2FSDA

A common fold for the receptor binding domains of lactococcal phages? the crystal structure of the head domain of phage bil170
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
DIPWTDLNRASGVGSTGILQARIINGVIYVRGNSIPVPNVAPNFIVPVGTFPPAFGTNLPQFDSSGTFYSHGNLSLSLINMSPSGIAVGNPNNTSMNGKTISFALSAPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative baseplate protein
publication title Crystal Structure of the Receptor-Binding Protein Head Domain from Lactococcus lactis Phage bIL170
pubmed doi rcsb
source organism Unidentified phage
molecule tags Viral protein
total genus 19
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2460 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fsdA00
2FSDA
chains in the Genus database with same CATH superfamily
3BZFA 4PPTA 5DLMH 4D2NA 4AJYV 1FZJA 3P54A 1JMZA 3BP4B 1ROCA 3KH3A 4KUCD 4B9JA 1T7WA 2WZPD 3PIQA 5J12B 3T2NH 3OKLA 1YY9D 1Q38A 4X2UA 5I24A 2ADFH 1QW9A 5CCKL 2JCWA 3QIUB 4LHUG 4LPCA 3VFMA 3ZKNC 5L8LB 3HMXA 4J28A 5GGUB 5IZ7A 3PP4H 1YEIH 1HHHA 2DTML 2P24A 5FYJE 2ZOUA 2X4PA 4NPJA 4DPRA 1RZ7L 5LGHH 3QI9D 3P3YA 4Z7UE 3SE8L 1NC4A 1TT6A 3EG9B 3WJMB 1MIEH 1RURL 4KI5D 5DUMH 4BH7B 2HTLD 3BIKA 3U4AA 4MA3B 5K39A 1BYOA 4NC1C 2PW1B 3CV5A 2HRHA 3O41A 4Y2NA 3VYPA 4GFXA 2BLFA 3BIAX 4JM2A 2QVFB 1CFMA 3T8MA 4YQXH 2WUCH 5FEBA 5HHXH 4LASL 3IGAA 4KX9A 4RAUB 2EUWA 4PBXA 1I8MA 5ID0A 4EOWL 3MBED 2VLRE 4G6AD 3T9WA 4FQ2H 1ZGLM 3Q48A 2BCKB 5I1EH 4FFZL 5K9JL 3CIAA 3OHMB 3U4EB 1CR9L 3ARSA 1OPGL 1OGPA 2KH2B 2V9RA 4IMLA 4YDIL 4QRSB 3PGDB 1HHIB 1KTCA 4NFBA 3UG5A 5A2CA 2X28A 3P4MA 2V0AA 1LO3L 3AS2A 3I84A 2F53E 1SHSA 2VM3A 1MWOA 3NSYA 3WNIA 3PWJA 4I77L 3HOGA 3VXSD 3ZRSA 2QSVA 4L37B 4P46C 4HJ0C 1FVEA 3TX4A 3EJJX 3EOAA 3I2CH 3OWRA 4R8WH 5F7KC 4DKAA 1RPUA 3H9SD 1RK7A 4Z1PA 5KOMC 5T1DH 3O6KL 5T3ZH 5CR1A 3B2UD 5JW3L 3ISWA 4U05A 1XVSA 2AERT 2OMXB 3WL9B 3G5VB 2BVOA 1RUQH 1SXZA 2EXYD 5CBAB 3K72A 2CO2A 3LQAC 3R06A 1KN2H 3D87B 1EJOH 1NFDA 4WKZB 4FN0A 5IHHA 1LJMA 4HS6B 3ZKSD 4HPHA 1GXEA 4JMNA 1XSOA 5T1LD 2XACC 2BX5A 5IP4A 3BKYL 2K78A 4FD0A 4WHDA 5EUKA 3EJSA 3RI5F 3RB7A 5BJTB 4ENEC 2FUTA 4JY6A 5IG7A 4AGPA 1U2HA 3EFOA 4OUUA 5B4MC 2LU5A 2OMNA 5E6SB 4ALAH 2VZSA 5ACLA 4HMDA 2GITA 1RUMH 4Y5XC 4GINA 4WHTB 3L3IA 3MCG1 4Q6IC 1I9RH 4OZHB 5D7IA 3BJLA 5F9JA 3C2AL 1KNOA 2JTYA 2H26A 4IRSA 4RMTA 5C08D 3UC0L 4LLAA 5GRZA 5JA8B 2IH3A 4LCYA 4MZIA 4XN1A 1C1EL 4F37K 3LZFH 2CO7B 3QNXA 5CGMA 1N8OE 1CK0H 2P5EE 2R29H 2HT4C 4PR5A 1B2WH 4A7SA 3EO0B 1A2YA 3WSQH 3GSXA 4HSAC 2AJYL 5I1AA 5JHBA 1OAZH 3Q7JA 4AGOA 3UX9B 2ESVD 3S8GB 5EEYA 1DZBA 2ZAIA 1AQ8A 4NPYA 4AQEA 5GGTL 3CPLA 2Y06H 2E74C 3WJJC 2YPLE 2ZG2A 1ZLDA 4IDJH 1HHJA 3HUJF 4XNQB 2Q6WB 2VLLB 4TNGA 2OI9C 1MFAL 1I1CA 2YD0A 4JL2A 2OZ4A 1FGVH 3ATFA 4GW5B 4EIZC 4L8CB 2UY7B 3FB6A 3WE1A 4XMPL 4NKIH 3IJ9A 1UZ8A 2RB8A 4N8CH 5C07E 4BK5A 5E8PB 3QQ3B 5IHZB 3IWUA 4NNYB 1NGXB 2N1KA 1CLYL 1LEKB 2FHCA 4JG0H 1SN0A 3FQWA 3MV9E 3QUZD 4KJQC 4DUVA 5ITBH 4ILDA 4O2CA 2CHWA 4UYQA 5FOBA 5IB4B 4KAQL 2Y6TE 2GY5A 5GIRA 1USZA 3UMNA 4B5ZA 2F68X 2H6UA 4N3TA 3JYBA 4GIOA 4NEHB 5BRZA 1E5AA 5BMFH 4BGDA 2AXHA 3W3BA 5E1AA 4NZFA 5C09D 2B15A 2YR3A 3FONA 4LFHG 1JJUA 4PHXA 4X4ME 1BBJB 1NGWA 3TWYA 1B3JA 4HIJB 2C9QA 4PJAE 4X5WA 1KJMA 5JHLH 4NFDA 3ZY7A 3DHJA 4Z7IA 1RCYA 1PZDA 3SY6A 1JZ2A 1H5BC 4TUKH 3DO7A 3D08A 1GGIL 4XXWC 5DJZB 1YEJH 4F5CE 3BAKA 3WGVB 1J1PL 1MW1A 4PD4K 4IS6A 3DX7B 3TVMB 3AY4A 4CNIB 1CGYA 4GSXA 4FQXB 4OKDA 4JHWH 5I82A 3ZE1E 2IPUK 4LVNC 4BCXA 1PBYA 4L2LA 1NOAA 1OTTC 1UA3A 5ICZB 4MJIE 4X5RA 3LIZL 4WK2B 3JWNE 5IMMB 3IU4H 3N44B 3MCKB 4WCYH 5LQBL 4AE1A 3F6LA 2XFXB 4NLHA 4P46A 5SX4H 2DY2A 4L4JA 4OLVL 4DESA 4JO4L 1EGJH 1FC1A 4TN9A 4ODVL 1E40A 3TZVD 1LK2B 2OTPA 3GZQA 3JVGA 4TSBH 5SWZB 4YHML 1V10A 3WELA 1GPOH 4FLHA 4OCSH 2VDOH 4TV3A 3ZTJH 5KVDH 2FT6A 4LCCA 4GB9A 3SDYL 3IJEB 1FORL 3G04B 1FZOB 3IRPX 2WXGA 3S4SB 1X4ZA 4Q89A 1GYWA 1U91A 2DQJH 4K3JL 3K6SA 2VZVA 3QDMB 3VNZA 5J56B 3MODL 4QJ5B 4NQDD 3S97C 4KQ3H 2BY2A 2OJEB 4BKSC 5C7XL 1X9LA 4KGJA 3MV8E 4N5UA 4PLJD 5GGSY 3ROLB 3B9EA 1ZLVK 2E7BA 1HCZA 2ORBL 2WNGA 3B9KC 3BQUD 3KYKH 4Y5XA 4U49A 3VUAA 1JWUA 3O0RL 4Q6IA 3AWFA 2ICEB 4JCLA 2F1AA 2IBZY 1H9DA 3QUYB 4PRHB 1NCGA 2A38A 3K8KA 3GSUB 1QBLH 1YJDH 1T0NA 4ZMXA 1F4XL 2C1PB 4LCWA 5EBLB 5AL8A 1E8XA 1JRHL 1UA6L 3L1OL 4DT2A 1N59A 4FTVE 1UD2A 3MFFB 1NH6A 3H6AA 1MOEA 5T5FL 4UQ2A 3V0GA 3GF8A 4C56B 5F3HA 4G72B 5IW3A 1HYRC 4RGNE 1AG6A 4EI6A 5IMLA 1G0XA 1IGFH 3N04A 1QI4A 5K9KA 2TSAA 4M4RB 3APNA 2WLLA 4CA4A 3HG2A 2HT2D 3DETC 4XRCB 1VIWA 4S1SH 4UTBA 3VXQB 2HKHH 3IVKA 1S7TB 3O2DL 3BUTA 2LAGB 4JHAL 3QCTL 4PW4A 4Y2DC 3WJJA 2V7NB 3KXFE 1BAFL 5I1LA 1JNLL 5E7BA 4ZFFA 3BN3B 2A77H 3ZMNA 3OKKB 4LQFH 2OSYA 2DYSB 4ZTPL 4JB9L 4LRNL 2VZTA 3ZDWA 3VGHA 4KKBD 4JRYD 2Y5TA 2WQSA 3BO8B 5KJRH 5KVEL 3GHEH 1EO8L 4DP1X 3V6OE 3EF4A 2DRUA 3VI4A 2PO6C 1WZAA 4HIXL 4IGBB 1MEXH 2W8CA 1D2OA 4KPHH 5ANMA 3HNSH 3VGBA 2DM4A 1W72H 3EKCA 3BH4A 2JKNA 5GZND 2XVBA 3OF6A 4XCYB 2GABA 1L6XA 3I50L 1MCFA 2OZNA 5DUBA 4DPCX 1U92A 4OFPA 2WO3B 3NH7H 1GGBL 3OKLB 1NICA 4P57B 4ELKA 2QSCL 1DSWA 2X12A 1E0OB 5GQBA 4B7LA 1TOXA 3L9RA 4ZDHB 