZA 4CFKA 5A5OA 5E9MA 3O70A 4Z93A 2VJEB 4QF2A 5CPEA 5L99A 4GPJA 5DYUA 5FH6A 2PNXA 4ZQLA 4YYKA 3P1CA 3L1XA 3PUQA 3N9QA 3RPGB 5AMEA 4YAXA 3K2JA 4YYIA 4A9HA 2EGPA 5DY7A 3M63A 4ALHA 3LQHA 2KGIA 2XEUA 4Q6FA 4I7BA 5L8TA 5DFDA 4UIXA 5I89A 5II1A 3ZNIA 2CT2A 5FE0A 4J1PA 5I40A 4PKLA 3O7AA 5D7XA 4BW2A 4WZ3B 5KH9A 5KH7A 2RS9B 3MB4A 4LRGA 5C7NA 5C11A 3LXJA 5EQ1A 4LADB 4B7YC 5B77A 2M3HA 1VFYA 5HRVA 5FERA 2YDWA 4YYNA 4BW1A 2YHNA 5TDRA 2RFJA 2ZETC 5LJ0A 2KTBB 5AITA 4NR7A 4UIYA 4A9EA 5C87A 2YW5A 5FG4A 1F68A 5C13A 2G43A 4V3KC 2EODA 4R7EA 1N72A 3RCWA 1WE9A 3HMFA 2XB1A 3U5PA 4I7DA 4QSUA 2ECNA 5A7CA 4R8PK 5CGPA 4F52B 5CQ3A 4LDFA 5FE6A 5CRMA 4YC9A 2F42A 2ECJA 1RMDA 5E9KA 5EM3A 2OUOA 4O7CA 1WEQA 4CCGX 3JVJA 4QC3A 4TU4A 2GRCA 5D3RA 5EWWA 4ZDTA 4BW4A 4XYAA 4UP5A 4XUAA 4LLBA 1U6GB 4WHUA 3AQAA 4HXRA 5D1MB 4LYWA 4TT6A 5KTWA 3N9LA 1E6IA 2BAYA 5H1TA 2UZGA 3SOWA 5F5ZA 4QSWA 1WGMA 5CUEA 5A5SA 4L58A 4MVTA 4O78A 4O70A 2ECGA 5B8DA 2M1RA 3SOXA 5HQ6A 3UV2A 2YQLA 4N4IA 2YEMA 2YQMA 5LKTA 2YURA 2K4DA 3MULA 5TRBA 5C4QA 2Y1MA 3U5JA 5HELA 1JM4B 5EWHA 1WEUA 2QIZA 4WZ0A 2MA6A 5I86A 5EV9A 3QZSA 2LGLA 4B86C 5FG6A 3MXFA 2JRJA 2KGGA 4YYMA 5EWCA 5F36A 5HQ5A 5D3TA 4NQMA 3Q2FA 4QSVA 3SVFA 4O7BA 4O7EA 4YBSA 5A5PA 2YSJA 2LSPB 3NG2A 1Z2QA 4MEOA 5HRWA 2D82A 1K2FA 5I7XA 5G4RA 4CA1A 3HMEA 5E9LA 4CFLA 5IGLA 1Z60A 3JVLA 2ECWA 3UVXA 4YBTA 5DYXA 4NR6A 4QSRA 5DW2A 4AYCB 5CP5A 5DX4A 4A0CD 2DX8A 4LYSA 4HXKA 5IGKA 5IGMA 5FBXA 5HENA 1WUMA 4CL9A 1ZS5A 4NUCA 4WHWA 5F1HA 2MA5A 4QYLA 5B79A 5A83A 3P1DA 5CQAA 2G4AA 3QZVA 5HFQA 4PCIA 5KU3A 4HXSA 2MD8C 2C2VS 4RVRA 1LDKC 5D3PA 5FH8A 5FE8A 4OGJA 2OO1A 5ETBA 4XY8A 5DW1A 3PURA 2KIZA 5EICA 5EU1A 3ZYQA 3D7CA 4YYGA 5LKXA 2ECVA 4OUFA 5D1LB 4WIVA 4YYDA 3LRQA 4IR6A 5LVRA 4CUSA 3HTKC 4W4UA 2KREA 5BT5A 5FE3A 5FFWA 5II2A 3KV6A 1JM7B 4QEWA 4O64A 4NN2A 1WESA 3MUKA 4A9FA 3EB5A 2FUIA 3KV5A 4I7CA 5JG6A 4CURA 4CUPA 4IC2A 1JSPB 2MNYA 4UYGA 4NS5A 5G4SA 4QEVA 4X3GA 3P5OA 2KR4A 3AADA 5D3NA 5KHMA 5JI8A 4AUQB 4YABA 5ENFA 3O36A 2LGKA 5L98A 3U5OA 5KTXA 3I3JA 5ENJA 3C5KA 5CFWA 5DKAA 5A5RA 4TYLA 4QR5A 5FB1A 5L97A 5FE2A 4QC1A 4A9OA 2HYED 4WZ2A 5TDWA 5F1LA 2KWNA 4IR5A 4MEPA 3UW9A 4TQNA 3MQMA 4UITA 4BW3A 4FO9A 1EQFA 4MR5A 5FE5A 5ENBA 5FE7A 5G05B 5LVQA 1DVPA 4A49A 3N9OA 4OGIA 2YYNA 5J0DA 4O7FA 5CZGA 1WILA 4KV4A 4QY4A 2YYRA 2F6NA 4TZ8A 5HM0A 2ECIA 1E4UA 5DYAA 2DATA 3GV4A 1BORA 5CQ5A 4A9LA 4QSPA 5CRZA 2YUCA 3FKMX 5C85A 2CKLA 2L84A 5EPBA 1X4IA 2MNZA 4Z1QA 1WENA 3UVWA 5E73A 2MUMA 2LXHC 2DVSA 4QYDA 3M62A 4MENA 5E9IA 5KH3A 4HBVA 4LYIA 1MM3A 2E6SA 3UV5A 3T7LA 4KCXA 3RTRB 4QUUA 2KE1A 4Z1SA 2MT5A 5DLXA 4UYFA 2RSDA 4NR4A 4QNSA 5BT3A 5CQ4A 4UP0A 5D0CA 5EI4A 4O72A 5CUCA 4QR3A 4A9MA 4NYVA 5KTUA 4J3IA 5DKCA 2R0VA 4Q0OA 5D3HA 5DKHA 5E9YA 5ACYA 1X4UA 5CY9A 5AMFA 4QR4A 5D3SA 2VJFA 4O75A 5I3LA 4MSXA 3O37A 4PCEA 2CSYA 2LXPC 3QZTA 5J3XA 5DKDA 5FEYA 4YATA 5DINA 4CUQA 3LQIA 2AN6A 4S3OC 5B75A 1X0JA 3DQVR 5G04B 2ECTA 5D25A 1WEMA 2H60A 3FL2A 4LZRA 3KQIA 4IOQA 3M99A 4GNGA 5I7YA 2G45A 5HQ7A 4N4FA 5F3AA 4NXJA 5I80A 3HCUA 5D3LA 4AP4A 4Y03A 3DWYA 4AKNA 5CUBA 4NUDA 5DBMA 4HXPA 5ETDA
chains in the Genus database with same CATH superfamily
4ALGA 5CTLA 5ENHA 1LDJB 2YSMA 4GB0A 5CUGA 1FBVA 2FD4A 4HBWA 5ENGA 2MD7B 1XWHA 2YVRA 2L80A 5D3JA 2KWJA 2LGVA 5I88A 4ZUXU 4XI1A 4BBQA 2FUUA 2E3KA 4NR8A 4FIPA 2I8NA 3U5NA 5E3GA 1WFKA 2YT5A 5TCMA 5EPRA 3U5MA 5C8GA 2IDAA 4HXMA 4PS5A 3LJWA 5CUDA 5DFCA 3S91A 2JMDA 2JMIA 3HCTA 4GNFA 3SUBA 3LDYA 2LV9A 5DFBA 4LZ2A 1ZBDB 2KWKA 4UYHA 5A82A 1WEWA 1N87A 4BHWA 2PUYA 4QBMA 2F6JA 5K3QA 5TB6A 1FP0A 3VKGA 2LQ6A 5ENCA 1WEEA 4HBYA 2K17A 5E0RA 5ENEA 5HFRA 3VK6A 3G0LA 3GL6A 5FDZA 5LKUA 2WP1A 4HBXA 5FG5A 3DPLR 3KNVA 4IOOA 5L96A 4MR4A 4TZ2A 4NRCA 2LGGA 5FFYA 2VP7A 3L11A 3MB3A 4WA6A 4QB3A 2L75A 4HXLA 2HDPA 2XOCA 2DKWA 5F25A 3FAOA 3UVDA 5F61A 2L5EA 2K16A 2LRIC 4CLBA 4H9DA 1V87A 3HCSA 1HYIA 5SVYA 2KKYA 5COIA 4UIUA 2L43A 2VJEA 2I50A 5EK9A 3Q2EA 1WUGA 4NQNA 1MM2A 4QUTA 5F60A 1WEOA 5H85A 2RNYA 5E7DA 4DONA 5EA1A 5D1KB 2VPGA 5CQTA 2R10A 4MR6A 5A5QA 4UI9B 2D8SA 3SOUA 3LJUX 3ZPVE 2LN0A 5CQ8A 5E74A 3N9MA 3UVYA 4LJNA 4J0SA 4QSQA 3M7KA 4UIZA 3NXBA 5EYAF 5CUAA 2E6RA 2DWWA 3O35A 5FB0A 4N3WA 4NYWA 4N4HA 4TT4A 4LR6A 5LUUA 1VD4A 4GNEA 2H0DA 5ENIA 5CU8A 4A9NA 3DDTA 4QSTA 5EWVA 4HXOA 3JVMA 4PPEA 5F63A 2YELA 5AD3A 4A4BA 5CQ7A 5SVIB 3ZTGA 2KWOA 2RO1A 1G25A 2M85A 3ZPV1 4QEUA 4Z0OA 4HXNA 5I83A 5CS8A 5H1VA 2H0DB 3L1ZB 2VPBA 4OGCA 2MJVB 5FH7A 2NAAA 4O71A 5B78A 3G0JA 4IORA 5AD2A 3PLWA 2IQJA 4FLPA 4C67A 1X4JA 2FSAA 4O76A 4TU6A 2Y1NA 2N9GA 4YY4A 2OXQC 4LKAA 4MR3A 5H9MA 2CSVA 5LJ2A 2YW8A 3T6RA 4XY9A 2CKLB 5HCLA 4UIVA 4YH4A 2DVVA 2D9EA 4NRBA 4PY6A 5A85A 4LC2A 5IGNA 3O33A 1MBMA 5CQ6A 4QSSA 3ONIA 4X2IA 3N9NA 3IU5A 2YQDA 4TS8A 4KV1A 5KO4A 2YHOA 4YYJA 2DVRA 4F3IA 4CUUA 2MIQA 3SHBA 2QJ0A 4XUBA 1JOCA 2E7OA 2XOYA 2G6QA 5EP7A 4UYFB 1WEPA 2JMJA 4QF3A 4NUEA 2R0YA 3ZVZB 3HMHA 4LK9A 1F62A 2RNWA 4AI6A 4LZSA 4Q0NA 4ZC9A 5HJCA 4AVXA 3GG3A 4C66A 4O74A 5FFVA 3IU6A 4A9KA 3FJUB 4TTEA 1HYJA 4NR5A 5D26A 3P1FA 2KU3A 5DYCA 3LQJA 4A9JA 2QICA 5D24A 2VJFB 4O77A 3O34A 4YK0A 5I29A 1CHCA 2VPDA 5F2PA 3SVGA 5DLZA 5E3DA 5JWMA 4UYDA 4L7XA 5IBNA 3RPGC 4FK5A 2K1JA 3U5KA 1Z6UA 5L8UA 4UYEA 5LJ1A 2DVQA 2E7NA 5FE9A 5BT4A 5IG6A 5C89A 