2FSDA

A common fold for the receptor binding domains of lactococcal phages? the crystal structure of the head domain of phage bil170
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
b'DIPWTDLNRASGVGSTGILQARIINGVIYVRGNSIPVPNVAPNFIVPVGTFPPAFGTNLPQFDSSGTFYSHGNLSLSLINMSPSGIAVGNPNNTSMNGKTISFALSAPLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative baseplate protein
publication title Crystal Structure of the Receptor-Binding Protein Head Domain from Lactococcus lactis Phage bIL170
pubmed doi rcsb
source organism Unidentified phage
molecule tags Viral protein
total genus 19
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2460 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fsdA00
2FSDA
chains in the Genus database with same CATH superfamily
5HGBA 1KN4L 4ODTH 3WSQH 4LCUB 3W0WD 4M00A 4FMVA 1KBKA 3CVHH 4J4PD 2PN5A 5IJCC 7PAZA 1Q9LA 1S9VB 2UWEF 4YBQD 3WLBA 5F6IB 3BPNB 5HYQB 4ODXA 4F7EB 3DC0A 4ERSH 3EO9H 8FABB 2AXWA 4PI2A 1HI6A 2Y07H 3P4NB 1GS7A 1L9OA 1E27B 3S37L 1QQDA 1Z0MA 2GJZA 3ZJAA 2G2PA 2X5PA 2NPLX 4EMZA 4LE8A 4DAGH 4JPIA 3DO4A 1CE6B 4Y2OB 4P57B 1YEFL 2ROXA 4MJ6B 1C1EL 2FWUA 3LKRA 4JG0H 5DVPA 4AC2A 1TOXA 1NBYB 3GMOB 3M8OL 4Z76B 3PFQA 5AW3B 3B3IB 1Z5HA 2Z7WA 4C56B 1FPTH 1AR1D 3RIAK 3KCPA 5TFSH 4WGKA 4AIXA 4F9LC 4ZNCD 1FZMB 2X4TA 3BGMB 3SPIA 1T7XA 4YXKL 4IQHA 3SDAA 2NXYB 4IRZA 3QFJD 5KYXA 2AXJA 3LRGA 5DUBB 2J2ZA 2VLKD 2WIIB 3PIQB 4MB3A 1EPFA 4HUCA 4QYOB 5HDBF 1EMTL 4HKBA 2CO2A 4I13B 1AC0A 1OANA 2VIRB 3QHTC 4LOUD 4XN5A 3KBEA 5JIDA 1F45A 4JE0A 4Z7WB 5GRYA 5TF0A 2YRBA 2AI0L 3PU7A 5TDNA 1R46A 2VRAA 3QWQB 1MJUL 2J56A 4QAWA 3QIWA 5DMIL 1G43A 4CBPA 3CX5K 1ZA6A 2ITCA 1QUPA 3VXNB 2XYBA 5HGAB 4LGPB 1QWNA 1BZQK 2NZ9C 3PG2A 3MRHA 2WINB 4JDTH 1GJUA 2QJDA 1A65A 5IMOA 2Z8RA 2H7WA 4FJ6A 4PRBA 1TZGL 4NQQA 4KKBD 1JV5B 4ANVA 3MFFB 3TPUB 1PEZA 3VQ1C 4PREA 2ZOOA 2IO5A 3FH8A 3VXQA 5L2KA 3LV3A 2D03H 3O6LL 5HI3D 2F54D 3O81A 3IAPA 4QHNA 2M8XA 5HVGB 1Z9NA 4GUPB 4IOSA 3X13B 1T20B 4P46D 3W9DA 2Q3AA 4PR5A 2G2RA 2Z8SA 3KYNA 4HJ0D 1KB3A 2GYSA 4S10A 2VDLB 2E4TA 3QISA 4HJGB 4WSKA 4X8JA 1O6SB 3KXFD 3RGVB 3WL9A 5L9DH 3LTVA 1W2KT 1IC4L 1M7UA 2YAEA 2WLIA 3D0LA 2D9CA 4LMQI 1UM4H 1P6WA 2LV4A 3DMMD 1DDHA 4IHOA 5MEOA 3BE1L 5DMGD 4KDVA 4XB3A 3ARSA 3D05A 8PAZA 2H6OA 2D0HA 5C3TA 4E9VA 3HNVH 5K33A 1ZT4B 3FRPB 4WI6A 3ARQA 4KZEH 3FO0L 3MBWA 4WTZG 4DKTA 5ENWA 2FT7A 2Q8AL 1AE6L 3E3QC 5GSRB 1CLVA 1E7UA 2MEJB 2P5EE 4NWTH 1QD0A 3QEHB 4BRJA 1AVAA 4KI1A 2DD8L 4H88H 2XZQH 2R1XA 3KYMB 1CE1L 4Y9CA 3BKYH 1OK0A 1A1OA 2QGEA 3FQWB 4RVBA 2FATL 4P07A 4YH6A 1ZHBA 2I07B 3UADA 4UQ3A 2P8MA 3VFGH 1CLZL 2COQA 2AHIA 4JRXA 5AL0A 2VISB 3K6SA 4TQ8A 5BZWB 5GS0H 2E27L 1WBZA 5GS0C 4RSYA 2XFXA 2DLFL 2XYCA 3ARDD 3KM1A 3UJIL 3DX9B 4Q9QL 1ET5A 3UJTL 3LEYH 1OV8A 4ELMA 4URTB 4D8PB 4B7IA 3A6BH 5FDYA 1G9HA 2FJGA 3G6DL 1INQB 1NDMA 3B9DA 4KJQD 5FLVA 4PRHD 4WKXA 3L7FA 3ZTCC 4B97A 2V5YA 1DJWA 3KNBA 1PZ5A 4LSVH 1AGFB 1NWPA 1XF5B 3MAWA 2FEDD 1KPRB 3C8DA 3DHMA 2BSTB 3TYFA 2W59A 1VDGA 5IHZB 3VFSB 5D9SA 3X3GH 4GAGL 1BJMA 2EIBA 5E1QA 1WHPA 1DUZB 5J06A 1CG9B 4TUOA 1TITA 4C56D 1OT1A 3SD5A 3ARFA 2RTTA 3WNOA 1OAUH 1KJMA 1ODUA 3CIAA 4TNEA 4UM8A 3ME0A 2WNGA 4X98B 1M57B 5DQ9B 5EDXA 5DYFA 2NXYD 4S1DD 4Y5VC 4ZQTA 2FYYB 3PDOB 4JFFE 1U91A 4IMLA 3V4LA 2ZTBA 1DVUA 2JXMB 4N1CA 2J1ZA 3O2DH 2AMUA 4EN2A 3MX0B 2KPNA 4HXAL 1TXKA 4JEGB 2NY1C 1B9ZA 1BMGA 1LO4L 2F08A 2OCJA 1YJDL 5TQ0L 3G6JF 3MXWH 1SVZA 2JTDA 4L8BA 5T1KA 3ATBA 3AITA 5EDSA 3IAGC 4H20H 5I5IA 2EILB 4NWUH 2EUWA 2FK9A 2F7IA 3IDNB 4PCSA 4X83A 4XNMB 3VFOA 2P45B 4JQIA 4UQ9A 4HJTA 1KG0B 1G7LB 1XVSA 2VUOA 3V2AR 1TKWA 1YQVH 2NUTB 1NGPL 3AREA 4XCEB 5DEJA 2IGTA 1GW0A 3Q2LA 5FKAB 3U7WL 2EIJB 1FLRL 3HRZB 3KLKA 3GIZL 3OXRA 3BESR 4NOBA 1NFKA 2GCYA 4YFLF 4U2YA 4HF5L 2J88L 4YGVB 5CBEA 1T03H 4Y5XC 3HUJB 5DC2A 2CJ3A 1QR1B 4Z7UA 5E9NA 2VXUH 1QEXA 3DWTA 1OAQL 3IJYA 4MAUL 3FQYA 2R29A 1JGLL 1HIMH 3FKUS 5C92A 1OHZA 1XXDC 4GKNB 4L8SC 4EJ1C 2AV1A 2GQHA 2Y36H 3MRPA 4OD2B 2XZAH 3FYIB 3OLDA 4RFOL 4YL4A 2B0SL 5C2BH 2GPZA 5AAMC 4YZFF 3RGVD 1Q72H 3MMEB 3QQ4A 4S1QL 4V2CB 1VCBC 2WWMC 2E74C 3UTQA 3VYNA 1A7OH 2X1WL 4KO6A 5KVGH 3IDIB 1N0XL 1QWUA 5IESL 5HGHA 1P9MA 2GSGB 4P3CH 5BQ7B 1ZDSA 4LLUA 5GGTL 3UFIA 4KQ0A 5E95B 4LAQL 3CBJB 3UAJA 3RNQA 1IC1A 3ZHFA 5C0GB 1J0HA 2X7LA 2HN7B 4JFFB 4BUGA 4XOAA 5JO5B 5B38A 1S7TA 5CZXD 1OM9A 4XXWA 2F8XC 3PABB 4XOEA 4XVSL 3WMSA 1MFDL 3GSWB 1PZ3A 5TDPA 4AGOA 1H3TA 4HPYL 3OKKA 1EGJL 3H4HA 4FFYL 1HHGB 2YGNA 15C8L 1L9TA 3QXTA 5T3XE 1JZ8A 1OW0A 1QSZA 3FB6A 3OG4B 2AK4A 2Q7AA 3HS0C 5CGYD 1HL4A 5MEND 1E6JL 1A6WH 1T22B 3IB4A 1J1OL 3NABH 5LG1A 4DKEL 5LQBL 1BVLA 4UANA 2H5UA 2OFQA 3C2AH 3VXME 4X4YB 3IRZA 5J4MA 4MJ5B 4PJHF 1NLDH 4HVBA 1L3WA 5JA9A 3STZB 1QYGH 2P5WE 1QFWL 3DGGA 3FMGL 3X1NA 2BSRB 2YRZA 4JKLA 4L4TA 5JIKA 2WO2B 3GJFA 3RHWK 4XNBA 2YFNA 4JKPL 1OF0A 3NFPA 1A1MB 4OB5L 4N0CD 2HFEA 4TXVB 5KZCD 2LAGB 3P77A 2VLRB 4PJ5B 4YFDB 4K73A 5JPMC 1PSKH 3US1A 4N9OB 3MBXH 5DHVB 4APXB 4XNAA 2DH3A 2K45A 4FLOA 4HHAA 4NM8H 3TBVB 2IQ9L 5JQ6H 2DI8A 3N85L 1FYTA 4PV9A 5DD0H 2F9BT 1M05B 2EH7L 3C60B 2ZF9A 4QHPA 1YVLA 3NSJA 