3OGCA 2CK0H 4EN3C 2G0LA 1HOCA 1S7WB 2HFEA 5I28A 2JI3A 1J0IA 1E9OA 4YSPA 3CFEB 4HQQL 1HHHB 3PLYA 1S78D 2L7QA 3OKDA 1FAIH 1K3ZA 4NO0A 1RIVH 1GTNA 4KVCH 2OSLB 4XGZB 1TFPA 5FECA 1DBML 2AABL 3UTTB 1NC4B 3RVWD 1J05A 1JXDA 3GK8H 2YJLA 3QJRB 4NS0A 3TJHC 1FNSH 2APWA 3QWNA 1DBJH 5IMOB 3OGOE 2CKNA 5I75B 1H5BA 3IGUA 1YNKH 3NSCA 1TJGH 1CD0A 2F54E 4IU3A 4XXWA 4E5XA 3K46A 4RFNB 3P0VL 1E4WH 3OPZH 5D7LE 5IVZA 3IGAB 2XZQH 1KTJA 4I89A 1MQKH 2I5YL 3CBJB 3IE4A 5ID0B 2AW2A 3QO1A 4UOQA 3EH2A 4TNVF 5GRWA 4CUCA 3EGSB 1X5IA 4JZJB 3E6FB 3MRFA 1MSPA 3ILQD 1ZEAH 3KLSA 4IMLB 2DWEB 2BERA 2ZQKA 5HHMB 1RQ5A 3P4MB 2XG4B 3CLEH 5FO9A 1JGEA 1JZJA 3DIFA 3BPCA 1AXTL 1XZ0A 4BYHA 4Y1TA 4DF9A 5ESVA 5ESQA 1NOLA 5KEZA 3EOAB 5DWUH 2MJWA 5GHWL 4BE6A 2YBGA 4NSKA 3A6CH 3VG9B 1D5XB 1ML0A 3B7YA 5HYQA 1MXGA 4F9LC 3DV4A 2GPZA 2WYHA 2XWJA 3WFZA 2ALAA 4PRNB 2HG5B 3S3DB 1FH5H 4LO9A 3TYFA 4B9CA 5F3FA 5KJ7E 1NCAL 2NT1A 1NTDA 2QVTA 1C5CH 3OAYK 2ARWA 4DETA 5JW4M 2PP7A 3C5SA 3BVXA 3I75A 3EO9H 1CFNA 1V3MA 3X2QB 3SIKA 1ET5A 1OK8A 3PFQA 4JY6B 3ZDZB 2YA0A 1M1SA 3ZE0F 2G2NA 1CLCA 4QF1A 5I5JA 3CWGA 5C0JA 1JZ4A 1F42A 4X6DA 5FFOA 5KSBE 2MKLC 1J0HA 1ZLSH 1G1YA 1BREA 4A1RA 1O7DC 3RKDD 5F9JB 2WQXA 1KNOB 1HH9A 1MCLA 2H26B 3GXNA 2YLHA 4BDVB 5L7XL 2IH3B 2DN7A 1FSKC 2ERJC 3O6FB 4LCYB 1F2QA 2FECI 1CE1L 1KCSL 4GEJA 4FABH 4WY7L 4K94C 4J8QA 4HJSA 4PR5B 1YEDB 1WUNT 4AL8H 3NCYP 4KOCA 4XO3A 3KL5A 1A2YB 1J5OL 3UAJD 2R8SH 3GSXB 4X98B 4R97B 1R5IB 2R51A 4GT7A 1IGIL 1GZQB 4KVNH 3FT1A 3CZJA 3LSOA 2CGRL 4M1CD 1C5BL 3QWOA 4M6OL 4NO2A 4NPYB 3EYVA 3R1GL 1XGTA 4PP2A 4FYSA 5L6YH 4FEMA 3RY6C 5CZKA 1HHJB 2WANA 3TWCL 2G9HA 3VXTB 5IVXB 4PJ7F 2PO6A 4BXVA 5FYLH 3ZT6A 1SVCP 2GAZB 3UZVB 4NO5B 1WWAX 3MV11 3RKPA 3FB6B 1B4JH 3SGDI 3RY5A 1TPXC 3GXMA 4YX2H 2JKSA 1KPVB 2YRBA 5CKAA 4U6VL 4QTHB 2JQMA 3MCLL 4PJXB 5JXAL 4EN3A 5IR1A 3HRPA 1IC4L 4CC4C 3BP6A 3M46A 2ZCLL 4AT6A 1RIUH 5DMKB 1HC1A 4J3OG 4KRNA 1PY0A 5A6MA 2YEZB 2WLKA 5DUJA 3VI3E 3SDXA 3CN3A 1FLRL 1ORSA 3RWCA 3LHPH 5D8JL 3RAJL 1SHXA 4AOFA 1JZIA 1JD9A 4ZUWA 1NGWB 3SYPA 2BOCA 1AO7B 1KCRL 2P26A 4U2ZA 3RG1C 3DSFH 4PJBF 3MNZA 4WFGD 4OQTA 1CGUA 1DUZB 3VE0A 4PRBA 3U82B 1B0GB 4KKCC 4HWBA 4OLUH 2PPCA 4HX1B 4YVNA 5IWLC 1HZKA 3TL5A 1VEMA 4CVWA 3G6JA 1KCUL 3U79A 5C2UB 1CFTA 4FFWC 3CZKA 1W2KT 1ADWA 4CKVX 1GCFA 5TDOB 1ACYL 4JFQA 3BSHA 1L9TA 2Q8BL 2FATL 4Z7WE 3B2MA 1PPIA 5A2AA 5AW5B 4FYTA 2YAMA 1HEJC 4R90L 1GKEA 1ETZA 4MAYC 1NCWL 2GSGB 5H2BA 4JM2D 1DUYB 1TZIB 5DD5L 3GSOA 5I76A 3ZYIA 1AH1A 1YYCA 3AXIA 3M17A 4G6JH 3UZQB 4S1DD 5IUSA 4F9LA 1S7SA 2DTMH 4JPVL 2OV0A 4W9FC 4K2UL 2M2DA 4QRUB 2GHWB 2AV7A 2VM9A 1JFQL 3OR6A 3SE8H 2XV3A 1HSBB 1DANT 5D96C 5AZUA 1RURH 4B95C 3B83A 1X5XA 1BVLB 1J18A 2O5YL 1HH6B 3HG4A 3QNYA 5H8DA 3Q5YA 5F6HJ 4NKQB 1LDPL 3K6SB 1EHNA 4F57L 5EO0B 1YCSA 2NR6C 3LQAL 3MYZA 5D1ZC 5AW4B 3EOBB 4F80A 1A02N 4PWEA 5HYFA 4N28A 4Y19E 5LBSH 1ZGLP 4MHHG 2FAUA 2PCFA 4LASH 3EF7A 2OULB 5CWSB 2AMGA 4OV5B 2WB7A 3FKUS 2VN5A 4EOWH 4EBQL 5EH1A 2HG0A 4UCFA 3HI1A 1HXMA 1AGBA 1M1XB 1JWUB 2NNFA 4FFZH 4UILL 4Q6IB 4JO1L 5TE7H 1YVLA 3SDAC 1CR9H 5DMJB 3DGGA 5E1GA 1A6TA 5C0EA 3WUWA 5D70L 3VD7A 2JI2A 1SF3A 1T7ZA 1T0NB 1YHPA 1YYML 2F58L 2YA2A 3HB3D 3KVPA 4LCWB 4XMTA 1LO3H 4NHCL 1N59B 1PZ5A 3DPBB 3EGXA 4WU5A 4E5XB 3KPLA 3GRBA 1OF0A 3GB7B 4ZOCA 3GRGA 5HGHB 1LGVA 4WU7A 5IMLB 5F3HB 2Z92A 3MN8A 1T1ZA 1R75A 2YQBA 1Q90A 5TFSH 3RI5K 3TBBA 2VLJD 3U2SA 4Q9QH 1MJUH 5GZOC 1HCVA 4OGAC 4JFWA 1YN6B 4H26B 3BP7B 2GBAA 4IEFA 5A40E 4B0MM 3IVKB 1QUNA 1RHFA 4LOUD 1XSJA 3QDGA 1G4RA 4TVPE 2UX6A 5I1LB 2DIJA 1U8JA 3EFFA 2H0JA 2OI9B 1WZ1H 3ES6A 3EYOA 2Y5TB 2XUWA 2R1WA 1X44A 3EJCA 3KLAA 3BKYH 1FO0A 4G7VL 2VDRL 4V33A 5E0FA 5ANMB 3VFWA 4ABUA 1UGKA 3RVXD 5BO1H 2MNJB 3TH4T 2Z0UA 1YECH 4G6KL 3DJRA 5DUBB 2EIJB 1NPUA 3IDXL 4CC4A 4ELKB 3TEYA 4WENB 3KAAA 1MH5A 3L9RB 1BOGA 3OGCB 5C0ND 2HFEB 3P9LA 1KC5L 5FYKE 3D18A 5I0ZA 3UC0H 3BXNA 1E9OB 4F2ME 5IB5B 1SHWA 5LG1A 1C1EH 2OCJA 2OX5A 5F7LB 2O61A 4QRRB 1MF2L 2CLRB 2X4TA 4JRWA 2ZUYA 4UU9A 5KS9E 5HDBF 1ZMYA 4ZFOB 2CRZA 4GY4A 3CFMA 4XC1L 1J05B 3QDJE 2IFFL 3RVVC 2J1ZA 2Z65C 2QHRL 4DERA 1OALA 2C4FU 1X5KA 1DZ0A 3QHZH 4WK0B 1F2XK 3UOAB 4ZFOL 3OMNB 3RIFF 3ZPDA 3MV7D 5GGTH 3MUUA 4F2EA 3HNVH 4AJWA 3VCLB 4K3GA 3DRQA 5BRZD 3AXHA 1IILE 2XWEA 4FYRA 4LVNB 3ZRFC 4OCMC 5DZNA 3QO1B 2OBGA 4OZIF 2VABA 2DL9A 3I74A 2J88L 3QCUH 4HJ1A 4XMPH 5CSZA 3RJDA 2XPGA 3QZNA 3Q3GB 4MAYA 2HJKA 4M62L 1GW6A 2YD5A 1I85C 4KRPB 1IFRA 5FO9B 1N18A 4A2LA 1JGEB 1LVEA 1AYOA 1M57B 3DIFB 5CJ5A 3BPCB 3OKYA 8FABB 1Y7VA 3PYCA 4DN3L 4KAQH 1QSFE 3JV5A 2JJTC 4ES8A 2J6EL 1HCFX 4HLEA 2BHFA 4B5EA 3IGKA 1XEDA 4JZNA 1KGXA 3F6JA 1YO4A 4G1EA 4N3UA 1DSYA 1MUJA 3INUL 4C58B 1MPAL 2FO1A 2E75C 1W0VA 3GC3A 4E41E 3NEOA 3D0VA 2XWJB 4FZEH 2GTWA 2CJ3A 5JQ6L 3T6QC 4PBWD 1A9VA 1GGTA 1V5JA 4CRPA 4IBSA 3KGRA 2NY6C 3N40F 4CAGA 1S9XA 5E4AA 1I9IL 4MWFB 5D1ZA 1K5NB 4WGVB 4HT1L 4GLRI 1GSKA 2VSKB 3GSNB 4P46D 4O51A 5DGRA 5ENWB 3C5SB 1K2DA 4AYBA 4G3YL 1BG9A 2NQ3A 2OAAA 1GGIH 2O5ZH 5AVYB 2IVFC 4BUHA 5JW4R 1OM3L 4FG6D 1G1KA 5CHNB 2X10A 3B9KB 4ZXBC 3BKML 3Q9PA 1J1PH 3GSNL 1T03L 1JNNH 4BELD 4QF1B 3QYMA 5C0JB 