2P57A 5HRXA 4YBMA 3MHSA 4V3LC 3P1EA 3LVRE 5LCWB 2L0BA 3JVKA 2VNFA 3IHPA 4AYCA 5EGUA 3S92A 2C2LA 3N9PA 3FEHA 5TABA 4YYHA 4YADA 4O7AA 5HLSA 4IR3A 4BJXA 5F62A 4J0RA 3ZVYA 5LKZA 2L5UA 5EWDA 5TBNA 4QZSA 2E61A 4N4GA 4GNDA 1WIMA 5EPSA 2L85A 1IYMA 4NRAA 5I1QA 3VKHA 5EVAA 2R0SA 5IIDA 5G0FA 2CRWA 2YU4A 5EISA 4A9IA 3TLPA 1VYXA 2WP2A 4YY6A 3I2DA 4MEQA 4E96A 2VPEA 3ASLA 3C6WA 4TKPB 4PTBA 3MHHA 3ERRA 3ZYUA 1WEVA 2Y43A 3PHDA 1JM7A 2NXBA 4UIWA 5E9VA 5B76A 2CRRA 5K29A 3EB6A 2YEKA 5AIUA 2YREA 3SVHA 2RNXA 4IC3A 4NYXA 5FE1A 4Z6IA 2KFTA 4S3OB 5FE4A 3UV4A 2LDRA 3FM8C 3V43A 2EA6A 5A81A 3Q1DA 2RI7A 4YH3A 4CUTA 2KYUA 2M6MA 4TT2A 4P5OB 1T1HA 5H1UA 5A5NA 4R2YA 2CSZA 4NR9A 4ZW1A 4FJCA 3DAIA 2OSSA 4QSXA 4IR4A 2I7KA 5HEMA 4Z6HA 3U5LA 2EXUA 4C9ZA 4CFKA 5A5OA 4AKIA 5E9MA 3O70A 4Z93A 2VJEB 4QF2A 5CPEA 5L99A 4GPJA 5DYUA 5FH6A 2PNXA 4ZQLA 4YYKA 3P1CA 3L1XA 3PUQA 3N9QA 3RPGB 5AMEA 4YAXA 3K2JA 4YYIA 4A9HA 2EGPA 5DY7A 3M63A 4ALHA 3LQHA 2KGIA 2XEUA 4Q6FA 4I7BA 5L8TA 5DFDA 4UIXA 5I89A 5II1A 3ZNIA 2CT2A 4F1PA 5FE0A 4J1PA 5I40A 4PKLA 3O7AA 5D7XA 4BW2A 4WZ3B 5KH9A 5KH7A 2RS9B 3MB4A 4LRGA 5C7NA 5C11A 3LXJA 5EQ1A 4LADB 4B7YC 4A4CA 5B77A 2M3HA 1VFYA 3D1BA 5HRVA 5FERA 2YDWA 4YYNA 4BW1A 2YHNA 5TDRA 2RFJA 2ZETC 5LJ0A 2KTBB 5AITA 4NR7A 4UIYA 4A9EA 5C87A 2YW5A 5FG4A 1F68A 5C13A 2G43A 4V3KC 2EODA 4R7EA 1N72A 3RCWA 1WE9A 3KDEC 2KKXA 3HMFA 2XB1A 3U5PA 4I7DA 4OGEA 4QSUA 2ECNA 5A7CA 4R8PK 3D1DA 2D8UA 5CGPA 4F52B 5CQ3A 4LDFA 5FE6A 5CRMA 2B0OE 4YC9A 2F42A 2ECJA 1RMDA 5E9KA 5EM3A 2OUOA 4O7CA 1WEQA 4CCGX 3JVJA 4QC3A 4TU4A 3E2DA 2EJNA 2GRCA 5D3RA 5EWWA 4ZDTA 4BW4A 4XYAA 4UP5A 4XUAA 4LLBA 1U6GB 4WHUA 3AQAA 4HXRA 5D1MB 4LYWA 4TT6A 5KTWA 3N9LA 1E6IA 2BAYA 3T9KA 5H1TA 2UZGA 3SOWA 5F5ZA 4QSWA 1WGMA 5CUEA 2XP0A 5A5SA 2EGMA 4L58A 4O78A 4MVTA 4O70A 2ECGA 5B8DA 2M1RA 3SOXA 5HQ6A 3UV2A 2YQLA 4N4IA 2YEMA 2YQMA 5LKTA 2YURA 4QQ4A 2K4DA 3MULA 5TRBA 5C4QA 2Y1MA 3U5JA 5HELA 1JM4B 5EWHA 1WEUA 2QIZA 4WZ0A 2MA6A 5I86A 5EV9A 3QZSA 2LGLA 4B86C 5FG6A 3MXFA 2JRJA 2KGGA 4YYMA 2CONA 5EWCA 1ZKRA 5F36A 5HQ5A 5D3TA 4NQMA 3Q2FA 4QSVA 3SVFA 4O7BA 4O7EA 4YBSA 5A5PA 4AKHA 2YSJA 2LSPB 3NG2A 1Z2QA 4MEOA 5HRWA 2D82A 1K2FA 5I7XA 5G4RA 4CA1A 3HMEA 5E9LA 4CFLA 5IGLA 1Z60A 3JVLA 2ECWA 3UVXA 4YBTA 5DYXA 4NR6A 4QSRA 5DW2A 4AYCB 5CP5A 5DX4A 4A0CD 2DX8A 4LYSA 2DJAA 4HXKA 5IGKA 3JUEA 5IGMA 5FBXA 5HENA 1WUMA 2JM3A 4CL9A 1ZS5A 4NUCA 4WHWA 5F1HA 2MA5A 4QYLA 3MDBC 5B79A 5A83A 3P1DA 5CQAA 2G4AA 3QZVA 5HFQA 4PCIA 5KU3A 4HXSA 2M13A 2C2VS 2MD8C 4RVRA 1LDKC 5D3PA 5FH8A 5FE8A 4OGJA 2OO1A 5ETBA 4XY8A 5DW1A 3FANA 1DCQA 3PURA 2KIZA 5EICA 5EU1A 3ZYQA 3D7CA 4YYGA 5LKXA 2ECVA 4OUFA 5D1LB 4WIVA 4YYDA 3LRQA 4IR6A 5LVRA 4CUSA 3HTKC 4W4UA 2KREA 5BT5A 5FE3A 5FFWA 5II2A 3KV6A 1JM7B 4QEWA 4O64A 4NN2A 1WESA 3MUKA 4A9FA 2LAUA 3EB5A 2FUIA 3KV5A 4I7CA 5JG6A 4CURA 4CUPA 4IC2A 1JSPB 2MNYA 4UYGA 4NS5A 5G4SA 3O47A 4QEVA 4X3GA 3P5OA 4AKGA 2OWAA 2KR4A 3AADA 5D3NA 5KHMA 5JI8A 4AUQB 4YABA 5ENFA 3O36A 2LGKA 5L98A 3U5OA 5KTXA 3I3JA 5ENJA 3C5KA 5CFWA 5DKAA 5A5RA 4TYLA 3DWDA 4QR5A 5FB1A 5L97A 5FE2A 4QC1A 4A9OA 2HYED 5SVIA 4WZ2A 5TDWA 5F1LA 2KWNA 4IR5A 4MEPA 3UW9A 4TQNA 3MQMA 4UITA 4BW3A 4FO9A 1EQFA 4MR5A 5FE5A 5ENBA 5FE7A 5G05B 5LVQA 1DVPA 4A49A 3N9OA 4OGIA 2YYNA 5J0DA 4O7FA 5CZGA 1WILA 4KV4A 4QY4A 2YYRA 2F6NA 4TZ8A 5HM0A 2ECIA 1E4UA 5DYAA 2DATA 2JUNA 3GV4A 1BORA 5CQ5A 4A9LA 4QSPA 5CRZA 2YUCA 3FKMX 5C85A 2CKLA 2L84A 5EPBA 1X4IA 2MNZA 4Z1QA 1WENA 3UVWA 5E73A 2MUMA 2DSMA 2LXHC 3LVQE 2DVSA 4QYDA 3M62A 4MENA 5E9IA 5KH3A 4HBVA 4LYIA 1MM3A 2E6SA 3UV5A 2FFWA 3T7LA 4KCXA 1PUOA 3RTRB 4QUUA 2KE1A 3H7HA 4Z1SA 2MT5A 4Z0RA 5DLXA 4UYFA 2RSDA 4NR4A 4QNSA 5BT3A 5CQ4A 4UP0A 5D0CA 5EI4A 4O62A 4O72A 5CUCA 4QR3A 4A9MA 4NYVA 5KTUA 4J3IA 5DKCA 2R0VA 4Q0OA 5D3HA 5DKHA 5E9YA 5ACYA 1X4UA 5CY9A 5AMFA 4QR4A 5D3SA 2VJFA 4O75A 5I3LA 4MSXA 3O37A 4PCEA 2CSYA 2LXPC 3QZTA 5J3XA 5DKDA 5FEYA 4YATA 5DINA 4CUQA 3LQIA 2XOZA 2AN6A 4S3OC 5B75A 5SVXA 1X0JA 3DQVR 5G04B 2ECTA 5D25A 1WEMA 2H60A 3FL2A 4LZRA 2L7PA 3KQIA 2RR4A 4IOQA 3M99A 4GNGA 5I7YA 2G45A 5HQ7A 4N4FA 5F3AA 4NXJA 5I80A 3HCUA 5D3LA 4AP4A 2MKEA 4Y03A 3DWYA 4AKNA 5CUBA 4NUDA 5DBMA 4HXPA 5ETDA
chains in the Genus database with same CATH topology
4ALGA 5CTLA 5ENHA 1LDJB 2YSMA 4GB0A 5CUGA 1FBVA 4HBWA 5ENGA 2MD7B 1XWHA 2L80A 5D3JA 2KWJA 2LGVA 5I88A 4ZUXU 4XI1A 4BBQA 2FUUA 2E3KA 4NR8A 4FIPA 2I8NA 3U5NA 5E3GA 1WFKA 2YT5A 5TCMA 5EPRA 3U5MA 5C8GA 2IDAA 4HXMA 4PS5A 3LJWA 5CUDA 5DFCA 3S91A 2JMDA 2JMIA 3HCTA 4GNFA 2LV9A 5DFBA 4LZ2A 1ZBDB 2KWKA 4UYHA 5A82A 1WEWA 1N87A 4BHWA 2PUYA 4QBMA 2F6JA 5TB6A 1FP0A 2LQ6A 5ENCA 1WEEA 4HBYA 2K17A 5E0RA 5ENEA 5HFRA 3VK6A 3G0LA 3GL6A 5FDZA 5LKUA 2WP1A 4HBXA 5FG5A 3DPLR 3KNVA 4IOOA 5L96A 4MR4A 4TZ2A 4NRCA 2LGGA 5FFYA 2VP7A 3L11A 3MB3A 4WA6A 4QB3A 2L75A 4HXLA 2HDPA 2DKWA 5F25A 3UVDA 5F61A 2L5EA 2K16A 2LRIC 4CLBA 1HYIA 1V87A 3HCSA 5COIA 4UIUA 2L43A 2VJEA 2I50A 5EK9A 3Q2EA 1WUGA 4NQNA 1MM2A 4QUTA 5F60A 1WEOA 5H85A 2RNYA 5E7DA 4DONA 5EA1A 5D1KB 2VPGA 5CQTA 2R10A 4MR6A 5A5QA 4UI9B 2D8SA 3SOUA 3ZPVE 4A4CA 2LN0A 5CQ8A 5E74A 3N9MA 3UVYA 4LJNA 4J0SA 4QSQA 4UIZA 3NXBA 5EYAF 5CUAA 2E6RA 2DWWA 3O35A 5FB0A 4N3WA 4NYWA 4N4HA 4TT4A 4LR6A 5LUUA 1VD4A 4GNEA 2H0DA 5ENIA 5CU8A 4A9NA 4QSTA 5EWVA 4HXOA 3JVMA 