2FSAA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the h3(1-15)k4me2 bound state
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
168
Chain Sequence
DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords bromodomain PHD finger transcription factor
total genus 50
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2fsaA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2fsaA01
2KE1A 5HELA 5E0RA 5A7CA 4GNDA 3O35A 2Y1NA 2WP1A 1WEQA 3SOWA 5DFBA 4AUQB 4YYIA 5CQ8A 2KR4A 4A9JA 5K29A 5E3DA 3C5KA 2KWKA 2EODA 4TZ2A 5HJCA 2VJFA 4PY6A 2L75A 5JG6A 4IOQA 2LGKA 2YEKA 3MQMA 5L8TA 4PCIA 4TU6A 4Q0OA 3P1FA 4TT4A 4DONA 2G45A 2RNXA 3FL2A 5L97A 5D7XA 4AVXA 5L98A 4QEWA 5TCMA 4UP5A 3HMHA 2PNXA 5F2PA 5TRBA 5B77A 2KREA 1HYIA 1F68A 3LJWA 4MR3A 4IR4A 2YHNA 4O7BA 3ASLA 3U5MA 5FE7A 5KU3A 5CQ6A 1WFKA 4NR4A 3S91A 4CFLA 5CUCA 5F25A 5DYXA 1HYJA 3ZTGA 5EWDA 1Z2QA 5DW1A 4N3WA 4IC2A 5LVRA 2H0DA 2VJEB 2R10A 4QEVA 2XB1A 3M63A 4FJCA 3RPGC 2DATA 2ECGA 5KTWA 1IYMA 2L85A 4YADA 4UYFB 2ECVA 4L58A 2KWNA 3P5OA 5D3LA 3N9NA 5TB6A 1Z6UA 4FLPA 5CQ5A 5EI4A 4A9EA 1JOCA 4BW3A 2K1JA 5I1QA 1CHCA 3GV4A 3UV4A 4QSXA 2YUCA 5E74A 3EB5A 5CQ4A 5EWCA 4OGJA 2OUOA 4J3IA 2NAAA 5E73A 3MUKA 2RNWA 5G0FA 4GB0A 4LK9A 5A81A 4A4BA 4LYSA 4NXJA 4XUAA 2LSPB 4CURA 4CCGX 5EWVA 4UIVA 4E96A 5D3PA 5II1A 3NXBA 3MXFA 3U5PA 5CUEA 3GL6A 5I29A 4BW1A 3IHPA 3KNVA 5B76A 5L99A 5LKXA 4NR8A 1BORA 1WEPA 3V43A 4YBMA 5CUAA 5DYCA 4KCXA 5BT4A 3UVYA 2DVQA 5DKHA 3S92A 5D0CA 5CRMA 4CL9A 2L43A 3C6WA 5EA1A 4YBTA 5D3NA 5AMEA 4CUQA 5DINA 3T6RA 1WENA 2LXHC 3M62A 1VD4A 4QEUA 2DVRA 4MEQA 5ENGA 4YYKA 3DAIA 4LZRA 5A5OA 4CA1A 5C87A 4C9ZA 2YQLA 2Y43A 5ENHA 5FE9A 5FFYA 3O33A 5FG5A 5H1VA 4A4CA 2D82A 2I8NA 4LRGA 3RTRB 1RMDA 2DX8A 4F52B 4YH3A 4NS5A 1WEVA 5LVQA 4X3GA 4MR5A 5F1HA 5EQ1A 5CQ3A 2PUYA 5AMFA 5HM0A 2LRIC 3LXJA 2YDWA 2QICA 4HXRA 3ZPVE 4J0RA 4UIUA 3PURA 4QSPA 4QY4A 4QYDA 1WUGA 4TT6A 5KTUA 4LC2A 3LQJA 4HXKA 5EM3A 5D24A 2RSDA 5ETDA 3O36A 4QC3A 4QSTA 4MENA 2CKLB 2JMJA 4A0CD 5FG4A 4TT2A 5H1UA 3MHHA 2H0DB 5EVAA 2VJEA 3U5OA 2VNFA 5FG6A 1MM3A 4UIZA 2MD8C 4RVRA 4UIWA 5EWWA 5CQAA 5A82A 4A9IA 4YYNA 3I2DA 3M99A 4O78A 4HXNA 5CGPA 2CT2A 2M3HA 4MEOA 2L5EA 2YQMA 4O75A 5F60A 3MB4A 4YH4A 3UVWA 5FE0A 2VP7A 3L1XA 4QUTA 2KTBB 2I7KA 4NUDA 3FKMX 5F36A 4V3LC 1MM2A 4YY4A 2LXPC 4LKAA 3G0JA 5EP7A 2KWJA 5DFCA 2G4AA 4O74A 5H85A 2NXBA 3K2JA 3P1CA 4A9HA 5LUUA 4LLBA 4QUUA 5CPEA 1DVPA 2LGGA 5DFDA 4QR3A 5IIDA 4YATA 2R0SA 2JMDA 2KU3A 4Q6FA 5DX4A 4QSUA 4QSVA 5ACYA 3UV2A 3MB3A 3Q2EA 4A9LA 5FE2A 2EGPA 4NUCA 3LRQA 3ZYQA 5I3LA 5I80A 5D3RA 2MJVB 5E9YA 2MT5A 1WEEA 5IGLA 4NN2A 5G4RA 4NYXA 3U5KA 4UI9B 1T1HA 4YYHA 4YABA 4PKLA 5CUDA 5ENBA 5HFQA 4QYLA 2FSAA 5F61A 2RS9B 2MIQA 1X4UA 3U5LA 4TZ8A 4MR6A 4OGIA 4Z93A 4L7XA 5DKCA 4NUEA 5DBMA 2LGVA 4AYCB 2DVVA 2I50A 4QF3A 5DY7A 4QSWA 5I7XA 3I3JA 4Z1QA 2CSZA 3AQAA 3TLPA 2CKLA 5FBXA 4LADB 4QBMA 1U6GB 2E6RA 4A9FA 5LKTA 4IORA 4KV4A 2C2VS 5IBNA 5HQ7A 5C11A 5D3TA 5FDZA 5F5ZA 5ENIA 2DKWA 5DYUA 5EU1A 5I89A 4IOOA 3L11A 4XI1A 5EICA 5ENFA 4I7CA 4XY8A 4B7YC 2JRJA 1X0JA 5EISA 5FEYA 5AIUA 4XY9A 5EYAF 4HXPA 5CTLA 3UV5A 1Z60A 5C8GA 2LGLA 2OO1A 5FERA 2HYED 3SVFA 2YQDA 4QR5A 3GG3A 2MNZA 4C67A 4UIYA 5ETBA 4N4IA 1X4IA 1E6IA 2RI7A 5D1LB 4F3IA 4IR3A 4O76A 3ZVYA 4O70A 4ZDTA 2LV9A 2UZGA 4O7FA 4YYGA 4QR4A 5LKZA 3SOXA 5CU8A 4N4FA 2M85A 2G43A 5EPBA 1WEMA 5EK9A 5ENCA 4TYLA 4QNSA 3JVJA 5KTXA 3JVMA 1ZBDB 5C89A 4P5OB 4B86C 1N87A 5CP5A 5FE4A 2LN0A 2R0VA 4IR5A 5E9KA 5KO4A 2JMIA 4ZC9A 4YYDA 2GRCA 5E7DA 2QIZA 4WZ0A 4NR6A 4BBQA 3JVKA 4CUPA 2YHOA 2LDRA 4UYDA 5DW2A 2K16A 2RO1A 2VPGA 4FIPA 5FB1A 5CQ7A 3HMEA 5D26A 5B78A 5D3SA 5FE3A 3UVXA 4WZ3B 4YYMA 4J1PA 4CUUA 5F1LA 5HRWA 2E6SA 2HDPA 2M6MA 4R2YA 5AITA 4MR4A 2VJFB 5C85A 5EV9A 3DPLR 4A9MA 4A49A 4FK5A 3O37A 4YBSA 5CS8A 3P1DA 1X4JA 2VPBA 4J0SA 2F6NA 5FE8A 4ZW1A 4BHWA 1WUMA 2LQ6A 4CLBA 4QSSA 3U5NA 4O7EA 5L96A 4YYJA 4AYCA 2CSYA 2G6QA 1F62A 2ECTA 5FB0A 5DKDA 1JM7A 4ZUXU 4NR9A 2YREA 3O34A 4FO9A 5CY9A 2YURA 5A5NA 3O70A 5EWHA 3SHBA 5COIA 2N9GA 4NYVA 4N4GA 1XWHA 3DQVR 4UP0A 3N9QA 5E9LA 2IDAA 5TABA 5HQ5A 2YT5A 2YEMA 5ENJA 4KV1A 4NRAA 3KV5A 4A9OA 2MA5A 3N9PA 3DWYA 4LYIA 2E3KA 5A5SA 2MD7B 3O7AA 4V3KC 4MVTA 3SVHA 3AADA 5I83A 4GNFA 4WZ2A 4R8PK 4Z1SA 2D8SA 2KWOA 4NQNA 5J3XA 1JM4B 4HXLA 2YSMA 3ZNIA 5FE5A 5IGKA 5I86A 2ECIA 3L1ZB 2YYRA 4XYAA 3T7LA 2YSJA 3QZSA 3Q2FA 4HXSA 4NR5A 3N9LA 4TQNA 4A9KA 3MULA 4NRCA 2ECNA 2VPDA 4QF2A 5H9MA 5CRZA 4GNEA 5ENEA 4Z6HA 5B75A 5CQTA 4UYFA 4MSXA 4IC3A 5KHMA 2C2LA 4CFKA 3N9MA 3LQHA 5E9MA 5TDWA 3D7CA 5J0DA 5D1KB 1WILA 4NR7A 5F62A 4TKPB 3LQIA 4ALGA 1VFYA 2KGGA 2KFTA 2K4DA 3ONIA 2E7OA 5F3AA 2FUIA 5FH6A 2KYUA 4QSRA 4HBXA 2YELA 4NRBA 1WE9A 5LJ0A 5LJ1A 4R7EA 1EQFA 2H60A 5CZGA 5DYAA 5LJ2A 4OUFA 2L5UA 4O72A 2K17A 5II2A 1V87A 2F6JA 3QZTA 2YW8A 5D25A 1WESA 4O7AA 4HXMA 3HCSA 4Y03A 5FFWA 4HBYA 5I40A 2RNYA 4O71A 4WA6A 5EPSA 5A85A 5C7NA 4QZSA 5TDRA 5KH7A 4HBVA 2Y1MA 2RFJA 1G25A 5E9VA 5HCLA 2AN6A 4O77A 3HCUA 4NQMA 4PS5A 5BT3A 1WEOA 2OSSA 1K2FA 2L0BA 5G04B 3PUQA 5I88A 4BW4A 5G4SA 1ZS5A 4CUSA 3NG2A 4YAXA 4S3OB 5HQ6A 1JM7B 5C13A 4ALHA 4LDFA 2KIZA 5A5QA 5HRXA 4I7BA 1E4UA 2OXQC 1FBVA 4LYWA 5BT5A 3PHDA 2DVSA 4XUBA 5B79A 2KGIA 4N4HA 3N9OA 1LDKC 5E9IA 4LR6A 2F42A 4UYEA 5HEMA 5LCWB 2DWWA 2L80A 4AP4A 3JVLA 1WIMA 2D9EA 5IGMA 3VK6A 4LJNA 2E7NA 4C66A 3RCWA 5H1TA 1VYXA 4WIVA 4BJXA 4BW2A 5A5PA 4O64A 4HXOA 5DLXA 2BAYA 4YC9A 5L8UA 2FUUA 4WHWA 2YU4A 5D3HA 5D3JA 3UVDA 1FP0A 4UYHA 4Q0NA 2QJ0A 4TS8A 2R0YA 4ZQLA 4Z6IA 3KQIA 3SOUA 5JWMA 3RPGB 2ECJA 3SVGA 2VPEA 5AD2A 5KH3A 4QB3A 4LZSA 5FFVA 3P1EA 2YYNA 4TU4A 3KV6A 1WEWA 4CUTA 4YK0A 4UITA 5F63A 4YY6A 5G05B 4X2IA 3EB6A 5HRVA 5D1MB 3ZPV1 5TBNA 4HBWA 1N72A 5DKAA 4UIXA 5DLZA 5AD3A 1LDJB 5HLSA 5IG6A 5FE6A 2EA6A 3IU6A 5EPRA 5C4QA 3HTKC 5HENA 3ZVZB 2MNYA 4GNGA 5CUGA 4PPEA 1JSPB 4O7CA 3HMFA 3QZVA 5LKUA 1WEUA 2WP2A 4WHUA 5B8DA 5CUBA 3IU5A 4QC1A 2M1RA 4NYWA 5HFRA 2YW5A 3MHSA 2MA6A 5FH8A 3HCTA 2L84A 2ECWA 4LZ2A 3UW9A 4S3OC 5FH7A 4QSQA 5E3GA 5CFWA 4PCEA 5EGUA 5I7YA 5JI8A 4AKNA 4GPJA 5IGNA 3U5JA 4TTEA 5KH9A 2ZETC 2XEUA 2MUMA 3G0LA 4IR6A 4PTBA 5FE1A 1WGMA 5A5RA 4I7DA 5A83A 4A9NA 4UYGA 4MEPA 4W4UA 3ZYUA