3P0YH 3U6RB 4DN4H 5LJYH 1HL9A 1ZVSA 3K74B 3VFPB 2AQ3A 4B41A 1OTUD 5C92A 3D9AH 3HZ3A 3LIZH 3FU3A 1HH9B 3HI6L 4H1LA 5KTEH 2ZXWB 2LU3A 4GSQA 3RUGF 2M1KA 1OL0A 1ZHBA 5GZOA 4ODVH 1CICC 5E2TH 4C54A 4YHMH 1CMOA 1AGFA 5LAXA 2HUEA 2IWFA 3FTGA 5KSAD 4Y2DB 3U0PA 4MA7L 2Z1PA 4NO2B 3SDYH 3ARPA 1FORH 4UAHA 1CUOA 3WO3B 3GLZA 3GTTA 4TSAH 3GWJA 3F7YB 4BK4A 5I73C 4K3JH 1NSNL 3MODH 2PO6B 4LNRB 3LRGA 2VLME 3K2IA 4PV9A 1BXUA 1JOIA 1U2CA 1U9KA 2EE0A 2XWTA 4WEEA 3DOIA 4XR8C 4ZMZA 2F5AL 4OZ4A 4GI8A 2ORBH 2Y1AA 4AQAA 1SYVB 4P05A 2NLJA 3E2HC 2AZUA 4RGOH 1LP9E 1CIDA 1MELA 1WCBA 1ZHNA 2Z35B 4EN3B 5IR1B 1BMGA 4JFEA 4GRMB 4IOFD 5AB2A 2FLBT 1X3DA 1F4XH 3QYCA 4PFEA 1JRHH 3L1OH 4XP5L 1A64A 5TTRA 3PDDA 4ZAKD 4LSSL 4P2QB 5T5FH 4XBGB 3RWCB 3N6YA 5H94B 3SBPA 4ZS6D 4XMUA 3FB5A 4OCYL 4ZUWB 3X1EA 5AVXB 5FYLE 3OF6D 4N68A 1NM4A 5IIEA 5EFIA 2F74A 2IPTL 2LLNA 4XPGL 3QCTH 3NPZB 3QHTC 3GKWL 1IEBB 1LLAA 1BAFH 1JI2A 1OEZW 1JNLH 5F71A 2O6DA 4L1SA 4OSUL 1N3NB 4PRBB 3LEYL 2VQ1B 3VWKB 2YIHA 4MJ5B 4Z5RA 1A9BA 4ZTPH 4JB9H 4LMQE 1F8TH 1YLBB 1KEGL 2EEFA 4MSWA 4TSCL 4XC3L 3OX8B 3VXRD 2X4NA 1EO8H 1LO4L 3OR7B 4HCRA 4MNQA 1FQ9C 4UIMB 3WLBB 2DDQL 4XCNA 1FL3A 2AI0L 4QRTB 5DHDA 3S3PA 4HXBL 4WW1B 1BZ8A 4ZT1A 2EDKA 1OP3K 3W1ZA 3FRUA 1QFWL 4GS7C 1WBYA 3I50H 1XAUA 1QRKA 3B56A 2ZSWA 3HEIB 1GGBH 2FYVA 2Q5BA 4F24A 1HIMH 2WP3O 4WJG3 3ZYZA 3O6ML 4YSRA 3RGBA 1RH8A 4PRPB 4N8VG 3GSOB 3POCA 4GKNB 3TO2B 5I76B 1KTDB 1OTTD 4HQQH 1MCKA 2QKIA 4HWUA 4JR9L 5DJ0A 3C2SA 4P3CL 3TNNA 3KM1A 2HFFB 5DTFA 2AV7B 3C08L 4DCQA 1IAKA 2WO2B 4WO0A 1DBMH 1F13A 1UD4A 4JRLA 1XBDA 4P2RA 2J8UE 2B77A 3DK0A 2Y3AA 1KLUA 1B90A 1YNLL 2HRLA 3QNYB 4HWZA 1G6VK 2X9YA 3FXIC 4F8NA 4CVZB 1NCBL 3NN8B 5CGTA 3J07A 3L2MA 1H6FA 4F7MA 1LE9A 3RGVA 3T0EC 1R17A 1NMCC 1IC0A 1F4YH 4UT6L 2HMIC 2BVTA 2I5YH 4ZTEA 3VW3L 3I9GL 3OD3A 5F7UA 5B3NA 3P40A 4Z7UF 5DDHB 4PJEF 4PJ8B 4HU8A 1A6TB 1NAML 1KYAA 3WUWB 5C0EB 4KKLD 3REVB 4U1LA 4ONHA 1FSKB 2BMKA 2BW5A 3UIZA 3HUJA 4AEEA 1PZ5B 5IFAL 4WU5B 3ARXA 1CICA 4MNGA 1QFWM 5BZWA 2Z92B 3DA0A 1KGUA 2Y9RT 3NIFE 4I87A 4Y1AE 4XAWL 3U2SB 3DUSA 3X3GH 1T21A 5GHWH 1HZLA 2OCCB 2GSIA 5F8RC 1JXJA 4ZSOA 5HYSG 4N86A 4I18A 2WQAA 1RU9L 4WI9A 2GJ6E 4HGMA 3VXMA 5GS0C 2WNKA 2M83A 5JTWA 4HEME 3CFNA 2EZ0C 3S34H 4BZYA 3EFFB 1ZDSA 1NCAH 4FQ1L 1OGAD 1ZCRA 1MIML 4OFVA 2NY0D 1FG2B 3IM1A 4XOBA 3EYOB 4NN6C 3VB8A 2OMWB 2VNCA 3D3VD 5HHOE 2IAMC 4PWKA 5DVKA 2IH1A 5F7YC 1FYTE 1RSYA 3X12A 5K9OB 3A4FA 2UX7A 3RWFA 1FO0B 3IAPA 1TPXB 3MUJA 1ZOXA 3Q8EA 4HFUL 5I8OL 2YO3A 3CUPA 1AE6L 4Y4FC 1FAKT 4JFFE 1NWOA 4Q9CA 4ECNA 2NDGA 1BLIA 2WSPA 3U9PL 2CDGA 4QXUL 2C9SA 4ONGL 2EILB 2ADYA 1BOGB 1O7VA 5E9DB 3SJVE 3F7RA 5K9QG 1GC1H 1YUHA 3UROR 4GW1B 2G5BA 3S2CA 1ORQB 3X13A 2E9WA 1CE1H 1KCSH 2VWEC 3B3BA 4KTGA 1U6AL 4LHJB 2YGOA 1NDTA 2B59B 4UU9B 4NO3A 1WWWX 1U8CA 1OGSA 2PETA 1XIWD 2CRIA 1KTBA 2WVSA 1Z3GL 4JS7A 1IGIH 2V5MA 2VISB 3IFPA 2HAZA 3UO1L 4POZC 2XTJE 2X3CA 1T66D 3U4BL 4YBQD 1HKLL 1MAKA 3R1GH 2B5IC 2EDQA 3QEQA 5JORA 3ZN6A 2MSPA 3B2DC 2DWYA 3H3BC 3D50A 2D4FA 2ZUQC 4Z7NE 3CFDB 4BIKA 4HOMA 4S0SD 2Q2LA 5BUAA 1U93A 1VHPA 3H4FA 1I1FA 4XN9A 4L18A 4HKXA 2EIKB 1D5BA 3D39D 5SWSA 4UZUA 3TJHD 3BVTA 3M7OA 3E8UL 1DDHB 4N2GA 3A6BL 2DBLL 2GB2A 2XPGB 1HEHC 2DD8L 4MAYB 2HJKB 3KPOA 3ESUF 2V2WA 4U6VH 5JQHC 1YPZF 4GSUA 1G4MA 5JXAH 5A16B 2PWEA 2WBKA 1VFMA 1IC4H 1U3HC 2HKFL 4H8UA 2XQYA 2ZCLH 3GMRA 1WPCA 3NT0A 1NEZG 3QT2A 2J57A 4ORGA 5ILTL 2MCG1 4M3KB 2JCCE 1RI8A 1KDJA 1NOFA 3HC0A 5D8JH 3RAJH 1TZAA 5DA4A 4AYGA 5D96B 1KFGA 3B2VL 3FMGL 2GTWB 2HX8A 1OGTA 3LQZB 3T04D 1KCRH 1WWCA 5D1XC 5AOKA 1BDYA 3QJTB 4DVBA 5F1NA 1S9XB 2F0CA 3O3BB 5D1ZB 3T0EA 3B9VA 2GK0A 2HCZX 5DRNA 3VSQA 2P42B 1LMIA 2K8QA 1S7VA 2Y36H 5AKTA 5CEZE 1GS7A 2XWXA 4WSJA 4OBRA 5IKCB 4NI3A 3C5XA 3PWPD 1QG3A 1BVZA 5IHBA 1KCUH 4B9ZA 3SDAB 4IBUA 4KZDL 3HC3L 1J8SA 5C08B 4KZCA 5FWQA 2JWYA 2D4DA 1JXFA 1HU8A 5C0IA 1ACYH 4HSCX 1WC7B 1MDTA 4J6RL 2FATH 4LLMB 1F6LL 5DO8A 4G8GD 3VRJB 3RVTD 3DI3B 2ATKB 3RURA 3HE7A 3CE1A 4R90H 1JV5B 3NJIA 2BS9A 5CAYB 1LO0H 1U8QA 3MLYL 3TA3C 5DD5H 3UTSA 4LEOA 2GIXA 1AGFB 4PB0L 3FTGB 3PP3K 1AR1C 2DQTL 3NCBB 4JPVH 1OANA 4Y5YA 4K2UH 4HFWA 4L48A 4ACPA 2ID5A 1K6QL 4QRFA 3ZGIA 1JPST 1I1AD 5KN5A 4IKLA 5J57B 2O5YH 3D2UA 2IAMA 2VXVL 5E8OA 5FGSA 4IRJC 2DWDA 5DZPA 1LDPH 5E08L 4F57H 3BSZL 4M7ZC 5EG6C 4DEPC 4KJPD 5HPOA 3K8MA 2A0LD 3LQAH 3BEVB 4PV9B 1DEEA 5FW7A 1Z5LA 1EANA 2X87A 4L1LA 4GBXC 1ND0A 1XT5A 5EF3A 1JMXA 1QLEL 4PGEA 1DVFC 4OZ4B 1XWVA 2A9DA 4AQAB 3H2WA 3QDGD 3ZO9A 3OKEA 2E9IA 4JO1H 4LIQE 4X7FC 2X4UA 5AZ2L 1W8NA 3SOBL 2NY5L 2H32H 5A3IC 4JFEB 5D70H 1BZ7A 4DWHA 3TCLA 2DI7A 1FN4A 3KGSA 4JFVA 1F41A 2F58H 2FGWL 4N9GB 1N19A 4PUBL 4NHCH 5KW9L 2K3HA 2EKSA 1O75A 3HG0A 3K0YA 3TBVA 3F58L 4EZJA 5L2KA 3DVIA 3KGUA 3GXFA 6FABL 2G0KA 5A2IH 4GAJH 2DKUA 3NGBC 2OL3A 1B9KA 3N1FC 4G9FD 3EUDA 3KLLA 3GJFA 1EXUB 1CDCA 5T5NF 5EFIB 2KI6A 2F74B 3K6IA 3QPKA 3VJ6B 4A2HA 1ZLUH 2IBBA 2BFGA 5GRJL 4RMWA 5DXWA 1J10A 1N7ML 4N2MA 5F88A 2FQFA 4PGBB 2WZ6A 4M8RA 2V5SA 4W68A 3IF1A 3V6ZA 2K9UA 2W9EL 5LB1A 1JZ5A 4Q9RL 3CHRA 2EDJA 3SO5A 4WGWB 5E8DH 1NDMA 1IARB 4G7VH 4XCNB 1FL3B 1CDIA 2O6CA 