4JZJC 3O9WC 3BPCB 4IDLA 5IK3A 3K8LA 4X6BB 3WFBH 1BP3B 2MHAB 1CPUA 3QUXC 4HIJA 5DJXB 3HCVB 2WSPA 3N41B 3FDWA 4HCGA 3U1SH 2OMYB 1E40A 3DDGA 2RACA 1CTOA 4YHLL 2UY6A 4R96B 3VXSD 2V17H 4UYQA 2KZWA 4GY4A 5DS8B 1A4BA 4F20A 2EYSA 4PMFA 1CQYA 3QNXB 5FCSH 3HB3D 1E42A 4P23B 3P11H 4QXVA 1XCQA 3VCLB 5HHQB 3KPTA 3VTMA 3PWPE 4JM2C 5FECA 2YA2A 1VEOA 3WEOA 1NGXA 5DFTA 2OYKA 1U8QA 4TNVF 5LBSA 3ARBA 1TENA 3OSVA 4IIZA 2UXGA 3QXAB 4GRMA 5HTSA 1CGWA 3ZL1A 3HHSB 1J0ZA 3DBXB 3A47A 1ZS8A 2GJ6A 4Z7VA 3ZDXB 4XO9A 3QHZH 1CC3A 1CJYA 3SDXF 1TQCB 3PWNB 2EE2A 2E8YA 2W5PA 3V0DA 3Q05A 4G42A 3LZNA 2NX5E 1TQTA 4BE6A 3CBKB 2P5WB 3WMPA 4QRUB 3ZTEA 5I1AB 5GRJH 1CFSA 2C9SA 3S4SG 1AKJB 4V2BA 3SDDA 2PLTA 4DGIL 3WU1A 3WUWG 3L48A 5KYWA 4HXBH 5INCA 1YZZA 1PY0A 5C7XL 3KBFA 3H9SB 4DTGH 5IEHB 2JJTA 4CVXA 4XGZB 2EO9A 3N1MC 1YEGH 1N5YL 1UH3A 4OQTA 4WUUA 4PJAA 4U4IA 4XAWL 2AQ1A 1UEYA 5GGVH 3MUGA 1KB9J 1MCWM 2FHBA 3AWFA 4LEBA 1JXDA 4A7GA 3QIUC 2OM5A 5TK4A 1JZFA 4R5XA 2OMBA 2BZCA 43CAB 5J3HD 4X50A 2BVOB 2A9BA 3DI2B 3QA3A 3BVVA 3NSFA 1X5GA 5EIIB 1JDDA 4TM9A 2AXGB 1KIPB 3RIAF 2NQDA 1SF5A 3PGDA 4DN3L 4Z7OF 4Z23A 4HZLA 7FABH 4MS8D 5ETUA 5EZOL 3MRNA 4K15A 1MLBB 2D7OA 3RVWC 4BUHA 3N2JA 2ICWI 2NNCA 5J13B 1RZGB 4NP4L 3BKMH 1C16B 3NFNB 4XP4L 3VI3E 3WMQA 1YMME 1J8RA 3NCEB 4DKAA 2FHCA 4LBAA 1KT2B 4OZIB 3EOBB 2VLLA 1BGXL 3PWPB 3SPVA 3CPUA 1HILA 1GW6A 1TTFA 3LXAA 3O3AA 4G1EA 5E9DB 3U4KA 4XMTA 4A2HA 1F4XH 1ND0A 2Y22A 2VXVH 2B5IC 5ISZB 5K9JH 2OJEB 1KTLA 2XV2A 4NBXB 5IF0A 2E56A 2HFGL 1IGJB 2VMJA 1A22B 4OJAA 2J4WL 3PWUA 4EKJA 3ML8A 4AQAB 2YJLA 2DQDH 1N59B 1RK0B 2Q76B 2XRAL 4HUVB 3G04A 1TVBA 4DK5A 2QGDA 1EBAA 2ZUWA 4HHGA 4KTGA 4NPYB 1KJ3L 1NGZB 5AALA 4FFTA 4XC3L 2VLRD 3IXAB 4PJ5D 4ZAKB 3WD5H 3IM1A 4HS6B 1YNKH 4GW5B 4U3SB 5EEXA 4M1GH 1UD5A 3KVQA 2A73A 2RGSA 4HMDA 4PGEB 5B1JC 1D3CA 4L4VE 5AYQA 1ADQL 2YD0A 4ZUVB 4B9GA 2VQ4A 4NEHB 1TTCA 4UDUA 3ETTA 4RFEB 2CALA 2D7TH 4RESB 1UJ3C 4ABUA 2O4EA 3FXIC 4O58L 4CGUB 2WQSA 2ZXDA 5HJDA 5AB1A 3POCA 4I9WE 1B2YA 1FF5A 2GY5A 2V3FA 1OF2B 2VR6A 2C1OB 3BP5B 3BGAA 3FU3A 3F58H 3DV6A 4OT1L 1S7XA 4AMXA 5CMAA 5AVYB 1CT8B 5HYEA 4PJEB 1SHXA 1X7SA 2AJZA 1KDJA 1EJOH 4LCYB 4MA1C 4XMLL 1HHIA 2ZT9C 3EYQC 3C8HA 4I87A 4B53A 1KLGA 4HPOH 3MLPA 5B8CC 2DYPB 4P23D 5K9OB 3UTSA 4CAGA 1JMXA 4I1NB 2Z31A 2XQYK 1FH5L 4OGAD 5BO1H 2Y5EA 1KY6A 1F58L 3IU3B 3QJFA 1T83A 1BQHG 1YNTA 3HN8A 4TS6A 1KDIA 2Q0ZX 3VI3B 5T5FL 2RFXB 3O0RH 1YMMB 4S11A 5KSBB 1IZJA 5I1CH 1QWHA 2JJSA 1VESA 5CR8A 2DWTA 1TJIL 1GA2A 2CZNA 1XCTB 1KPUB 1KXHA 4NN6B 2WLLA 4A2DA 4XBPB 2GTWB 3IE9A 1KENL 3EYVB 2HJFB 3BT0A 4W1TA 3TV3H 3OPUA 3S5LG 5LWYH 4LU5L 2J21A 3QEQA 3RTQA 3PQYB 3T8VA 1ZGLM 7CGTA 5KVFH 5DQDH 1TZAA 2FJUB 3B7TA 4OU3A 2CRMA 2GFBA 1MIML 1HEHC 4D9QE 1RIHL 1PLAA 3H9SD 1IARB 4JAMB 1WRFA 2VT0A 3TN0D 1DQQA 4PD4K 2H3XC 3QEUA 4EVNA 1F0LA 5CS7A 2OZ4L 3CVIL 3L3OC 3G6AA 5E56A 3GK8H 3LEXA 4NENA 1WAAE 2OTWB 2BSED 4F5CA 3VWKA 3BVUA 2A6DA 5LB1A 4XNZC 1UXWB 1SJVA 2WXNA 4PBXA 3LNGA 5DT1L 6FABH 5E2VL 3NYKA 3NA9H 5L2JB 1YCSA 3K80A 4MA7L 1Q94B 3OJDA 1NCBH 2EKSA 5IQ7H 1EEZA 2VAJA 4JHWL 4F8PA 1EX0A 1U3HC 3HPJB 5D7LA 2V9QA 1VPOH 2D7NA 3BP7B 3BFWA 4MD5B 4KMQA 8CGTA 3VW3L 2X6AA 4OGZA 3C6SA 2NTFA 3T5WA 3LQAH 4PRIE 4BEIA 2XVGA 3LQAC 1MVYA 5DD3H 3ISYA 3QULB 2RA1A 3PHQA 4GEJA 4MJIE 1A02N 5E9DD 4OLYH 4JFPB 1UADC 2QHRH 3IFOA 5ISZD 3CDGB 5KSAC 2E3VA 3H3KA 3IDMA 4NJAH 4WWKB 1KXVA 1WC7A 5GGUA 3MCKA 4ACTA 4LLDB 2JCCB 1KCSL 1BQ5A 2GUOA 3LD8C 3EBGA 4XR8C 4DUVA 1P69B 2BIOA 1XMWA 4JY6B 4Z6AT 2EUZA 2A4EA 4Y4FB 2RD0A 4Z78B 5CO1A 1RAMA 4ZFFA 1TYEB 5JOPD 2NZIA 2WK2A 1E4WL 3LYRA 3QG6A 4ZAKD 3SYCA 4DQOH 3MROA 3PXJA 3QQDA 4CADA 2R0ZL 1MFEH 3QEGL 5ICYA 3QG7H 4Z0XA 4N2CA 4PJDA 4V11A 4PG2A 1PL3A 2D7MA 4CU7A 4EN3A 2R69H 2VW4A 4Y4KC 2A0LC 2DWEB 5I74C 4ZS7H 5J11B 1RVFL 3RB5A 3BSZH 4FQ1L 1FSKB 1BA9A 4D3CL 6PCYA 2EQDA 2IALB 2ZCKH 1GHFH 3CFTA 2DMBA 3GF8A 2CO3A 2TSAA 4WHYG 3HJEA 2OMVB 4JRYE 3ULUD 1OGTA 1P2CA 35C8H 2EECA 2GW5A 3FF7A 4LEOA 1II4E 2EE9A 4AQ1A 2DYPD 5J8OA 4E9YA 4P5MA 2JIXA 1IJ9A 3J8F7 3OAZH 3KYKL 2AEWA 2I27N 4PV8B 4WJ5B 3TFBA 5HSFA 1K8IA 4HWBL 3MRRA 4W4OC 4Z3EA 5D1XA 1DSFH 1NBZA 1KTRL 2CUIA 2ZOKA 2BMKA 3JV6B 1T7ZA 1D7BA 1Q1PA 3B56A 4QTIL 4XODA 2BW5A 1G6RA 2DQCL 4PPTA 1CL7L 3FO9B 4EZMA 2CKBB 1U9KA 2NY6C 3MRLA 2WXQA 5DVNA 3TEWA 2XXMB 1O75A 2X89A 4PM1A 4QOKD 4WSGA 1CFTB 1QSFE 3TVMA 4R5TA 3IGFA 2IANA 1QKZL 2R0WL 4Z3TA 4EUPG 4S2SA 2G5UA 3PQYD 3S37H 1VGKB 4IRSA 2H0JA 5F70A 3HFMH 4XCYB 5DGQA 2BXZA 5JOFA 1JUFB 4NUPA 4R90L 1IM3B 2PR9A 1JGDB 1YEFH 2E59A 4P59L 2HSIA 5DU7A 1KC5L 4PWKA 1RIVH 5I1EH 3M8OH 4O00A 1CXHA 1DBJH 3V5KA 4JFXB 1NUNB 4UZGA 4YAQB 4N8VA 5HHPA 2Z4QB 5TE4L 4MXQD 5HHVL 5IVXE 1T5KA 1EMTH 3TA4D 3UBFA 3L9YA 5E24E 1E65A 5DHYA 2D8KA 3DPBB 4JVUA 3NZHL 4G1MA 1XTLA 4JRYB 4R7NB 4G6KL 4HOMA 4RISL 2AI0H 3RUGA 1Q38A 3BUYA 4X9IA 1MRCL 2R2HA 4LCVA 1KYAA 1DQMH 5FR3A 2H2PD 3BH4A 5I8CB 4UWQB 1U6AL 1FL5A 4RNRA 1A7PL 4WDIB 1EBPA 1TQSA 3FHAA 3KPRA 4YHOL 4YDIL 4ELMF 1C8PA 3E1F1 3Q44A 3VFTA 4CVZB 1TZGH 2WXLA 2WP3O 1ORSA 4WWKD 5FUOL 2C7FA 3QI9C 4K2UL 2FLMA 3HHMA 3CZFB 4HHWA 4L5FH 5JTWA 1DL7L 4Z95H 1KBBA 3F7KA 