chains in the Genus database with same CATH superfamily
2KE1A 3FANA 3T9KA 5HELA 5E0RA 5A7CA 4GNDA 3O35A 2Y1NA 2WP1A 1WEQA 3SOWA 5DFBA 4Z0RA 4AUQB 4YYIA 5CQ8A 2KR4A 4A9JA 5K29A 5E3DA 3C5KA 2KWKA 2EODA 4TZ2A 3DWDA 5HJCA 2VJFA 4PY6A 2L75A 5JG6A 4IOQA 2LGKA 2YEKA 3MQMA 5L8TA 4PCIA 4TU6A 4Q0OA 3P1FA 4TT4A 4DONA 2G45A 2L7PA 2RNXA 3FL2A 5L97A 5D7XA 4AVXA 5L98A 4QEWA 5TCMA 4UP5A 2KKYA 3HMHA 2PNXA 5F2PA 5TRBA 5B77A 2KREA 1HYIA 1F68A 3LJWA 4MR3A 4IR4A 4O62A 2JM3A 2YHNA 3DDTA 4O7BA 3ASLA 3U5MA 5FE7A 4AKHA 5KU3A 5CQ6A 1WFKA 4NR4A 3S91A 4CFLA 5CUCA 5F25A 5DYXA 1HYJA 3ZTGA 5EWDA 1Z2QA 5DW1A 4N3WA 2CRRA 4IC2A 5LVRA 2H0DA 2VJEB 2R10A 4QEVA 2XB1A 3M63A 4FJCA 3RPGC 2DATA 2ECGA 5KTWA 3LDYA 2L85A 1IYMA 4YADA 4UYFB 2ECVA 4L58A 2KWNA 3P5OA 5D3LA 3N9NA 5TB6A 1Z6UA 4FLPA 5CQ5A 5EI4A 4A9EA 1JOCA 4BW3A 2K1JA 5I1QA 1CHCA 3GV4A 3UV4A 4QSXA 2YUCA 5E74A 3EB5A 5CQ4A 5EWCA 4OGJA 2OUOA 4J3IA 2NAAA 5E73A 3MUKA 2RNWA 5G0FA 4GB0A 4LK9A 5A81A 4A4BA 4LYSA 4NXJA 4XUAA 2LSPB 4CURA 4CCGX 5EWVA 3M7KA 4UIVA 4E96A 5D3PA 5II1A 3NXBA 3MXFA 2FFWA 3U5PA 5CUEA 3GL6A 5I29A 4BW1A 3IHPA 3KNVA 5B76A 5L99A 5LKXA 4NR8A 1BORA 1WEPA 3V43A 4YBMA 3FEHA 5CUAA 5DYCA 4KCXA 5BT4A 3UVYA 2DVQA 5DKHA 3S92A 5D0CA 5CRMA 4CL9A 2L43A 2XOZA 3C6WA 5EA1A 4YBTA 5D3NA 5AMEA 4CUQA 3Q1DA 5DINA 3T6RA 1WENA 2LXHC 3M62A 1VD4A 4QEUA 2DVRA 4MEQA 5ENGA 4YYKA 3DAIA 4LZRA 5SVYA 5A5OA 4CA1A 5C87A 4C9ZA 2YQLA 2Y43A 5ENHA 5FE9A 5FFYA 3ERRA 3O33A 5FG5A 5H1VA 4A4CA 2D82A 2I8NA 4LRGA 3RTRB 1RMDA 2DX8A 4F52B 4YH3A 4NS5A 1WEVA 5LVQA 4X3GA 4MR5A 5F1HA 2EGMA 5EQ1A 5CQ3A 2FD4A 5AMFA 2PUYA 5HM0A 2LRIC 3LXJA 2YDWA 2QICA 4HXRA 3ZPVE 4J0RA 4UIUA 3PURA 4QSPA 4QY4A 4QYDA 1WUGA 4TT6A 5KTUA 4LC2A 3LQJA 4HXKA 5EM3A 5D24A 2RSDA 5ETDA 3O36A 4QC3A 4QSTA 4MENA 2CKLB 2JMJA 4A0CD 5FG4A 4TT2A 5H1UA 2EXUA 3MHHA 2H0DB 1ZKRA 5EVAA 2VJEA 3U5OA 2VNFA 5FG6A 1MM3A 4UIZA 2MD8C 4RVRA 4UIWA 2JUNA 5EWWA 5CQAA 5A82A 4A9IA 4YYNA 3I2DA 3M99A 4O78A 4HXNA 5CGPA 2CT2A 2M3HA 4MEOA 2YVRA 2L5EA 4QQ4A 2YQMA 4O75A 5F60A 3MB4A 4YH4A 3UVWA 5FE0A 2B0OE 2VP7A 4QUTA 2KTBB 2I7KA 4NUDA 3FKMX 5F36A 3L1XA 4V3LC 1MM2A 4YY4A 2LXPC 4LKAA 3G0JA 5EP7A 3MDBC 5SVIA 2KWJA 5DFCA 2G4AA 4O74A 5H85A 2NXBA 3K2JA 3P1CA 4A9HA 5LUUA 4LLBA 4QUUA 5CPEA 1DVPA 2LGGA 5DFDA 4QR3A 2E61A 5IIDA 2IQJA 4YATA 2R0SA 2JMDA 2KU3A 4Q6FA 4H9DA 5DX4A 4QSUA 4QSVA 5ACYA 3UV2A 3MB3A 3Q2EA 4A9LA 5FE2A 2EGPA 4NUCA 3LRQA 3ZYQA 5I3LA 5I80A 5D3RA 2MJVB 5E9YA 2MT5A 1WEEA 5IGLA 4NN2A 5G4RA 4NYXA 3U5KA 4UI9B 1T1HA 4YYHA 4YABA 4PKLA 5CUDA 1PUOA 5ENBA 5HFQA 4QYLA 2FSAA 5F61A 2RS9B 4OGEA 2MIQA 1X4UA 3U5LA 4TZ8A 4MR6A 4OGIA 4Z93A 4L7XA 5DKCA 4NUEA 5DBMA 2LGVA 4AYCB 2DVVA 1MBMA 2I50A 4QF3A 5DY7A 4QSWA 5I7XA 3I3JA 4Z1QA 2CSZA 3AQAA 3TLPA 2CKLA 5FBXA 4LADB 2DSMA 4QBMA 1U6GB 2E6RA 4A9FA 5LKTA 4AKGA 4IORA 4KV4A 2C2VS 5IBNA 5HQ7A 5C11A 5D3TA 5FDZA 3D1DA 5F5ZA 5ENIA 2DKWA 5DYUA 5EU1A 5I89A 4IOOA 3L11A 4XI1A 5EICA 5ENFA 4I7CA 4XY8A 4B7YC 2JRJA 1X0JA 2XOCA 5EISA 5FEYA 5AIUA 4XY9A 5EYAF 4HXPA 5CTLA 3UV5A 1Z60A 5C8GA 4AKIA 2LGLA 2OO1A 5FERA 2HYED 3SVFA 2YQDA 4QR5A 3GG3A 2MNZA 4C67A 4UIYA 5ETBA 4N4IA 1X4IA 1E6IA 2RI7A 5D1LB 4F3IA 4OGCA 4IR3A 4O76A 3ZVYA 4O70A 4ZDTA 2LV9A 2UZGA 4O7FA 4YYGA 4QR4A 5LKZA 3SOXA 5CU8A 4N4FA 2M85A 2G43A 5EPBA 1WEMA 5SVIB 5EK9A 5ENCA 4TYLA 4QNSA 3JVJA 5KTXA 3JVMA 1ZBDB 5C89A 2CSVA 4P5OB 4B86C 1N87A 5CP5A 5FE4A 2LN0A 2P57A 2R0VA 4IR5A 5E9KA 5KO4A 2JMIA 4ZC9A 4YYDA 2GRCA 5E7DA 2QIZA 4WZ0A 4NR6A 4BBQA 3JVKA 4CUPA 2YHOA 2LDRA 4UYDA 5DW2A 2K16A 2RO1A 2VPGA 4FIPA 5FB1A 5CQ7A 3O47A 3HMEA 5D26A 3JUEA 5B78A 5D3SA 5FE3A 3UVXA 4WZ3B 2CONA 4YYMA 4J1PA 4CUUA 5F1LA 5HRWA 2E6SA 2HDPA 2M6MA 4R2YA 5AITA 4MR4A 2VJFB 5C85A 5EV9A 3DPLR 4A9MA 4A49A 4FK5A 3D1BA 3O37A 4YBSA 5CS8A 2DJAA 3P1DA 5SVXA 1X4JA 2VPBA 4J0SA 2F6NA 5FE8A 4ZW1A 4BHWA 1WUMA 2LQ6A 4CLBA 4QSSA 3U5NA 4O7EA 5L96A 4AI6A 4YYJA 4AYCA 2CSYA 2G6QA 1F62A 2ECTA 5FB0A 5DKDA 1JM7A 4ZUXU 4NR9A 2YREA 3O34A 4FO9A 5CY9A 2YURA 5A5NA 3O70A 5EWHA 3SHBA 5COIA 2N9GA 4NYVA 4N4GA 1XWHA 3DQVR 4UP0A 3N9QA 5E9LA 2IDAA 3H7HA 5HQ5A 2YT5A 5TABA 2YEMA 5ENJA 4KV1A 4NRAA 3KV5A 4A9OA 2MA5A 3N9PA 3DWYA 4LYIA 1DCQA 2E3KA 5A5SA 2MD7B 3O7AA 4V3KC 4MVTA 3SVHA 3AADA 5I83A 4GNFA 4WZ2A 4R8PK 4Z1SA 2D8SA 2KWOA 4NQNA 5J3XA 1JM4B 4HXLA 2YSMA 3ZNIA 5FE5A 5IGKA 5I86A 2ECIA 3L1ZB 2YYRA 4XYAA 3T7LA 2YSJA 3QZSA 3Q2FA 4HXSA 4NR5A 3N9LA 4TQNA 4A9KA 3MULA 4NRCA 2ECNA 2VPDA 3PLWA 4QF2A 5CRZA 4GNEA 5ENEA 4Z6HA 5H9MA 5CQTA 5B75A 4UYFA 4MSXA 4IC3A 5KHMA 2C2LA 4CFKA 3N9MA 3LQHA 5E9MA 2CRWA 5TDWA 3D7CA 5J0DA 3FM8C 5D1KB 1WILA 4NR7A 5F62A 4TKPB 3LQIA 4ALGA 1VFYA 2XOYA 2KGGA 2KFTA 2K4DA 3ONIA 2E7OA 5F3AA 2FUIA 5FH6A 2KYUA 4QSRA 4HBXA 2YELA 4NRBA 1WE9A 5LJ0A 5LJ1A 4R7EA 1EQFA 2H60A 5CZGA 5DYAA 5LJ2A 2OWAA 4OUFA 2L5UA 3E2DA 4O72A 2K17A 5II2A 1V87A 2F6JA 3QZTA 2YW8A 5D25A 1WESA 4O7AA 4HXMA 3HCSA 4Y03A 5FFWA 4HBYA 5I40A 2RNYA 4O71A 4WA6A 5EPSA 5A85A 5C7NA 4QZSA 5TDRA 4F1PA 5KH7A 4HBVA 2Y1MA 2RFJA 1G25A 5E9VA 5HCLA 2AN6A 4O77A 3HCUA 4NQMA 4PS5A 5BT3A 1WEOA 2OSSA 1K2FA 2L0BA 5G04B 3PUQA 5I88A 4BW4A 5G4SA 1ZS5A 4CUSA 3NG2A 4YAXA 4S3OB 5HQ6A 