2JKLA 3MREA 1PLAA 2VJ8A 4CVXB 4ZUSB 5FDWA 3FRUB 5CD3A 1MAMH 1WBYB 3HG1A 3DMMA 3T4YA 3MROA 3QJZA 1U3HA 1K8DA 5CMAA 1J1OL 1BYNA 4W9CC 2DQDL 5IB2A 2X2UA 4X6CB 2IDQA 3WTVA 1CGXA 5IOPA 2V7HB 3IDMB 2X3BA 5FO8A 1LWJA 2ZWNA 1M7DA 1D9KA 4D0CA 5DJ0B 1L0XA 3BPNC 2CO3A 5J9PB 1N26A 3BC9A 1QPXA 1MF2H 3L9EA 4DCQB 2NY6B 5KVEE 4JN2A 1HAWA 4XC1H 4MYPA 3S35X 1KLUB 2IFFH 4LVHC 4ZMVA 2QHRH 1L9PA 4G7YL 3U36A 3THML 3A4AA 1CURA 3IN0A 5TF1H 3ZO0A 4X9FA 2VN3A 2ZICA 1ESOA 4X8XA 3VXNA 5HYSB 1CE6A 3MMEB 4ZXBB 4I3GA 4L4VE 1XGQA 1QO3A 1R24A 4N20A 3FSOA 2VH5L 4GO8A 3RL2A 1IGMH 1QKZL 2NPLX 3FQ1A 2D7PA 1TG8A 2JE8A 1I4FA 4XNXL 4JRXB 2J88H 3EBIA 5ALBH 3RIAF 3EJZD 3VMOA 4OD1L 2EKJA 4JPSA 3CH8A 4M62H 2BMKB 3GMPB 1NMBH 3R8BB 3UG3A 2WXHA 3TA3A 3A67L 3GMNA 5GGVL 3ZL2A 2J5LC 5C0DB 4L3EA 3UEQA 2QTEA 3KZ8A 2FNWA 4PJIB 5BZWB 4F9PC 2Q87A 2C1OB 3ENEA 4Z7VE 4PGJA 2V5TA 2J6EH 2VIRA 1ZE3C 3DUSB 1UEYA 4XPBL 4BFKA 2GSIB 3AU1B 1YMMA 1ZHKA 2IDFA 2PMZA 1KT2A 3INUH 1K5WA 2KMWA 1MPAH 5I6XB 4MXQD 3S3BB 4S0HA 4FQJL 3VXMB 2YWZA 4RIRA 4I4WA 5JQ6H 1M71A 5I1IL 1F6AA 4CW1A 5I73B 1IVTA 4Z76A 2EE9A 4D9LL 4XNAA 1IFGA 1I9IH 3IK2A 4J3XA 4GBXA 2IH1B 4J5VA 2YEQA 5GZOD 1G9MC 2BNQA 4G3YH 3WIFA 2Q7AA 3X12B 1Y6NR 4OGAD 1OM3H 3WG7B 2HXAA 3L5XL 1FA4A 3H2PA 3BKMH 3S88L 1Z9OA 3E2HB 3GSNH 1T03H 4WF7A 2BHUA 3MPCA 4HIIA 1UZGA 4ODUB 1NPNA 4LB8A 2HVKB 4PJBA 5GGRB 3NDZE 1RZJL 3LNHA 5BNXD 1EQWA 5FM8A 8PAZA 5C0AA 3TEWA 3JV4A 1AZCA 4IJTA 1BD2E 1MLCA 3Q01A 2CRYA 3GIZH 4QOKE 4PLKD 1OQXA 2OMTB 2G5BB 4OT1H 1OAUL 4XMKL 1GAFL 1E3XA 1X7SA 3X13B 1QLFB 2FEDD 1NGQL 1WBZB 1TYEB 5JW4Q 4ZBJA 4TUJA 3BX7C 4NO3B 3ABMB 5LAPA 4MTMA 1HAUA 3UADA 3L3JB 4MA7H 2YD4A 5EEXA 1OZUA 1IM3A 1E27A 5KSBF 2P28B 1KIQA 1KY6A 5H37A 2YPVL 4X6BB 4Y2LA 4PJHE 4HVBA 3QEQB 1KXQA 5JORB 1VENA 3HBPA 5ADOL 1CVRA 1W6LA 4OB5H 4J3OH 4ZMQA 2EIZB 3NESA 1NSNH 2I7OA 4KDWA 35C8L 4ZFQA 32C2A 4HV8B 2XYBA 3HNTH 4K3EH 1XR8B 2Y7QA 1CYWA 5SWSB 1O0VA 3Q2NA 4KV5F 3RLSA 4L2YA 1KLFB 4K5MA 2H41A 4GS7B 2J55A 2X9WA 2XJKA 1KG0B 2J2ZB 2F5AH 2L7EA 3JSSA 1ZKAA 2PPEA 2OYKA 1EJ6A 5F9WC 5L2JA 1IQDB 1YG9A 2C3VB 2X4SB 1JWSB 1W0WB 1XTLA 3WTUA 2ZX9A 4KXCA 5TH2B 3GMRB 2DYPB 2I60H 1XF5A 5IQ7L 3ZJAA 1U41A 3ALPA 5T1JA 4XP5H 2K6ZA 2HJLB 4MNQD 2NW2A 2RGSA 3GDCA 4KGLA 4LSSH 1PZ3A 3HC0B 2FJFA 4JFSA 4XCEB 5EZPA 3D25A 1P4LA 3CFBA 4NB7A 2BDNL 3WAKA 1KPRB 4OCYH 3K91A 1QHPA 1OAYL 4BD4A 4NKMB 4TSAL 3B8SA 3I3EA 3V10A 1KBVA 1NCIA 3CHOA 2YN3A 2O6EA 3L4VA 4CBPA 4DVBB 3O9WC 3RWGA 2IPTH 3DIVA 2Y6SC 4XPGH 1MHEA 3T0EB 4C83B 1NMCB 5DRNB 3I6GB 3GKWH 2E7HA 3O3EB 1S7VB 2AJZB 4L9LA 1ZT1B 2ZJSL 4M3JA 4HK3N 3OJDB 1BFSA 3W56A 1UM6H 5T3XD 4LLWB 4XC3H 4YSUA 2X6VA 5HVGB 3PQYA 4F7KA 1KYOJ 1LO4H 4BFNA 1AOHA 3S5ZA 4Q4IA 5D7LD 2AI0H 1C08A 1SEQL 2VDNB 4P2RD 1X4YA 4YE4L 5T33L 3ET9F 2CBMA 2ENYA 4P2OA 1J8HE 2N56A 4DK6A 3LN5B 4KO7A 2Q86A 4LSPH 5H4YA 3RB5A 2Y07L 2PXYA 2YD8A 1EVUA 1EJ8A 1SNRA 5D7KE 4NQSA 1U8KB 1E8YA 1N6VA 2WIIA 2VDNL 3RGVD 2VZUA 4JFZL 1QYGH 5EUOA 3EO1A 3O6MH 5E94B 3DRTA 2NNCA 3UTSB 1REIA 2IDCA 2C9RA 1P4BH 2Y5EA 1CDHA 3FFCA 4JR9H 2ZYRA 4K7PX 2V5YA 4P3CH 5DJXB 5J1AA 5EN2B 4ERSL 4YHLL 2PYFA 5I15L 3A6OA 2AAAA 4DKTA 3BOVA 5I0YA 4Z7WF 1OSEA 5HHVH 1LD9B 4NN6B 5JYLA 3HPJB 1OWWA 1L4IA 4JO3H 1YNLH 5KN5B 2IAMB 4N8UA 5E8OB 1HSAB 1Z9NA 2DWDB 4OFQA 1NCBH 5HY9B 3HHSB 2R0WH 3BAIA 3N9GL 3B2PA 1R9FA 3E9UA 1WBXB 5C0BA 4UT6H 1ND0B 4UT9A 1WRFA 2NX5B 4Y4FB 4P5MA 3BFOA 3VW3H 4PGEB 2QQQA 1EPFA 1MFDH 3MJ9A 1Y07A 3I9GH 1UKTA 3WFEL 1SN2A 1VACB 4RAVA 2MHAA 2X4UB 4PJFE 4XNZC 2ZCKH 4F7CB 1NAMH 1Q9KB 4KKAD 4H0IA 2WXNA 1K3IA 3C5ZC 3FT0A 1FN4B 5CN1A 3MRNA 1O9WA 5B38A 4YAQA 5I0XA 2Q76A 1YN7A 4OZIA 4KXAA 2EDEA 2G2RB 3K80A 4RA3A 4C59B 1QSEE 2WVUA 5C97A 5L2KB 1EFXB 1R3IH 3FU8A 1S6NA 1J9RA 1QWNA 3IFLL 3MRCB 4ZRGA 4Z7AA 3ME0A 4XAWH 1BF8A 2OL3B 4S1QL 4FQQA 1XF1A 4K94H 5KYYA 1SFDA 3GJFB 1T0OA 1MHPL 2YXVA 3MACL 4LPXA 3FTXA 1QP1A 3QUHA 3CFJA 3GSWA 1RU9H 1IM9A 2B5IB 4FMVA 4HWNA 4H8WL 4HS3A 5F88B 2AKRA 4L3AA 2DQIL 2ZUQB 5IROD 4FQ1H 1MIMH 3O4LE 4XXCC 2E9JA 5TQ0L 2QFPA 4YHNB 1ET8A 1UYWH 3H53A 4E42A 4F8TA 3WGUB 3EH1A 2W9DH 3AQYA 1NDMB 2ARJQ 4HH8A 4HHGA 2F8XC 5J3HD 2WXJA 4D8PB 4ELMA 5KBPA 3D4YA 1SXSA 1UCTA 4HFUH 5DJDA 5B8CA 1YDPA 2AJ3A 1IAIL 3DOHA 3MREB 3S36X 4QRPA 1YUKB 5FDWB 1AE6H 4LXFA 3T4YB 3U7AA 1FO0H 1XMEB 5EU6E 1UJ3B 1NCUA 1U3HB 1K8DB 3BE1L 4J3VA 3T1FA 4L29A 4MB4A 4YDJA 5F7EL 4KHTL 3U9PH 6PAZA 4L4TD 2ZUXA 5BZDA 4BRVA 2VW7A 4ONGH 2CK2A 4ATWA 5IOPB 4NNXB 1T22A 5BV7L 3ZSSA 1M7DB 3S35L 1AZZC 1TO4A 1JGLL 4DIXA 3SGEH 3NIDE 3WFDH 4AGLA 3KL0A 1U6AH 3IDIA 1B6UA 4Q6KA 4F33B 1NEPA 4L0ZA 5D1XB 4JN2B 1WHOA 3O9WA 2OSWA 5FM5O 2GG1A 3IJHA 3P9WB 1AP2A 4FLRA 3SBWC 4OLXH 5FWRA 3U36B 2CDEB 4GUPA 4BH8A 1GKOA 3L4UA 3UO1H 2CJUL 5J13B 5FF6B 3DECA 2FUQA 3N0AA 2TAAA 2KZKA 1HKLH 1I3UA 1CE6B 1XGQB 3VFSA 4ZUTA 4BSWA 3GRWH 1FFPB 3T4AC 4ABWA 2IANE 5D5ME 4NXSA 3DX8A 1O9ZA 2VR8A 1GSMA 1TZHA 4LP4A 2HT3C 2ZSVA 2FIKB 4I8DA 2GC4C 5KS9F 4XVTH 2QLVB 4N2OA 1Q9LA 1CLOL 2DBLH 1D7DA 3A6BH 1N0XH 4I0KA 4N0CD 2EVJA 3GUTA 2DD8H 2VLJB 3I02A 3TA3B 2HTKD 4P59H 1IAIM 2NMSA 3MCYA 1P7KA 5IW6B 3FUIA 3QRLA 1PQZA 1P7QA 3C60C 4KX7A 4WW2C 