2FL5A 3O6LH 1PX3A 2GIYA 3BD5A 3FUDA 4I2XE 4HJJL 4XNQA 4WWID 4Y4FD 4BHUI 2RB8A 1QSFB 3TEXA 1SXCA 4J3OF 5IBLC 5H94B 3ZRSA 4GSRA 5IW1A 1T4KA 3LKPB 4P5SA 2OR8A 2GTQA 1VKXA 1YN7A 2W0FA 3VGGA 4D9QD 3O11A 3V6OC 4MRCA 1IC4H 5I6LA 2IAMA 1PTZA 5DZJA 1OL0A 2ZICA 2XVLA 4PRPB 1C08A 3BE1H 4TQHA 4PSRA 4FQXC 3ZQ9A 1XT5A 3US9A 1M56B 5D5MA 1MAKA 4I18B 4WV1C 2YUZA 4OZHB 3FO0H 4XN8A 4EZJA 2VLME 1SJEB 3JYBA 1AE6H 4Y5YB 5FGRA 2Q8AH 1G7PA 1VFAA 4A66A 3BLKA 2WSDA 5ICUA 2F53A 1CDUA 4KQ3L 1UCTA 4Q4IA 1T0NB 3P3UA 3DX7B 3L95B 1EUUA 3QGVA 3P40A 1MRFL 1CE1H 3CDZB 1X5AA 2EXWD 3GSNH 4NUGL 4CMMA 4F24A 2V2XA 1J8SA 2V7NB 4FS0A 2FATH 4G7YL 5B7FA 2NMSA 3T4AA 4E41A 1MCQA 1UUNA 1CLZH 3HC3H 2EDJA 4QRSA 5KANG 2BDNL 2DTSA 3TM6A 1GRWA 2KZ1B 3LCYA 2E27H 3CD4A 3E6HA 1YMHB 3WY4A 1UENA 5EU3B 4Q9QH 1UH2A 5BJTB 5EF3A 1CFQB 3UJTH 3PFUA 3OD3A 4E2OA 4Z7UF 1MCSA 3H56A 3VXUE 1NBQA 3G6DH 4WW2A 1E8XA 3ZHDA 2HKHL 1NFIB 1J11A 4F33A 4UZUA 4HUXB 5BV7L 2WWKO 4G8EA 3GXFA 4EKXA 1PY4A 2BY0A 2PXYB 4B41A 4V1DA 1J5OL 3KPSA 4J3VA 4I2XB 1OP9A 4QHUA 3ULVL 1IM3D 3R0MA 3WN5A 1RPUA 5ADPL 1P4LB 4GAGH 3EH1A 1J05A 2YA0A 5E1AB 1BD2B 3AS2A 3T2OA 1WFMA 4YEEA 2EEFA 4OV6F 3B9KB 3Q3GB 4HSCX 5AZEL 1GTNA 3TEZA 4GMTL 2WLKA 4LSUL 2RAMA 2I5YH 5DHDA 1X3DA 2XKUA 3SDCB 3VWJD 2A6IB 3D39A 4A2LA 2XCMC 3V55A 1ET8A 3D09A 3NCJL 3V4VL 3MSPA 2R9HC 3M86A 1KCUL 2KDYA 4MMZB 4PJIE 1KB5B 3BPLC 2B9BA 3VI4B 1B0RB 1LO4H 3DX1A 1YJDH 3MOBH 4HKZB 3FQNA 1OTTC 5TQ0H 1YJDC 2YXVA 1GR7A 3MN8A 1FNSL 1JNNH 1R3JA 4ORGB 4PJGA 4UILL 1BPLB 2DQJH 3JZ7A 3QNFA 4P9HL 5JZ7C 4YHYC 3IS1X 3VDAA 4ZMAT 2B9AA 1NGPH 1RUPL 1CUOA 4YX2L 5KSUA 3P4MA 1HSBA 1J10A 5FA3B 1EHKB 1R0AL 4E9WA 3U7WH 3BZFA 4GBXC 1NMCB 3ZSTA 4ANKA 3L3GB 4FXKA 1BLNA 5E1GA 5HGDB 3IMWA 4HF5H 1IBHA 2J88H 3P0GB 3D18B 1W8NA 4HAGA 4H4NA 1OAQH 4RFNB 3VXUB 2E9BA 4MAUH 3DXAB 5ESQB 1UB5A 5FGBA 3E9TA 4GEIA 4N24A 3G5ZA 3MNVA 4WEEA 5F96L 4L37A 4WFHE 2X3BA 4TPRL 1AGEA 5GJTL 3DROB 5CWSA 1FZOB 3U0PB 3GWJA 4BWUA 3AADB 2FX8L 3IDJA 1ZTXH 2B0SH 1PG7H 4RFOH 4I1RA 3BI9X 2OMWB 4ZXBB 2JJUA 4YN3A 4S1QH 3WDIA 1DCEA 4FXTA 3QHFL 4NSKB 4LSSH 4BBWA 1ITBB 2WNWA 2V6HA 2ENJA 2I85A 1M3IA 3PP3K 5FIEA 4PRPD 5ID0A 3JTTB 1TZOA 1VCAA 5IESH 5E5LA 2UZXB 3ECBB 4JDEA 1TTAA 2F74A 5GGTH 4QRPE 1SYSA 4F15B 2UYLB 2Z3FA 1GZPB 1S9WA 3FAWA 4OUOA 5KS9B 4LAQH 5D1ZI 4LHUG 2YWYA 1PS3A 2DPKA 4PJ8B 4W9EC 5BOJA 1ID5I 5F72S 1HWGB 3U25A 1TSRA 3IXTB 1BM3L 1MN4A 1LTXA 2PTTB 3O6FB 2HG0A 3RE0A 4GG8A 1AO7A 2QVKA 2AV7B 3S35L 4D0DA 2A9AA 3HBQA 4MB5A 1KXTA 2HVBA 4HPYH 4UAOB 4HDIA 2VMDA 3FSZA 2CR0A 5D1ZC 5E1HB 4FFYH 5F88A 3VXRE 15C8H 3ZUNC 4BGDA 3A22A 4MAYB 1GMEA 5JIIA 4R7LA 3HR5A 3DTDA 4IU2A 1YEIL 2PCFA 4MKTA 3G7TA 3NIDE 4ZUUA 3UTZB 3BUDA 2VDPB 3L4TA 1E6JH 1I7TA 2OMUB 4LNVA 4AGNA 5IOPB 2FZ3A 4R97B 1FH2A 3DVGA 1J1OH 4NYLB 4DKEH 3TBYB 1ID2A 1PZSA 2XUWA 4O2FB 2Z64C 1IB5A 3HE6C 4Z7VF 3WCYA 2WC7A 5JMRA 2RR3A 3PF2A 4K71C 4UT9A 4H8HA 4PP2B 3S48A 1LE5A 1VJSA 4HG4J 3FMGH 2FIRT 3EJZD 4FZ8L 4YHKL 3FTGB 1TO5A 4MFHA 2IWKA 4HX1B 4XBMA 2HX8A 4I48A 3KBPA 1OY3B 1SLUA 1VHPA 4IBLT 5DI8A 3LY6A 3QZWA 3MRFB 3TNNA 1OT2A 1JZHA 3VXOB 2ITDB 5IUSA 1BD2D 4IRJC 2EDWA 3UZQB 2O6FA 3MV9A 4PJAF 1KYOJ 5DJ0B 1T5XA 2IQ9H 3B9KD 3N85H 4MQXC 3I6KA 5TH2A 5CJOL 4DFHA 1QZNA 2EH7H 4A7GF 1JWUA 1ZLWK 1Q9OA 2X70B 4HFWA 3VNZA 5A2FA 4QY8A 3EFFA 1A3ZA 5EB9A 2WUCL 1CD8A 3OF6A 2ENPA 2XTLA 4QRPB 5CJXC 4D9RD 2P42B 1NEPA 2MH4A 2G9KA 3H7BB 2OP4H 4FYSA 3IK2A 1BIIA 1E5YA 4YHLH 1XGPB 5K93A 2VSCA 4JR9L 5LCVA 4MA3B 2IH3A 2V5MA 2OSXA 3A4EA 3X1GA 3VD4A 2QTEA 1DN0B 4JHVA 3ZL2A 4RAHA 2W07B 1BF8A 3E8VA 4Q9RL 3ZHLA 4NN7B 4I85A 1F11B 1NMAL 3EOAB 3KL0A 3UBXI 4Z7IA 2ZPKL 4O02H 2HP4A 3HAEH 4YDVA 5H35A 1V8HA 3ULSB 1W0YT 4XN9A 5JNYB 2P24A 1ETB1 2WKGA 5FW7A 4J5VA 1A6PA 3RWHA 3GXNA 4Y4HD 3S36X 4WHTA 1LO0L 4MLIA 3X12B 4YS4A 3FQUA 1C7SA 3EGDA 3DXAD 4X7TA 3WTVA 2BVTA 5M94B 4LCWB 3SBRA 2XBDA 2AITA 3RX7A 3FZUC 4Y19E 3OQ3B 1DVQA 3B8YA 4MDJA 3H1ZA 3RPBA 2QSQA 1QBBA 1ZHKB 4DHLA 1R3LB 4DGIH 5AG9A 4U1MA 5KG9A 4ZXBD 3CFEB 1P5UA 3INOA 2BRRL 2WO3B 3SQOL 4AQ8A 3QXDB 1XF4B 2BY3A 4TUJB 2PW1B 1MNNA 3FK3A 1M7IA 5F1IB 5CCGE 2CHXA 5F7EL 5HYJE 3BVTA 3D30A 1WIUA 1Q0XH 3I6LE 4XAWH 1AXSB 1AYOA 3KWWA 1PZUB 3NH7H 4Q9BA 4R26L 2K8MA 2W60A 2YN5A 1E2VA 5F89A 4OV5B 4PJ8D 4YSDA 2MTPA 4ONGH 3HR6A 3K46A 3UMNA 1E5UI 3KPOB 4QCIB 3QJRB 5CGBA 1J5IA 4DN3H 3BWAB 4KXBA 2VABB 3OLGA 3SKNB 3V7AE 5EZOH 3ZZLA 2IGFL 1NCTA 2DQUL 3WIAA 1ZV2A 1R47A 1T0OA 1LP9E 4MAYD 3FOLB 4NP4H 1YNTF 1ZKAA 2R2EA 3BQUC 4XP4H 3QUYC 4Z77A 2BHFA 3N42B 1NEZA 1ZOXA 2BVEA 1BGXH 4LKXB 3HPLA 3K2KA 4KH2A 3K1DA 4LCCB 1AD9A 2AEQL 4KGLA 3OKOA 2K1MA 1DUYB 3C5ZC 4UDTB 2ERJB 2QV4A 1BVOA 5I30L 3AABA 3RVXC 2HFGH 1BBDL 2HMIC 2J4WH 2AW2A 4H8WH 4H8WC 4OM1L 2BCKB 2LTQC 2XRAH 4KRPB 2V8LA 5DMKA 3VFWB 2CGYA 3ETBJ 4AJYV 4X6CF 5C0EB 1BZOA 2CIIA 2V2WB 5B22A 1KJ3H 1NC4B 4TTGA 4DT2A 3ZDWA 1MG3C 4XC3H 1ASPA 5BVJA 4LPYA 2QPDB 3C12A 4TVSa 5D7JD 2DLGA 2UVEA 3VD5A 2R7EA 1RK1B 3K72A 3TA3C 2WBJB 2QGCA 1XF3A 4B9JA 4OCSH 5JORA 1ADQH 3VYPA 3AT0A 3QCUL 2XZCL 2ZOLB 2CHWA 5HI5C 5CZVL 4QWWC 3NIFF 4N2IA 3FCTA 1KCWA 3IJHA 4FHKA 4Q74A 1N6VA 5HYJB 2DEYX 5E8OB 5EBLB 