1JM7B 5C13A 4ALHA 4LDFA 2KIZA 5A5QA 5HRXA 4I7BA 1E4UA 2OXQC 1FBVA 4LYWA 5BT5A 3LJUX 3PHDA 2DVSA 4XUBA 2M13A 5B79A 2KGIA 4N4HA 3N9OA 1LDKC 3VKHA 5E9IA 4LR6A 2F42A 4UYEA 5HEMA 5LCWB 2DWWA 2L80A 4AP4A 3JVLA 1WIMA 2D9EA 5IGMA 3VK6A 4LJNA 2KKXA 2E7NA 4C66A 3RCWA 5H1TA 1VYXA 4WIVA 5K3QA 2EJNA 4BJXA 4BW2A 5A5PA 4O64A 4HXOA 5DLXA 2BAYA 4YC9A 5L8UA 2FUUA 4WHWA 2YU4A 5D3HA 2D8UA 5D3JA 3UVDA 1FP0A 3SUBA 4UYHA 4Q0NA 2QJ0A 4TS8A 3VKGA 2R0YA 4ZQLA 4Z6IA 3KQIA 3SOUA 5JWMA 3RPGB 2ECJA 3SVGA 2VPEA 5AD2A 5KH3A 4QB3A 4LZSA 5FFVA 3P1EA 2YYNA 4TU4A 3KV6A 1WEWA 2LAUA 4CUTA 3KDEC 4YK0A 4UITA 5F63A 4YY6A 5G05B 4X2IA 3EB6A 5HRVA 5D1MB 3ZPV1 5TBNA 4HBWA 1N72A 5DKAA 4UIXA 5DLZA 5AD3A 3FJUB 1LDJB 5HLSA 5IG6A 2MKEA 5FE6A 2EA6A 3IU6A 5EPRA 5C4QA 3HTKC 5HENA 3ZVZB 2MNYA 4GNGA 5CUGA 3FAOA 4PPEA 1JSPB 4O7CA 3HMFA 3QZVA 5LKUA 1WEUA 2WP2A 4WHUA 5B8DA 5CUBA 3LVRE 3IU5A 4QC1A 2M1RA 4NYWA 5HFRA 2YW5A 3MHSA 2MA6A 5FH8A 3HCTA 2L84A 2ECWA 4LZ2A 3UW9A 4S3OC 5FH7A 3LVQE 4QSQA 5E3GA 5CFWA 4PCEA 4Z0OA 5EGUA 5I7YA 5JI8A 4AKNA 4GPJA 5IGNA 3U5JA 4TTEA 2RR4A 5KH9A 2XP0A 2ZETC 2XEUA 2MUMA 3G0LA 4IR6A 4PTBA 5FE1A 1WGMA 5A5RA 4I7DA 5A83A 4A9NA 4UYGA 4MEPA 4W4UA 3ZYUA
chains in the Genus database with same CATH topology
2KE1A 5HELA 5E0RA 5A7CA 4GNDA 3O35A 2Y1NA 2WP1A 1WEQA 3SOWA 5DFBA 4AUQB 4YYIA 5CQ8A 2KR4A 4A9JA 5K29A 5E3DA 3C5KA 2KWKA 2EODA 4TZ2A 5HJCA 2VJFA 4PY6A 2L75A 5JG6A 4IOQA 2LGKA 2YEKA 3MQMA 5L8TA 4PCIA 4TU6A 4Q0OA 3P1FA 4TT4A 4DONA 2G45A 2RNXA 3FL2A 5L97A 5D7XA 4AVXA 5L98A 4QEWA 5TCMA 4UP5A 3HMHA 2PNXA 5F2PA 5TRBA 5B77A 2KREA 1HYIA 1F68A 3LJWA 4MR3A 4IR4A 2YHNA 4O7BA 3ASLA 3U5MA 5FE7A 5KU3A 5CQ6A 1WFKA 4NR4A 3S91A 4CFLA 5CUCA 5F25A 5DYXA 1HYJA 3ZTGA 5EWDA 1Z2QA 5DW1A 4N3WA 4IC2A 5LVRA 2H0DA 2VJEB 2R10A 4QEVA 2XB1A 3M63A 4FJCA 3RPGC 2DATA 2ECGA 5KTWA 1IYMA 2L85A 4YADA 4UYFB 2ECVA 4L58A 2KWNA 3P5OA 5D3LA 3N9NA 5TB6A 1Z6UA 4FLPA 5CQ5A 5EI4A 4A9EA 1JOCA 4BW3A 2K1JA 5I1QA 1CHCA 3GV4A 3UV4A 4QSXA 2YUCA 5E74A 3EB5A 5CQ4A 5EWCA 4OGJA 2OUOA 4J3IA 2NAAA 5E73A 3MUKA 2RNWA 5G0FA 4GB0A 4LK9A 5A81A 4A4BA 4LYSA 4NXJA 4XUAA 2LSPB 4CURA 4CCGX 5EWVA 4UIVA 4E96A 5D3PA 5II1A 3NXBA 3MXFA 3U5PA 5CUEA 3GL6A 5I29A 4BW1A 3IHPA 3KNVA 5B76A 5L99A 5LKXA 4NR8A 1BORA 1WEPA 3V43A 4YBMA 5CUAA 5DYCA 4KCXA 5BT4A 3UVYA 2DVQA 5DKHA 3S92A 5D0CA 5CRMA 4CL9A 2L43A 3C6WA 5EA1A 4YBTA 5D3NA 5AMEA 4CUQA 5DINA 3T6RA 1WENA 2LXHC 3M62A 1VD4A 4QEUA 2DVRA 4MEQA 5ENGA 4YYKA 3DAIA 4LZRA 5A5OA 4CA1A 5C87A 4C9ZA 2YQLA 2Y43A 5ENHA 5FE9A 5FFYA 3O33A 5FG5A 5H1VA 4A4CA 2D82A 2I8NA 4LRGA 3RTRB 1RMDA 2DX8A 4F52B 4YH3A 4NS5A 1WEVA 5LVQA 4X3GA 4MR5A 5F1HA 5EQ1A 5CQ3A 2PUYA 5AMFA 5HM0A 2LRIC 3LXJA 2YDWA 2QICA 4HXRA 3ZPVE 4J0RA 4UIUA 3PURA 4QSPA 4QY4A 4QYDA 1WUGA 4TT6A 5KTUA 4LC2A 3LQJA 4HXKA 5EM3A 5D24A 2RSDA 5ETDA 3O36A 4QC3A 4QSTA 4MENA 2CKLB 2JMJA 4A0CD 5FG4A 4TT2A 5H1UA 3MHHA 2H0DB 5EVAA 2VJEA 3U5OA 2VNFA 5FG6A 1MM3A 4UIZA 2MD8C 4RVRA 4UIWA 5EWWA 5CQAA 5A82A 4A9IA 4YYNA 3I2DA 3M99A 4O78A 4HXNA 5CGPA 2CT2A 2M3HA 4MEOA 2L5EA 2YQMA 4O75A 5F60A 3MB4A 4YH4A 3UVWA 5FE0A 2VP7A 3L1XA 4QUTA 2KTBB 2I7KA 4NUDA 3FKMX 5F36A 4V3LC 1MM2A 4YY4A 2LXPC 4LKAA 3G0JA 5EP7A 2KWJA 5DFCA 2G4AA 4O74A 5H85A 2NXBA 3K2JA 3P1CA 4A9HA 5LUUA 4LLBA 4QUUA 5CPEA 1DVPA 2LGGA 5DFDA 4QR3A 5IIDA 4YATA 2R0SA 2JMDA 2KU3A 4Q6FA 5DX4A 4QSUA 4QSVA 5ACYA 3UV2A 3MB3A 3Q2EA 4A9LA 5FE2A 2EGPA 4NUCA 3LRQA 3ZYQA 5I3LA 5I80A 5D3RA 2MJVB 5E9YA 2MT5A 1WEEA 5IGLA 4NN2A 5G4RA 4NYXA 3U5KA 4UI9B 1T1HA 4YYHA 4YABA 4PKLA 5CUDA 5ENBA 5HFQA 4QYLA 2FSAA 5F61A 2RS9B 2MIQA 1X4UA 3U5LA 4TZ8A 4MR6A 4OGIA 4Z93A 4L7XA 5DKCA 4NUEA 5DBMA 2LGVA 4AYCB 2DVVA 2I50A 4QF3A 5DY7A 4QSWA 5I7XA 3I3JA 4Z1QA 2CSZA 3AQAA 3TLPA 2CKLA 5FBXA 4LADB 4QBMA 1U6GB 2E6RA 4A9FA 5LKTA 4IORA 4KV4A 2C2VS 5IBNA 5HQ7A 5C11A 5D3TA 5FDZA 5F5ZA 5ENIA 2DKWA 5DYUA 5EU1A 5I89A 4IOOA 3L11A 4XI1A 5EICA 5ENFA 4I7CA 4XY8A 4B7YC 2JRJA 1X0JA 5EISA 5FEYA 5AIUA 4XY9A 5EYAF 4HXPA 5CTLA 3UV5A 1Z60A 5C8GA 2LGLA 2OO1A 5FERA 2HYED 3SVFA 2YQDA 4QR5A 3GG3A 2MNZA 4C67A 4UIYA 5ETBA 4N4IA 1X4IA 1E6IA 2RI7A 5D1LB 4F3IA 4IR3A 4O76A 3ZVYA 4O70A 4ZDTA 2LV9A 2UZGA 4O7FA 4YYGA 4QR4A 5LKZA 3SOXA 5CU8A 4N4FA 2M85A 2G43A 5EPBA 1WEMA 5EK9A 5ENCA 4TYLA 4QNSA 3JVJA 5KTXA 3JVMA 1ZBDB 5C89A 4P5OB 4B86C 1N87A 5CP5A 5FE4A 2LN0A 2R0VA 4IR5A 5E9KA 5KO4A 2JMIA 4ZC9A 4YYDA 2GRCA 5E7DA 2QIZA 4WZ0A 4NR6A 4BBQA 3JVKA 4CUPA 2YHOA 2LDRA 4UYDA 5DW2A 2K16A 2RO1A 2VPGA 4FIPA 5FB1A 5CQ7A 3HMEA 5D26A 5B78A 5D3SA 5FE3A 3UVXA 4WZ3B 4YYMA 4J1PA 4CUUA 5F1LA 5HRWA 2E6SA 2HDPA 2M6MA 4R2YA 5AITA 4MR4A 2VJFB 5C85A 5EV9A 3DPLR 4A9MA 4A49A 4FK5A 3O37A 4YBSA 5CS8A 3P1DA 1X4JA 2VPBA 4J0SA 2F6NA 5FE8A 4ZW1A 4BHWA 1WUMA 2LQ6A 4CLBA 4QSSA 3U5NA 4O7EA 5L96A 4YYJA 4AYCA 2CSYA 2G6QA 1F62A 2ECTA 5FB0A 5DKDA 1JM7A 4ZUXU 4NR9A 2YREA 3O34A 4FO9A 5CY9A 2YURA 5A5NA 3O70A 5EWHA 3SHBA 5COIA 2N9GA 4NYVA 4N4GA 1XWHA 3DQVR 4UP0A 3N9QA 5E9LA 2IDAA 5TABA 5HQ5A 2YT5A 2YEMA 5ENJA 4KV1A 4NRAA 3KV5A 4A9OA 2MA5A 3N9PA 3DWYA 4LYIA 2E3KA 5A5SA 2MD7B 3O7AA 4V3KC 4MVTA 3SVHA 3AADA 5I83A 4GNFA 4WZ2A 4R8PK 4Z1SA 2D8SA 2KWOA 4NQNA 5J3XA 1JM4B 4HXLA 2YSMA 3ZNIA 5FE5A 5IGKA 5I86A 2ECIA 3L1ZB 2YYRA 4XYAA 3T7LA 2YSJA 3QZSA 3Q2FA 4HXSA 4NR5A 3N9LA 4TQNA 4A9KA 3MULA 4NRCA 2ECNA 2VPDA 4QF2A 5H9MA 5CRZA 4GNEA 5ENEA 4Z6HA 5B75A 5CQTA 4UYFA 4MSXA 4IC3A 5KHMA 2C2LA 4CFKA 3N9MA 3LQHA 5E9MA 5TDWA 3D7CA 5J0DA 5D1KB 1WILA 4NR7A 5F62A 4TKPB 3LQIA 4ALGA 1VFYA 2KGGA 2KFTA 2K4DA 3ONIA 2E7OA 5F3AA 2FUIA 5FH6A 2KYUA 4QSRA 4HBXA 2YELA 4NRBA 1WE9A 5LJ0A 5LJ1A 4R7EA 1EQFA 2H60A 5CZGA 5DYAA 5LJ2A 4OUFA 2L5UA 4O72A 2K17A 5II2A 1V87A 2F6JA 3QZTA 2YW8A 