4PPEA 5F63A 2YELA 5AD3A 4A4BA 5CQ7A 3ZTGA 2KWOA 2RO1A 1G25A 2M85A 3ZPV1 4QEUA 4HXNA 5I83A 5CS8A 5H1VA 2H0DB 3L1ZB 2VPBA 2MJVB 5FH7A 2NAAA 4O71A 5B78A 3G0JA 4IORA 5AD2A 4FLPA 4C67A 1X4JA 2FSAA 4O76A 4TU6A 2Y1NA 2N9GA 4YY4A 2OXQC 4LKAA 4MR3A 5H9MA 5LJ2A 2YW8A 3T6RA 4XY9A 2CKLB 5HCLA 4UIVA 4YH4A 2DVVA 2D9EA 4NRBA 4PY6A 5A85A 4LC2A 5IGNA 3O33A 5CQ6A 4QSSA 3ONIA 4X2IA 3N9NA 3IU5A 2YQDA 4TS8A 4KV1A 5KO4A 2YHOA 4YYJA 2DVRA 4F3IA 4CUUA 2MIQA 3SHBA 2QJ0A 4XUBA 1JOCA 2E7OA 2G6QA 5EP7A 4UYFB 1WEPA 2JMJA 4QF3A 4NUEA 2R0YA 3ZVZB 3HMHA 4LK9A 1F62A 2RNWA 4LZSA 4Q0NA 4ZC9A 5HJCA 4AVXA 3GG3A 4C66A 4O74A 5FFVA 3IU6A 4A9KA 4TTEA 1HYJA 4NR5A 5D26A 3P1FA 2KU3A 5DYCA 3LQJA 4A9JA 2QICA 5D24A 2VJFB 4O77A 3O34A 4YK0A 5I29A 1CHCA 2VPDA 5F2PA 3SVGA 5DLZA 5E3DA 5JWMA 4UYDA 4L7XA 5IBNA 3RPGC 4FK5A 2K1JA 3U5KA 1Z6UA 5L8UA 4UYEA 5LJ1A 2DVQA 2E7NA 5FE9A 5BT4A 5IG6A 5C89A 5HRXA 4YBMA 3MHSA 4V3LC 3P1EA 5LCWB 2L0BA 3JVKA 2VNFA 3IHPA 4AYCA 5EGUA 3S92A 2C2LA 3N9PA 5TABA 4YYHA 4YADA 4O7AA 5HLSA 4IR3A 4BJXA 5F62A 4J0RA 3ZVYA 5LKZA 2L5UA 5EWDA 5TBNA 4QZSA 4GNDA 4N4GA 1WIMA 5EPSA 2L85A 1IYMA 4NRAA 5I1QA 5EVAA 2R0SA 5IIDA 5G0FA 2YU4A 5EISA 4A9IA 3TLPA 1VYXA 2WP2A 4YY6A 3I2DA 4MEQA 4E96A 2VPEA 3ASLA 3C6WA 4TKPB 4PTBA 3MHHA 3ZYUA 1WEVA 2Y43A 3PHDA 1JM7A 2NXBA 4UIWA 5E9VA 5B76A 3EB6A 5K29A 2YEKA 5AIUA 2YREA 3SVHA 2RNXA 4IC3A 4NYXA 5FE1A 4Z6IA 2KFTA 4S3OB 5FE4A 3UV4A 2LDRA 3V43A 2EA6A 5A81A 2RI7A 4YH3A 4CUTA 2KYUA 2M6MA 4TT2A 4P5OB 1T1HA 5H1UA 5A5NA 4R2YA 2CSZA 4NR9A 4ZW1A 4FJCA 3DAIA 2OSSA 4QSXA 4IR4A 2I7KA 5HEMA 4Z6HA 3U5LA 4C9ZA 4CFKA 5A5OA 5E9MA 3O70A 4Z93A 2VJEB 4QF2A 5CPEA 5L99A 4GPJA 5DYUA 5FH6A 2PNXA 4ZQLA 4YYKA 3P1CA 3L1XA 3PUQA 3N9QA 3RPGB 5AMEA 4YAXA 3K2JA 4YYIA 4A9HA 2EGPA 5DY7A 3M63A 4ALHA 3LQHA 2KGIA 2XEUA 4Q6FA 4I7BA 5L8TA 5DFDA 4UIXA 5I89A 5II1A 3ZNIA 2CT2A 5FE0A 4J1PA 5I40A 4PKLA 3O7AA 5D7XA 4BW2A 4WZ3B 5KH9A 5KH7A 2RS9B 3MB4A 4LRGA 5C7NA 5C11A 3LXJA 5EQ1A 4LADB 4B7YC 5B77A 2M3HA 1VFYA 5HRVA 5FERA 2YDWA 4YYNA 4BW1A 2YHNA 5TDRA 2RFJA 2ZETC 5LJ0A 2KTBB 5AITA 4NR7A 4UIYA 4A9EA 5C87A 2YW5A 5FG4A 1F68A 5C13A 2G43A 4V3KC 2EODA 4R7EA 1N72A 3RCWA 1WE9A 3HMFA 2XB1A 3U5PA 4I7DA 4QSUA 2ECNA 5A7CA 4R8PK 5CGPA 4F52B 5CQ3A 4LDFA 5FE6A 5CRMA 4YC9A 2F42A 2ECJA 1RMDA 5E9KA 5EM3A 2OUOA 4O7CA 1WEQA 4CCGX 3JVJA 4QC3A 4TU4A 2GRCA 5D3RA 5EWWA 4ZDTA 4BW4A 4XYAA 4UP5A 4XUAA 4LLBA 1U6GB 4WHUA 3AQAA 4HXRA 5D1MB 4LYWA 4TT6A 5KTWA 3N9LA 1E6IA 2BAYA 5H1TA 2UZGA 3SOWA 5F5ZA 4QSWA 1WGMA 5CUEA 5A5SA 4L58A 4MVTA 4O78A 4O70A 2ECGA 5B8DA 2M1RA 3SOXA 5HQ6A 3UV2A 2YQLA 4N4IA 2YEMA 2YQMA 5LKTA 2YURA 2K4DA 3MULA 5TRBA 5C4QA 2Y1MA 3U5JA 5HELA 1JM4B 5EWHA 1WEUA 2QIZA 4WZ0A 2MA6A 5I86A 5EV9A 3QZSA 2LGLA 4B86C 5FG6A 3MXFA 2JRJA 2KGGA 4YYMA 5EWCA 5F36A 5HQ5A 5D3TA 4NQMA 3Q2FA 4QSVA 3SVFA 4O7BA 4O7EA 4YBSA 5A5PA 2YSJA 2LSPB 3NG2A 1Z2QA 4MEOA 5HRWA 2D82A 1K2FA 5I7XA 5G4RA 4CA1A 3HMEA 5E9LA 4CFLA 5IGLA 1Z60A 3JVLA 2ECWA 3UVXA 4YBTA 5DYXA 4NR6A 4QSRA 5DW2A 4AYCB 5CP5A 5DX4A 4A0CD 2DX8A 4LYSA 4HXKA 5IGKA 5IGMA 5FBXA 5HENA 1WUMA 4CL9A 1ZS5A 4NUCA 4WHWA 5F1HA 2MA5A 4QYLA 5B79A 5A83A 3P1DA 5CQAA 2G4AA 3QZVA 5HFQA 4PCIA 5KU3A 4HXSA 2MD8C 2C2VS 4RVRA 1LDKC 5D3PA 5FH8A 5FE8A 4OGJA 2OO1A 5ETBA 4XY8A 5DW1A 3PURA 2KIZA 5EICA 5EU1A 3ZYQA 3D7CA 4YYGA 5LKXA 2ECVA 4OUFA 5D1LB 4WIVA 4YYDA 3LRQA 4IR6A 5LVRA 4CUSA 3HTKC 4W4UA 2KREA 5BT5A 5FE3A 5FFWA 5II2A 3KV6A 1JM7B 4QEWA 4O64A 4NN2A 1WESA 3MUKA 4A9FA 3EB5A 2FUIA 3KV5A 4I7CA 5JG6A 4CURA 4CUPA 4IC2A 1JSPB 2MNYA 4UYGA 4NS5A 5G4SA 4QEVA 4X3GA 3P5OA 2KR4A 3AADA 5D3NA 5KHMA 5JI8A 4AUQB 4YABA 5ENFA 3O36A 2LGKA 5L98A 3U5OA 5KTXA 3I3JA 5ENJA 3C5KA 5CFWA 5DKAA 5A5RA 4TYLA 4QR5A 5FB1A 5L97A 5FE2A 4QC1A 4A9OA 2HYED 4WZ2A 5TDWA 5F1LA 2KWNA 4IR5A 4MEPA 3UW9A 4TQNA 3MQMA 4UITA 4BW3A 4FO9A 1EQFA 4MR5A 5FE5A 5ENBA 5FE7A 5G05B 5LVQA 1DVPA 4A49A 3N9OA 4OGIA 2YYNA 5J0DA 4O7FA 5CZGA 1WILA 4KV4A 4QY4A 2YYRA 2F6NA 4TZ8A 5HM0A 2ECIA 1E4UA 5DYAA 2DATA 3GV4A 1BORA 5CQ5A 4A9LA 4QSPA 5CRZA 2YUCA 3FKMX 5C85A 2CKLA 2L84A 5EPBA 1X4IA 2MNZA 4Z1QA 1WENA 3UVWA 5E73A 2MUMA 2LXHC 2DVSA 4QYDA 3M62A 4MENA 5E9IA 5KH3A 4HBVA 4LYIA 1MM3A 2E6SA 3UV5A 3T7LA 4KCXA 3RTRB 4QUUA 2KE1A 4Z1SA 2MT5A 5DLXA 4UYFA 2RSDA 4NR4A 4QNSA 5BT3A 5CQ4A 4UP0A 5D0CA 5EI4A 4O72A 5CUCA 4QR3A 4A9MA 4NYVA 5KTUA 4J3IA 5DKCA 2R0VA 4Q0OA 5D3HA 5DKHA 5E9YA 5ACYA 1X4UA 5CY9A 5AMFA 4QR4A 5D3SA 2VJFA 4O75A 5I3LA 4MSXA 3O37A 4PCEA 2CSYA 2LXPC 3QZTA 5J3XA 5DKDA 5FEYA 4YATA 5DINA 4CUQA 3LQIA 2AN6A 4S3OC 5B75A 1X0JA 3DQVR 5G04B 2ECTA 5D25A 1WEMA 2H60A 3FL2A 4LZRA 3KQIA 4IOQA 3M99A 4GNGA 5I7YA 2G45A 5HQ7A 4N4FA 5F3AA 4NXJA 5I80A 3HCUA 5D3LA 4AP4A 4Y03A 3DWYA 4AKNA 5CUBA 4NUDA 5DBMA 4HXPA 5ETDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ALG A;  5CTL A;  5ENH A;  1LDJ B;  2YSM A;  4GB0 A;  5CUG A;  1FBV A;  4HBW A;  5ENG A;  2MD7 B;  1XWH A;  2L80 A;  5D3J A;  2KWJ A;  2LGV A;  5I88 A;  4ZUX U;  4XI1 A;  4BBQ A;  2FUU A;  2E3K A;  4NR8 A;  4FIP A;  2I8N A;  3U5N A;  5E3G A;  1WFK A;  2YT5 A;  5TCM A;  5EPR A;  3U5M A;  5C8G A;  2IDA A;  4HXM A;  4PS5 A;  3LJW A;  5CUD A;  5DFC A;  3S91 A;  2JMD A;  2JMI A;  3HCT A;  4GNF A;  2LV9 A;  5DFB A;  4LZ2 A;  1ZBD B;  2KWK A;  4UYH A;  5A82 A;  1WEW A;  