2QVMA 4IJ3B 3LRSB 3CSPA 3K81A 4GFXA 1JK9B 4OT1H 4YDKL 4KTDL 2HJLB 3KWUA 3MR9B 3QJXA 1ACCA 2OR7A 4OUUB 3HZYB 5DYOB 4EDWL 3GXPA 1OAYL 3L4XA 4WI2A 2K9FB 2ZX6A 4XMLH 4C59B 1AD0A 3ROLA 1QLRA 1SRDA 3VG9C 5I1DA 1BVKB 2UUDH 3IRCA 5CGMA 3H0TA 1VRSA 5D8JH 3DOIA 2C5DC 1EHLL 1HCVA 3VMPA 2I7SA 3MCG1 2BNQE 1Q9LB 3WLBB 3VXPB 1KFGA 3GTTA 4U1GC 1T3FA 1OTSD 4GYBA 3L4CA 1TJIH 4M8RA 2YAFA 1XIWA 1KJVA 4GAAA 4N2MA 3QRGL 5I17B 3DOHA 1CFNA 5D6DC 5IG7B 4U6VL 3QSKB 5E4AA 4DKFL 3EIFA 1WSST 1WT5A 3M7FB 3NJVA 4LCWD 3TJHC 2ADJA 4JREB 1MWAA 3X2QB 4AIEA 4YQXL 3VRLF 3ULVE 5DS1A 1MUJA 4JPIB 4ZMQA 4N2DA 5G2NA 4G8GB 4PJDF 3D9AH 4YE4H 2W8CA 1UURA 1GZQB 3QP3A 1F86A 1LK2B 2VDOL 4JBSA 4PGBB 3O3BB 1RIHH 2HLEB 4X5XA 5DFVC 5GGQL 4ZFOA 1FA4A 1QP1A 4IBZA 3KCPB 2EXYC 4W93A 2GAZB 2OZ4H 3CVIH 5DC9B 2X4TB 3WFZA 2ZZUT 4JPKL 4YIQB 2EDYA 2WB1A 3QARA 4JMXA 3SDAB 3B3BA 5ESAA 3MBEB 2GK2A 3FC8A 4OR1A 5EMYA 1BWWA 4DO4A 2WV3A 3QRFM 2C3VA 1SVCP 3NP4A 4N6QA 5IFHL 5DT1H 2PKDA 2PW2B 3MPCA 3POHA 4AENB 3FT4A 2WWOA 4JQVC 4MA7H 3T2PA 3V0FA 5I5RA 5EPMA 1JYXA 4X5PA 1ZA6B 2ITCB 3VW3H 2BFVH 1HVXA 4B9FA 1IQWL 4J4PC 1MCNA 2LR4A 3MYZA 3AB0C 3UTPE 3T0EA 4DO6A 1VZGA 4IBTA 5IM7A 3TP4A 5IMOB 3CFQA 2EIZA 1T1ZA 2CLVA 3PAYA 1E0OB 3RY4A 4PREB 5EOCJ 5FM4A 1QNIA 1ZSHA 4BM7A 1GS8A 1IAKA 3L1GA 5DD6B 1EDQA 4OBSA 3WS6A 1EEQA 3Q6FB 5GS2D 4NQUA 2OYMA 2VLJA 1T66D 2J1WA 4QHNB 3NFSL 5JDSA 2Y7NA 4ZYKA 4KRPD 3MUHL 2VJ0A 3NEXA 4J3SA 1DQIA 3W9DB 1G87A 1SOXA 4PR5B 5DWPA 1V7NL 2H8PA 2VXTL 1E4WH 4X8JB 4LXFA 4F91B 3TTSA 3QEGH 3WL9B 5C97A 3ZHKA 3NRFA 3UTTE 3D0LB 5CLZA 1GXEA 4IEFB 2YD1A 5MEOB 5L9DL 3NACL 1MNUH 3QUMB 1GYVA 3AROA 4HH8A 4MA8H 1RVFH 1E9QA 2EH8L 5HVHB 5I6OA 3D3VA 4FQ1H 2PCPA 4GRLA 3OKEA 4AEEA 4CU6A 4QHLA 4D3CH 3LIUA 3WI9A 1PFOA 1IAOB 3BC9A 3MBWB 1PAMA 1NFDE 5ENWB 1JBJA 4FG0A 4CBZA 4LRIA 1FO0B 3QUHA 1AHMA 1SDYA 5D7IE 1HE7A 1IBGH 1WAEA 1SN2A 3BN9D 1RZ8A 3W37A 2DJUA 4N2AA 1ZHBB 1E8WA 3SQRA 3UTOA 1SXSA 1NQBA 3KYKH 2P7TA 4M43L 4HWBH 4LP4A 3T8XB 4KKBC 5CN2A 1HYSD 5LJYH 2XN1A 1LD9A 1ZHNA 4JY4B 4HBCL 2DBLL 4QTIH 4R4BA 4BCYA 4DFIA 5JXEA 3S98A 4F7TA 1FNGB 2JLLA 2K8QA 3WIHL 4NUJA 2WSKA 3GKZA 4Q14A 5HI3C 5JXAH 3O3UN 2FJGB 2WXHA 3HNSL 1NDMB 2WQWA 1BZ7B 2D3NA 1MW2A 3PGCA 3CXDH 3GXTA 1SFHA 3K6IA 3EYUL 3LN9A 4QNPE 1WZ1H 2C3WA 3SIKA 4O9HH 3KLLA 5D72L 3ZYJA 1W0VA 1IGML 1S7QB 4M6ML 1A1NB 5A16A 2VITA 1QKZH 2R0WH 1OSPL 1I3UA 2UXVA 5D9SB 2K0RA 4HCIA 4G8GD 2BOCA 2CO7B 2E7HA 2G5BB 5BS0A 4FFVD 3DMMC 4MQSB 4Q58C 5FM5O 1DQTA 5L4MA 5BMFL 1XR8A 4NO0A 5I75C 3LH2L 3UTTB 2A4ZA 2C9PA 2C3GA 2MPAL 3CCHA 5IREA 3A21A 3SDAD 5D5MF 4KRNA 1OSYA 3GJEA 1L9PA 2FJHA 3KBHE 5TE4H 5FYLD 4OCMC 2VDMB 5HHVH 1YC7A 5CLYA 1CMOA 4PGZA 1SY6L 5C71A 1LVEA 3NZHH 4L8BB 3QIWD 4RMWA 5D7IB 3NA4A 3SJVA 4G6KH 2Y0SA 1ML0A 3NCYS 2OCCB 2OMZB 1DJGA 1MRCH 1XCXA 4PJ7A 4LFHG 4FFZL 4NO5A 1QPXA 4RMTA 3D7PA 2NRDA 3ARDC 4G80B 4BFGA 5I1KL 4L3EE 3D85A 5F6IC 2Z35A 4YOKA 3VFNA 3X1FA 5EU6E 2X41A 5DJ8A 2CO6A 3NPSB 4PLKC 1A7PH 5K5YA 4WTQA 5E6SB 2ZUVA 2W0LA 1EXUB 4W9ZA 4KJQC 5FGCE 3TWCL 2GCYB 5C09E 4C55A 4KKAD 3NBNA 5L2KD 4U6TA 4G7QB 4WW2F 5FUOH 3TS8A 4JO5A 4P06A 1NAMA 5ECGA 4K2UH 2Q3ZA 5HI4D 1DL7H 3NCMA 4O2EB 3W39A 4MZRA 4IOSD 4GAYA 4X6DE 5F3FA 4P2QB 2FLRT 2OL3A 1XDTT 5B1BB 5GSVA 4XPBL 2EO1A 2V7HB 3EXLA 5D2NE 4KNTA 5B4MC 4A63A 2MMXA 5FK9B 1G9NL 4QO1B 1I31A 1U8CB 4KXCA 1XGUB 4E9LA 3EOTL 4NRZB 3TFKC 4BKLA 2NXYC 4N2NA 4S1DC 1T0MB 2Y6SD 5HGHB 3GO1H 5CEYA 1GIGL 2BNRB 4JCLA 4PJCE 1A6ZB 5JYLA 3HOGA 4XCFL 2XWRA 5E0FA 3T65A 2BH0A 3IETB 1M7XA 2X7LB 4GIPD 4LL9A 4LVHB 2Y24A 2X42A 1CD1A 2C26A 3ZQXA 2SODB 2NYYD 4NQCE 3H4FA 3M1CA 4DEPC 1KN2H 3DRTB 4AM0A 3OKKB 4KQ3H 1X44A 2CK0L 2Q9OA 2ZSWA 1MRFH 4M7KL 2Z93A 4KJPD 5CEXA 4KXDA 1HXMA 3ATAA 4G7YH 4ZMYA 1KNOB 4ZUTB 5GISL 1CR9L 1UZ6E 2E4FA 4B60A 4H1LH 3FH7A 1I9EA 2JFCA 1WJ3A 3HC0B 1I9RL 2R15A 4L3EB 5HVFB 2BDNH 4PJXB 5EU6B 3PAUA 2NXZC 2OAAA 4M7LH 4XO4A 5DHXB 2KPWA 4Z0BH 4JN1L 5C09B 4DOHE 3HZKB 1MW1A 1Z9PA 3CNKA 2H1PL 2A5UA 3NZ8B 1FC1A 3QR2A 3DJZA 2Y1VA 3S3BB 2KYIA 5LN8A 1A4JA 5BV7H 5BV7C 2PYFA 1AGBA 2HFEB 4IBQA 3SCMC 4J3OD 2D3LA 3P77B 43C9A 5TF1L 3RVVD 2DZEA 3II3A 2DV6A 1JZ6A 1J5OH 5EO1A 1FUNA 5IIEB 4NNPL 2MQGA 3QNZA 5MEPA 5FUCE 1JNHA 4LARL 3ULVH 2YK1H 32C2A 4AIZB 4LEEA 3ULVC 4HIHA 3L2MA 5ADPH 2P49B 2NYZA 2ZXEB 3ARFD 3PXHA 5AVVB 5IB3A 5D96C 2F7OA 3DPDA 4PS4L 4R2GB 1E2WA 3MRQB 4JFEE 1F5WA 1XAKA 2BSSB 2DL9A 4WNQB 4ENED 2VQUA 5D2LB 3MV7B 1I8MA 2ICES 3CH1B 4K0OA 5AZEH 1J12A 2V2TA 3OKMA 4HIJB 4ADIA 4GMTH 5CZXC 4LSUH 3U2SA 1TETL 2NT1A 5AOZA 2UVFA 4XVJL 5JUEL 1ESOA 1Z1WA 5I82A 3R1GL 1G7JA 3T0WA 2WZPD 3NCJH 3V4VH 5KJ7E 4M8VA 1KCUH 5T1KD 2E5EA 3DX0A 3M46A 4IS6B 4WU7B 2IH8A 3FTSA 5E6IA 4J3WA 4B9YA 2CBTA 1H8SA 2RCSH 1CXLA 2YD6A 3KL3A 4CNIB 1MJJA 1FNSH 3GTNA 3QT2A 4L48A 4UILH 5HDWA 2W80C 2DLTA 1NGXB 4I0PC 4U1NA 3QXUA 4ATWA 3SN6N 3V5HA 1TZHA 1RPQA 3WIFB 4Q4EA 4P9HC 5AVRB 5CJ8A 3HNTH 3VSUA 1RUPH 3CZUB 3NZSA 4FERA 4YX2H 4GRMB 4PTTA 1R0AH 5LGJB 2VYRE 1ZLSL 1OPGL 2JH2A 2QVTA 1XSJA 2BVQB 4N0CC 4U1HA 1RJLB 4G8IA 3NN8B 4P2QD 1JXKA 1SDDB 5DUMH 5I1LB 3AMKA 2CJSA 3LRHA 3WEBA 1UZ8B 5F96H 1DBAL 1I8IB 5KWYC 4TPRH 2J5WA 