5D25A 1WESA 4O7AA 4HXMA 3HCSA 4Y03A 5FFWA 4HBYA 5I40A 2RNYA 4O71A 4WA6A 5EPSA 5A85A 5C7NA 4QZSA 5TDRA 5KH7A 4HBVA 2Y1MA 2RFJA 1G25A 5E9VA 5HCLA 2AN6A 4O77A 3HCUA 4NQMA 4PS5A 5BT3A 1WEOA 2OSSA 1K2FA 2L0BA 5G04B 3PUQA 5I88A 4BW4A 5G4SA 1ZS5A 4CUSA 3NG2A 4YAXA 4S3OB 5HQ6A 1JM7B 5C13A 4ALHA 4LDFA 2KIZA 5A5QA 5HRXA 4I7BA 1E4UA 2OXQC 1FBVA 4LYWA 5BT5A 3PHDA 2DVSA 4XUBA 5B79A 2KGIA 4N4HA 3N9OA 1LDKC 5E9IA 4LR6A 2F42A 4UYEA 5HEMA 5LCWB 2DWWA 2L80A 4AP4A 3JVLA 1WIMA 2D9EA 5IGMA 3VK6A 4LJNA 2E7NA 4C66A 3RCWA 5H1TA 1VYXA 4WIVA 4BJXA 4BW2A 5A5PA 4O64A 4HXOA 5DLXA 2BAYA 4YC9A 5L8UA 2FUUA 4WHWA 2YU4A 5D3HA 5D3JA 3UVDA 1FP0A 4UYHA 4Q0NA 2QJ0A 4TS8A 2R0YA 4ZQLA 4Z6IA 3KQIA 3SOUA 5JWMA 3RPGB 2ECJA 3SVGA 2VPEA 5AD2A 5KH3A 4QB3A 4LZSA 5FFVA 3P1EA 2YYNA 4TU4A 3KV6A 1WEWA 4CUTA 4YK0A 4UITA 5F63A 4YY6A 5G05B 4X2IA 3EB6A 5HRVA 5D1MB 3ZPV1 5TBNA 4HBWA 1N72A 5DKAA 4UIXA 5DLZA 5AD3A 1LDJB 5HLSA 5IG6A 5FE6A 2EA6A 3IU6A 5EPRA 5C4QA 3HTKC 5HENA 3ZVZB 2MNYA 4GNGA 5CUGA 4PPEA 1JSPB 4O7CA 3HMFA 3QZVA 5LKUA 1WEUA 2WP2A 4WHUA 5B8DA 5CUBA 3IU5A 4QC1A 2M1RA 4NYWA 5HFRA 2YW5A 3MHSA 2MA6A 5FH8A 3HCTA 2L84A 2ECWA 4LZ2A 3UW9A 4S3OC 5FH7A 4QSQA 5E3GA 5CFWA 4PCEA 5EGUA 5I7YA 5JI8A 4AKNA 4GPJA 5IGNA 3U5JA 4TTEA 5KH9A 2ZETC 2XEUA 2MUMA 3G0LA 4IR6A 4PTBA 5FE1A 1WGMA 5A5RA 4I7DA 5A83A 4A9NA 4UYGA 4MEPA 4W4UA 3ZYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE1 A;  5HEL A;  5E0R A;  5A7C A;  4GND A;  3O35 A;  2Y1N A;  2WP1 A;  1WEQ A;  3SOW A;  5DFB A;  4AUQ B;  4YYI A;  5CQ8 A;  2KR4 A;  4A9J A;  5K29 A;  5E3D A;  3C5K A;  2KWK A;  2EOD A;  4TZ2 A;  5HJC A;  2VJF A;  4PY6 A;  2L75 A;  5JG6 A;  4IOQ A;  2LGK A;  2YEK A;  3MQM A;  5L8T A;  4PCI A;  4TU6 A;  4Q0O A;  3P1F A;  4TT4 A;  4DON A;  2G45 A;  2RNX A;  3FL2 A;  5L97 A;  5D7X A;  4AVX A;  5L98 A;  4QEW A;  5TCM A;  4UP5 A;  3HMH A;  2PNX A;  5F2P A;  5TRB A;  5B77 A;  2KRE A;  1HYI A;  1F68 A;  3LJW A;  4MR3 A;  4IR4 A;  2YHN A;  4O7B A;  3ASL A;  3U5M A;  5FE7 A;  5KU3 A;  5CQ6 A;  1WFK A;  4NR4 A;  3S91 A;  4CFL A;  5CUC A;  5F25 A;  5DYX A;  1HYJ A;  3ZTG A;  5EWD A;  1Z2Q A;  5DW1 A;  4N3W A;  4IC2 A;  5LVR A;  2H0D A;  2VJE B;  2R10 A;  4QEV A;  2XB1 A;  3M63 A;  4FJC A;  3RPG C;  2DAT A;  2ECG A;  5KTW A;  1IYM A;  2L85 A;  4YAD A;  4UYF B;  2ECV A;  4L58 A;  2KWN A;  3P5O A;  5D3L A;  3N9N A;  5TB6 A;  1Z6U A;  4FLP A;  5CQ5 A;  5EI4 A;  4A9E A;  1JOC A;  4BW3 A;  2K1J A;  5I1Q A;  1CHC A;  3GV4 A;  3UV4 A;  4QSX A;  2YUC A;  5E74 A;  3EB5 A;  5CQ4 A;  5EWC A;  4OGJ A;  2OUO A;  4J3I A;  2NAA A;  5E73 A;  3MUK A;  2RNW A;  5G0F A;  4GB0 A;  4LK9 A;  5A81 A;  4A4B A;  4LYS A;  4NXJ A;  4XUA A;  2LSP B;  4CUR A;  4CCG X;  5EWV A;  4UIV A;  4E96 A;  5D3P A;  5II1 A;  3NXB A;  3MXF A;  3U5P A;  5CUE A;  3GL6 A;  5I29 A;  4BW1 A;  3IHP A;  3KNV A;  5B76 A;  5L99 A;  5LKX A;  4NR8 A;  1BOR A;  1WEP A;  3V43 A;  4YBM A;  5CUA A;  5DYC A;  4KCX A;  5BT4 A;  3UVY A;  2DVQ A;  5DKH A;  3S92 A;  5D0C A;  5CRM A;  4CL9 A;  2L43 A;  3C6W A;  5EA1 A;  4YBT A;  5D3N A;  5AME A;  4CUQ A;  5DIN A;  3T6R A;  1WEN A;  2LXH C;  3M62 A;  1VD4 A;  4QEU A;  2DVR A;  4MEQ A;  5ENG A;  4YYK A;  3DAI A;  4LZR A;  5A5O A;  4CA1 A;  5C87 A;  4C9Z A;  2YQL A;  2Y43 A;  5ENH A;  5FE9 A;  5FFY A;  3O33 A;  5FG5 A;  5H1V A;  4A4C A;  2D82 A;  2I8N A;  4LRG A;  3RTR B;  1RMD A;  2DX8 A;  4F52 B;  4YH3 A;  4NS5 A;  1WEV A;  5LVQ A;  4X3G A;  4MR5 A;  5F1H A;  5EQ1 A;  5CQ3 A;  2PUY A;  5AMF A;  5HM0 A;  2LRI C;  3LXJ A;  2YDW A;  2QIC A;  4HXR A;  3ZPV E;  4J0R A;  4UIU A;  3PUR A;  4QSP A;  4QY4 A;  4QYD A;  1WUG A;  4TT6 A;  5KTU A;  4LC2 A;  3LQJ A;  4HXK A;  5EM3 A;  5D24 A;  2RSD A;  5ETD A;  3O36 A;  4QC3 A;  4QST A;  4MEN A;  2CKL B;  2JMJ A;  4A0C D;  5FG4 A;  4TT2 A;  5H1U A;  3MHH A;  2H0D B;  5EVA A;  2VJE A;  3U5O A;  2VNF A;  5FG6 A;  1MM3 A;  4UIZ A;  2MD8 C;  4RVR A;  4UIW A;  5EWW A;  5CQA A;  5A82 A;  4A9I A;  4YYN A;  3I2D A;  3M99 A;  4O78 A;  4HXN A;  5CGP A;  2CT2 A;  2M3H A;  4MEO A;  2L5E A;  2YQM A;  4O75 A;  5F60 A;  3MB4 A;  4YH4 A;  3UVW A;  5FE0 A;  2VP7 A;  3L1X A;  4QUT A;  2KTB B;  2I7K A;  4NUD A;  3FKM X;  5F36 A;  4V3L C;  1MM2 A;  4YY4 A;  2LXP C;  4LKA A;  3G0J A;  5EP7 A;  2KWJ A;  5DFC A;  2G4A A;  4O74 A;  5H85 A;  2NXB A;  3K2J A;  3P1C A;  4A9H A;  5LUU A;  4LLB A;  4QUU A;  5CPE A;  1DVP A;  2LGG A;  5DFD A;  4QR3 A;  5IID A;  4YAT A;  2R0S A;  2JMD A;  2KU3 A;  4Q6F A;  5DX4 A;  4QSU A;  4QSV A;  5ACY A;  3UV2 A;  3MB3 A;  3Q2E A;  4A9L A;  5FE2 A;  2EGP A;  4NUC A;  3LRQ A;  3ZYQ A;  5I3L A;  5I80 A;  5D3R A;  2MJV B;  5E9Y A;  2MT5 A;  1WEE A;  5IGL A;  4NN2 A;  5G4R A;  4NYX A;  3U5K A;  4UI9 B;  1T1H A;  4YYH A;  4YAB A;  4PKL A;  5CUD A;  5ENB A;  5HFQ A;  4QYL A;  2FSA A;  5F61 A;  2RS9 B;  2MIQ A;  1X4U A;  3U5L A;  4TZ8 A;  4MR6 A;  4OGI A;  4Z93 A;  4L7X A;  5DKC A;  4NUE A;  5DBM A;  2LGV A;  4AYC B;  2DVV A;  2I50 A;  4QF3 A;  5DY7 A;  4QSW A;  5I7X A;  3I3J A;  4Z1Q A;  2CSZ A;  3AQA A;  3TLP A;  2CKL A;  5FBX A;  4LAD B;  4QBM A;  1U6G B;  2E6R A;  4A9F A;  5LKT A;  4IOR A;  4KV4 A;  2C2V S;  5IBN A;  5HQ7 A;  5C11 A;  5D3T A;  5FDZ A;  5F5Z A;  5ENI A;  2DKW A;  5DYU A;  5EU1 A;  5I89 A;  4IOO A;  3L11 A;  4XI1 A;  5EIC A;  5ENF A;  4I7C A;  4XY8 A;  4B7Y C;  2JRJ A;  1X0J A;  5EIS A;  5FEY A;  5AIU A;  4XY9 A;  5EYA F;  4HXP A;  5CTL A;  3UV5 A;  1Z60 A;  5C8G A;  2LGL A;  2OO1 A;  5FER A;  2HYE D;  3SVF A;  2YQD A;  4QR5 A;  3GG3 A;  2MNZ A;  4C67 A;  4UIY A;  5ETB A;  4N4I A;  1X4I A;  1E6I