1N87 A;  4BHW A;  2PUY A;  4QBM A;  2F6J A;  5TB6 A;  1FP0 A;  2LQ6 A;  5ENC A;  1WEE A;  4HBY A;  2K17 A;  5E0R A;  5ENE A;  5HFR A;  3VK6 A;  3G0L A;  3GL6 A;  5FDZ A;  5LKU A;  2WP1 A;  4HBX A;  5FG5 A;  3DPL R;  3KNV A;  4IOO A;  5L96 A;  4MR4 A;  4TZ2 A;  4NRC A;  2LGG A;  5FFY A;  2VP7 A;  3L11 A;  3MB3 A;  4WA6 A;  4QB3 A;  2L75 A;  4HXL A;  2HDP A;  2DKW A;  5F25 A;  3UVD A;  5F61 A;  2L5E A;  2K16 A;  2LRI C;  4CLB A;  1HYI A;  1V87 A;  3HCS A;  5COI A;  4UIU A;  2L43 A;  2VJE A;  2I50 A;  5EK9 A;  3Q2E A;  1WUG A;  4NQN A;  1MM2 A;  4QUT A;  5F60 A;  1WEO A;  5H85 A;  2RNY A;  5E7D A;  4DON A;  5EA1 A;  5D1K B;  2VPG A;  5CQT A;  2R10 A;  4MR6 A;  5A5Q A;  4UI9 B;  2D8S A;  3SOU A;  3ZPV E;  4A4C A;  2LN0 A;  5CQ8 A;  5E74 A;  3N9M A;  3UVY A;  4LJN A;  4J0S A;  4QSQ A;  4UIZ A;  3NXB A;  5EYA F;  5CUA A;  2E6R A;  2DWW A;  3O35 A;  5FB0 A;  4N3W A;  4NYW A;  4N4H A;  4TT4 A;  4LR6 A;  5LUU A;  1VD4 A;  4GNE A;  2H0D A;  5ENI A;  5CU8 A;  4A9N A;  4QST A;  5EWV A;  4HXO A;  3JVM A;  4PPE A;  5F63 A;  2YEL A;  5AD3 A;  4A4B A;  5CQ7 A;  3ZTG A;  2KWO A;  2RO1 A;  1G25 A;  2M85 A;  3ZPV 1;  4QEU A;  4HXN A;  5I83 A;  5CS8 A;  5H1V A;  2H0D B;  3L1Z B;  2VPB A;  2MJV B;  5FH7 A;  2NAA A;  4O71 A;  5B78 A;  3G0J A;  4IOR A;  5AD2 A;  4FLP A;  4C67 A;  1X4J A;  2FSA A;  4O76 A;  4TU6 A;  2Y1N A;  2N9G A;  4YY4 A;  2OXQ C;  4LKA A;  4MR3 A;  5H9M A;  5LJ2 A;  2YW8 A;  3T6R A;  4XY9 A;  2CKL B;  5HCL A;  4UIV A;  4YH4 A;  2DVV A;  2D9E A;  4NRB A;  4PY6 A;  5A85 A;  4LC2 A;  5IGN A;  3O33 A;  5CQ6 A;  4QSS A;  3ONI A;  4X2I A;  3N9N A;  3IU5 A;  2YQD A;  4TS8 A;  4KV1 A;  5KO4 A;  2YHO A;  4YYJ A;  2DVR A;  4F3I A;  4CUU A;  2MIQ A;  3SHB A;  2QJ0 A;  4XUB A;  1JOC A;  2E7O A;  2G6Q A;  5EP7 A;  4UYF B;  1WEP A;  2JMJ A;  4QF3 A;  4NUE A;  2R0Y A;  3ZVZ B;  3HMH A;  4LK9 A;  1F62 A;  2RNW A;  4LZS A;  4Q0N A;  4ZC9 A;  5HJC A;  4AVX A;  3GG3 A;  4C66 A;  4O74 A;  5FFV A;  3IU6 A;  4A9K A;  4TTE A;  1HYJ A;  4NR5 A;  5D26 A;  3P1F A;  2KU3 A;  5DYC A;  3LQJ A;  4A9J A;  2QIC A;  5D24 A;  2VJF B;  4O77 A;  3O34 A;  4YK0 A;  5I29 A;  1CHC A;  2VPD A;  5F2P A;  3SVG A;  5DLZ A;  5E3D A;  5JWM A;  4UYD A;  4L7X A;  5IBN A;  3RPG C;  4FK5 A;  2K1J A;  3U5K A;  1Z6U A;  5L8U A;  4UYE A;  5LJ1 A;  2DVQ A;  2E7N A;  5FE9 A;  5BT4 A;  5IG6 A;  5C89 A;  5HRX A;  4YBM A;  3MHS A;  4V3L C;  3P1E A;  5LCW B;  2L0B A;  3JVK A;  2VNF A;  3IHP A;  4AYC A;  5EGU A;  3S92 A;  2C2L A;  3N9P A;  5TAB A;  4YYH A;  4YAD A;  4O7A A;  5HLS A;  4IR3 A;  4BJX A;  5F62 A;  4J0R A;  3ZVY A;  5LKZ A;  2L5U A;  5EWD A;  5TBN A;  4QZS A;  4GND A;  4N4G A;  1WIM A;  5EPS A;  2L85 A;  1IYM A;  4NRA A;  5I1Q A;  5EVA A;  2R0S A;  5IID A;  5G0F A;  2YU4 A;  5EIS A;  4A9I A;  3TLP A;  1VYX A;  2WP2 A;  4YY6 A;  3I2D A;  4MEQ A;  4E96 A;  2VPE A;  3ASL A;  3C6W A;  4TKP B;  4PTB A;  3MHH A;  3ZYU A;  1WEV A;  2Y43 A;  3PHD A;  1JM7 A;  2NXB A;  4UIW A;  5E9V A;  5B76 A;  3EB6 A;  5K29 A;  2YEK A;  5AIU A;  2YRE A;  3SVH A;  2RNX A;  4IC3 A;  4NYX A;  5FE1 A;  4Z6I A;  2KFT A;  4S3O B;  5FE4 A;  3UV4 A;  2LDR A;  3V43 A;  2EA6 A;  5A81 A;  2RI7 A;  4YH3 A;  4CUT A;  2KYU A;  2M6M A;  4TT2 A;  4P5O B;  1T1H A;  5H1U A;  5A5N A;  4R2Y A;  2CSZ A;  4NR9 A;  4ZW1 A;  4FJC A;  3DAI A;  2OSS A;  4QSX A;  4IR4 A;  2I7K A;  5HEM A;  4Z6H A;  3U5L A;  4C9Z A;  4CFK A;  5A5O A;  5E9M A;  3O70 A;  4Z93 A;  2VJE B;  4QF2 A;  5CPE A;  5L99 A;  4GPJ A;  5DYU A;  5FH6 A;  2PNX A;  4ZQL A;  4YYK A;  3P1C A;  3L1X A;  3PUQ A;  3N9Q A;  3RPG B;  5AME A;  4YAX A;  3K2J A;  4YYI A;  4A9H A;  2EGP A;  5DY7 A;  3M63 A;  4ALH A;  3LQH A;  2KGI A;  2XEU A;  4Q6F A;  4I7B A;  5L8T A;  5DFD A;  4UIX A;  5I89 A;  5II1 A;  3ZNI A;  2CT2 A;  5FE0 A;  4J1P A;  5I40 A;  4PKL A;  3O7A A;  5D7X A;  4BW2 A;  4WZ3 B;  5KH9 A;  5KH7 A;  2RS9 B;  3MB4 A;  4LRG A;  5C7N A;  5C11 A;  3LXJ A;  5EQ1 A;  4LAD B;  4B7Y C;  5B77 A;  2M3H A;  1VFY A;  5HRV A;  5FER A;  2YDW A;  4YYN A;  4BW1 A;  2YHN A;  5TDR A;  2RFJ A;  2ZET C;  5LJ0 A;  2KTB B;  5AIT A;  4NR7 A;  4UIY A;  4A9E A;  5C87 A;  2YW5 A;  5FG4 A;  1F68 A;  5C13 A;  2G43 A;  4V3K C;  2EOD A;  4R7E A;  1N72 A;  3RCW A;  1WE9 A;  3HMF A;  2XB1 A;  3U5P A;  4I7D A;  4QSU A;  2ECN A;  5A7C A;  4R8P K;  5CGP A;  4F52 B;  5CQ3 A;  4LDF A;  5FE6 A;  5CRM A;  4YC9 A;  2F42 A;  2ECJ A;  1RMD A;  5E9K A;  5EM3 A;  2OUO A;  4O7C A;  1WEQ A;  4CCG X;  3JVJ A;  4QC3 A;  4TU4 A;  2GRC A;  5D3R A;  5EWW A;  4ZDT A;  4BW4 A;  4XYA A;  4UP5 A;  4XUA A;  4LLB A;  1U6G B;  4WHU A;  3AQA A;  4HXR A;  5D1M B;  4LYW A;  4TT6 A;  5KTW A;  3N9L A;  1E6I A;  2BAY A;  5H1T A;  2UZG A;  3SOW A;  5F5Z A;  4QSW A;  1WGM A;  5CUE A;  5A5S A;  4L58 A;  4MVT A;  4O78 A;  4O70 A;  2ECG A;  5B8D A;  2M1R A;  3SOX A;  5HQ6 A;  3UV2 A;  2YQL A;  4N4I A;  2YEM A;  2YQM A;  5LKT A;  2YUR A;  2K4D A;  3MUL A;  5TRB A;  5C4Q A;  2Y1M A;  3U5J A;  5HEL A;  1JM4 B;  5EWH A;  1WEU A;  2QIZ A;  4WZ0 A;  2MA6 A;  5I86 A;  5EV9 A;  3QZS A;  2LGL A;  4B86 C;  5FG6 A;  3MXF A;  2JRJ A;  2KGG A;  4YYM A;  5EWC A;  5F36 A;  5HQ5 A;  5D3T A;  4NQM A;  