5GJTH 3MJ9A 3MODH 1U8LB 5JLZB 4PIBA 2FX8H 1KGJA 2G60L 2BJML 3PDGA 5GHWL 3QHFH 4HCRL 3DRQB 4PVMA 1O9ZA 2BNRD 4NFBA 2VW6A 5TQ2L 2V8MA 4Z7NF 2OPCA 3T09A 1XF2B 3P30L 3RNKB 2FR4A 2NW3A 4S0HA 3HS9A 4LOVA 4K7PX 3QA3B 3AWGA 4QKTA 4M56A 1R5WA 1XGQA 2EC9U 2HUHA 3PGDB 2ILLA 4J23A 4CW1B 3HB3C 2WQAA 1WITA 4FXGB 3CFJB 1C5BL 3MRNB 2VDKB 1BM3H 3JTSA 2J7LA 1Z9LA 3CZKA 3FONA 5FO7A 3UZVA 4UQBA 5AEAA 4K4KA 1EV2E 3IFLL 4D8OA 5CN1A 3V8CA 2ID5A 2AK4D 2HTKC 1CXEA 3FUFA 2EUXA 2VLLB 1ZWIA 4KZDL 3LAFA 2I60L 3BT2L 2BOBB 1M71A 2FEEL 3MRBB 2GSMB 4FQCH 5JHDE 5EU6D 4OZGA 5F3BB 1KPVA 5C0DA 5A43C 1AGDB 5IW3A 1KTLB 4ZFGH 2DWSA 5E5RB 4GG6A 2AJYL 5BW7A 1ZAGA 2F68X 4NERA 5FWQA 2W9DL 3GSOB 1L9QA 3L9RB 2J57A 3ARWA 2ICEB 4L4TD 4DNLA 3FH5A 3G04B 3OAYH 4H8VA 3ZVVA 3EG9A 1R3KB 3DIFA 4RAUA 4HWNA 3DA0A 3KGRA 5EUKA 4GSQA 1FCGA 4KROC 4FZ8H 4YHKH 3RBGA 4UT6A 3DSNA 2AGJL 2I9LA 2UX7A 2ZX8A 2ODHA 4M9PA 1SJHA 5EUOA 2WCSA 3GFUA 3UG3A 3FT2A 4PVNA 4NKDB 4X0NA 4JPSA 1J5DA 2E6PA 4CSZA 4NUQA 1D5ZA 2MJWA 1MHHA 4U0RB 4X8CA 4QAMB 4R2GD 1X7QA 3MZTA 2DF3A 2HTLC 1AZBA 3KLAA 3QDGB 1L9SA 4HFUL 2AQ3A 3MV7D 4P5KA 5SV4A 5CJOH 3UC0L 2NDFA 5L0QB 3DUUA 3EJYC 2XN9A 3CPLB 2HT2D 3CHXA 1SBBA 3DV6B 1BEYL 2WUCH 3GBNL 2PWDA 5CMAB 1UM6L 2NUPA 1KLUA 2A38A 2AJZB 5DTFB 3WNJA 1HHIB 5EORL 3PPEA 3UXFA 1ZD6A 1FNFA 4RGMB 2UWEE 1RH8A 4MQTB 4JR9H 3H54A 5AQ0A 1S4IA 4K7PY 2CKNA 4J28A 4IKKA 2Z31B 2R1YA 2GKIA 2M26A 2PUQT 4TUKL 2VLKA 3BEVA 1BQLL 5F7FA 2X38A 5KN5A 5CP7A 3S9DB 5C0FA 1K8DB 3RGHA 4C4BA 4NQDE 4Q9RH 1NMAH 1L0PA 2VR3A 5E08H 4DZBB 5JHDB 3GMLA 1F3JB 4DEWA 3S34L 3RWFA 2FO8A 1BSIA 4EAEA 3OR6B 5MI0C 2VXSH 4H7VA 1RUAH 3MUZ1 4PGCB 1LO0H 5E6UB 1IC0A 1XB6A 2E7MA 4QXTB 5CIPH 3RTQB 5FA4B 1BQRA 1VFUA 4NC0B 2IBZX 4QF1A 1DR9A 4L0PB 2GFBB 2WAHA 1J0YA 1F1AA 2FBRA 2PPAA 2Y2WA 3FT9A 3P73A 4NQSA 3MRGA 4PRAA 3SYOA 3MRIB 1DQQB 5HDBE 4EVNB 1H6FA 1BXVA 1BFOA 4MGXA 2BRRH 3U1QA 3SQOH 4U1SA 2F54A 5D2NC 4AE0A 5B39A 3G6AB 4WUUD 5DK2B 5HXMA 4HIEB 4WWOA 5ILTH 1KXQE 1QZ1A 4QR7A 5F7EH 3HG4A 4P46A 3T6VA 1YAZA 1AMYA 1GZHC 1DVFB 3AXLA 3LKOB 3T9WA 4YWGL 2Y7QB 4POYA 1SXNA 4R26H 3CN2A 3KXFA 5D7KD 3QORC 4GXUN 4N0UE 3OJDB 4FL4B 2JI1A 5BUGA 2FSDA 2IPUG 2WO4A 3K5SA 4AYFB 4N6RB 4FABL 4U1IA 4PJ9C 1AQKH 4LIQH 5D7LB 5FB8B 1EUTA 1AZNA 2Z4TA 1OARL 4OGAC 3STLA 2OA9A 4G43A 4MCZB 3UACA 2IGFH 2DQUH 2P9RA 4M5ZL 3PHAA 4WZ9A 1JXFA 3DETC 1EZVX 3LXCA 3D34A 4K94L 4B27A 4TVUA 2EO7A 4D0CA 2XWJB 2H3NB 4NUMA 4BH8A 2R56L 5DEZA 1MCOL 3DJSA 2QV2A 3HG0A 2BVYA 4MD4A 1TQCC 4XPFL 4E9XA 4KO5A 1FRGL 1V3LA 4PEEA 2AEQH 2YZ8A 2HFTA 3MCKB 5I30H 1NCAL 4LCUA 1QEWB 3V9EA 4X8XA 4OM1H 2E6JA 4ZFFB 4OLEA 3SGEI 5ACMA 1X9UA 4OZFB 3TN0C 1F2XK 4GW1A 5HYQA 2VM9A 2K9UA 4P9ML 1H3GA 4F7EA 2YAMA 2IVFC 2IV9A 1ZSDA 5DURB 1OSZA 4B0MM 3NUKA 3P4NA 1E27A 3SGEH 3QDGD 1QRNB 2AQRA 5FHAL 3QCUH 2IBZY 5ANME 4ZZFA 2XZCH 5FUZH 5F7WC 3IJ7A 1CCZA 2VR4A 2Z7UA 1JWSA 2DIAA 1CE6A 3SOTA 4N2LA 5IP4A 1OGTB 1RU9L 2ESVE 4MJ6A 4PN6A 2FBOJ 5C08E 3HI6L 3GMOA 4Z76A 3EH5B 3B3IA 4YDKH 4KTDH 3H2WA 3P4LA 3ZKXC 2XJLA 1J8HE 3BP6A 2P8PB 3KWXA 4N0UB 3WE6B 4AQ1B 4YSAA 4LSRL 4EDWH 1OAYH 3BGMA 3FO2B 3MJ7B 1E6OL 2JIXB 4TQEH 2WVTA 1K8IB 3QR1A 4GRWB 2Z31D 3MRRB 1AOZA 5DUBA 2WIIA 3PIQA 3JYCA 2BMKB 4X7DC 4QYOA 4GP4B 1HHKA 1FFPA 3HAEG 2X0VA 3UIYA 4F57H 1MZZA 5AAWC 2JJVA 5D1QE 4ES8A 1YEDB 4V33A 1SQ2N 5FXCH 3FFDB 5FO9B 3JV0A 5EOQL 3S6CA 5DD1L 1EA9C 4PD4J 1QA9B 1H6UA 4RWHA 4KKCC 2HKAA 3UBXG 1TG8A 1RUKL 3VXNA 4C8XA 3KDPB 5EFIA 5CJ5A 1U8IB 5F6HI 3MZGB 5HGAA 5EEYA 1EZVY 1R3IL 1YEKL 3EH3B 2WINA 3HS0A 3GSQA 4DKFH 3Q9QA 4S2SB 2BIHA 3RTQD 1UOLA 1WWBX 4PRDA 4PWFA 4TQIA 1PIGA 3R06B 5KBPA 2ZYSA 2OXHA 3QCTL 1RULL 4UV7L 3RGBA 1UHVA 1UACL 3MFFA 3OHXB 5AL8A 3TPUA 12E8L 4JFDB 3F3HA 3VD3A 2VZVA 1WQVT 3ATDA 3WG7B 3U82B 1KBVA 4MJHA 3TT1L 1JGVH 1NGWB 3R7QA 5GZOD 3APFA 4KV5F 4GUQA 5FV2A 4IBVA 2G3MA 5A2LH 4G82A 1J0IA 3X13A 1T20A 1HDMB 1NCJA 4UT7L 4JPKH 5CM1A 1EVTC 2IDSA 1DANU 5ANMB 1KTCA 1ZT1B 4HJGA 1O6SA 4GO9A 1WBYB 3RGVA 4LVNC 4G6ML 4Q6IC 5IJDC 3BLBA 5DHYB 5IFHH 1KWKA 2NY2C 4N90D 3JQOB 2ESVB 2B14A 2ZKYA 2DMCA 5D7LD 5C08B 3B9EA 4JZJA 3O9WA 4PV1C 3RUGB 3BUYB 1WAPA 3ZE0E 2R2HB 3CN3A 4KBPA 1J8HB 3FRPA 3NIGF 3CFCL 4RNRB 1RERA 4N20A 1IQWH 5GSRA 3MUUA 1RZ7L 3TBBA 3TYGL 2Q8BL 5L8JB 2BW4A 4GQPH 2RHEA 4NZJA 4NN6C 4OI9A 1OCOB 1DCLA 3F6JA 3QFDB 5D1QB 3KYMA 3ZR5A 1S7VB 4QI3A 2K7QA 1OAXL 1I8AA 2WW8A 4HP5A 3FQWA 3NGBC 5DJZA 4K9JA 4OIIH 2I07A 5BRZE 3NG5A 4ZFZB 3HKFA 4YZFE 3MNZB 2X0WA 3HIZA 4J1UB 4JPQA 4NC1E 4YSTA 1NL0L 2VISA 3NFSH 5EBWA 1G7HB 2H47C 5C0BB 3WJLC 2EABA 3FFCE 1PLCA 2YBGA 3DX9A 2O6PA 1QFUL 3IGUA 1V7NH 3IN2A 1N26A 2VXTH 4D8PA 3SGJA 3NQKA 3SOBL 3CJJA 4TNFA 5LO7A 2W0FB 4EN3D 1BW8A 1INQA 1R17A 4F9PA 3QH3B 2W88A 4G9DB 1YEHL 4WQOA 5A6MA 5DURD 2IAMB 1UYWL 4U6YB 1T1XB 4WW1A 5CHNB 5IVZB 1C08B 1QRND 4JGUA 2DIBA 2E76C 1HH9B 2Y1AA 3E2HC 1J18A 3NACH 4L9DA 5FYLL 4XH2B 3BOVA 1KPRA 2GT9A 1SQMA 2EH8H 4LLMA 4MXQC 2BSTA 4HMEA 3ECQA 5FKPB 3VFSA 5KUKA 4NQVA 1QBMH 2GK0A 1DUZA 4BSJA 3WY2A 1CG9A 4TLSA 5EEVA 4OFVA 1GGIL 1TZ8A 2F53B 4X8GA 1W72H 3IGKA 2H2PC 2MRYA 4LSQH 2H32B 2Q86B 4HBQA 4MXVF 2JIXD 5DQ9A 1QO3B 1X5ZA 3D2UB 