A;  2RI7 A;  5D1L B;  4F3I A;  4IR3 A;  4O76 A;  3ZVY A;  4O70 A;  4ZDT A;  2LV9 A;  2UZG A;  4O7F A;  4YYG A;  4QR4 A;  5LKZ A;  3SOX A;  5CU8 A;  4N4F A;  2M85 A;  2G43 A;  5EPB A;  1WEM A;  5EK9 A;  5ENC A;  4TYL A;  4QNS A;  3JVJ A;  5KTX A;  3JVM A;  1ZBD B;  5C89 A;  4P5O B;  4B86 C;  1N87 A;  5CP5 A;  5FE4 A;  2LN0 A;  2R0V A;  4IR5 A;  5E9K A;  5KO4 A;  2JMI A;  4ZC9 A;  4YYD A;  2GRC A;  5E7D A;  2QIZ A;  4WZ0 A;  4NR6 A;  4BBQ A;  3JVK A;  4CUP A;  2YHO A;  2LDR A;  4UYD A;  5DW2 A;  2K16 A;  2RO1 A;  2VPG A;  4FIP A;  5FB1 A;  5CQ7 A;  3HME A;  5D26 A;  5B78 A;  5D3S A;  5FE3 A;  3UVX A;  4WZ3 B;  4YYM A;  4J1P A;  4CUU A;  5F1L A;  5HRW A;  2E6S A;  2HDP A;  2M6M A;  4R2Y A;  5AIT A;  4MR4 A;  2VJF B;  5C85 A;  5EV9 A;  3DPL R;  4A9M A;  4A49 A;  4FK5 A;  3O37 A;  4YBS A;  5CS8 A;  3P1D A;  1X4J A;  2VPB A;  4J0S A;  2F6N A;  5FE8 A;  4ZW1 A;  4BHW A;  1WUM A;  2LQ6 A;  4CLB A;  4QSS A;  3U5N A;  4O7E A;  5L96 A;  4YYJ A;  4AYC A;  2CSY A;  2G6Q A;  1F62 A;  2ECT A;  5FB0 A;  5DKD A;  1JM7 A;  4ZUX U;  4NR9 A;  2YRE A;  3O34 A;  4FO9 A;  5CY9 A;  2YUR A;  5A5N A;  3O70 A;  5EWH A;  3SHB A;  5COI A;  2N9G A;  4NYV A;  4N4G A;  1XWH A;  3DQV R;  4UP0 A;  3N9Q A;  5E9L A;  2IDA A;  5TAB A;  5HQ5 A;  2YT5 A;  2YEM A;  5ENJ A;  4KV1 A;  4NRA A;  3KV5 A;  4A9O A;  2MA5 A;  3N9P A;  3DWY A;  4LYI A;  2E3K A;  5A5S A;  2MD7 B;  3O7A A;  4V3K C;  4MVT A;  3SVH A;  3AAD A;  5I83 A;  4GNF A;  4WZ2 A;  4R8P K;  4Z1S A;  2D8S A;  2KWO A;  4NQN A;  5J3X A;  1JM4 B;  4HXL A;  2YSM A;  3ZNI A;  5FE5 A;  5IGK A;  5I86 A;  2ECI A;  3L1Z B;  2YYR A;  4XYA A;  3T7L A;  2YSJ A;  3QZS A;  3Q2F A;  4HXS A;  4NR5 A;  3N9L A;  4TQN A;  4A9K A;  3MUL A;  4NRC A;  2ECN A;  2VPD A;  4QF2 A;  5H9M A;  5CRZ A;  4GNE A;  5ENE A;  4Z6H A;  5B75 A;  5CQT A;  4UYF A;  4MSX A;  4IC3 A;  5KHM A;  2C2L A;  4CFK A;  3N9M A;  3LQH A;  5E9M A;  5TDW A;  3D7C A;  5J0D A;  5D1K B;  1WIL A;  4NR7 A;  5F62 A;  4TKP B;  3LQI A;  4ALG A;  1VFY A;  2KGG A;  2KFT A;  2K4D A;  3ONI A;  2E7O A;  5F3A A;  2FUI A;  5FH6 A;  2KYU A;  4QSR A;  4HBX A;  2YEL A;  4NRB A;  1WE9 A;  5LJ0 A;  5LJ1 A;  4R7E A;  1EQF A;  2H60 A;  5CZG A;  5DYA A;  5LJ2 A;  4OUF A;  2L5U A;  4O72 A;  2K17 A;  5II2 A;  1V87 A;  2F6J A;  3QZT A;  2YW8 A;  5D25 A;  1WES A;  4O7A A;  4HXM A;  3HCS A;  4Y03 A;  5FFW A;  4HBY A;  5I40 A;  2RNY A;  4O71 A;  4WA6 A;  5EPS A;  5A85 A;  5C7N A;  4QZS A;  5TDR A;  5KH7 A;  4HBV A;  2Y1M A;  2RFJ A;  1G25 A;  5E9V A;  5HCL A;  2AN6 A;  4O77 A;  3HCU A;  4NQM A;  4PS5 A;  5BT3 A;  1WEO A;  2OSS A;  1K2F A;  2L0B A;  5G04 B;  3PUQ A;  5I88 A;  4BW4 A;  5G4S A;  1ZS5 A;  4CUS A;  3NG2 A;  4YAX A;  4S3O B;  5HQ6 A;  1JM7 B;  5C13 A;  4ALH A;  4LDF A;  2KIZ A;  5A5Q A;  5HRX A;  4I7B A;  1E4U A;  2OXQ C;  1FBV A;  4LYW A;  5BT5 A;  3PHD A;  2DVS A;  4XUB A;  5B79 A;  2KGI A;  4N4H A;  3N9O A;  1LDK C;  5E9I A;  4LR6 A;  2F42 A;  4UYE A;  5HEM A;  5LCW B;  2DWW A;  2L80 A;  4AP4 A;  3JVL A;  1WIM A;  2D9E A;  5IGM A;  3VK6 A;  4LJN A;  2E7N A;  4C66 A;  3RCW A;  5H1T A;  1VYX A;  4WIV A;  4BJX A;  4BW2 A;  5A5P A;  4O64 A;  4HXO A;  5DLX A;  2BAY A;  4YC9 A;  5L8U A;  2FUU A;  4WHW A;  2YU4 A;  5D3H A;  5D3J A;  3UVD A;  1FP0 A;  4UYH A;  4Q0N A;  2QJ0 A;  4TS8 A;  2R0Y A;  4ZQL A;  4Z6I A;  3KQI A;  3SOU A;  5JWM A;  3RPG B;  2ECJ A;  3SVG A;  2VPE A;  5AD2 A;  5KH3 A;  4QB3 A;  4LZS A;  5FFV A;  3P1E A;  2YYN A;  4TU4 A;  3KV6 A;  1WEW A;  4CUT A;  4YK0 A;  4UIT A;  5F63 A;  4YY6 A;  5G05 B;  4X2I A;  3EB6 A;  5HRV A;  5D1M B;  3ZPV 1;  5TBN A;  4HBW A;  1N72 A;  5DKA A;  4UIX A;  5DLZ A;  5AD3 A;  1LDJ B;  5HLS A;  5IG6 A;  5FE6 A;  2EA6 A;  3IU6 A;  5EPR A;  5C4Q A;  3HTK C;  5HEN A;  3ZVZ B;  2MNY A;  4GNG A;  5CUG A;  4PPE A;  1JSP B;  4O7C A;  3HMF A;  3QZV A;  5LKU A;  1WEU A;  2WP2 A;  4WHU A;  5B8D A;  5CUB A;  3IU5 A;  4QC1 A;  2M1R A;  4NYW A;  5HFR A;  2YW5 A;  3MHS A;  2MA6 A;  5FH8 A;  3HCT A;  2L84 A;  2ECW A;  4LZ2 A;  3UW9 A;  4S3O C;  5FH7 A;  4QSQ A;  5E3G A;  5CFW A;  4PCE A;  5EGU A;  5I7Y A;  5JI8 A;  4AKN A;  4GPJ A;  5IGN A;  3U5J A;  4TTE A;  5KH9 A;  2ZET C;  2XEU A;  2MUM A;  3G0L A;  4IR6 A;  4PTB A;  5FE1 A;  1WGM A;  5A5R A;  4I7D A;  5A83 A;  4A9N A;  4UYG A;  4MEP A;  4W4U A;  3ZYU A; 
#chains in the Genus database with same CATH topology
 2KE1 A;  3FAN A;  3T9K A;  5HEL A;  5E0R A;  5A7C A;  4GND A;  3O35 A;  2Y1N A;  2WP1 A;  1WEQ A;  3SOW A;  5DFB A;  4Z0R A;  4AUQ B;  4YYI A;  5CQ8 A;  2KR4 A;  4A9J A;  5K29 A;  5E3D A;  3C5K A;  2KWK A;  2EOD A;  4TZ2 A;  3DWD A;  5HJC A;  2VJF A;  4PY6 A;  2L75 A;  5JG6 A;  4IOQ A;  2LGK A;  2YEK A;  3MQM A;  5L8T A;  4PCI A;  4TU6 A;  4Q0O A;  3P1F A;  4TT4 A;  4DON A;  2G45 A;  2L7P A;  2RNX A;  3FL2 A;  5L97 A;  5D7X A;  4AVX A;  5L98 A;  4QEW A;  5TCM A;  4UP5 A;  2KKY A;  3HMH A;  2PNX A;  5F2P A;  5TRB A;  5B77 A;  2KRE A;  1HYI A;  1F68 A;  3LJW A;  4MR3 A;  4IR4 A;  4O62 A;  2JM3 A;  2YHN A;  3DDT A;  4O7B A;  3ASL A;  3U5M A;  5FE7 A;  4AKH A;  5KU3 A;  5CQ6 A;  1WFK A;  4NR4 A;  3S91 A;  4CFL A;  5CUC A;  5F25 A;  5DYX A;  1HYJ A;  3ZTG A;  5EWD A;  1Z2Q A;  5DW1 A;  4N3W A;  2CRR A;  4IC2 A;  5LVR A;  2H0D A;  2VJE B;  2R10 A;  4QEV A;  2XB1 A;  3M63 A;  4FJC A;  3RPG C;  2DAT A;  2ECG A;  5KTW A;  3LDY A;  2L85 A;  1IYM A;  4YAD A;  4UYF B;  2ECV A;  4L58 A;  2KWN A;  3P5O A;  5D3L A;  3N9N A;  5TB6 A;  1Z6U A;  4FLP A;  5CQ5 A;  5EI4 A;  4A9E A;  1JOC A;  4BW3 A;  2K1J A;  5I1Q A;  1CHC A;  