2HKFH 4PMEA 1MRDL 5DO2D 4JZOA 1GGYA 5J6SA 1AR1B 2VIRB 3TIEB 3V6BR 3CHQA 3GT6A 1N64L 3SYCA 1QQDA 1YMMB 1ZHKB 1TYRA 5HJBA 5BVJB 1KT2B 1OB1A 3ARTA 5DEFB 4OI9A 3F6IA 3B2VH 3FMGH 1F6AB 2AV1A 4IRJB 3HE7D 4M7ZB 4DEPB 4PJ9D 3WLWC 4ZX3A 3OAUH 4U7KA 2G2PA 3DNKA 1MCBA 4NQQA 4NUPA 4GBXB 4DSYA 2ZD0A 5HJDA 3IETA 3WIFB 3FBKA 4A2FA 43CAA 1BVNP 1DVFB 4XB8A 2HP4A 4L8SC 5FKAB 4N2FA 5DJ6A 1AKJA 3HC3H 3MRBA 2ZKMX 3HC4H 4AKPA 4ZODA 5KYXB 1CS6A 1G7MA 2BSSB 4QD2E 4XP4H 5CNHA 1KGJA 4KKQA 4PRAA 5DRXA 1XGRB 3C5ZA 3TA4D 1D2PA 4J6RH 1KELL 1E50A 2B9AA 5C0AB 2WNXA 3JV4B 1XF3A 3D2UD 2O6PA 5CBEA 4J39A 4MGXA 1MLCB 3H7BA 1DN2A 4HPYL 4MXVE 3STZB 4LSTL 1TJXA 2NXZC 3MLYH 5ETUB 3JTSA 3PRZA 1MFUA 2EECA 5MEPA 1VGKA 4TUJB 4BJLA 4YGAB 3H42L 3MUGB 2DEYX 3LRMA 3LN4A 4PB0H 2H47C 5DRWB 1JNHA 2XRAH 2EDWA 2DQTH 4QXTA 3VGEA 1DQLL 5FFLA 3GBLA 5M94B 1N5YL 2VXQA 4U1HB 5KYUB 3BAYA 1AQHA 1ZANH 5HBBA 3WCYA 1TQWA 5C3IA 1K6QH 5JOFA 4XXCA 5T1MA 2V2TA 4AM0B 1AS8A 2ZOLB 4PYHA 2YWYA 4XPHL 5E08H 1FDLL 2P1YA 2IPUG 4WUUE 3BSZH 3U6XA 4V2BA 2NTFA 2VUYA 32C2B 2XOTA 2EINB 2Y7QB 3FO9A 4XCCL 3D09A 5TDNB 4HULB 5DK2B 5I17A 2XN2A 5PAZA 4IHOA 3FRPA 3SY0A 5IK3B 1MWAA 1AY1L 1BEYL 4KDTC 5EOTB 2UXFA 2R23A 1U95B 4R7VA 4U0QB 3QO0B 4MJ6B 2YPKA 4BUQA 4AEIL 2ZXCA 3SOBH 5CD5C 5AZ2H 3WHXB 2NY5H 2E59A 3S0PA 1KY7A 1TKWB 2JK5A 2O1AA 1X9UA 3WFHB 2OQJA 3DBXA 1A3ZA 2FGWH 3GSVA 2Z93A 1XF5B 3BPNB 3FAWA 3IDYB 2FDBP 2KPNA 2G5RA 1E28A 5JDSA 1DJHA 2R0KL 5D6CA 5GGVY 1FWXA 2NW2B 3HPLA 2FJFB 4PP1C 3D25B 3CFBB 3DGCR 4Z7UA 4PJEA 1T2JA 4M5TA 4LVHB 4UQ3A 3SBWA 2IPKB 4U4IA 2IFGA 3BZ4B 5IHWA 4ELDA 3HG1D 4MMZC 2OFQA 3DMMD 4XZ4A 3GMOB 4EEEA 2FO4A 3QUMB 1OE2A 4Y9BA 1DO5A 2WXLA 3OLDA 1MHEB 3TFBA 4WTQA 4S2SB 3DX9A 1KB5B 5GRJH 4R96A 4QHLA 3W9DA 4ZX5A 2WVVA 4ODSL 1JF6A 3T4AA 4DO4A 3ECVA 4YHKH 1I7ZA 4ZUUA 1AVAA 1D9KD 3OXSA 2W9EH 2XIIA 4PV8A 3MZGB 1KB5L 2I85A 1OO2A 2ZX7A 3PQYB 5ESAA 4APQD 2B1AL 3Q0HA 4AGNA 2CO1A 4IBWA 3NRQA 1NANH 2IDUA 4F7EB 5GRUL 4Z7QE 3DJZA 1DLFH 4AGMA 3O4OB 1IAOA 1IE4A 5ISZA 1MREH 2J5LB 4MAUH 4MA1C 1S9YA 1JRHI 5KBDA 2I9LB 4JDVA 4K7PL 2WIIB 1FE8H 3ROOB 2VJXA 1ZPLA 3NABL 2DQDH 3GZPA 3M88A 5EUOB 5HYJB 4PTTA 3DRTB 1GVIA 3OSKA 3KG5A 4KJWC 5FA3A 2PCYA 2VDKB 5AVRB 4W70A 1SY6L 2D31B 1V27A 1KF9B 1J1XL 4CU8A 4QKXB 3SKOB 1S4IA 3MNWA 4YFLI 3PE9A 2OW6A 1RLBA 2PYFB 2WLIA 1NLBL 1R3LA 2VDKL 1A6ZA 2NNAA 3OJ2C 4X0KA 5FA4A 4P2CG 5F7NC 3HKZA 2C34A 1ZRUA 1DR9A 4ADJA 4H8QA 4G7YH 4JKWA 2XTSA 3THMH 1A7PH 3RPIB 3D06A 4L3ED 5MEQA 3KLHD 2AS5M 2OP4H 4L8SA 4S0TD 5AUMA 2BWDA 2EUVA 1IX2A 4M6MH 4OLYL 2YXMA 1G9NL 1XH1A 4KROC 2VH5H 4LDLB 4P5MB 1HX0A 3BVNA 2F5BL 1HK6A 4K23L 4NUGL 4HUVB 3FF7A 5C1MB 3ZDYE 4XNXH 3W0WE 3SCMA 2MHAB 1KXHA 2OJZH 3HLAA 1T1YA 2BP8B 4OD1H 4JKLA 1JWMA 5DC9B 1ZA3A 4LCVA 5B38B 5C71A 4UI2A 4YAQB 4WWPA 3A67H 2JKTM 2Q76B 1JPTL 3RJQB 2VN6A 1YN7B 2K7QA 2BNQD 5GGVH 4LEXH 1CCZA 1C7SA 2LW3A 2P5EA 1T83C 1ADQA 1CFSA 1JN6A 3KPSD 2YD9A 3ESPA 4GKZB 3ME0B 4RGNC 5DS1A 5C0CB 1NPJA 4XPBH 2R7EB 3A21A 1L9NA 4JFDB 4Y9EA 4N90D 2Z31D 1ES0A 1NIAA 1YQ2A 3CZEA 4U6TA 1F45A 3F83A 1YPZA 2VMJA 2FR4B 1GYVA 3GSWB 1MZYA 4Y4HA 1U8HB 4HS3B 1SJEA 4E9WA 4OF3A 2VMDA 5I1IH 4JW3A 2AKRB 4XHJD 1HL5A 1OK0A 1QASA 2ALWA 3S36L 3KPRE 3ISYA 2YUXA 5AB0A 1IKOP 4QY8A 1M3IA 4E42B 1JI1A 1RVFH 3QQDA 3L95A 4KKPA 1LO5B 1BJ1J 4PYGA 1NCNA 3NIFF 1N8ZB 4CC1A 4ELMB 4U3CA 1QNZL 2XNAA 5KJ4A 4K3DL 3RZCA 1ONQA 4KDTA 5G2NA 4AQOA 1KMGA 2AJ3B 5F9WB 3S88H 5D72H 3UABA 1CGTA 3QNFA 2PTTA 3ARDD 1B3IA 2CWRA 1KIRB 2NY1C 2YD2A 1IM3D 5IF0B 3S3CB 3GI8H 4LCUA 3QYNA 4JN1L 5IFJA 1IC7L 1KGYE 1OHZA 2F8OA 2AXWA 2PYEE 4L29B 4YDJB 2DBJA 5D2LB 3BN9D 5BZDB 4NN7B 4FNRA 5KBKA 5JPMC 2QMJA 4NUMA 1OP5K 5KYWA 4PRDA 4FNSA 1OAUH 4EMZA 4XMKH 3PU7A 5KAQF 4D9RE 1MRFL 3E38A 1NGQH 3Q06A 4X4MA 1F11A 1FNAA 5ICUA 2BH0A 4U1JB 3ZTDC 5JQIB 4FQHB 4MMZA 2H3NA 5F0PB 2ETWA 2DMCA 4PJAA 2XT1B 3O9WB 3HC2A 1RLWA 1ZTXL 2Z8SA 1N10A 3AGWA 1WP6A 3KLKA 4IIZA 2ZXQA 4FQIH 3MOAL 4GUPB 3WTXA 1G0DA 1GGUA 3S98A 4YDKL 4TPRL 1N5AA 1TETH 1WS8A 4X99A 5CSGA 5JHDD 5M95B 2F7QA 3FS9A 3VFSB 4F5CA 4BSWB 2W0FA 1UWEL 2WD0A 2HPTA 1MJJB 5DFVD 1E42A 4UWQB 1PVHA 1WTGT 2CO4A 4RGMC 4QTFA 5DHYA 35C8H 4OVUA 1TZHB 2YQGA 2CE6A 2ZZUT 4DZ8A 5KBLA 2QT6A 4M8QA 4EI5C 1A4JA 2WBWB 3PNWA 1LWRA 4HBQA 4LSDA 2A9AA 4WSGA 1D5IL 1QFHA 3O45A 1AFVL 4MJIA 5J6GA 5IB3A 1AAJA 4XOAA 3GUTB 3NCYS 1TTGA 3GKZA 3I02B 5EWIL 4GRWB 1KBBA 1PX4A 3ECWA 4F58H 2A7BA 4KI5E 2W95A 3BLBA 1FL5A 2CSPA 4HJIA 4QWWC 1SJHB 5KVGL 3T65A 2GEQA 5IQ7H 2DQUL 5DURD 3LKPA 3REWB 1ZHLB 3ZKMC 3WENA 3QWRA 5K1JA 1OGAB 2OTUB 2R4SL 1JZ7A 5B39G 3SKMB 2RMNA 2Z7WA 1NC2A 1GJIA 1J11A 4B9YA 2XSKA 5CM1A 1U3ZA 4I2XA 2BDNH 4P2OD 3SE6A 3D0LA 4NRZB 3NIGE 4ZW6A 2PW2B 1FVCA 2DQHL 3QR0A 4O02L 4M02A 4OZHF 4MB3A 2PXYD 1JHTB 4FERA 4I48A 3W11D 2CR3A 3V5KB 4AVKA 5IHUL 1O6VA 2DM7A 5D4QA 1DJZA 3G08A 4JDZA 4ZO6A 5KSVA 5D7JA 3IETB 2ZJSH 2NUTA 1PAZA 43CAB 1UQSA 3JWNG 4O2FB 1X5ZA 4QKTA 3FFCD 3MV8A 1OZTG 3GHBH 4IKJA 3RVUD 3OLIA 5E0QA 1RJZB 5EDSA 3VXSE 2BP0A 1AKJB 3H0TA 5CJOL 5DJ6B 4RRPA 3KE0A 1MY7A 2CIKB 2AQSA 5HHQB 4JCWA 3C5ZB 5T33H 4UDUB 3H9SE 4YE4H 4F27A 3V9FA 3ZT7A 4NT6B 5CCHE 1JK9A 