4X98A 4CMMB 5MP6L 4PJ7F 1MFBL 3B7RL 4HGWB 4HJ1A 5FEBA 3ZE0B 1I4FA 2JXMA 1OKEA 5J12C 4JFUA 1A7NL 3L17A 3N44B 3MX0A 4OW6A 2XXFA 3EHBB 2OW7A 3UX9B 2HFFA 4AVHA 4DP1X 4EIBA 3PNWB 3QQ9D 1SFDA 1GY1A 4PTUB 3JV4B 2P5EA 2DBLH 4HBCH 1MDTA 2OI9B 2IFGA 5GZNC 2BWQA 3I9AA 2A1WL 5T1DL 4DGVL 5AOLA 4GT7A 4E42A 3IDNA 5LBGA 3TVMD 4PGJA 1QBLL 2BHZA 3EYUH 1KG0A 2AKRB 3B6SB 1G7LA 1KTDA 5D72H 2P80A 3D6GA 4IRSD 4M6MH 2YGVA 3II1A 4HEPA 3HRZA 4YHNB 2AXFA 1OSPH 2WIMA 3I2CH 3EBAA 1GYUA 4JFDD 3FFCB 1A3RL 4PJFF 3TGXA 1CGUA 5B3NA 4YGVA 5SWSE 2BP8B 2YPVH 3HUJA 1QR4A 1QR1A 1J05B 2EDEA 1AI1L 2E9IA 1C5CL 2X4RB 1I8UA 2J71A 2VUKA 4UIMA 4L1HA 5BMFH 1VEPA 3LH2H 4BE5A 5IWLA 3DGDA 5SX5H 2WLZA 3JVGA 3VFRB 3MJ8B 3EDEA 2QKIB 4OD2A 2VDRB 4P4RB 1CTNA 4PS3A 4NQEB 1DSWA 4Z3JA 3Q2VA 4WKZB 4YBLB 1RK7A 2LGNA 3REWB 1ZK5A 2NNAB 3B2PA 3PL6B 1NPNA 5KBLA 3IDIA 5BQ7A 3FQNB 5E1IA 2XJKA 4ODWB 1FL6A 1OGAE 2R0LL 4I3RH 4MZ2A 3K7UA 4FJYA 4PJGB 5C0GA 2MSPA 3ZGHA 1LXMA 1TQVA 1CICC 4M6AA 2CKBH 4XBGA 1AIFA 2HN7A 4FFZH 4JFFA 5I1KH 3KPRD 1X5HA 5E4EB 1FJ1A 4A6YB 5GS1B 4YK4B 3PABA 3I50L 1BLNB 4G71B 4PFEA 1RP9A 4PW9A 2APFA 3EUDA 1KB9K 3IGLA 3ZE1B 3NSYA 3TZVC 1EFQA 1YY9D 5C0BD 1JNLL 3G5ZB 2OTPA 3MNVB 1U21A 4M7LT 4L37B 1GMIA 1T22A 1WYJA 4D9LL 4PSPA 3BIKB 3LZLA 4N22A 2JQZA 1JPTL 1GTFA 1NUFA 1U58A 4X4YA 2BPBA 4MJ5A 2F1BA 1IE4A 1G9NC 3V4PB 2IAMD 2A9NL 4KUZL 3EOTH 2CQVA 2VZTA 2BSRA 2B2XL 4Y9GA 3FPXA 4Z7OE 5HY9B 4JDEB 3T6XA 1A1MA 1GIGH 4KKLD 4AZUA 1U33A 3FHEA 4ODBD 4IIQC 1NGYB 2VLRA 4PJ5A 4XCFH 3VWJC 3AW5A 1U8KB 3BKJL 1W91A 1JHKL 3RKDD 5DHVA 4APXA 2IQAB 1HCFX 3L3OA 4JQIL 2F53D 2FQFA 4GG8B 1AO7B 3P0VL 3CFNA 1UKSA 4OAWB 2WBXA 3GKWL 4D0DB 3C60A 1QSEE 4F37F 1KXTB 2B59B 4ISVA 3CFDB 2CK0H 3BPCA 3O4OC 3QWOB 3MRKB 3OB0H 4X6BA 4M7KH 2ZCLL 1JOIA 3SGKC 2MHAA 2NLJB 1YDPA 1DLHA 2APTA 3EHBD 4N3UA 4RMRA 5GISH 4ZUUB 1CR9H 3FQTB 1XFPA 1BMZA 4R96A 5DS8A 3RX5A 2FZ3B 4UBDC 1E8ZA 2QFRA 3K6FA 4LSPL 4OFIA 5AD0B 5KBNC 1MI5E 3HE7B 3O8XC 2YQ3A 1BWMA 3AS3A 3N04A 4P23A 1CF8H 3VCLA 4JN1H 5HHQA 1UOKA 1LE5B 3N1GC 2V5SA 1HWHB 2CRYA 2H1PH 1BOGB 2PP8A 2WBWB 3NCYP 4KDWA 4Y8AA 4YBHA 5DK0B 5F7DB 2ENYA 4UUJB 4WAFA 1O0VA 1T7YA 2E9WA 3GD1C 3FUEA 4ZODA 1I1FA 5CEZD 4PRNB 4YNYB 5KSAA 4EDXB 5TF1H 3ATEA 4OM0L 1IEAB 4L9LC 4KX7A 3HHSA 3DBXA 5DI8B 3IMVA 3EYOB 3N1PC 4LCIL 4NNPH 4ANWA 1VA9A 2CHDA 2VMCA 3QUKA 3MV9B 3VXMA 4ZZKA 1A4KA 1QTSA 5F7KC 1Q0YH 2I7OA 5GRVL 3PWNA 4I18C 2YMXL 3HN3A 5J1AB 4PS4H 2P5WA 1MXGA 1DZBA 4QRUA 4UCFA 5I1AA 3GSRB 4R7XA 4QY8B 3EFFB 1AKJA 4NQED 1EZLA 1AC6A 1E9OA 5E00B 4ZTOL 3D39D 4U1LB 3TEUA 1CYGA 1N3NB 5IEHA 4XVJH 2VDNL 4YFLI 1T89C 4XGZA 4M6NH 1SXBA 2C9QA 4JFHE 4HJEA 1DQJB 3QO0B 4OGXL 3S5YA 3EAKA 1U8PB 5KW9L 3V7AG 4KI5F 4NNXB 4TUUA 4M5YH 1QSEB 3FBQA 1HOEA 1FCCA 2EICA 2B08A 2BVOA 2E7CA 5DZ9A 2DLEA 4J27A 5EIIA 3NJMA 2AXGA 2FAUA 3BAIA 4R0LC 4OIFA 5DJ6B 1Y18B 4OZGF 3TBCA 3ECVA 5BOPA 2OMNA 1U41A 5CZRA 5K39A 1WCBB 4IKLA 3RIFF 3RY6A 3SD2A 4BQBA 4XMKL 1MLBA 4GG6F 3WV0A 3KS0J 2X2HA 1KJ2B 2P46B 1ZLSH 1JIBA 3EZJB 1C16A 1OPGH 1X5YA 3NFNA 5EZPA 3U9WA 5BXFB 4ACPA 2L7JA 3AS1A 4M5TA 1TEGA 4KMTL 4OZIA 2CAKA 1WFNA 3PWPA 3NJNA 3P9LB 1IAIL 2VN6A 4OF0A 4NC1C 4EZKA 2A9CA 4YVNA 5EUOF 4AV5A 1XF1A 1F3RB 1ZLDA 3S36L 3VQ2C 4Z7QF 1DBAH 2Z9TA 3RG1C 5IT2L 4FNTA 1P5UB 4EIGB 1IGJA 4YC2C 1AP2B 1S78C 2WXRA 3QWNA 1N59A 1RK0A 2BJMH 2Q76A 4HUVA 3EDJA 1M7IB 4EXKA 2BOLA 4HPHA 2DBJA 5GHWH 5ADOL 5CLWA 4PWHA 1NBVL 1S9XB 4QJ5B 3LMJL 3PJNA 2E9GA 4NPYA 2CXGA 3VRIB 2Z1KA 4C57C 4JPVL 1I1YB 3IXAA 1A3LL 4ZAKA 4N2HA 5CN3A 4HS6A 1F00I 4MMZC 1BF5A 4GW5A 3OKLB 3MA9H 3FF8A 4YSEA 4FJZA 4MMXC 2WVVB 2R2BA 3QUGA 4YXHL 1AO7D 2CO4A 1HFUA 5GGSA 2X9XA 3T08A 1JZ3A 2ORBL 1G7QB 1EJFA 4KX8A 3WLWD 3RJOA 2BINA 5LBSL 5FCUL 4PJBB 3G5YB 4IM8A 3RPKA 4H1LG 4YHPB 3BP5A 1OF2A 4Y16A 2C1OA 3IFLH 4PB0L 1O6VA 2Y5TB 2GHWB 2PPCA 2FWLB 4Z77B 3MKGA 2OX5B 4BUQA 5DUPL 1CT8A 3BD4A 2I60H 4G3YH 2VGLM 3BFQG 2D4FA 4NHCL 4Y4HC 2O6EA 3HE7D 1U95A 5K9OA 2Y7LA 1ZLVK 4JRFA 2AJYH 1K3ZA 3BW9A 1ZS2A 4ABVA 1TCRB 1XO8A 2WXGA 3AC0A 3SKMB 4KXAA 2CBQA 3VI3A 1EWHA 1TMCB 2RFXA 2NW2B 1YMMA 2BP0B 3MV01 3QQ3B 5KSBA 2ZKHL 3AY4C 5L8LB 2OR9L 5FOBA 3WTSA 5EU4B 2HAZA 4AI7A 4CDGC 3EO9L 4ERSL 1KPUA 2OLDA 5FAAA 2QSCH 4XBPA 1OB1B 2LU7A 3DK0A 1MCJA 1TIUA 3K72B 2PYEE 4WFGE 3MV9D 4CL7A 5DGRA 2BZ7A 5IZ7A 2HJFA 3L81A 1UOVA 3D8MA 4PY7B 3WN6A 1L0XA 5JIPA 4R3SB 1CLYL 2K3HA 4P05A 2PO6A 5AVXB 1FHNA 4WUKL 1UXSB 4HFUH 4R4ND 2XTJE 3VDBA 2HUEA 3GB7A 5FYKD 4M3KB 5DMJB 4OJFH 3UC0H 3OF6D 4EOWL 4JG0L 2HWZL 5F7NC 3S4SB 3PGFL 3S3JA 4H44C 2WKOA 3CQQA 4JAMA 1FPTL 1BEYH 1F4WL 2A83A 2XTSA 3GBNH 2VMEA 3RZCC 1UM6H 5IV2B 1WWAX 4ZTEA 4L4VA 3FB5A 4Z9KB 5I0VA 5K69A 5EORH 5JHMA 1AD0B 4MAYC 2OTWA 5I1DB 2Y3AA 1RURH 1OTUD 1OK8A 2CU9A 4KKQA 2VC2B 4TUKH 2W9LA 4U33A 2VSDA 4WWNA 3U0TB 5ITBH 1BQLH 3WTWA 2ITFA 2MQ3A 3DHUA 5L2JA 5LXGH 3F6IA 1CDIA 1SM3L 3NTCL 1Q94A 3C6LC 5MERB 1BZ9B 2VM4A 2P8LA 1T3FB 4ODVL 3DIDA 4YHML 3I9GH 4M61A 3MGAA 4XMVA 1B90A 4FG6D 4H5SB 3BP7A 4MD5A 2X4UB 1LYQA 1ZVSB 1MHPL 1I1RA 2GHZA 3KM2A 1D6EB 5IBUG 2DM2A 3QULA 1PGRB 2ADJB 2B1HL 3HVNA 3RFZB 1MWAB 2YQGA 1IC7L 2W0PA 2VQTA 3ARRA 4JFPA 5D7JC 