3GV4 A;  3UV4 A;  4QSX A;  2YUC A;  5E74 A;  3EB5 A;  5CQ4 A;  5EWC A;  4OGJ A;  2OUO A;  4J3I A;  2NAA A;  5E73 A;  3MUK A;  2RNW A;  5G0F A;  4GB0 A;  4LK9 A;  5A81 A;  4A4B A;  4LYS A;  4NXJ A;  4XUA A;  2LSP B;  4CUR A;  4CCG X;  5EWV A;  3M7K A;  4UIV A;  4E96 A;  5D3P A;  5II1 A;  3NXB A;  3MXF A;  2FFW A;  3U5P A;  5CUE A;  3GL6 A;  5I29 A;  4BW1 A;  3IHP A;  3KNV A;  5B76 A;  5L99 A;  5LKX A;  4NR8 A;  1BOR A;  1WEP A;  3V43 A;  4YBM A;  3FEH A;  5CUA A;  5DYC A;  4KCX A;  5BT4 A;  3UVY A;  2DVQ A;  5DKH A;  3S92 A;  5D0C A;  5CRM A;  4CL9 A;  2L43 A;  2XOZ A;  3C6W A;  5EA1 A;  4YBT A;  5D3N A;  5AME A;  4CUQ A;  3Q1D A;  5DIN A;  3T6R A;  1WEN A;  2LXH C;  3M62 A;  1VD4 A;  4QEU A;  2DVR A;  4MEQ A;  5ENG A;  4YYK A;  3DAI A;  4LZR A;  5SVY A;  5A5O A;  4CA1 A;  5C87 A;  4C9Z A;  2YQL A;  2Y43 A;  5ENH A;  5FE9 A;  5FFY A;  3ERR A;  3O33 A;  5FG5 A;  5H1V A;  4A4C A;  2D82 A;  2I8N A;  4LRG A;  3RTR B;  1RMD A;  2DX8 A;  4F52 B;  4YH3 A;  4NS5 A;  1WEV A;  5LVQ A;  4X3G A;  4MR5 A;  5F1H A;  2EGM A;  5EQ1 A;  5CQ3 A;  2FD4 A;  5AMF A;  2PUY A;  5HM0 A;  2LRI C;  3LXJ A;  2YDW A;  2QIC A;  4HXR A;  3ZPV E;  4J0R A;  4UIU A;  3PUR A;  4QSP A;  4QY4 A;  4QYD A;  1WUG A;  4TT6 A;  5KTU A;  4LC2 A;  3LQJ A;  4HXK A;  5EM3 A;  5D24 A;  2RSD A;  5ETD A;  3O36 A;  4QC3 A;  4QST A;  4MEN A;  2CKL B;  2JMJ A;  4A0C D;  5FG4 A;  4TT2 A;  5H1U A;  2EXU A;  3MHH A;  2H0D B;  1ZKR A;  5EVA A;  2VJE A;  3U5O A;  2VNF A;  5FG6 A;  1MM3 A;  4UIZ A;  2MD8 C;  4RVR A;  4UIW A;  2JUN A;  5EWW A;  5CQA A;  5A82 A;  4A9I A;  4YYN A;  3I2D A;  3M99 A;  4O78 A;  4HXN A;  5CGP A;  2CT2 A;  2M3H A;  4MEO A;  2YVR A;  2L5E A;  4QQ4 A;  2YQM A;  4O75 A;  5F60 A;  3MB4 A;  4YH4 A;  3UVW A;  5FE0 A;  2B0O E;  2VP7 A;  4QUT A;  2KTB B;  2I7K A;  4NUD A;  3FKM X;  5F36 A;  3L1X A;  4V3L C;  1MM2 A;  4YY4 A;  2LXP C;  4LKA A;  3G0J A;  5EP7 A;  3MDB C;  5SVI A;  2KWJ A;  5DFC A;  2G4A A;  4O74 A;  5H85 A;  2NXB A;  3K2J A;  3P1C A;  4A9H A;  5LUU A;  4LLB A;  4QUU A;  5CPE A;  1DVP A;  2LGG A;  5DFD A;  4QR3 A;  2E61 A;  5IID A;  2IQJ A;  4YAT A;  2R0S A;  2JMD A;  2KU3 A;  4Q6F A;  4H9D A;  5DX4 A;  4QSU A;  4QSV A;  5ACY A;  3UV2 A;  3MB3 A;  3Q2E A;  4A9L A;  5FE2 A;  2EGP A;  4NUC A;  3LRQ A;  3ZYQ A;  5I3L A;  5I80 A;  5D3R A;  2MJV B;  5E9Y A;  2MT5 A;  1WEE A;  5IGL A;  4NN2 A;  5G4R A;  4NYX A;  3U5K A;  4UI9 B;  1T1H A;  4YYH A;  4YAB A;  4PKL A;  5CUD A;  1PUO A;  5ENB A;  5HFQ A;  4QYL A;  2FSA A;  5F61 A;  2RS9 B;  4OGE A;  2MIQ A;  1X4U A;  3U5L A;  4TZ8 A;  4MR6 A;  4OGI A;  4Z93 A;  4L7X A;  5DKC A;  4NUE A;  5DBM A;  2LGV A;  4AYC B;  2DVV A;  1MBM A;  2I50 A;  4QF3 A;  5DY7 A;  4QSW A;  5I7X A;  3I3J A;  4Z1Q A;  2CSZ A;  3AQA A;  3TLP A;  2CKL A;  5FBX A;  4LAD B;  2DSM A;  4QBM A;  1U6G B;  2E6R A;  4A9F A;  5LKT A;  4AKG A;  4IOR A;  4KV4 A;  2C2V S;  5IBN A;  5HQ7 A;  5C11 A;  5D3T A;  5FDZ A;  3D1D A;  5F5Z A;  5ENI A;  2DKW A;  5DYU A;  5EU1 A;  5I89 A;  4IOO A;  3L11 A;  4XI1 A;  5EIC A;  5ENF A;  4I7C A;  4XY8 A;  4B7Y C;  2JRJ A;  1X0J A;  2XOC A;  5EIS A;  5FEY A;  5AIU A;  4XY9 A;  5EYA F;  4HXP A;  5CTL A;  3UV5 A;  1Z60 A;  5C8G A;  4AKI A;  2LGL A;  2OO1 A;  5FER A;  2HYE D;  3SVF A;  2YQD A;  4QR5 A;  3GG3 A;  2MNZ A;  4C67 A;  4UIY A;  5ETB A;  4N4I A;  1X4I A;  1E6I A;  2RI7 A;  5D1L B;  4F3I A;  4OGC A;  4IR3 A;  4O76 A;  3ZVY A;  4O70 A;  4ZDT A;  2LV9 A;  2UZG A;  4O7F A;  4YYG A;  4QR4 A;  5LKZ A;  3SOX A;  5CU8 A;  4N4F A;  2M85 A;  2G43 A;  5EPB A;  1WEM A;  5SVI B;  5EK9 A;  5ENC A;  4TYL A;  4QNS A;  3JVJ A;  5KTX A;  3JVM A;  1ZBD B;  5C89 A;  2CSV A;  4P5O B;  4B86 C;  1N87 A;  5CP5 A;  5FE4 A;  2LN0 A;  2P57 A;  2R0V A;  4IR5 A;  5E9K A;  5KO4 A;  2JMI A;  4ZC9 A;  4YYD A;  2GRC A;  5E7D A;  2QIZ A;  4WZ0 A;  4NR6 A;  4BBQ A;  3JVK A;  4CUP A;  2YHO A;  2LDR A;  4UYD A;  5DW2 A;  2K16 A;  2RO1 A;  2VPG A;  4FIP A;  5FB1 A;  5CQ7 A;  3O47 A;  3HME A;  5D26 A;  3JUE A;  5B78 A;  5D3S A;  5FE3 A;  3UVX A;  4WZ3 B;  2CON A;  4YYM A;  4J1P A;  4CUU A;  5F1L A;  5HRW A;  2E6S A;  2HDP A;  2M6M A;  4R2Y A;  5AIT A;  4MR4 A;  2VJF B;  5C85 A;  5EV9 A;  3DPL R;  4A9M A;  4A49 A;  4FK5 A;  3D1B A;  3O37 A;  4YBS A;  5CS8 A;  2DJA A;  3P1D A;  5SVX A;  1X4J A;  2VPB A;  4J0S A;  2F6N A;  5FE8 A;  4ZW1 A;  4BHW A;  1WUM A;  2LQ6 A;  4CLB A;  4QSS A;  3U5N A;  4O7E A;  5L96 A;  4AI6 A;  4YYJ A;  4AYC A;  2CSY A;  2G6Q A;  1F62 A;  2ECT A;  5FB0 A;  5DKD A;  1JM7 A;  4ZUX U;  4NR9 A;  2YRE A;  3O34 A;  4FO9 A;  5CY9 A;  2YUR A;  5A5N A;  3O70 A;  5EWH A;  3SHB A;  5COI A;  2N9G A;  4NYV A;  4N4G A;  1XWH A;  3DQV R;  4UP0 A;  3N9Q A;  5E9L A;  2IDA A;  3H7H A;  5HQ5 A;  2YT5 A;  5TAB A;  2YEM A;  5ENJ A;  4KV1 A;  4NRA A;  3KV5 A;  4A9O A;  2MA5 A;  3N9P A;  3DWY A;  4LYI A;  1DCQ A;  2E3K A;  5A5S A;  2MD7 B;  3O7A A;  4V3K C;  4MVT A;  3SVH A;  3AAD A;  5I83 A;  4GNF A;  4WZ2 A;  4R8P K;  4Z1S A;  2D8S A;  2KWO A;  4NQN A;  5J3X A;  1JM4 B;  4HXL A;  2YSM A;  3ZNI A;  5FE5 A;  5IGK A;  5I86 A;  2ECI A;  3L1Z B;  2YYR A;  4XYA A;  3T7L A;  2YSJ A;  3QZS A;  3Q2F A;  4HXS A;  4NR5 A;  3N9L A;  4TQN A;  4A9K A;  3MUL A;  4NRC A;  2ECN A;  2VPD A;  3PLW A;  4QF2 A;  5CRZ A;  4GNE A;  5ENE A;  4Z6H A;  5H9M A;  5CQT A;  5B75 A;  4UYF A;  4MSX A;  4IC3 A;  5KHM A;  2C2L A;  4CFK A;  3N9M A;  3LQH A;  5E9M A;  2CRW A;  5TDW A;  3D7C A;  5J0D A;  3FM8 C;  5D1K B;  1WIL A;  4NR7 A;  5F62 A;  4TKP B;  3LQI A;  4ALG A;  1VFY A;  2XOY A;  