5E51A 1AGCA 1PW3A 4WHYG 2Y07H 4MD4A 3O81A 1Q94B 3VWJC 4FTVA 5EPMB 1T83A 4DUXA 1I53A 2ICCA 2D3LA 2VDNH 5BS0A 3PV6B 2WTOA 3BMWA 5C0BD 4YJZL 5I16A 3HJ0A 5L8JB 5F8QC 3QVAA 5AOMA 1ZK5A 1VGKB 2E3VA 3QRFM 1FF5A 1JYXA 3MLSL 2EE3A 2N7SA 3E3QE 4KTDL 3QC6X 2H0PA 2NY2C 4ERSH 4N6RB 2X9XA 4MD5A 4NAQA 5D4IA 5IMKA 3P2TA 4PWGA 5FM5M 4Y9CA 2X1OA 5I15H 4DP2X 2IOIA 3D39B 2FL5A 1BYPA 4E0RB 1HDMA 3PGCA 1NL0L 5GS0H 4ALAC 4NJ9L 4IRZL 3SZ6A 5EOCL 2NTFB 3V5HB 3N9GH 1C8QA 1KJ2L 1WDAA 2XQBH 3M1CA 3RTLA 5A6LA 4AMXA 5B3JE 2YBRB 2RR3A 5CS7A 4MVBC 3G5XB 1FFOB 3C6LC 4IHOB 2C4XA 3CBKB 3FRPB 1MWAB 4I0CC 3EBGA 1OV8A 4XOCA 3TPUB 1G6RA 3ZMRA 5D2NE 4ZS7L 1T4KA 3NZ8A 1T04B 4OQTL 1IM9D 1JZEA 5ECJE 1KYOK 4N2HA 4RISL 4QCIA 4QT5B 3CZLA 4PS8A 2ESVE 2JK5B 3UGUA 5AVVB 5C6PB 2OQJB 2WWKT 3DBXB 3DO3A 4AW7A 3GSVB 1E30A 2Z93B 5E4OA 3W2DL 3PWVB 3QFDB 5JDSB 2R0ZL 2FX7H 5D6CB 3SN6N 1WEJL 4W6YB 3HPLB 1EK3A 1ETJA 2V4LA 4FFYL 1U8MB 2HFGL 3IFLH 3O3UN 4F1SA 2Q9OA 2APVA 2QVMA 4QRPD 4S1QH 4UQ3B 3MRLB 3CN0A 3AAZA 3AG2B 2ITEA 1E4JA 5GS2D 2FO4B 1MHPH 4UM9B 4YZWA 2AZAA 2P5WA 2MPVA 3N44F 2FHBA 3DX9B 2AJUL 4XNYH 3VB9A 1DSFH 4GPVA 4P99A 4R96B 4H8WH 2OL3H 4PCYA 4Z3FA 4YGVA 4ZW8A 3T4AB 2DQIH 3GJFH 4X5QA 2NXYD 4XMLL 4HHWA 1USQA 5TQ0H 4F8LA 4Y4KC 2CUAA 1DVTA 1WAAE 2EIMB 2VLRB 2RQEA 4EI5A 3QA3A 4HH9A 5E00A 3WE6B 2CR6A 2CRMA 3ZYOA 4KQ4L 4JQVC 1EVTC 5JMRA 2ZOOA 5F0LB 5C09E 1D7FA 1IZJA 1QEWA 1JHKL 3T3ME 4FHBD 3ZYJA 2F53B 1XCWA 5FR3A 1NZRA 2KBGA 3BE1H 3C60B 3V52L 2Y69B 4WW2B 2QR0A 1BVKA 4LVOC 4KHTH 4R7NA 2OS7A 1BECA 1YEFL 5INDB 5JNYA 5FA3B 4D0DB 1DQKA 5BV7H 2YC1A 3B5HA 3S35H 4KI1A 1L6PA 2KERA 1JYWA 4I0PC 1JGLH 5KWYC 1UUNA 1AC0A 3WD5L 3OMAB 3GLDA 1SXBA 4CBZA 5IEKB 4JJOA 2WLIB 2EXTA 1A6ZB 2ZUWA 4X0KB 1VESA 3D8MA 1MCIA 2O26U 3OKMA 4J4PC 4A7GF 4Y16D 4HCGA 3SYQA 4E9QA 3HZMB 1ETA1 1A1MB 4PVLA 1G7IA 1SFHA 2CJUH 1KCBA 3SKNB 5LBGA 4YBLC 1V8HA 2PR4L 2UUDH 4U6HB 2WCGA 3VFTA 3WNLA 4FKEA 5ABZA 4YSCA 3TBWA 3DVGA 4JJ5B 2DLEA 2VLKA 1ZT4A 4GUQA 1WK0A 2XN9D 5C0FB 5AOZA 1YEHH 2ICWB 2EDTA 4KO9A 3MNVB 4DPAX 5KSBA 2JB6A 3IS0X 4A2MA 1JZFA 5IJKA 3SBRA 2UZXB 2C9PA 5HI3C 3HLAB 1T1YB 4K71C 2XX1A 4JFYA 3MRRA 4ZPTA 3VWJA 4X6CE 3ZHKA 1UWXH 1ZA3B 4E2OA 1GZHC 4AYID 4W9EC 2NXZB 2D3NA 3V4PL 3IJSA 3L16A 1QHOA 3SD5A 3SGJC 2DLFL 2P5EB 2HN7B 3DUHA 3EH3B 1WISA 2Z64C 4LSQL 1JN6B 1UGNA 1ZV2A 1WG3A 1MRDH 5IJVA 1T2XA 2W07B 4XWGH 2VM4A 4Z3IA 2EH7L 4NQDE 3HE6D 5DCCA 3QZWG 1DJWA 1U33A 1VFBB 2XA8L 3AGVA 4AWJC 3EDKA 2XLLA 3AMLA 3DDFA 3F7KA 2YPLB 3KPPA 2IBGA 3OLEA 2GI0A 3L6FA 2ZOKA 3QG6A 4B50A 7PAZA 3VD1A 1S5HA 3ASWA 4LLQA 3B5GA 4P9ML 5KOVC 1MFNA 3FHAA 4UNIA 1T5WA 2PPDA 3LKQA 3QQDB 3NPSC 4HETA 2X42A 4M3HA 3C6LA 4Q9BA 2CKBB 1YJDC 4Z7VF 1A0QL 2W60B 3ARGC 2XNAB 5C07B 1P5UC 1JNJA 1ONQB 3SKUD 2R1YA 2XWZA 1EZLA 2R29A 3LPWA 2E7DA 1CN4A 3O11A 1JVOA 4D3CH 4LCUB 3MV9B 1AJ7H 3QQ4A 1H9VA 4XNBA 2CKBL 4HOXA 1HXKA 3E7JA 3DKHA 1EAPA 1KELH 4NIKB 5TGBB 2ISDA 3C75A 5IM7B 3U0TA 5ADPL 5FUCE 2WIMA 2COVD 4HPYH 5KYWB 3PPSA 1OT1A 2Z3FA 4LSTH 1B0RB 1H3PL 3QIBB 2AF2A 4XODA 2UYLB 4OAWB 3ZGHA 4JRYE 2X9ZA 1F11B 5AVZB 3N06B 1KCVH 1WJ3A 4MMZB 4WTXA 2BK8A 2H3NB 3H42H 3CFTA 4ZPVB 4P23D 3UCRA 4LRIC 1JV2A 3NSJA 3QWQB 4PJAB 3NRFA 3KMDA 1N5YH 3MRGA 5CIPB 3CZFA 2ZOWA 2AQRA 4OZFG 5B39B 3CMOL 4GXFA 4PVMA 1JE6A 4LF3A 4X99B 4Y4KA 1JPEA 1SXAA 2W0FB 1FDLH 4JANA 1E43A 1UC6A 1SJVA 3ZE1B 5DHYB 2P8PB 4DZ8B 2QELA 4M8QB 4TS6A 1A1OA 1A4JB 3NG5A 5CN2A 1Q72L 1VFUA 2RBLA 4JL1A 12E8L 1X5GA 4Z7WA 4O2EA 4R84A 5HDRA 5J6GB 3DYMA 1J88A 1BEYH 3L3HB 2AAVA 2EIEA 2YMXH 4AEIH 3SKJL 2UXGA 5E8EA 4UOW0 2Z8RA 1THAA 5JHLA 1HQRB 3F5WA 4PJHF 3K6NA 2BJMH 4KFMA 5BXFA 4PY7A 4FNLL 3EYUL 4KZEH 3T65B 2Q7NA 2LGNA 5F7DB 3EYFA 3ZDZF 3CSTA 1RJYA 2R0KH 2HZHA 4K7FA 3JTTA 4EVNB 1EBPA 2WV3A 4XWOC 1OSPH 3NSDA 1SEBA 1A8JH 1R0AL 2FSEA 3DTXA 3QUXA 2YSSA 3MLZH 3LNEA 5ISZD 3LIUA 4MKMA 1XCTA 3EHBC 4GI6A 2KLSA 4KKNA 3QEUB 1YAIA 4WI3A 5EC1A 4HOZA 5HHPA 2QPFA 2WCPA 3G08B 3P3TA 3R4DA 4L5FH 5LN4A 4Y19A 4ODSH 2H9GA 3MOQA 3C6EA 2NUTB 3UACA 4UTAH 3QUMH 3LRSB 2XY2A 5DZLA 3MV8B 4LBAA 5DJAB 5AL0A 3OVUB 1EGJA 1KB5H 3EJPA 2WQ8A 5E6RB 5TDPA 2B1AH 4ZMAT 3FQRA 3BRDA 1NJ9A 1PZAA 4FJ6A 2Y5QA 2WXIA 4GRLC 2BINA 5AB9A 4G43B 1GZHA 4Z0XA 5IREA 4V1DA 2IDSA 1ZT7A 4MD4B 3TN0D 3UBFA 3PAUA 4DOHE 4FTVB 3T0AA 3I6LD 2UVEA 5IVXF 4K7PH 4MRCA 2PP8A 1KGCD 3OAZK 4RGNB 5BVPL 2YXFA 1UD3A 5I9QC 3UC2A 5DC0A 4BQ8A 3MQIA 1SY6H 4YO0B 2C9XA 1J1XH 3EADA 2BC4A 2XV0A 1F4HA 1A4AA 3SCMD 1ZE3H 5CGYD 4PJXF 2VRAA 2BO0A 4MD5B 3KXFB 5IMKB 2BFVL 1NLBH 2VDKH 2CNYA 4GO9A 5FB8A 1F02I 1UADC 3QFJD 4OY9A 1PD6A 3VFOA 2VITB 2MCMA 4GMSH 5KVFH 1MCPL 4Q2ZB 3DGDA 4DPBX 2NYZA 3ARGA 1P5UA 2VE6A 3HN3A 3QNZB 4TF4A 5CN3A 2EVFA 1G9NH 4GIAA 1OARL 1IEAB 1FNGA 1A7OH 5IGXH 5AB1A 1G6RB 4MQXC 4K23H 4MA8L 4NUGH 4JGUA 4PAZA 4Y4HD 4QCIB 3LHAA 3OZKA 5JPMB 1IBFA 1MI5A 1MZZA 1U2YA 2VZ3A 2MPAL 3QIWC 4K8RC 4IU2A 3NDYE 3GS0A 1N0LA 4U1NA 3RX9A 1LILA 1DN0A 1JPTH 4NQCD 2XYCA 3TP4A 2HVJA 3BH9A 5C2BL 4TNWK 1P9MC 3FTVA 3TJPA 4KOBA 4LRIA 3RZCD 5D1QC 5KS9A 4ODWA 3TBTB 1CBVL 5FOJA 4PG2A 3CHPA 2AXFA 3R4RA 5EBMA 1HL4A 2E6QA 3E1F1 3AAZB 3PABB 2P4AB 4YWGL 1UZ6F 3H54A 