3F12A 5I71C 4AK1A 1LLAA 4HKXB 3AG4B 3BCFA 3CDGA 2DQFB 4YDLC 3U1PA 3SQBB 4X5XB 1N6QL 5C70A 3ZKQD 2IXQB 4NAMA 3ZRFC 2XG4A 2M2DA 4LLDA 4HOZA 2JCCA 4X5QA 4B5ZA 4Z78A 4Y4FA 3VXTA 5ESAB 3HZ3A 1UT9A 4MVBD 1MCWW 1VACB 2B77A 3K8MA 3RKPA 2BIQA 4YWGH 3TCTA 3RI5F 2APSA 1ES0B 1UM4L 5KOVC 3FT4B 1OAKH 3HFFA 2DWEA 4YEFA 5BCAA 4JMNA 5FFGA 1UZGA 4FABH 4NKOB 3L9BA 3CHPA 4KOBA 2NYKA 2AQSA 3ZT6A 4ELME 5JW4Q 2H1XA 4CN1A 1Q9WB 2IALA 5I6XC 4HOXA 1K6QL 1WAAA 4NWTL 3T0EB 2AAVA 3ALXA 4M5ZH 5D71L 2OMVA 1MREH 2ED6A 4H88L 4UQEA 1OTSC 4Z7WF 4K94H 4HUUB 1C9SA 4TF4A 1MCIA 4K94C 5E4OA 2ARWA 4XMPH 6CGTA 1EIBA 4EI6B 1JAEA 1B3IA 1JN6A 1IAKB 1MCOH 4WJ5A 4DP4X 3AMLA 2ZUQB 3WTUA 4XPFH 1FRGH 2VLJB 2WXKA 2AK1L 4ZYKB 2JTYA 3JV6A 3FU5A 3ARPA 1ZIAA 4PRIA 2X4PB 1BQHB 1JF1B 2H8PB 3LEYL 1AH1A 1R3HB 3FO9A 4XX5A 4JY5L 2CXKA 2ALWA 2X4OB 4P9MH 1KULA 5EA0L 2ZOWA 4Y1AE 1RJYA 2XKNB 4X4ME 1F6FB 4ZK8A 2COVD 5FLUA 4ZI8A 3CX2A 3S5LB 2PCPB 4GRLB 3OKEB 3C6EA 4XCYA 4N68A 5FHAH 4QRRE 5JW4R 4XTRD 1W6LA 3FSAA 5ALBL 3NESA 4CGTA 1UFGA 4AJWA 1IM3A 1E28B 1JGDA 4ELDA 1NC2A 1RU9H 3UAEA 3AT8A 1IT9L 2CPCA 1D9KB 2KLSA 5IR1B 3CFKA 4OGYH 1GYAA 2XN2A 1WTLA 3ILDA 3QIBC 3CFUA 1DN2A 3BD3A 3GQFA 4JFXA 4MSWA 2IOIA 3OKNB 4BZ2H 1MLCB 4LSRH 3LQZB 3VMNA 2DJSA 4MNQE 1CK0L 2JI2A 4YAQA 2P7TB 3O2DL 1LL1A 3J27A 4LHQB 4XMXA 2Z4QA 1N2RB 3D25A 3EDFA 3DYOA 3IBEA 4MD0B 1ZHNB 3QPQC 4WO4A 1N19A 3DPBA 4AGQA 3F62A 2F5AL 3WKYA 2H0PA 4JRYA 3U30B 5GS2H 4TVPL 4KNUA 4P2OA 5EOQH 2QBWA 4YO0B 2W65B 5DD1H 1FIEA 1N5AB 1PCSA 3H6AA 2FRGP 2YKLL 1EGJA 5I8CA 1RUKH 1YQVL 2Q5BA 4P49A 3C5SA 5A16B 1PKQB 1XH0A 1YEKH 4NN5C 2VITB 4KVNL 2ZP9A 4BCZA 1FLTX 5LKNA 1VFBA 1E4KC 1BFTA 3QCTH 1RULH 4UV7H 4CVZA 5BS0B 5JOEA 1C12B 4G6FD 1UACH 4FGMA 2EDQA 4F1SA 1SN0A 4NPKA 4K9EL 1V05A 4Z18A 4NO0B 3ARTA 5C6TH 4LO9A 4A7SA 5IHLB 3CCHB 3M1BB 4PS8A 4Y1AB 3T1WA 4KX9A 2F7RA 1QSFA 4WU5B 1H5BC 4FNLL 1RLWA 3U7AA 2QFPA 5LVEA 1MPAL 4LLQA 2DLIA 3LKPA 1CU4H 2FJHB 1MCPH 1F97A 4QRRB 4U6HB 4NHUB 1G1KA 2MCMA 4IRJA 3BN9C 2YLHA 3DBSA 4G6MH 4L23A 1NA8A 1CDHA 1H3UA 3OAUL 5CFHA 5HDRA 2DQEL 4PRPA 3QUZB 1G6RL 2OTUB 3PUUA 3CAFA 1QTYT 2OSWA 4IU3B 3SPGA 1HCZA 5CJXA 4F92B 3AQXA 1D2PA 3T0ED 4OZHA 4MNQB 3ML9A 1JZ4A 1SJEA 1MFCL 2DEXX 3HBZA 1RZ7H 2A3TA 1HHJA 1PMYA 3P9MB 5I76B 5IVXA 1OZTG 1RHFA 4MMYB 1T0NA 3WO3B 1R5IA 3DX7A 3L95A 3LB6D 4NT6A 3TV8A 3T0DA 3CDZA 5FC9A 4ZMTA 3J7HA 1G0DA 3WS3B 2V7NA 1D7DA 2VLJD 1C7TA 1T4WA 4FLQA 1AZVA 1AHWB 1KCVL 5C6WH 2WXFA 2EEDA 5HD8D 2P43B 2HJKB 4OF3A 3EO1A 1NL0H 1YYCA 3NABL 2ZXWB 2YD2A 3L2NA 4FFVC 2OL3B 3KR3L 3VGBA 1YMHA 2R1WB 2QADB 3C2AL 5EU3A 1M2VB 1T0PB 3X3FH 1CFQA 3NCCB 1UXMA 3VGAB 1KCKA 2G5RA 4L4JA 1NLDL 3HUJF 4AMKH 1JK8B 4WEMB 5E6YA 4XCCL 2EC9T 5HHXH 4IRZH 1NFIA 3C5XA 3SDAC 5EU5B 2NY4B 4K07A 4HUXA 2IBBA 1E5CA 1UYWH 1KGCE 2J44A 5CEYB 1Z3GL 4XCNB 2DMHA 1FG2A 3D3VD 3D33A 4GRLD 3H2QA 2PXYA 2B39A 4EUPB 5FYLH 1PSKL 4I2XA 3T1FA 1QRKA 3RPIB 4RDQF 3UYPB 1KIUB 1D5IL 1LO3H 4JGNA 1IL1A 3LS4L 3CZLA 5JQ6L 3QIWC 2XTJC 4HUWA 1JRHI 5E1AA 4H0LC 1BD2A 5DD0L 3C87A 4ZMVA 2AQPA 2CUMA 3QZMA 2E8ZA 1GGIH 4PB9L 4AM0B 3H9ZA 3B9KA 1FGNL 5T33H 5E7FA 4K8RL 5MP6H 4ELKA 4HG4K 2A74B 3DYMA 1MFBH 1CGVA 2J5LC 5C07B 3BISA 1WG3A 2GJ6E 4Z7VE 3L5XL 3SDCA 1JRHH 3WO4B 1JTPA 4ZNEE 5I16B 2G30A 4KKAC 1CD0A 3CQFA 1C8QA 4W9IC 4DGUA 1RPKA 1UH4A 1KB5A 1NKRA 5DJ2A 4K5OA 4DP0X 3VI4A 4YPJA 3N43B 4HKZA 2WD0A 2Y06L 2VO5A 4ZPTB 5HI4C 1KYOK 2OQJB 4XE0A 4EI5B 3EGSB 2A1WH 4AE1A 1AIZA 1LM8V 2WZ0A 1QLEL 2L8AA 1QBLH 5AZ2L 3WKNA 2AQQA 3F7RA 4PJAE 2XWEA 5FA3A 3E8UH 5BS0D 2UZYA 3L3GA 2I26N 2Y6SC 1A3RH 1KZYA 4HIHB 1D2OA 3QHZL 4FEMA 3D18A 2NNXA 4NO0D 5IJKA 2EVHA 3FPYA 1AI1H 1PZDA 1C5CH 3VXUA 3DXAA 5ESQA 4N26A 3W81A 5I0XA 4Q8BA 1XWVA 1SMOA 4CSPA 2ZKMX 3DROA 1FZOA 5C0JA 4PGDA 4QRRD 5I1GL 2OMWA 4ZXBA 3LDBB 2KI6A 3GMRB 1G7JB 2VW7A 5TDOB 3UBGA 3S5ZA 4N9GB 4YDJB 4YVUA 1UWGL 1G9EA 1RMFL 4AYMC 4Y2DB 5GGVL 1ZDQA 3JTTA 5LAXB 3OJVC 2VXQA 2JV6A 2PNDA 4HD9A 2UZXA 2IPUK 1TZIB 3ECBA 3LKSB 5E8PB 2DM3A 5KS9A 1MJJB 3MCYA 3D85D 1SLWA 1V10A 3F01A 1DEEB 3N41F 2K6YA 4PJ8A 1O5DT 3IWUA 1S3RA 3S8FB 4ONFH 1I1AA 1L7IL 3IXTA 2X6BA 4I77H 3RAJH 3O6FA 4PTTB 1VEMA 5CCKH 5F2FA 2AV7A 3HHRB 2DYSB 4OZ4B 5DRNB 1YUHA 3V95A 3I50H 3HMWL 3NQIA 3RLSA 1NDGB 1PX4A 3HMXA 5G4OA 3CXHJ 4J3OH 4AM0Q 3ILEA 4J3OC 3M6DA 2WCGA 4U1HB 2RALA 3CVHB 4Z3IA 1FZJB 2WLMA 1YEJL 4P5TC 3UTZA 1X9LA 3Q13A 5T5FA 4X9BA 2J8UE 4CU8A 4JKMA 2OMUA 5IOPA 4UMSA 1TEYA 2BS9A 2AVGA 3ARFC 4NYLA 3TBYA 4O2FA 5E8DL 1JPTH 2WQRA 5ITFB 1I9IL 3B5HA 3ZDXF 1JZ5A 4ENEC 2NY4D 1JVOA 2X2UA 3P4OB 4PI0A 4PP2A 4YPGB 1UWEH 2A9NH 4KUZH 4TSBH 4ABWA 3S8GB 4A7QA 1DJIA 3OC5A 2K6ZA 1UD4A 4ZUSB 3ZE2B 2B2XH 3FTGA 2Y7MA 3L4VA 5T5NF 2PWHA 3CLWA 3BP4B 1YNKL 2NW3B 5CD5C 2FR4B 4HX1A 4JL2A 3BX7C 1OO2A 4WI0B 3UTSE 5KVDH 1KTBA 1PD0A 3B9VA 4MKMA 2IFFL 4NZTH 5J1TC 2YOCA 3MRFA 1JHKH 4L1BA 1X4YA 1DJSA 3ARGC 2ITDA 4HSAC 3VXOA 3GHEH 3FU6A 4QMEA 2D7TL 4JQIH 3H85A 5DJ0A 2ZE0A 3VX1A 2HRLA 3FONB 1E2ZA 2VKWA 3E3QE 3P0VH 3UZVB 3GKWH 1R33A 3IBOA 3AREC 4XXCA 1OP3K 2GITB 2YHGA 2X70A 4LMQE 4LF3B 5C07D 2R83A 4LRNL 1E3ZA 4FYQA 2ZCLH 4QRPA 1ZWIB 3KE0A 1LO5B 1QUNB 3FU7B 1XGPA 