3Q2F A;  4QSV A;  3SVF A;  4O7B A;  4O7E A;  4YBS A;  5A5P A;  2YSJ A;  2LSP B;  3NG2 A;  1Z2Q A;  4MEO A;  5HRW A;  2D82 A;  1K2F A;  5I7X A;  5G4R A;  4CA1 A;  3HME A;  5E9L A;  4CFL A;  5IGL A;  1Z60 A;  3JVL A;  2ECW A;  3UVX A;  4YBT A;  5DYX A;  4NR6 A;  4QSR A;  5DW2 A;  4AYC B;  5CP5 A;  5DX4 A;  4A0C D;  2DX8 A;  4LYS A;  4HXK A;  5IGK A;  5IGM A;  5FBX A;  5HEN A;  1WUM A;  4CL9 A;  1ZS5 A;  4NUC A;  4WHW A;  5F1H A;  2MA5 A;  4QYL A;  5B79 A;  5A83 A;  3P1D A;  5CQA A;  2G4A A;  3QZV A;  5HFQ A;  4PCI A;  5KU3 A;  4HXS A;  2MD8 C;  2C2V S;  4RVR A;  1LDK C;  5D3P A;  5FH8 A;  5FE8 A;  4OGJ A;  2OO1 A;  5ETB A;  4XY8 A;  5DW1 A;  3PUR A;  2KIZ A;  5EIC A;  5EU1 A;  3ZYQ A;  3D7C A;  4YYG A;  5LKX A;  2ECV A;  4OUF A;  5D1L B;  4WIV A;  4YYD A;  3LRQ A;  4IR6 A;  5LVR A;  4CUS A;  3HTK C;  4W4U A;  2KRE A;  5BT5 A;  5FE3 A;  5FFW A;  5II2 A;  3KV6 A;  1JM7 B;  4QEW A;  4O64 A;  4NN2 A;  1WES A;  3MUK A;  4A9F A;  3EB5 A;  2FUI A;  3KV5 A;  4I7C A;  5JG6 A;  4CUR A;  4CUP A;  4IC2 A;  1JSP B;  2MNY A;  4UYG A;  4NS5 A;  5G4S A;  4QEV A;  4X3G A;  3P5O A;  2KR4 A;  3AAD A;  5D3N A;  5KHM A;  5JI8 A;  4AUQ B;  4YAB A;  5ENF A;  3O36 A;  2LGK A;  5L98 A;  3U5O A;  5KTX A;  3I3J A;  5ENJ A;  3C5K A;  5CFW A;  5DKA A;  5A5R A;  4TYL A;  4QR5 A;  5FB1 A;  5L97 A;  5FE2 A;  4QC1 A;  4A9O A;  2HYE D;  4WZ2 A;  5TDW A;  5F1L A;  2KWN A;  4IR5 A;  4MEP A;  3UW9 A;  4TQN A;  3MQM A;  4UIT A;  4BW3 A;  4FO9 A;  1EQF A;  4MR5 A;  5FE5 A;  5ENB A;  5FE7 A;  5G05 B;  5LVQ A;  1DVP A;  4A49 A;  3N9O A;  4OGI A;  2YYN A;  5J0D A;  4O7F A;  5CZG A;  1WIL A;  4KV4 A;  4QY4 A;  2YYR A;  2F6N A;  4TZ8 A;  5HM0 A;  2ECI A;  1E4U A;  5DYA A;  2DAT A;  3GV4 A;  1BOR A;  5CQ5 A;  4A9L A;  4QSP A;  5CRZ A;  2YUC A;  3FKM X;  5C85 A;  2CKL A;  2L84 A;  5EPB A;  1X4I A;  2MNZ A;  4Z1Q A;  1WEN A;  3UVW A;  5E73 A;  2MUM A;  2LXH C;  2DVS A;  4QYD A;  3M62 A;  4MEN A;  5E9I A;  5KH3 A;  4HBV A;  4LYI A;  1MM3 A;  2E6S A;  3UV5 A;  3T7L A;  4KCX A;  3RTR B;  4QUU A;  2KE1 A;  4Z1S A;  2MT5 A;  5DLX A;  4UYF A;  2RSD A;  4NR4 A;  4QNS A;  5BT3 A;  5CQ4 A;  4UP0 A;  5D0C A;  5EI4 A;  4O72 A;  5CUC A;  4QR3 A;  4A9M A;  4NYV A;  5KTU A;  4J3I A;  5DKC A;  2R0V A;  4Q0O A;  5D3H A;  5DKH A;  5E9Y A;  5ACY A;  1X4U A;  5CY9 A;  5AMF A;  4QR4 A;  5D3S A;  2VJF A;  4O75 A;  5I3L A;  4MSX A;  3O37 A;  4PCE A;  2CSY A;  2LXP C;  3QZT A;  5J3X A;  5DKD A;  5FEY A;  4YAT A;  5DIN A;  4CUQ A;  3LQI A;  2AN6 A;  4S3O C;  5B75 A;  1X0J A;  3DQV R;  5G04 B;  2ECT A;  5D25 A;  1WEM A;  2H60 A;  3FL2 A;  4LZR A;  3KQI A;  4IOQ A;  3M99 A;  4GNG A;  5I7Y A;  2G45 A;  5HQ7 A;  4N4F A;  5F3A A;  4NXJ A;  5I80 A;  3HCU A;  5D3L A;  4AP4 A;  4Y03 A;  3DWY A;  4AKN A;  5CUB A;  4NUD A;  5DBM A;  4HXP A;  5ETD A; 
#chains in the Genus database with same CATH topology
 4ALG A;  5CTL A;  5ENH A;  1LDJ B;  2YSM A;  4GB0 A;  5CUG A;  1FBV A;  2FD4 A;  4HBW A;  5ENG A;  2MD7 B;  1XWH A;  2YVR A;  2L80 A;  5D3J A;  2KWJ A;  2LGV A;  5I88 A;  4ZUX U;  4XI1 A;  4BBQ A;  2FUU A;  2E3K A;  4NR8 A;  4FIP A;  2I8N A;  3U5N A;  5E3G A;  1WFK A;  2YT5 A;  5TCM A;  5EPR A;  3U5M A;  5C8G A;  2IDA A;  4HXM A;  4PS5 A;  3LJW A;  5CUD A;  5DFC A;  3S91 A;  2JMD A;  2JMI A;  3HCT A;  4GNF A;  3SUB A;  3LDY A;  2LV9 A;  5DFB A;  4LZ2 A;  1ZBD B;  2KWK A;  4UYH A;  5A82 A;  1WEW A;  1N87 A;  4BHW A;  2PUY A;  4QBM A;  2F6J A;  5K3Q A;  5TB6 A;  1FP0 A;  3VKG A;  2LQ6 A;  5ENC A;  1WEE A;  4HBY A;  2K17 A;  5E0R A;  5ENE A;  5HFR A;  3VK6 A;  3G0L A;  3GL6 A;  5FDZ A;  5LKU A;  2WP1 A;  4HBX A;  5FG5 A;  3DPL R;  3KNV A;  4IOO A;  5L96 A;  4MR4 A;  4TZ2 A;  4NRC A;  2LGG A;  5FFY A;  2VP7 A;  3L11 A;  3MB3 A;  4WA6 A;  4QB3 A;  2L75 A;  4HXL A;  2HDP A;  2XOC A;  2DKW A;  5F25 A;  3FAO A;  3UVD A;  5F61 A;  2L5E A;  2K16 A;  2LRI C;  4CLB A;  4H9D A;  1V87 A;  3HCS A;  1HYI A;  5SVY A;  2KKY A;  5COI A;  4UIU A;  2L43 A;  2VJE A;  2I50 A;  5EK9 A;  3Q2E A;  1WUG A;  4NQN A;  1MM2 A;  4QUT A;  5F60 A;  1WEO A;  5H85 A;  2RNY A;  5E7D A;  4DON A;  5EA1 A;  5D1K B;  2VPG A;  5CQT A;  2R10 A;  4MR6 A;  5A5Q A;  4UI9 B;  2D8S A;  3SOU A;  3LJU X;  3ZPV E;  2LN0 A;  5CQ8 A;  5E74 A;  3N9M A;  3UVY A;  4LJN A;  4J0S A;  4QSQ A;  3M7K A;  4UIZ A;  3NXB A;  5EYA F;  5CUA A;  2E6R A;  2DWW A;  3O35 A;  5FB0 A;  4N3W A;  4NYW A;  4N4H A;  4TT4 A;  4LR6 A;  5LUU A;  1VD4 A;  4GNE A;  2H0D A;  5ENI A;  5CU8 A;  4A9N A;  3DDT A;  4QST A;  5EWV A;  4HXO A;  3JVM A;  4PPE A;  5F63 A;  2YEL A;  5AD3 A;  4A4B A;  5CQ7 A;  5SVI B;  3ZTG A;  2KWO A;  2RO1 A;  1G25 A;  2M85 A;  3ZPV 1;  4QEU A;  4Z0O A;  4HXN A;  5I83 A;  5CS8 A;  5H1V A;  2H0D B;  3L1Z B;  2VPB A;  4OGC A;  2MJV B;  5FH7 A;  2NAA A;  4O71 A;  5B78 A;  3G0J A;  4IOR A;  5AD2 A;  3PLW A;  2IQJ A;  4FLP A;  4C67 A;  1X4J A;  2FSA A;  4O76 A;  4TU6 A;  2Y1N A;  2N9G A;  4YY4 A;  2OXQ C;  4LKA A;  4MR3 A;  5H9M A;  2CSV A;  5LJ2 A;  2YW8 A;  3T6R A;  4XY9 A;  2CKL B;  5HCL A;  4UIV A;  4YH4 A;  2DVV A;  2D9E A;  4NRB A;  4PY6 A;  5A85 A;  4LC2 A;  5IGN A;  3O33 A;  1MBM A;  5CQ6 A;  4QSS A;  3ONI A;  4X2I A;  3N9N