1TMQA 5E5MB 1D3CA 1OHQA 3VM5A 2E27L 2EYRB 3UJTL 2VKXA 3L3KA 2FWOA 2F54B 1BMWA 5I1JH 5I30L 4YGVB 2X70A 1UD5A 4NENA 5D7LB 1EEQA 5I1GL 4RGMB 2IWEA 3S36H 3U46A 3IDNA 4A67A 4CJ1A 1IIKA 1U3JA 3TFKC 3QA3B 4HH9B 5E00B 2KS0A 2BZ7A 2L0DA 1KTKE 3MGAA 2YGNA 4K3DH 3BMVA 1EHXA 3TS8A 1S5IL 4Y8DC 2V9TA 2CCLA 3FZUD 4Z77B 4FJYA 4JN1H 1IC7H 4LL1A 4A2GA 1BEXA 1BVKB 4LBEA 3AWGA 4E9RA 3RWDA 1NQBA 1U4FA 4WFGE 3MLXL 5CFHA 4U1SA 1BFOB 5JNYB 1JGVL 2CLZB 4NJAL 1NMAH 4K73A 5FO2A 5DMYA 1G94A 2QQLL 2G75A 1MRFH 2COQA 4E41A 1BCIA 1MFCL 2QZ5A 2WW8A 3AADB 2OYLA 4D8OA 3DO4A 4O4YL 4G80A 3SHSA 1CYGA 1BBDL 3HN8A 1OSYA 1N2RA 2XZAL 3BUDA 4U4BA 2CLVA 5F9AC 4EIGB 1MVFA 2P48B 3D85A 4HJGB 3C9NB 3ZR6A 3MOAH 5DD1L 1T0MA 1G7IB 3T08A 4A55A 2YAPA 2A6KA 3BVUA 4RQQB 1M4KA 1B6DA 1OAKH 4TPRH 5D93C 5HJGA 1LXMA 1HOEA 3BZEB 1UWEH 1JPGA 1D6EA 2Q0ZX 3QWRD 1BAWA 1NC2D 3GGWB 3OKNA 2P8MB 2X4OA 5KSBB 4TTDC 3EXLA 3KEDA 3JYCA 1C12B 4G8EB 4FXKC 4WI4A 4CJ0A 2VSMB 4P2YA 1AFVH 1E4XL 4OGXL 3I9AA 3ULSA 5J8OA 1PS3A 4FJZA 3O8XA 5E6YA 3GPSA 3QIUC 5EWIH 2QGBA 3IJSB 4HJJL 5D7JD 2A2QT 3SGEI 1XSIA 4E9SA 5CFAA 5KVGH 4J8RA 1KB3A 2K1MA 5IJVB 2R2HB 3U9UA 1UT1A 2DQUH 4GRWH 3EZJB 3MRQA 5IQ9B 2NY2B 3KYNA 1RK1A 2J72A 3QEHA 3MR9A 4P4RB 4LLDA 3HRZC 1GL4B 2N7AA 3H56A 4G6FD 1C16A 2FBRA 2A73A 2DQHH 4JPKH 4O02H 2ZOKB 3QG6B 3MLTA 4YSTA 5IHUH 5BS0D 4TQEH 5JZ7C 4MCYA 4PW9A 1T5WB 2YN5A 3LKQB 5HJ3B 5D9SA 1NFDE 1FVDB 3SDDC 3DX0A 4DEWA 3C6LB 1YY8B 5SWQB 1RMFL 4PWHA 5CEYA 1KIUB 3HS9A 3DOSB 5CEXA 5GXBB 5C0GA 2BNRA 3OB0H 2AK4D 3UXFA 5CJOH 2K6WA 1LP9A 4JBSA 3ARZA 1D5ZA 5DSCA 1P7BA 3QIWA 4YDVB 5D6DA 4X7TB 2PF6A 3BPOC 1PZUB 4JDEA 1HINL 4MDIA 4MJJA 2I26N 1MCHA 3U0TB 1I75A 5D7IE 1P4IH 2FWUA 3VI3B 3GO1H 5AOIA 4GEIA 1P9MA 4LLVA 5D1QA 4HKBB 3WFBH 4AUYA 5I8CA 3B8YA 3HKFA 3IDGA 5T1KD 4ODHL 2NY1D 4YIQA 1NFKA 1ZAGA 2QGDA 2FJHB 5GRVK 2XHNA 4EJ1C 5EN3A 3MLSH 2NY4C 1J9CT 1OM9A 4JQIL 4KTDH 2A9MH 1JXKA 3AZUA 1BQHA 3ATEA 4BWUA 3MRGB 3I6KA 4A38A 1A9EB 2ED6A 1RFDL 4DKEL 3TEXA 4N0FB 2QQKL 2XTJC 4L9DA 1IEHA 2XV2A 3LD8C 4LF3B 4YZFF 1JUFA 4XVUC 2PP9A 3AITA 1NL0H 3MNMA 4Y4KB 2E4FA 4MXVF 5D1ZI 3MRMB 2A83B 4IRZH 1MNUL 3LEXA 5EOCH 3DARA 2QKSA 3N85L 4NKOB 1M2VB 1WV7T 4KK6C 3ARBC 3IPBA 4BM7A 4U1KA 2D7MA 3O4LD 4Q58C 2V37A 4Z7WB 5M7QA 4O2EB 1J9QA 4QO1A 2DL2A 5ECGA 2P5WD 1ACCA 3NFPB 4X6FA 4XMZA 1B9ZA 1XF4A 4LVOB 3MRPA 4RISH 3KH4A 1CO1A 2O93L 1FLTX 3VH8A 2QADD 1MWAH 2YEVB 1VGEL 1H19A 2MQ3A 1WAPA 4AH2A 4P48A 4I0PB 4WIQA 3MV7E 3W2DH 3QQ9D 3HBZA 1P1ZA 2R0ZH 3FCTB 4RWYH 4DW2L 4K7FB 2OYMA 3JTTB 1WEJH 2NT0A 4WI7A 5BRZE 3VG0L 1EXGA 1SEBB 2PN5A 4FFYH 4WO4C 2E9BA 4FG4A 2J8UA 1Q0XL 1ITBB 1THCA 3DTXB 5HGGS 1Q9WA 5FYJH 3VXUD 2N0MA 1PGRB 1O6SA 2EE2A 4WEUD 3UJIH 3ZE2E 1Z32X 2RQ8A 5DD0L 4Y19B 1TCRA 3AUVA 4XH2B 4XMLH 3UCQA 3BP4A 4EDXA 5HYIA 2QGEA 3BCFA 3TEUA 4FQPA 2ZXGA 2JFCA 1FZKA 2NZ9C 4OF0A 3NK4A 4BA8A 4J3OF 1NJ9B 2N1TE 4K71B 1L7TL 2GYSA 1OW0C 3NJXA 3WV0A 2NQDA 3QIUA 4H20L 4Z0XB 3II3A 1JHKH 1CL7H 5GGUA 1ZT7B 3BZ5A 1HEZB 4TRPL 3X1NA 2W59A 1SBBA 4OLZL 1YEFH 2VLKD 4Y1AA 1RJLA 2ATPB 2GT9A 3CTTA 4TULL 4XTRC 1GOGA 1DQTA 3HRZA 4HC1L 4JY5L 3CVHB 3WJMA 2O5XL 5F0JB 5LBSA 2EE6A 4S1RL 4AVIA 1WZLA 3WD5H 4BH7A 2BC4B 2P9RA 5DLLA 5CF3A 4LKCA 2FEEI 2WAQA 3BUPA 4GKLA 4U7MA 5FGRA 3U0WH 2AVFA 2GJ6A 3D69A 1H6TA 1J0KA 1QPKA 2PW1A 4Z7QF 4ZG1A 4HEMA 3B34A 3KEHA 4IM8A 1TR7A 1HKFA 3CVHL 4GQ9L 4FFZA 3K6FA 3QPQC 4RAUA 4PJ5D 5AZEH 3WHE1 3NPSB 3SDDA 5B3SB 1AD9B 1FYTA 2APFA 2PR4H 4UQIM 2MTAA 3ARGB 1P5UB 2EC9T 2VE6B 4GXVL 1NANI 4UYPA 1JDCA 5F1IB 4FQXC 3TV8A 3U4EA 1DVSA 1NUGA 3ULVD 2PKDA 2YMOA 2VXTH 4H40A 1JGUH 4U31A 2HH0L 5DEZA 3PGDA 1HHIA 4PREB 2BWQA 4EXKA 2ITDA 4AW4A 1GJUA 1QFUL 3NJJA 5K69A 3BUIA 4D0BB 4DKFL 4F91B 3KVQA 2XPYA 3EGDB 3TOPA 1E9PA 1G7JB 1S9WA 1N0LB 1RP9A 2CDFB 4F2MB 4URTB 1DN0B 1E6OL 3BISA 1WICA 2DLFH 4MVBD 4QXWA 4TTGA 1NUNB 3QR2A 3K7UA 4LSQH 4UT7L 1BZ9B 2O6FA 2GBTA 5KS9B 4ODWB 1PTZA 5FLVA 1F3DH 2AXFB 2ZCHH 2EH7H 5EBMB 4ANUA 5BQ7B 4NKDB 2OMXA 3QDJB 2YAEA 1IGYB 2XA8H 2VO5A 2DH3A 4GQRA 2FWOB 3WBDA 2Z7ZA 3QXDB 1HNYA 5DEJA 2L7UA 3ETTA 3PJNA 5E8NA 4C4BA 5BJTA 3GMMA 4AYMC 2ZKWA 3QBTB 1WFOA 3IDNB 3L5IA 3M86A 4P9MH 4ZZKA 3ARBA 3IMWA 3JTBA 5HGAB 3QUKA 2EDFA 2HFTA 3L5WB 3TESA 1OLZA 1CQKA 1A0QH 3HZVA 1Z5HA 2E8ZA 2CU9A 4WHTA 3VI4E 4ZMWA 2V3DA 3OAYH 3TO4C 1FZMA 3CN4A 4OZHA 1NCTA 4WI2A 1ZLWK 3ZUCA 1M42A 2NNRA 1HILB 2CKBH 2OCFD 4UQ9A 3BT0A 1JHLL 3FK3A 1QSFB 2R15A 4GG6E 3VNYA 5ADPH 5IBLC 4QNPF 5J4MA 4U1SB 3PJSB 2VMEA 1YA5A 5GGTA 1QSVA 3WTYA 2LV4A 1HHGA 1TVBB 4Q0XH 1H3PH 2G75B 2KDGA 2ZWSA 4KKRA 4BUGA 4E41B 5GGSB 2YKLL 3VXRE 4K0OA 3ZL4H 2ED7A 1K85A 4PGZA 5AD0A 3CHXA 4WV1B 4EZLA 5E9AA 1N2RB 2CLVB 3TNMB 1RIHL 2XZZA 4XNQA 2Q6WA 2VLLA 4FA6A 2CPCA 4W9ZA 4YXKH 1T0MB 1QRND 4HHAA 4LSRL 4TOYL 4CDGC 4POYA 5C0RL 2A6KB 5DJ2A 4AV5A 4D7BA 2UY7A 5JLZB 1N6QL 1AGDA 1JPGB 2WB1A 2QQNL 4UAOC 5HXMA 4HZLA 5CIPH 3STLB 5IHZA 3C8DA 1L0PA 1NGXA 2Y23A 3VXPB 2E47A 2BW4A 4GRLB 2NUPB 4RZKA 3HW7A 2X4OB 3ESMA 1A6PA 1JTPA 3QUXD 1Q72H 12E8H 1ZV5A 1EO5A 3K8LA 4KNSA 5IBUG 4X9GA 1JZGA 3E0GA 3IFNL 5I23A 2VERN 1JAEA 3Q8CA 2ZUTA 1ZTXE 4KC3B 4OTXH 4U6YB 4KXDA 5K5YA 4HK0B 