2KGG A;  2KFT A;  2K4D A;  3ONI A;  2E7O A;  5F3A A;  2FUI A;  5FH6 A;  2KYU A;  4QSR A;  4HBX A;  2YEL A;  4NRB A;  1WE9 A;  5LJ0 A;  5LJ1 A;  4R7E A;  1EQF A;  2H60 A;  5CZG A;  5DYA A;  5LJ2 A;  2OWA A;  4OUF A;  2L5U A;  3E2D A;  4O72 A;  2K17 A;  5II2 A;  1V87 A;  2F6J A;  3QZT A;  2YW8 A;  5D25 A;  1WES A;  4O7A A;  4HXM A;  3HCS A;  4Y03 A;  5FFW A;  4HBY A;  5I40 A;  2RNY A;  4O71 A;  4WA6 A;  5EPS A;  5A85 A;  5C7N A;  4QZS A;  5TDR A;  4F1P A;  5KH7 A;  4HBV A;  2Y1M A;  2RFJ A;  1G25 A;  5E9V A;  5HCL A;  2AN6 A;  4O77 A;  3HCU A;  4NQM A;  4PS5 A;  5BT3 A;  1WEO A;  2OSS A;  1K2F A;  2L0B A;  5G04 B;  3PUQ A;  5I88 A;  4BW4 A;  5G4S A;  1ZS5 A;  4CUS A;  3NG2 A;  4YAX A;  4S3O B;  5HQ6 A;  1JM7 B;  5C13 A;  4ALH A;  4LDF A;  2KIZ A;  5A5Q A;  5HRX A;  4I7B A;  1E4U A;  2OXQ C;  1FBV A;  4LYW A;  5BT5 A;  3LJU X;  3PHD A;  2DVS A;  4XUB A;  2M13 A;  5B79 A;  2KGI A;  4N4H A;  3N9O A;  1LDK C;  3VKH A;  5E9I A;  4LR6 A;  2F42 A;  4UYE A;  5HEM A;  5LCW B;  2DWW A;  2L80 A;  4AP4 A;  3JVL A;  1WIM A;  2D9E A;  5IGM A;  3VK6 A;  4LJN A;  2KKX A;  2E7N A;  4C66 A;  3RCW A;  5H1T A;  1VYX A;  4WIV A;  5K3Q A;  2EJN A;  4BJX A;  4BW2 A;  5A5P A;  4O64 A;  4HXO A;  5DLX A;  2BAY A;  4YC9 A;  5L8U A;  2FUU A;  4WHW A;  2YU4 A;  5D3H A;  2D8U A;  5D3J A;  3UVD A;  1FP0 A;  3SUB A;  4UYH A;  4Q0N A;  2QJ0 A;  4TS8 A;  3VKG A;  2R0Y A;  4ZQL A;  4Z6I A;  3KQI A;  3SOU A;  5JWM A;  3RPG B;  2ECJ A;  3SVG A;  2VPE A;  5AD2 A;  5KH3 A;  4QB3 A;  4LZS A;  5FFV A;  3P1E A;  2YYN A;  4TU4 A;  3KV6 A;  1WEW A;  2LAU A;  4CUT A;  3KDE C;  4YK0 A;  4UIT A;  5F63 A;  4YY6 A;  5G05 B;  4X2I A;  3EB6 A;  5HRV A;  5D1M B;  3ZPV 1;  5TBN A;  4HBW A;  1N72 A;  5DKA A;  4UIX A;  5DLZ A;  5AD3 A;  3FJU B;  1LDJ B;  5HLS A;  5IG6 A;  2MKE A;  5FE6 A;  2EA6 A;  3IU6 A;  5EPR A;  5C4Q A;  3HTK C;  5HEN A;  3ZVZ B;  2MNY A;  4GNG A;  5CUG A;  3FAO A;  4PPE A;  1JSP B;  4O7C A;  3HMF A;  3QZV A;  5LKU A;  1WEU A;  2WP2 A;  4WHU A;  5B8D A;  5CUB A;  3LVR E;  3IU5 A;  4QC1 A;  2M1R A;  4NYW A;  5HFR A;  2YW5 A;  3MHS A;  2MA6 A;  5FH8 A;  3HCT A;  2L84 A;  2ECW A;  4LZ2 A;  3UW9 A;  4S3O C;  5FH7 A;  3LVQ E;  4QSQ A;  5E3G A;  5CFW A;  4PCE A;  4Z0O A;  5EGU A;  5I7Y A;  5JI8 A;  4AKN A;  4GPJ A;  5IGN A;  3U5J A;  4TTE A;  2RR4 A;  5KH9 A;  2XP0 A;  2ZET C;  2XEU A;  2MUM A;  3G0L A;  4IR6 A;  4PTB A;  5FE1 A;  1WGM A;  5A5R A;  4I7D A;  5A83 A;  4A9N A;  4UYG A;  4MEP A;  4W4U A;  3ZYU A; 
#chains in the Genus database with same CATH homology
 2KE1 A;  5HEL A;  5E0R A;  5A7C A;  4GND A;  3O35 A;  2Y1N A;  2WP1 A;  1WEQ A;  3SOW A;  5DFB A;  4AUQ B;  4YYI A;  5CQ8 A;  2KR4 A;  4A9J A;  5K29 A;  5E3D A;  3C5K A;  2KWK A;  2EOD A;  4TZ2 A;  5HJC A;  2VJF A;  4PY6 A;  2L75 A;  5JG6 A;  4IOQ A;  2LGK A;  2YEK A;  3MQM A;  5L8T A;  4PCI A;  4TU6 A;  4Q0O A;  3P1F A;  4TT4 A;  4DON A;  2G45 A;  2RNX A;  3FL2 A;  5L97 A;  5D7X A;  4AVX A;  5L98 A;  4QEW A;  5TCM A;  4UP5 A;  3HMH A;  2PNX A;  5F2P A;  5TRB A;  5B77 A;  2KRE A;  1HYI A;  1F68 A;  3LJW A;  4MR3 A;  4IR4 A;  2YHN A;  4O7B A;  3ASL A;  3U5M A;  5FE7 A;  5KU3 A;  5CQ6 A;  1WFK A;  4NR4 A;  3S91 A;  4CFL A;  5CUC A;  5F25 A;  5DYX A;  1HYJ A;  3ZTG A;  5EWD A;  1Z2Q A;  5DW1 A;  4N3W A;  4IC2 A;  5LVR A;  2H0D A;  2VJE B;  2R10 A;  4QEV A;  2XB1 A;  3M63 A;  4FJC A;  3RPG C;  2DAT A;  2ECG A;  5KTW A;  1IYM A;  2L85 A;  4YAD A;  4UYF B;  2ECV A;  4L58 A;  2KWN A;  3P5O A;  5D3L A;  3N9N A;  5TB6 A;  1Z6U A;  4FLP A;  5CQ5 A;  5EI4 A;  4A9E A;  1JOC A;  4BW3 A;  2K1J A;  5I1Q A;  1CHC A;  3GV4 A;  3UV4 A;  4QSX A;  2YUC A;  5E74 A;  3EB5 A;  5CQ4 A;  5EWC A;  4OGJ A;  2OUO A;  4J3I A;  2NAA A;  5E73 A;  3MUK A;  2RNW A;  5G0F A;  4GB0 A;  4LK9 A;  5A81 A;  4A4B A;  4LYS A;  4NXJ A;  4XUA A;  2LSP B;  4CUR A;  4CCG X;  5EWV A;  4UIV A;  4E96 A;  5D3P A;  5II1 A;  3NXB A;  3MXF A;  3U5P A;  5CUE A;  3GL6 A;  5I29 A;  4BW1 A;  3IHP A;  3KNV A;  5B76 A;  5L99 A;  5LKX A;  4NR8 A;  1BOR A;  1WEP A;  3V43 A;  4YBM A;  5CUA A;  5DYC A;  4KCX A;  5BT4 A;  3UVY A;  2DVQ A;  5DKH A;  3S92 A;  5D0C A;  5CRM A;  4CL9 A;  2L43 A;  3C6W A;  5EA1 A;  4YBT A;  5D3N A;  5AME A;  4CUQ A;  5DIN A;  3T6R A;  1WEN A;  2LXH C;  3M62 A;  1VD4 A;  4QEU A;  2DVR A;  4MEQ A;  5ENG A;  4YYK A;  3DAI A;  4LZR A;  5A5O A;  4CA1 A;  5C87 A;  4C9Z A;  2YQL A;  2Y43 A;  5ENH A;  5FE9 A;  5FFY A;  3O33 A;  5FG5 A;  5H1V A;  4A4C A;  2D82 A;  2I8N A;  4LRG A;  3RTR B;  1RMD A;  2DX8 A;  4F52 B;  4YH3 A;  4NS5 A;  1WEV A;  5LVQ A;  4X3G A;  4MR5 A;  5F1H A;  5EQ1 A;  5CQ3 A;  2PUY A;  5AMF A;  5HM0 A;  2LRI C;  3LXJ A;  2YDW A;  2QIC A;  4HXR A;  3ZPV E;  4J0R A;  4UIU A;  3PUR A;  4QSP A;  4QY4 A;  4QYD A;  1WUG A;  4TT6 A;  5KTU A;  4LC2 A;  3LQJ A;  4HXK A;  5EM3 A;  5D24 A;  2RSD A;  5ETD A;  3O36 A;  4QC3 A;  4QST A;  4MEN A;  2CKL B;  2JMJ A;  4A0C D;  5FG4 A;  4TT2 A;  5H1U A;  3MHH A;  2H0D B;  5EVA A;  2VJE A;  3U5O A;  2VNF A;  5FG6 A;  1MM3 A;  4UIZ A;  2MD8 C;  4RVR A;  4UIW A;  5EWW A;  5CQA A;  5A82 A;  4A9I A;  4YYN A;  3I2D A;  3M99 A;  4O78 A;  4HXN A;  5CGP A;  2CT2 A;  2M3H A;  4MEO A;  2L5E A;  2YQM A;  4O75 A;  5F60 A;  3MB4 A;  4YH4 A;  3UVW A;  5FE0 A;  2VP7 A;  3L1X A;  4QUT A;  2KTB B;  2I7K A;  4NUD A;  3FKM X;  5F36 A;  4V3L C;  1MM2 A;  4YY4 A;  2LXP C;  4LKA A;  3G0J A;  5EP7 A;  2KWJ A;  5DFC A;  2G4A A;  4O74 A;  5H85 A;  2NXB A;  3K2J A;  3P1C A;  4A9H A;  5LUU A;  4LLB A;  4QUU A;  5CPE A;  1DVP A;  2LGG A;  5DFD