A;  3IU5 A;  2YQD A;  4TS8 A;  4KV1 A;  5KO4 A;  2YHO A;  4YYJ A;  2DVR A;  4F3I A;  4CUU A;  2MIQ A;  3SHB A;  2QJ0 A;  4XUB A;  1JOC A;  2E7O A;  2XOY A;  2G6Q A;  5EP7 A;  4UYF B;  1WEP A;  2JMJ A;  4QF3 A;  4NUE A;  2R0Y A;  3ZVZ B;  3HMH A;  4LK9 A;  1F62 A;  2RNW A;  4AI6 A;  4LZS A;  4Q0N A;  4ZC9 A;  5HJC A;  4AVX A;  3GG3 A;  4C66 A;  4O74 A;  5FFV A;  3IU6 A;  4A9K A;  3FJU B;  4TTE A;  1HYJ A;  4NR5 A;  5D26 A;  3P1F A;  2KU3 A;  5DYC A;  3LQJ A;  4A9J A;  2QIC A;  5D24 A;  2VJF B;  4O77 A;  3O34 A;  4YK0 A;  5I29 A;  1CHC A;  2VPD A;  5F2P A;  3SVG A;  5DLZ A;  5E3D A;  5JWM A;  4UYD A;  4L7X A;  5IBN A;  3RPG C;  4FK5 A;  2K1J A;  3U5K A;  1Z6U A;  5L8U A;  4UYE A;  5LJ1 A;  2DVQ A;  2E7N A;  5FE9 A;  5BT4 A;  5IG6 A;  5C89 A;  2P57 A;  5HRX A;  4YBM A;  3MHS A;  4V3L C;  3P1E A;  3LVR E;  5LCW B;  2L0B A;  3JVK A;  2VNF A;  3IHP A;  4AYC A;  5EGU A;  3S92 A;  2C2L A;  3N9P A;  3FEH A;  5TAB A;  4YYH A;  4YAD A;  4O7A A;  5HLS A;  4IR3 A;  4BJX A;  5F62 A;  4J0R A;  3ZVY A;  5LKZ A;  2L5U A;  5EWD A;  5TBN A;  4QZS A;  2E61 A;  4N4G A;  4GND A;  1WIM A;  5EPS A;  2L85 A;  1IYM A;  4NRA A;  5I1Q A;  3VKH A;  5EVA A;  2R0S A;  5IID A;  5G0F A;  2CRW A;  2YU4 A;  5EIS A;  4A9I A;  3TLP A;  1VYX A;  2WP2 A;  4YY6 A;  3I2D A;  4MEQ A;  4E96 A;  2VPE A;  3ASL A;  3C6W A;  4TKP B;  4PTB A;  3MHH A;  3ERR A;  3ZYU A;  1WEV A;  2Y43 A;  3PHD A;  1JM7 A;  2NXB A;  4UIW A;  5E9V A;  5B76 A;  2CRR A;  5K29 A;  3EB6 A;  2YEK A;  5AIU A;  2YRE A;  3SVH A;  2RNX A;  4IC3 A;  4NYX A;  5FE1 A;  4Z6I A;  2KFT A;  4S3O B;  5FE4 A;  3UV4 A;  2LDR A;  3FM8 C;  3V43 A;  2EA6 A;  5A81 A;  3Q1D A;  2RI7 A;  4YH3 A;  4CUT A;  2KYU A;  2M6M A;  4TT2 A;  4P5O B;  1T1H A;  5H1U A;  5A5N A;  4R2Y A;  2CSZ A;  4NR9 A;  4ZW1 A;  4FJC A;  3DAI A;  2OSS A;  4QSX A;  4IR4 A;  2I7K A;  5HEM A;  4Z6H A;  3U5L A;  2EXU A;  4C9Z A;  4CFK A;  5A5O A;  4AKI A;  5E9M A;  3O70 A;  4Z93 A;  2VJE B;  4QF2 A;  5CPE A;  5L99 A;  4GPJ A;  5DYU A;  5FH6 A;  2PNX A;  4ZQL A;  4YYK A;  3P1C A;  3L1X A;  3PUQ A;  3N9Q A;  3RPG B;  5AME A;  4YAX A;  3K2J A;  4YYI A;  4A9H A;  2EGP A;  5DY7 A;  3M63 A;  4ALH A;  3LQH A;  2KGI A;  2XEU A;  4Q6F A;  4I7B A;  5L8T A;  5DFD A;  4UIX A;  5I89 A;  5II1 A;  3ZNI A;  2CT2 A;  4F1P A;  5FE0 A;  4J1P A;  5I40 A;  4PKL A;  3O7A A;  5D7X A;  4BW2 A;  4WZ3 B;  5KH9 A;  5KH7 A;  2RS9 B;  3MB4 A;  4LRG A;  5C7N A;  5C11 A;  3LXJ A;  5EQ1 A;  4LAD B;  4B7Y C;  4A4C A;  5B77 A;  2M3H A;  1VFY A;  3D1B A;  5HRV A;  5FER A;  2YDW A;  4YYN A;  4BW1 A;  2YHN A;  5TDR A;  2RFJ A;  2ZET C;  5LJ0 A;  2KTB B;  5AIT A;  4NR7 A;  4UIY A;  4A9E A;  5C87 A;  2YW5 A;  5FG4 A;  1F68 A;  5C13 A;  2G43 A;  4V3K C;  2EOD A;  4R7E A;  1N72 A;  3RCW A;  1WE9 A;  3KDE C;  2KKX A;  3HMF A;  2XB1 A;  3U5P A;  4I7D A;  4OGE A;  4QSU A;  2ECN A;  5A7C A;  4R8P K;  3D1D A;  2D8U A;  5CGP A;  4F52 B;  5CQ3 A;  4LDF A;  5FE6 A;  5CRM A;  2B0O E;  4YC9 A;  2F42 A;  2ECJ A;  1RMD A;  5E9K A;  5EM3 A;  2OUO A;  4O7C A;  1WEQ A;  4CCG X;  3JVJ A;  4QC3 A;  4TU4 A;  3E2D A;  2EJN A;  2GRC A;  5D3R A;  5EWW A;  4ZDT A;  4BW4 A;  4XYA A;  4UP5 A;  4XUA A;  4LLB A;  1U6G B;  4WHU A;  3AQA A;  4HXR A;  5D1M B;  4LYW A;  4TT6 A;  5KTW A;  3N9L A;  1E6I A;  2BAY A;  3T9K A;  5H1T A;  2UZG A;  3SOW A;  5F5Z A;  4QSW A;  1WGM A;  5CUE A;  2XP0 A;  5A5S A;  2EGM A;  4L58 A;  4O78 A;  4MVT A;  4O70 A;  2ECG A;  5B8D A;  2M1R A;  3SOX A;  5HQ6 A;  3UV2 A;  2YQL A;  4N4I A;  2YEM A;  2YQM A;  5LKT A;  2YUR A;  4QQ4 A;  2K4D A;  3MUL A;  5TRB A;  5C4Q A;  2Y1M A;  3U5J A;  5HEL A;  1JM4 B;  5EWH A;  1WEU A;  2QIZ A;  4WZ0 A;  2MA6 A;  5I86 A;  5EV9 A;  3QZS A;  2LGL A;  4B86 C;  5FG6 A;  3MXF A;  2JRJ A;  2KGG A;  4YYM A;  2CON A;  5EWC A;  1ZKR A;  5F36 A;  5HQ5 A;  5D3T A;  4NQM A;  3Q2F A;  4QSV A;  3SVF A;  4O7B A;  4O7E A;  4YBS A;  5A5P A;  4AKH A;  2YSJ A;  2LSP B;  3NG2 A;  1Z2Q A;  4MEO A;  5HRW A;  2D82 A;  1K2F A;  5I7X A;  5G4R A;  4CA1 A;  3HME A;  5E9L A;  4CFL A;  5IGL A;  1Z60 A;  3JVL A;  2ECW A;  3UVX A;  4YBT A;  5DYX A;  4NR6 A;  4QSR A;  5DW2 A;  4AYC B;  5CP5 A;  5DX4 A;  4A0C D;  2DX8 A;  4LYS A;  2DJA A;  4HXK A;  5IGK A;  3JUE A;  5IGM A;  5FBX A;  5HEN A;  1WUM A;  2JM3 A;  4CL9 A;  1ZS5 A;  4NUC A;  4WHW A;  5F1H A;  2MA5 A;  4QYL A;  3MDB C;  5B79 A;  5A83 A;  3P1D A;  5CQA A;  2G4A A;  3QZV A;  5HFQ A;  4PCI A;  5KU3 A;  4HXS A;  2M13 A;  2C2V S;  2MD8 C;  4RVR A;  1LDK C;  5D3P A;  5FH8 A;  5FE8 A;  4OGJ A;  2OO1 A;  5ETB A;  4XY8 A;  5DW1 A;  3FAN A;  1DCQ A;  3PUR A;  2KIZ A;  5EIC A;  5EU1 A;  3ZYQ A;  3D7C A;  4YYG A;  5LKX A;  2ECV A;  4OUF A;  5D1L B;  4WIV A;  4YYD A;  3LRQ A;  4IR6 A;  5LVR A;  4CUS A;  3HTK C;  4W4U A;  2KRE A;  5BT5 A;  5FE3 A;  5FFW A;  5II2 A;  3KV6 A;  1JM7 B;  4QEW A;  4O64 A;  4NN2 A;  1WES A;  3MUK A;  4A9F A;  2LAU A;  3EB5 A;  2FUI A;  3KV5 A;  4I7C A;  5JG6 A;  4CUR A;  4CUP A;  4IC2 A;  1JSP B;  2MNY A;  4UYG A;  4NS5 A;  5G4S A;  3O47 A;  4QEV A;  4X3G A;  3P5O A;  4AKG A;  2OWA A;  2KR4 A;  3AAD A;  5D3N A;  5KHM A;  5JI8 A;  4AUQ B;  4YAB A;  5ENF A;  3O36 A;  2LGK