3QZBA 4AYFB 3T6XA 4PV1C 1R5WB 3L3OC 2FH8A 3EYUH 5EU3B 1BBJA 3JWNH 2XVGA 4B53A 4HIJA 2EYSA 3LPGA 3OLGA 2J25A 3MR9B 4PJGE 4LLDB 4KHXL 4UV7L 1I9JL 3EYSL 3U1PA 3DXAD 1Y1UA 4Y0GA 3UDWC 4GAGH 3GLAA 4V1DD 1JZDC 2A73B 2FJGA 6TAAA 3B2XA 4WHYH 4K5OA 2VDQB 5I6NA 3MLTB 1EHLL 1DVUA 1CGWA 4R6UA 1E65A 3TVMA 3UGEA 4CNIA 3NACL 3LIZA 3QSKB 4FQXA 5DFAA 5EIIA 3WN5C 2WXPA 3QS2A 4NZ8A 2VDQL 2YZ1A 1MLBA 5MEND 5CEXB 1KBPA 2QDVA 5LLIC 2DMKA 3WIHL 4ZUVB 2GJPA 4L8BB 5ICZA 3QHFL 4JZJC 3R7RA 2E9GA 3WEXA 5LWYL 3NP3A 2BHYA 1LP9B 5IMMA 1BPVA 4AYEC 3MCKA 5DSCB 1VPOL 1H3WM 4H0LC 2XFXA 3NIGF 4KK8C 1TLMA 2DLIA 3TTSA 1QVOB 1CU4L 4X6DE 1X7QA 7FABL 2EVHA 1RZGA 1W6WA 4JDEB 4MDIB 3WKQA 3CC5B 1SVBA 1LK2A 5SWZA 4M61A 3MO1A 1ZWIA 1R4XA 2A5UA 4K8RL 1P2CA 3EYQD 1G0YR 2O4EA 3HMWH 2ZKXA 1J48A 4NNPL 3SPVB 2IG2L 3D3VE 3IDGB 2WBJC 3IJEA 4WJ5A 3G04A 1FZOA 2FBOJ 4C47A 1DQIA 2PNDA 5JHDB 2GBVA 5I66A 2PPFA 4NWUL 3ZVVA 1BQHB 4OIAA 1YQVL 3QDMA 4NQED 5LG6A 3I6KB 1MI5D 15C8L 2XJLA 2BFVH 3Q44A 2PTVA 4ZYKB 2EVGA 4N26A 4LPYA 3D7PA 3VFVB 4Z7OE 1JUFB 2OJEA 4YPGB 1TF4A 1L9QA 3WMQA 1Q9OB 4N5ED 2OTWB 1AKPA 3RDTC 4KTYA 4E9XA 3ROLA 4ZTOH 3CCHA 1ECYA 2V3EA 3UYPA 1X5HA 3QZPA 2PWFA 5DHMC 3TO4A 3CN1A 4UM8B 1IE5A 3QUYA 4I13B 5T5FA 3RTQC 4N1EA 3GSUA 4QO1B 4OLWL 4A7GA 5EBLA 2C1PA 1DQDL 5TK2A 5DUPL 4X6FB 1P84J 2V3FA 4LHQB 4PJCE 3BAJA 3TGXA 4CL7A 2BIOA 3TBYB 4C56A 2C9AA 3O6FC 2MPAH 3O2DA 1G6RH 2WBXA 4AH2B 2OPCA 4MNHA 4W9GC 1IC1A 5HGDA 1QR1A 1UT9A 4NQUA 4YL4A 3QDAA 5HI5C 3FCGA 2Y7SA 3VXQA 1FL6A 2YAOA 4R97C 5B3JF 3SDXE 4NQXB 1CBVH 3UBGA 2V7NA 3TJEL 5HDQL 3VSUA 3KYOB 3DV6B 2J8UB 4X5XB 1F3RB 3NK3A 3OKKA 4ZMYA 1YEEL 4WWKD 1H3VA 4HIEB 4YWGH 3RU8H 3UAAA 4D9RD 1O6SB 1UB6B 1MCQA 1Y18A 1HT6A 2E27H 3UJTH 2A9BA 5CU5A 5D93B 2JSFA 3X14B 1Y6MR 5I30H 4L4VA 1TCRB 4IGBA 4EDXB 4M7LL 5I1GH 2VSDA 3T3PE 4XCYA 4UBDD 1FZKB 3QJXA 3G6JE 1VERA 1PKOA 4FXKB 4HUNB 3BPLC 4P57A 4G82A 4QDGA 4WQOA 5GGQL 3EHBD 4RBPK 4RZCB 4YLBA 1S5IH 4NC0B 1TJHL 4ZDHA 1WD8A 3D85D 2K7PA 4M1GL 1S7WA 4X5PA 3K2UL 1I3VA 3LCYA 3CFEA 4YSOA 2R0LH 4XBPB 1PL3A 2YARA 3L3OA 3MRJB 3V8OA 3J27A 1PNCA 3P2DA 3NIFB 4Z7VA 4Y1AB 1K9TA 1RJLB 2OSLA 3MLXH 4XGZA 2GT9B 3VTTA 4KNUA 4BKLB 2M26A 4NJAH 3UTTA 3CGTA 3HRZB 2E0PA 4WEBL 4B9FA 3F12B 4CC0A 4LKCB 3PWPE 5IMOA 1WFIA 1XD1A 4P5TC 1TQSA 2GJ6B 3D69B 1MFCH 3ARFC 3NAAL 5L4MA 2V9QA 4ESKA 2IQAB 3QG7L 3ABKB 4HD9A 1G9HA 4O4YH 4NCC1 1BBDH 2OMYA 5E5LA 1XBRA 4JM4L 3O8XD 4B9GA 4WEMB 4XOEA 3UFIA 4YXHL 1LO2L 1GHFL 5HHOB 3SDDB 5DD1H 1NBCA 4G8GE 3LQMA 3WN5A 4URKA 1FYTB 1JZHA 1X7TA 3IMRA 3S5LG 2D7QA 1IUZA 2VDML 3EGSA 4JZJA 3E6FA 1B2YA 3EOYG 4I88A 2DWEA 4NRXA 3HA0A 1VA9A 1UWGL 4XB7A 1GA2A 4H8HA 2XG4A 5JW4N 2Z7UA 4JFFB 2ITDB 5CLZA 3BPOB 4AQ1B 4XB3A 2DMGA 3FH7A 2F8IA 5DVNA 3WTSA 1BMZA 4OGXH 3SJVB 1E9PB 4KH9A 4HW6A 5C70A 1S9WB 5ICYB 1RXLA 4CU6A 3W82A 1OCCB 4HJJH 1ACZA 4QIRA 3PAZA 1BW8A 1D5XA 3UAEA 4DP4X 5JIIA 1URLA 3EJYC 2V9UA 3P11L 2PTUA 1F58H 2BNRD 2ZUUA 2NY4B 4PRNA 1WA0X 2HG5A 2ZUVA 5DQJB 4XN2A 2BSDA 4PS7A 3JBG7 4FQCH 5CINL 5CZVL 1RP8A 2XTJB 1GTFA 3LD8B 2ZXAA 1U8IA 3KD4A 4I7ZC 1ROWA 2C3GA 3WMSA 4PJHA 3QDGE 4X6CF 1XGZA 3RDTA 3KHOA 3PREA 1UD6A 5E8NB 1UATA 2FX9L 3GMMB 5TQ2H 5L4JA 3ILPA 3UBXG 4Z7NB 2RH0A 5D1QD 1VF5C 3MKGA 1U8OB 3EDJA 3ARBB 4R2GD 3KCPA 3K3QA 3QUKB 4HEPG 3F85A 2NYYD 3GJEB 4BGLA 5MEOA 1TZGH 3RTQA 1NBVL 3IMVA 5E4EC 3TYGL 4CN4A 1KFAH 1RMFH 4WSKA 1VZGA 4P9HC 3HZVB 4G1MB 5BO0D 2WGNB 1FZMB 2DB8A 3EBHA 1KYUA 2HLEB 5I1KH 4M56A 5CZXC 4N9OB 2VQUA 4BDVA 3N43B 3P3RA 4G9FE 4MCZA 3O6FA 3AREC 2MQCA 4OZFH 3LS5L 3N1MC 2DLGA 2JLLA 1KXTB 1LL1A 3TFKD 1YEDA 1YAZA 2ADIB 3PL6D 2XBTA 4MD0A 4RWHA 4X98A 3HFML 2JCCB 2O30A 3KM2A 3Q8AA 5HGBB 1HHGB 4LOVA 1M56B 4Y16B 5IBUB 1R5IA 4WO4B 1AXSB 1GZQA 4Y2OB 2FECL 4LKXB 4UQAA 5MHSD 4ODHH 2RIKA 4N0UE 1ZK9A 4TXVB 3DVFA 5AD0B 5B21A 2J1KA 3CDZB 1S2EA 3OHXC 4JQIH 4ODTL 1FNEA 4W9JC 3NJGA 4ICWA 1XAKA 1XH3A 2HLAA 3VXTA 1YYLH 5IVXA 4HHAB 4JHVA 1RFDH 4OCWL 2F7IA 4DKEH 2GAZA 4FNPA 4KK5D 5TPWH 3UZVA 5DJ2B 3ECBB 4PJIF 4FFTA 4NO5A 4DP8X 2R9HC 1RUAL 4XP1L 5LO7A 1TVDA 5AYUL 5CKGA 2EXWC 1AGDB 2VJ0A 2P3YA 4HZLB 1KPVA 3VMNA 3N85H 5CEZL 4CN6A 4QTHA 5ALCH 4PJXA 3JV6B 2HA1A 5F3BB 3APDA 4OH2A 4AX3A 3HVDA 2CBTA 5J6HA 4K5PA 1J8HA 1R5VA 1OP4A 4FXGC 2L3BA 3MLUL 3F62A 3HCVB 5DMKA 2EDMA 3VFNA 3OC5A 3D07A 4CSPA 2YEZA 3NCMA 3CFCH 4W9IC 1QTSA 4WWNA 5E5RB 5DZOA 2L8AA 1UOLA 5CUSL 4KZ0A 4PRID 3N91A 1VGEH 4MMXC 1AO7A 2EYSB 4FP8H 3Q2LA 4EUPG 2FT7A 1FG9C 3C12A 1CFVL 25C8H 1ZA6B 1S46A 1HL8A 4AC4A 3OWEA 4OV6F 5EDXA 5EU4A 3QIUD 1DUZA 2EICA 5LGKA 1B0GA 2FJGB 2FE0A 4HX1A 1YNTA 1DEDA 1XB3A 3FO0L 3GS7A 5EZOL 3RWJB 3JQOB 4E9TA 1TJIL 5EIIB 5DD0H 1OB0A 2ROXA 5TDOA 1F0LA 2GK2A 4HUXA 4HIHA 4IBVA 1KJ3H 3CSGA 1MLBB 1DQQB 2RACA 2FD6L 4DH2A 3U30C 1M6OB 1O6TA 2PCXA 1EHAA 3TH2T 3WEXB 5DVMA 1CFQB 1PY4A 1D6VH 4K9EL 2JLPA 4P4KC 4PJFA 4NP4L 2GSGA 1TQTA 3S37X 4KRPC 1X7QB 1RZGB 3UTOA 1DUYA 1TZIA 1H8NA 2IALA 2ZAHA 4TRPH 2CJTA 4M61B 4LIQL 3MO1B 1ZWIB 4LK4A 1IB5A 3UZQA 4A6YL 1P2CB 4ATTA 1FHNA 4QRUA 1T4WA 1Z9SB 4OLZH 4KH2A 4Z3HA 3EJQA 2A1WL 1OP3H 4WJ5B 4TULH 3LB6D 1HSBA 5AENA 1MHHB 3OG4B 3H6JA 5I66B 5E70A 5SX5K