A;  4QR3 A;  5IID A;  4YAT A;  2R0S A;  2JMD A;  2KU3 A;  4Q6F A;  5DX4 A;  4QSU A;  4QSV A;  5ACY A;  3UV2 A;  3MB3 A;  3Q2E A;  4A9L A;  5FE2 A;  2EGP A;  4NUC A;  3LRQ A;  3ZYQ A;  5I3L A;  5I80 A;  5D3R A;  2MJV B;  5E9Y A;  2MT5 A;  1WEE A;  5IGL A;  4NN2 A;  5G4R A;  4NYX A;  3U5K A;  4UI9 B;  1T1H A;  4YYH A;  4YAB A;  4PKL A;  5CUD A;  5ENB A;  5HFQ A;  4QYL A;  2FSA A;  5F61 A;  2RS9 B;  2MIQ A;  1X4U A;  3U5L A;  4TZ8 A;  4MR6 A;  4OGI A;  4Z93 A;  4L7X A;  5DKC A;  4NUE A;  5DBM A;  2LGV A;  4AYC B;  2DVV A;  2I50 A;  4QF3 A;  5DY7 A;  4QSW A;  5I7X A;  3I3J A;  4Z1Q A;  2CSZ A;  3AQA A;  3TLP A;  2CKL A;  5FBX A;  4LAD B;  4QBM A;  1U6G B;  2E6R A;  4A9F A;  5LKT A;  4IOR A;  4KV4 A;  2C2V S;  5IBN A;  5HQ7 A;  5C11 A;  5D3T A;  5FDZ A;  5F5Z A;  5ENI A;  2DKW A;  5DYU A;  5EU1 A;  5I89 A;  4IOO A;  3L11 A;  4XI1 A;  5EIC A;  5ENF A;  4I7C A;  4XY8 A;  4B7Y C;  2JRJ A;  1X0J A;  5EIS A;  5FEY A;  5AIU A;  4XY9 A;  5EYA F;  4HXP A;  5CTL A;  3UV5 A;  1Z60 A;  5C8G A;  2LGL A;  2OO1 A;  5FER A;  2HYE D;  3SVF A;  2YQD A;  4QR5 A;  3GG3 A;  2MNZ A;  4C67 A;  4UIY A;  5ETB A;  4N4I A;  1X4I A;  1E6I A;  2RI7 A;  5D1L B;  4F3I A;  4IR3 A;  4O76 A;  3ZVY A;  4O70 A;  4ZDT A;  2LV9 A;  2UZG A;  4O7F A;  4YYG A;  4QR4 A;  5LKZ A;  3SOX A;  5CU8 A;  4N4F A;  2M85 A;  2G43 A;  5EPB A;  1WEM A;  5EK9 A;  5ENC A;  4TYL A;  4QNS A;  3JVJ A;  5KTX A;  3JVM A;  1ZBD B;  5C89 A;  4P5O B;  4B86 C;  1N87 A;  5CP5 A;  5FE4 A;  2LN0 A;  2R0V A;  4IR5 A;  5E9K A;  5KO4 A;  2JMI A;  4ZC9 A;  4YYD A;  2GRC A;  5E7D A;  2QIZ A;  4WZ0 A;  4NR6 A;  4BBQ A;  3JVK A;  4CUP A;  2YHO A;  2LDR A;  4UYD A;  5DW2 A;  2K16 A;  2RO1 A;  2VPG A;  4FIP A;  5FB1 A;  5CQ7 A;  3HME A;  5D26 A;  5B78 A;  5D3S A;  5FE3 A;  3UVX A;  4WZ3 B;  4YYM A;  4J1P A;  4CUU A;  5F1L A;  5HRW A;  2E6S A;  2HDP A;  2M6M A;  4R2Y A;  5AIT A;  4MR4 A;  2VJF B;  5C85 A;  5EV9 A;  3DPL R;  4A9M A;  4A49 A;  4FK5 A;  3O37 A;  4YBS A;  5CS8 A;  3P1D A;  1X4J A;  2VPB A;  4J0S A;  2F6N A;  5FE8 A;  4ZW1 A;  4BHW A;  1WUM A;  2LQ6 A;  4CLB A;  4QSS A;  3U5N A;  4O7E A;  5L96 A;  4YYJ A;  4AYC A;  2CSY A;  2G6Q A;  1F62 A;  2ECT A;  5FB0 A;  5DKD A;  1JM7 A;  4ZUX U;  4NR9 A;  2YRE A;  3O34 A;  4FO9 A;  5CY9 A;  2YUR A;  5A5N A;  3O70 A;  5EWH A;  3SHB A;  5COI A;  2N9G A;  4NYV A;  4N4G A;  1XWH A;  3DQV R;  4UP0 A;  3N9Q A;  5E9L A;  2IDA A;  5TAB A;  5HQ5 A;  2YT5 A;  2YEM A;  5ENJ A;  4KV1 A;  4NRA A;  3KV5 A;  4A9O A;  2MA5 A;  3N9P A;  3DWY A;  4LYI A;  2E3K A;  5A5S A;  2MD7 B;  3O7A A;  4V3K C;  4MVT A;  3SVH A;  3AAD A;  5I83 A;  4GNF A;  4WZ2 A;  4R8P K;  4Z1S A;  2D8S A;  2KWO A;  4NQN A;  5J3X A;  1JM4 B;  4HXL A;  2YSM A;  3ZNI A;  5FE5 A;  5IGK A;  5I86 A;  2ECI A;  3L1Z B;  2YYR A;  4XYA A;  3T7L A;  2YSJ A;  3QZS A;  3Q2F A;  4HXS A;  4NR5 A;  3N9L A;  4TQN A;  4A9K A;  3MUL A;  4NRC A;  2ECN A;  2VPD A;  4QF2 A;  5H9M A;  5CRZ A;  4GNE A;  5ENE A;  4Z6H A;  5B75 A;  5CQT A;  4UYF A;  4MSX A;  4IC3 A;  5KHM A;  2C2L A;  4CFK A;  3N9M A;  3LQH A;  5E9M A;  5TDW A;  3D7C A;  5J0D A;  5D1K B;  1WIL A;  4NR7 A;  5F62 A;  4TKP B;  3LQI A;  4ALG A;  1VFY A;  2KGG A;  2KFT A;  2K4D A;  3ONI A;  2E7O A;  5F3A A;  2FUI A;  5FH6 A;  2KYU A;  4QSR A;  4HBX A;  2YEL A;  4NRB A;  1WE9 A;  5LJ0 A;  5LJ1 A;  4R7E A;  1EQF A;  2H60 A;  5CZG A;  5DYA A;  5LJ2 A;  4OUF A;  2L5U A;  4O72 A;  2K17 A;  5II2 A;  1V87 A;  2F6J A;  3QZT A;  2YW8 A;  5D25 A;  1WES A;  4O7A A;  4HXM A;  3HCS A;  4Y03 A;  5FFW A;  4HBY A;  5I40 A;  2RNY A;  4O71 A;  4WA6 A;  5EPS A;  5A85 A;  5C7N A;  4QZS A;  5TDR A;  5KH7 A;  4HBV A;  2Y1M A;  2RFJ A;  1G25 A;  5E9V A;  5HCL A;  2AN6 A;  4O77 A;  3HCU A;  4NQM A;  4PS5 A;  5BT3 A;  1WEO A;  2OSS A;  1K2F A;  2L0B A;  5G04 B;  3PUQ A;  5I88 A;  4BW4 A;  5G4S A;  1ZS5 A;  4CUS A;  3NG2 A;  4YAX A;  4S3O B;  5HQ6 A;  1JM7 B;  5C13 A;  4ALH A;  4LDF A;  2KIZ A;  5A5Q A;  5HRX A;  4I7B A;  1E4U A;  2OXQ C;  1FBV A;  4LYW A;  5BT5 A;  3PHD A;  2DVS A;  4XUB A;  5B79 A;  2KGI A;  4N4H A;  3N9O A;  1LDK C;  5E9I A;  4LR6 A;  2F42 A;  4UYE A;  5HEM A;  5LCW B;  2DWW A;  2L80 A;  4AP4 A;  3JVL A;  1WIM A;  2D9E A;  5IGM A;  3VK6 A;  4LJN A;  2E7N A;  4C66 A;  3RCW A;  5H1T A;  1VYX A;  4WIV A;  4BJX A;  4BW2 A;  5A5P A;  4O64 A;  4HXO A;  5DLX A;  2BAY A;  4YC9 A;  5L8U A;  2FUU A;  4WHW A;  2YU4 A;  5D3H A;  5D3J A;  3UVD A;  1FP0 A;  4UYH A;  4Q0N A;  2QJ0 A;  4TS8 A;  2R0Y A;  4ZQL A;  4Z6I A;  3KQI A;  3SOU A;  5JWM A;  3RPG B;  2ECJ A;  3SVG A;  2VPE A;  5AD2 A;  5KH3 A;  4QB3 A;  4LZS A;  5FFV A;  3P1E A;  2YYN A;  4TU4 A;  3KV6 A;  1WEW A;  4CUT A;  4YK0 A;  4UIT A;  5F63 A;  4YY6 A;  5G05 B;  4X2I A;  3EB6 A;  5HRV A;  5D1M B;  3ZPV 1;  5TBN A;  4HBW A;  1N72 A;  5DKA A;  4UIX A;  5DLZ A;  5AD3 A;  1LDJ B;  5HLS A;  5IG6 A;  5FE6 A;  2EA6 A;  3IU6 A;  5EPR A;  5C4Q A;  3HTK C;  5HEN A;  3ZVZ B;  2MNY A;  4GNG A;  5CUG A;  4PPE A;  1JSP B;  4O7C A;  3HMF A;  3QZV A;  5LKU A;  1WEU A;  2WP2 A;  4WHU A;  5B8D A;  5CUB A;  3IU5 A;  4QC1 A;  2M1R A;  4NYW A;  5HFR A;  2YW5 A;  3MHS A;  2MA6 A;  5FH8 A;  3HCT A;  2L84 A;  2ECW A;  4LZ2 A;  3UW9 A;  4S3O C;  5FH7 A;  4QSQ A;  5E3G A;  5CFW A;  4PCE A;  5EGU A;  5I7Y A;  5JI8 A;  4AKN A;  4GPJ A;  5IGN A;  3U5J A;  4TTE A;  5KH9 A;  2ZET C;  2XEU A;  2MUM A;  3G0L A;  4IR6 A;  4PTB A;  5FE1 A;  1WGM A;  5A5R A;  4I7D A;  5A83 A;  4A9N A;  4UYG A;  4MEP A;  4W4U A;  3ZYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...