A;  5L98 A;  3U5O A;  5KTX A;  3I3J A;  5ENJ A;  3C5K A;  5CFW A;  5DKA A;  5A5R A;  4TYL A;  3DWD A;  4QR5 A;  5FB1 A;  5L97 A;  5FE2 A;  4QC1 A;  4A9O A;  2HYE D;  5SVI A;  4WZ2 A;  5TDW A;  5F1L A;  2KWN A;  4IR5 A;  4MEP A;  3UW9 A;  4TQN A;  3MQM A;  4UIT A;  4BW3 A;  4FO9 A;  1EQF A;  4MR5 A;  5FE5 A;  5ENB A;  5FE7 A;  5G05 B;  5LVQ A;  1DVP A;  4A49 A;  3N9O A;  4OGI A;  2YYN A;  5J0D A;  4O7F A;  5CZG A;  1WIL A;  4KV4 A;  4QY4 A;  2YYR A;  2F6N A;  4TZ8 A;  5HM0 A;  2ECI A;  1E4U A;  5DYA A;  2DAT A;  2JUN A;  3GV4 A;  1BOR A;  5CQ5 A;  4A9L A;  4QSP A;  5CRZ A;  2YUC A;  3FKM X;  5C85 A;  2CKL A;  2L84 A;  5EPB A;  1X4I A;  2MNZ A;  4Z1Q A;  1WEN A;  3UVW A;  5E73 A;  2MUM A;  2DSM A;  2LXH C;  3LVQ E;  2DVS A;  4QYD A;  3M62 A;  4MEN A;  5E9I A;  5KH3 A;  4HBV A;  4LYI A;  1MM3 A;  2E6S A;  3UV5 A;  2FFW A;  3T7L A;  4KCX A;  1PUO A;  3RTR B;  4QUU A;  2KE1 A;  3H7H A;  4Z1S A;  2MT5 A;  4Z0R A;  5DLX A;  4UYF A;  2RSD A;  4NR4 A;  4QNS A;  5BT3 A;  5CQ4 A;  4UP0 A;  5D0C A;  5EI4 A;  4O62 A;  4O72 A;  5CUC A;  4QR3 A;  4A9M A;  4NYV A;  5KTU A;  4J3I A;  5DKC A;  2R0V A;  4Q0O A;  5D3H A;  5DKH A;  5E9Y A;  5ACY A;  1X4U A;  5CY9 A;  5AMF A;  4QR4 A;  5D3S A;  2VJF A;  4O75 A;  5I3L A;  4MSX A;  3O37 A;  4PCE A;  2CSY A;  2LXP C;  3QZT A;  5J3X A;  5DKD A;  5FEY A;  4YAT A;  5DIN A;  4CUQ A;  3LQI A;  2XOZ A;  2AN6 A;  4S3O C;  5B75 A;  5SVX A;  1X0J A;  3DQV R;  5G04 B;  2ECT A;  5D25 A;  1WEM A;  2H60 A;  3FL2 A;  4LZR A;  2L7P A;  3KQI A;  2RR4 A;  4IOQ A;  3M99 A;  4GNG A;  5I7Y A;  2G45 A;  5HQ7 A;  4N4F A;  5F3A A;  4NXJ A;  5I80 A;  3HCU A;  5D3L A;  4AP4 A;  2MKE A;  4Y03 A;  3DWY A;  4AKN A;  5CUB A;  4NUD A;  5DBM A;  4HXP A;  5ETD A; 
#chains in the Genus database with same CATH homology
 4ALG A;  5CTL A;  5ENH A;  1LDJ B;  2YSM A;  4GB0 A;  5CUG A;  1FBV A;  4HBW A;  5ENG A;  2MD7 B;  1XWH A;  2L80 A;  5D3J A;  2KWJ A;  2LGV A;  5I88 A;  4ZUX U;  4XI1 A;  4BBQ A;  2FUU A;  2E3K A;  4NR8 A;  4FIP A;  2I8N A;  3U5N A;  5E3G A;  1WFK A;  2YT5 A;  5TCM A;  5EPR A;  3U5M A;  5C8G A;  2IDA A;  4HXM A;  4PS5 A;  3LJW A;  5CUD A;  5DFC A;  3S91 A;  2JMD A;  2JMI A;  3HCT A;  4GNF A;  2LV9 A;  5DFB A;  4LZ2 A;  1ZBD B;  2KWK A;  4UYH A;  5A82 A;  1WEW A;  1N87 A;  4BHW A;  2PUY A;  4QBM A;  2F6J A;  5TB6 A;  1FP0 A;  2LQ6 A;  5ENC A;  1WEE A;  4HBY A;  2K17 A;  5E0R A;  5ENE A;  5HFR A;  3VK6 A;  3G0L A;  3GL6 A;  5FDZ A;  5LKU A;  2WP1 A;  4HBX A;  5FG5 A;  3DPL R;  3KNV A;  4IOO A;  5L96 A;  4MR4 A;  4TZ2 A;  4NRC A;  2LGG A;  5FFY A;  2VP7 A;  3L11 A;  3MB3 A;  4WA6 A;  4QB3 A;  2L75 A;  4HXL A;  2HDP A;  2DKW A;  5F25 A;  3UVD A;  5F61 A;  2L5E A;  2K16 A;  2LRI C;  4CLB A;  1HYI A;  1V87 A;  3HCS A;  5COI A;  4UIU A;  2L43 A;  2VJE A;  2I50 A;  5EK9 A;  3Q2E A;  1WUG A;  4NQN A;  1MM2 A;  4QUT A;  5F60 A;  1WEO A;  5H85 A;  2RNY A;  5E7D A;  4DON A;  5EA1 A;  5D1K B;  2VPG A;  5CQT A;  2R10 A;  4MR6 A;  5A5Q A;  4UI9 B;  2D8S A;  3SOU A;  3ZPV E;  4A4C A;  2LN0 A;  5CQ8 A;  5E74 A;  3N9M A;  3UVY A;  4LJN A;  4J0S A;  4QSQ A;  4UIZ A;  3NXB A;  5EYA F;  5CUA A;  2E6R A;  2DWW A;  3O35 A;  5FB0 A;  4N3W A;  4NYW A;  4N4H A;  4TT4 A;  4LR6 A;  5LUU A;  1VD4 A;  4GNE A;  2H0D A;  5ENI A;  5CU8 A;  4A9N A;  4QST A;  5EWV A;  4HXO A;  3JVM A;  4PPE A;  5F63 A;  2YEL A;  5AD3 A;  4A4B A;  5CQ7 A;  3ZTG A;  2KWO A;  2RO1 A;  1G25 A;  2M85 A;  3ZPV 1;  4QEU A;  4HXN A;  5I83 A;  5CS8 A;  5H1V A;  2H0D B;  3L1Z B;  2VPB A;  2MJV B;  5FH7 A;  2NAA A;  4O71 A;  5B78 A;  3G0J A;  4IOR A;  5AD2 A;  4FLP A;  4C67 A;  1X4J A;  2FSA A;  4O76 A;  4TU6 A;  2Y1N A;  2N9G A;  4YY4 A;  2OXQ C;  4LKA A;  4MR3 A;  5H9M A;  5LJ2 A;  2YW8 A;  3T6R A;  4XY9 A;  2CKL B;  5HCL A;  4UIV A;  4YH4 A;  2DVV A;  2D9E A;  4NRB A;  4PY6 A;  5A85 A;  4LC2 A;  5IGN A;  3O33 A;  5CQ6 A;  4QSS A;  3ONI A;  4X2I A;  3N9N A;  3IU5 A;  2YQD A;  4TS8 A;  4KV1 A;  5KO4 A;  2YHO A;  4YYJ A;  2DVR A;  4F3I A;  4CUU A;  2MIQ A;  3SHB A;  2QJ0 A;  4XUB A;  1JOC A;  2E7O A;  2G6Q A;  5EP7 A;  4UYF B;  1WEP A;  2JMJ A;  4QF3 A;  4NUE A;  2R0Y A;  3ZVZ B;  3HMH A;  4LK9 A;  1F62 A;  2RNW A;  4LZS A;  4Q0N A;  4ZC9 A;  5HJC A;  4AVX A;  3GG3 A;  4C66 A;  4O74 A;  5FFV A;  3IU6 A;  4A9K A;  4TTE A;  1HYJ A;  4NR5 A;  5D26 A;  3P1F A;  2KU3 A;  5DYC A;  3LQJ A;  4A9J A;  2QIC A;  5D24 A;  2VJF B;  4O77 A;  3O34 A;  4YK0 A;  5I29 A;  1CHC A;  2VPD A;  5F2P A;  3SVG A;  5DLZ A;  5E3D A;  5JWM A;  4UYD A;  4L7X A;  5IBN A;  3RPG C;  4FK5 A;  2K1J A;  3U5K A;  1Z6U A;  5L8U A;  4UYE A;  5LJ1 A;  2DVQ A;  2E7N A;  5FE9 A;  5BT4 A;  5IG6 A;  5C89 A;  5HRX A;  4YBM A;  3MHS A;  4V3L C;  3P1E A;  5LCW B;  2L0B A;  3JVK A;  2VNF A;  3IHP A;  4AYC A;  5EGU A;  3S92 A;  2C2L A;  3N9P A;  5TAB A;  4YYH A;  4YAD A;  4O7A A;  5HLS A;  4IR3 A;  4BJX A;  5F62 A;  4J0R A;  3ZVY A;  5LKZ A;  2L5U A;  5EWD A;  5TBN A;  4QZS A;  4GND A;  4N4G A;  1WIM A;  5EPS A;  2L85 A;  1IYM A;  4NRA A;  5I1Q A;  5EVA A;  2R0S A;  5IID A;  5G0F A;  2YU4 A;  5EIS A;  4A9I A;  3TLP A;  1VYX A;  2WP2 A;  4YY6 A;  3I2D A;  4MEQ A;  4E96 A;  2VPE A;  3ASL