3ZKND 2YUVA 3II2A 5C0DB 4TSAL 4X6CE 4DUXA 4OSUL 3WFEL 5DRXA 4LSPH 5EC1A 4GSXA 2XA8L 1H6EA 1WA2X 1DN0A 1HQRB 3DI3B 3IF1A 5L4JA 1CI3M 2W07A 4OZIF 4Y7OC 3SBQA 1CIDA 3O0RL 3NCWA 1F11A 4NNYA 4RAUB 3EOAA 3VXRA 5EUKB 4HZ1A 1A6UL 2AANA 2Q20A 3DSNB 3ULSA 4DK6A 2ZXGA 3NIFE 2ZX5A 1OB0A 5EUOB 3FT2B 3WEXB 4BD4A 1P9MC 2YRLA 3IDXL 2ZXAA 4OM0H 3PWVB 4LCIH 4Q89A 2D3VA 1MHHB 4WFFE 3ZN6A 3X12A 3UAJC 1KTKE 1X7QB 3RVUC 4LCWA 4G5AA 1MFMA 3K6OA 5DQDL 2L7EA 3DDFA 1H15B 1KGCD 5BZDB 1TJGL 3UJJL 3D1MC 4X99B 4NBZB 1QPKA 1ZHKA 2FD6L 1F4YL 4XXWC 2JKRM 2GBTA 2ZUXA 2YPLB 3ZZSA 2EDTA 3CFIC 4H8QA 4ZTOH 2J1KA 3O45A 2FLBT 2X12A 3FUMA 1XF4A 3GK8L 4I5BB 2PW1A 4KJWD 5LDUA 4Y2DD 1DFBL 3Q8EA 4G70B 1OW0C 5T1JA 3AU0A 1MOEA 4W6XB 3RJQB 3WKPA 1LWRA 4OGXH 5C0ND 5KW9H 2VL5B 5JQIB 4AEIH 1T6WA 1AXSA 2R1YB 5C9JB 4N5ED 3ROOB 6FABL 4W68A 5CP7B 1PQZB 4OV5A 2Y9RT 2FYVA 3HTLX 3ULUF 4LHUB 4HJUA 4B50A 1QFPA 1NGQL 3OBAA 4XO8A 4TVPE 4X0KB 1XX9C 3RWCB 3K6NA 5F7LB 3LPFA 4QCIA 2Z34A 4LDEB 1IFGA 2D0FA 3BWAA 3G3LA 2Y1ZA 1IAII 2VABA 3VRLE 2YUXA 3UAFA 2NR6A 2OJZL 3SKNA 3ZGIA 3GJFH 2AXHA 4XMKH 1DQDH 5FYJD 4WI9A 2JKSA 4PJDE 1TPXC 4DJMA 3VD1A 2DQIH 3FOLA 5L6YL 3BZ5A 4L29B 3VI3F 4ICXA 2XETA 4ADJA 5KSBF 2GJJA 1X7TA 3WNMA 2YLKA 4JKWA 1IAIH 4LKXA 4OH2A 5DA0B 3U4AA 5C0AE 4LCCA 5JR1H 1DVXA 3G08A 1I53A 3S36H 1DUYA 3VGEA 3QZPA 3L3DB 1BFOB 3GZKA 4L0YA 4TL4A 2QQQA 5CCJA 4U1SB 1HNGA 3NVQA 4G9FB 4DERA 1XZ0B 1SMDA 2QQNH 2WNXA 1ICTA 2HT2C 3VFWA 5ADOH 1N8OE 5C0EA 1JXJA 2WTRB 3LMJH 1NC4A 3QG7L 1EVUA 1CFBA 4JPVH 5LCVL 4B9CA 1MCKA 4P48A 4Y19A 2WKOF 4AV0A 5D1XE 1CBJA 2XBTA 3RWJB 2OS7A 3SO3C 1IKNA 4C47A 3B2MA 4ZS7L 1HINL 2WBJA 3N6YA 3IAQA 3OXSA 3ZT5A 1U36A 3WAJA 4UM9B 1WHOA 2HLFD 4Z1PA 1HN1A 4YXHH 2ZOLA 3IFPA 1GHFL 1UM5L 2ORBH 4G43B 4RZCB 5HYJA 1DDTA 5LBSH 5EBLA 5FCUH 3U9UA 3ARBC 3LRSA 2O1AA 1JPSL 2NY1B 1ITCA 4PB0H 2AS5M 1JK9A 1AZUA 2HJLA 2IANE 3CGTA 3AXIA 4IDJL 1CVSC 2B3IA 5DUPH 4OUUA 5DYOA 2O5NA 1FYHB 1D5XB 2DL2A 1TVDA 4MD4B 1LHZA 4X4ZA 5F8QC 4NHCH 3I02B 3BH9B 3S37X 4K7FB 2XBZA 2EZ0C 1KEGL 3D4CA 3RVTD 1FZKB 5E5MB 3SDDC 3IMSA 5HDOA 2A9ML 1CB4A 1ZGLB 4PHXA 1E3XA 1OGSA 5GRWA 3VXPA 2JJTC 2UY7B 1A7BA 4GW1B 4OQTH 4PY8I 2ZKHH 4Y5XB 3B7YA 2HG5B 2OR9H 4NFDA 3OTTA 5C0AB 1ZSDB 5I17A 1VADB 5IG7A 1OSZB 2O6CA 1L9MA 4L8SB 1WZAA 2CBPA 2JCCF 1JYWA 3UGUA 2UX6A 4WFEE 1SYVB 1KGYE 4E5XG 2QSVA 3HFML 1GY2A 4UOW1 1FGVL 1ZXQA 2XN9D 1CLYH 1JWSB 1G5GA 1PJWA 4WUKH 5ABAA 3SBPA 2DYRB 4LZKA 3WNPA 1E7VA 3T6QC 4G8GA 2YPLD 2VDKH 4EOWH 1GZQA 2HWZH 2XZZA 1LK2A 3PGFH 4PGBA 1RIVL 3TBTB 3O3BA 4AKQA 2NY3C 1DBJL 1F4WH 2IWEA 5IOKA 3LS5H 4OFDA 5LGHL 1IM9B 1EDYA 2GAZA 3BP6B 4Z3FA 6TAAA 4OCYL 4M1CC 5B7EA 4YIQA 2ISDA 1EFXB 3MBEA 1WAAF 1HK6A 3QPXH 4MDRA 1HHKB 1FFPB 1FN4B 4FXLA 3OX8B 4LHUD 4YDNA 2N0KA 3G9VA 1AG0A 5F71A 2PW2A 3O3EB 4AENA 1I1CA 1SM3H 3NTCH 3N40P 2HVJA 3O4LE 1BQKA 4ODVH 4YHMH 3IMBA 1DQML 2ZG3A 5EFIB 2YSTA 5A2CA 1A8ZA 3D08A 1MHPH 2BVPA 4M1DL 5EV7A 3HS0B 3JBG7 3GSQB 1WD8A 1UFUA 3LRLA 1KBPA 4PRDB 1JZJA 2B1HH 3MRCB 3JVFC 2OXHB 2AERT 3HW7A 1IC7H 1OT4A 1YLBB 3IJSB 2NCEA 4U1JB 1X5JA 3MGOB 1DZ0A 4ZMWA 4OVVA 1IVTA 3PPSA 4L5FL 4ZW8A 3PXLA 5DD6A 1HC1A 4Z95L 2VERN 5IROA 3Q6FA 4ZX5A 2JI3A 1ZPLA 4G9FD 1N6QH 2VUYA 5KAQF 3BIBX 1UWXK 4HALA 1PF3A 4R7VA 4G6JL 5DEFB 2ADFL 4BK4A 2YXWA 2IC2A 5JPMB 5EOTB 4TOYH 1K72A 1RJCA 3ZUCA 1JTOA 4AW7A 4IOFC 5GGSY 3EJCA 3ZO0A 4J8RB 4E41E 4XNYL 3FQ4A 2ZXQA 3L5WB 1P4UA 4M3JA 3IJ9A 1KUMA 1DQKA 4U3HA 4IEFA 4OJYA 4GS7C 4GUCA 3TH3T 5LHDA 4KDTA 4JZJB 3GRGA 3O9WB 3WOVA 3QUMA 3ZIMA 3X11A 1NPUA 1T83C 3PWLB 3OZLA 3QUXB 2KZKA 2XLLA 4BWWA 4LOFA 3JUYA 1A47A 1Q1JL 4GO8A 1IAOA 1T7VA 3IJEB 3Q01A 4RMSA 4APQC 4PBWD 2NY7H 5F9WC 1K6QH 2JJSC 4WJKB 1FO0A 3NOIA 2HB0A 1TU2B 5KBMA 3S3PA 3LZQA 1SOKA 5D71H 1S8DB 2R4SH 3GSNL 4V1DE 1URZA 3KPSE 2VDQB 4H8UA 4XC1L 3CG8A 3T2LA 5T3ZL 5DJZB 5EC2B 3O4LB 5D6CB 1SXAA 4OLUL 3RTQC 3HC3L 1D5RA 3TBSA 3UH8A 1PZCA 4U7MA 2AK1H 3BWUF 5EBWB 3KPLA 1ZJBA 4ZX6A 4JY4A 4ZFOL 4MNGE 3NJJA 1W16A 1FNGA 5D4IA 3LOWA 1HZHL 4JY5H 3THMH 1BZ7A 4YHZH 4EPSA 1EHXA 1UTDA 4K3DL 4JG1L 1HNFA 3NPZB 5EA0H 3VWKC 3QDJE 4WW1B 4TMPA 1S7QA 1A1NA 3GUFA 1ZHLB 2GT9B 4LLMB 3PJSB 1KIQA 2WMPB 2FWOB 1JF6A 1OVZA 4MYPA 3HRPA 4FL4C 4FNSA 4AJ0A 4YJZL 4NQVB 2CO7A 5ALBH 2G5BA 2GK0B 2WWMD 2FBJL 2H1LM 3QWRD 5CKAA 5I1IL 1PDKB 4BZ1A 4UYPA 4LVOC 3RWGA 1IM9D 4BIKA 1IT9H 3GXMA 1FNLA 2ZYRA 3UTTA 3MACH 3MLTA 3WKQA 4NRYB 5K1NA 2ED8A 3QIUB 4PJ6A 2O5ZH 5CSGA 3I74A 2I5YL 4UTBL 4Z5RB 1CK0H 1I4FB 4OZHF 2QL1A 5FYKU 4HT1L 5B21A 2GBAA 2HFFB 3O41B 4QJ3B 3M17B 5IVXF 1KXVC 2P5EB 4L1TA 3MOBL 2QR0B 4LNRA 2WZPA 5IKCB 3PV6B 2Y3NA 2F5AH 5D7IA 3TXAA 1RD6A 4TVPH 1J9QA 4LLWB 5IUCA 1JNNL 1JHTB 3CLEL 2CR6A 3ZYOA 2DQJL 2OMZA 3ETBF 4HIXH 4E42B 4K3HA 2YKLH 4UQ2A 2IV8A 4OCXL 2IPTH 4YLCA 4PBVC 4G80A 3D2TA 1KTDB 2E7LA 2N01B 4CRPA 4L2LA 4H0HB 1AGCB 3ABLB 4KVNH 1F90L 4PG2C 2B5IB 2ZUUA 2AXFB 1EXUA 4EN3C 4IGBC 1BXAA 4MNGB 4ZQKB 3LKQB 2ARJB 4F58L 4QHKI 1NCHA 4K9EH 4UIMB 3T0XA 5KVFE 4K9EC 4O2EA 4Q0XL 5H37A 3KJ4C 3NDZE 4P2QA 2WN2A 3QDJB 5TTRA 3UYRL 3WGVB 1IAIM 3NJXA 3QAZC 3N0AA 4HGMA 4FNLH 3ESMA 1ZTXL 1PG7L 1KEML 1MPAH 2IBGA 2V7HA 3OSKA