A;  3C6W A;  4TKP B;  4PTB A;  3MHH A;  3ZYU A;  1WEV A;  2Y43 A;  3PHD A;  1JM7 A;  2NXB A;  4UIW A;  5E9V A;  5B76 A;  3EB6 A;  5K29 A;  2YEK A;  5AIU A;  2YRE A;  3SVH A;  2RNX A;  4IC3 A;  4NYX A;  5FE1 A;  4Z6I A;  2KFT A;  4S3O B;  5FE4 A;  3UV4 A;  2LDR A;  3V43 A;  2EA6 A;  5A81 A;  2RI7 A;  4YH3 A;  4CUT A;  2KYU A;  2M6M A;  4TT2 A;  4P5O B;  1T1H A;  5H1U A;  5A5N A;  4R2Y A;  2CSZ A;  4NR9 A;  4ZW1 A;  4FJC A;  3DAI A;  2OSS A;  4QSX A;  4IR4 A;  2I7K A;  5HEM A;  4Z6H A;  3U5L A;  4C9Z A;  4CFK A;  5A5O A;  5E9M A;  3O70 A;  4Z93 A;  2VJE B;  4QF2 A;  5CPE A;  5L99 A;  4GPJ A;  5DYU A;  5FH6 A;  2PNX A;  4ZQL A;  4YYK A;  3P1C A;  3L1X A;  3PUQ A;  3N9Q A;  3RPG B;  5AME A;  4YAX A;  3K2J A;  4YYI A;  4A9H A;  2EGP A;  5DY7 A;  3M63 A;  4ALH A;  3LQH A;  2KGI A;  2XEU A;  4Q6F A;  4I7B A;  5L8T A;  5DFD A;  4UIX A;  5I89 A;  5II1 A;  3ZNI A;  2CT2 A;  5FE0 A;  4J1P A;  5I40 A;  4PKL A;  3O7A A;  5D7X A;  4BW2 A;  4WZ3 B;  5KH9 A;  5KH7 A;  2RS9 B;  3MB4 A;  4LRG A;  5C7N A;  5C11 A;  3LXJ A;  5EQ1 A;  4LAD B;  4B7Y C;  5B77 A;  2M3H A;  1VFY A;  5HRV A;  5FER A;  2YDW A;  4YYN A;  4BW1 A;  2YHN A;  5TDR A;  2RFJ A;  2ZET C;  5LJ0 A;  2KTB B;  5AIT A;  4NR7 A;  4UIY A;  4A9E A;  5C87 A;  2YW5 A;  5FG4 A;  1F68 A;  5C13 A;  2G43 A;  4V3K C;  2EOD A;  4R7E A;  1N72 A;  3RCW A;  1WE9 A;  3HMF A;  2XB1 A;  3U5P A;  4I7D A;  4QSU A;  2ECN A;  5A7C A;  4R8P K;  5CGP A;  4F52 B;  5CQ3 A;  4LDF A;  5FE6 A;  5CRM A;  4YC9 A;  2F42 A;  2ECJ A;  1RMD A;  5E9K A;  5EM3 A;  2OUO A;  4O7C A;  1WEQ A;  4CCG X;  3JVJ A;  4QC3 A;  4TU4 A;  2GRC A;  5D3R A;  5EWW A;  4ZDT A;  4BW4 A;  4XYA A;  4UP5 A;  4XUA A;  4LLB A;  1U6G B;  4WHU A;  3AQA A;  4HXR A;  5D1M B;  4LYW A;  4TT6 A;  5KTW A;  3N9L A;  1E6I A;  2BAY A;  5H1T A;  2UZG A;  3SOW A;  5F5Z A;  4QSW A;  1WGM A;  5CUE A;  5A5S A;  4L58 A;  4MVT A;  4O78 A;  4O70 A;  2ECG A;  5B8D A;  2M1R A;  3SOX A;  5HQ6 A;  3UV2 A;  2YQL A;  4N4I A;  2YEM A;  2YQM A;  5LKT A;  2YUR A;  2K4D A;  3MUL A;  5TRB A;  5C4Q A;  2Y1M A;  3U5J A;  5HEL A;  1JM4 B;  5EWH A;  1WEU A;  2QIZ A;  4WZ0 A;  2MA6 A;  5I86 A;  5EV9 A;  3QZS A;  2LGL A;  4B86 C;  5FG6 A;  3MXF A;  2JRJ A;  2KGG A;  4YYM A;  5EWC A;  5F36 A;  5HQ5 A;  5D3T A;  4NQM A;  3Q2F A;  4QSV A;  3SVF A;  4O7B A;  4O7E A;  4YBS A;  5A5P A;  2YSJ A;  2LSP B;  3NG2 A;  1Z2Q A;  4MEO A;  5HRW A;  2D82 A;  1K2F A;  5I7X A;  5G4R A;  4CA1 A;  3HME A;  5E9L A;  4CFL A;  5IGL A;  1Z60 A;  3JVL A;  2ECW A;  3UVX A;  4YBT A;  5DYX A;  4NR6 A;  4QSR A;  5DW2 A;  4AYC B;  5CP5 A;  5DX4 A;  4A0C D;  2DX8 A;  4LYS A;  4HXK A;  5IGK A;  5IGM A;  5FBX A;  5HEN A;  1WUM A;  4CL9 A;  1ZS5 A;  4NUC A;  4WHW A;  5F1H A;  2MA5 A;  4QYL A;  5B79 A;  5A83 A;  3P1D A;  5CQA A;  2G4A A;  3QZV A;  5HFQ A;  4PCI A;  5KU3 A;  4HXS A;  2MD8 C;  2C2V S;  4RVR A;  1LDK C;  5D3P A;  5FH8 A;  5FE8 A;  4OGJ A;  2OO1 A;  5ETB A;  4XY8 A;  5DW1 A;  3PUR A;  2KIZ A;  5EIC A;  5EU1 A;  3ZYQ A;  3D7C A;  4YYG A;  5LKX A;  2ECV A;  4OUF A;  5D1L B;  4WIV A;  4YYD A;  3LRQ A;  4IR6 A;  5LVR A;  4CUS A;  3HTK C;  4W4U A;  2KRE A;  5BT5 A;  5FE3 A;  5FFW A;  5II2 A;  3KV6 A;  1JM7 B;  4QEW A;  4O64 A;  4NN2 A;  1WES A;  3MUK A;  4A9F A;  3EB5 A;  2FUI A;  3KV5 A;  4I7C A;  5JG6 A;  4CUR A;  4CUP A;  4IC2 A;  1JSP B;  2MNY A;  4UYG A;  4NS5 A;  5G4S A;  4QEV A;  4X3G A;  3P5O A;  2KR4 A;  3AAD A;  5D3N A;  5KHM A;  5JI8 A;  4AUQ B;  4YAB A;  5ENF A;  3O36 A;  2LGK A;  5L98 A;  3U5O A;  5KTX A;  3I3J A;  5ENJ A;  3C5K A;  5CFW A;  5DKA A;  5A5R A;  4TYL A;  4QR5 A;  5FB1 A;  5L97 A;  5FE2 A;  4QC1 A;  4A9O A;  2HYE D;  4WZ2 A;  5TDW A;  5F1L A;  2KWN A;  4IR5 A;  4MEP A;  3UW9 A;  4TQN A;  3MQM A;  4UIT A;  4BW3 A;  4FO9 A;  1EQF A;  4MR5 A;  5FE5 A;  5ENB A;  5FE7 A;  5G05 B;  5LVQ A;  1DVP A;  4A49 A;  3N9O A;  4OGI A;  2YYN A;  5J0D A;  4O7F A;  5CZG A;  1WIL A;  4KV4 A;  4QY4 A;  2YYR A;  2F6N A;  4TZ8 A;  5HM0 A;  2ECI A;  1E4U A;  5DYA A;  2DAT A;  3GV4 A;  1BOR A;  5CQ5 A;  4A9L A;  4QSP A;  5CRZ A;  2YUC A;  3FKM X;  5C85 A;  2CKL A;  2L84 A;  5EPB A;  1X4I A;  2MNZ A;  4Z1Q A;  1WEN A;  3UVW A;  5E73 A;  2MUM A;  2LXH C;  2DVS A;  4QYD A;  3M62 A;  4MEN A;  5E9I A;  5KH3 A;  4HBV A;  4LYI A;  1MM3 A;  2E6S A;  3UV5 A;  3T7L A;  4KCX A;  3RTR B;  4QUU A;  2KE1 A;  4Z1S A;  2MT5 A;  5DLX A;  4UYF A;  2RSD A;  4NR4 A;  4QNS A;  5BT3 A;  5CQ4 A;  4UP0 A;  5D0C A;  5EI4 A;  4O72 A;  5CUC A;  4QR3 A;  4A9M A;  4NYV A;  5KTU A;  4J3I A;  5DKC A;  2R0V A;  4Q0O A;  5D3H A;  5DKH A;  5E9Y A;  5ACY A;  1X4U A;  5CY9 A;  5AMF A;  4QR4 A;  5D3S A;  2VJF A;  4O75 A;  5I3L A;  4MSX A;  3O37 A;  4PCE A;  2CSY A;  2LXP C;  3QZT A;  5J3X A;  5DKD A;  5FEY A;  4YAT A;  5DIN A;  4CUQ A;  3LQI A;  2AN6 A;  4S3O C;  5B75 A;  1X0J A;  3DQV R;  5G04 B;  2ECT A;  5D25 A;  1WEM A;  2H60 A;  3FL2 A;  4LZR A;  3KQI A;  4IOQ A;  3M99 A;  4GNG A;  5I7Y A;  2G45 A;  5HQ7 A;  4N4F A;  5F3A A;  4NXJ A;  5I80 A;  3HCU A;  5D3L A;  4AP4 A;  4Y03 A;  3DWY A;  4AKN A;  5CUB A;  4NUD A;  5DBM A;  4HXP A;  5ETD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...