2FSDA

A common fold for the receptor binding domains of lactococcal phages? the crystal structure of the head domain of phage bil170
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
DIPWTDLNRASGVGSTGILQARIINGVIYVRGNSIPVPNVAPNFIVPVGTFPPAFGTNLPQFDSSGTFYSHGNLSLSLINMSPSGIAVGNPNNTSMNGKTISFALSAPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Receptor-Binding Protein Head Domain from Lactococcus lactis Phage bIL170
pubmed doi rcsb
source organism Unidentified phage
molecule tags Viral protein
molecule keywords putative baseplate protein
total genus 19
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2460 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fsdA00
2FSDA
chains in the Genus database with same CATH superfamily
3O2VH 5I1LB 3QEUB 4QRTB 1C12B 2B1AH 5CILL 5DHYA 2E27H 2AS5M 3QZOA 1FJ1A 3E6FA 3FO0L 3GI8L 3UERA 2QDWA 4G9FA 4FABH 3TBYB 3CX2A 1OK0A 3HPLA 1NPNA 2UYLA 1MAJA 1XSKA 2AABH 3QEGL 3WS3B 4DVBB 5HHOD 3BZDA 1KB5A 3T2NL 1R5WA 4HIIA 2P9RA 1ACYL 3ARPA 1E8ZA 1UCBH 4OGXL 3KWTA 4X7CC 5HD8D 1T5WA 3T1FA 1CR9L 3AUWB 3LH2L 5CGMA 3KYNB 5KSBB 1EERB 4GFXA 5DFVC 2NYYC 3ATFA 4DN4L 3QIUA 1G9NC 4OCXH 3CQQA 4OM1L 4P2QD 1W72H 2VW6A 1KTLB 1TF4A 3G5YB 4XMKL 2C3WA 2Q86A 5IMMB 3CD4A 1Z5LA 3GBMH 3UYOD 4Q9RH 5DEFA 3DX4A 3C8HA 3MR9B 5FYJD 2QJDA 4TSAL 3JWNC 4YSUA 5D7JB 3X1FA 4XC3H 2YPLE 4QRRE 3X12B 43CAB 4YDVB 1HXYB 3BH8B 2R9HC 3HMXL 4Y19D 3AMLA 5EIQA 2YARA 4GNKB 4IBYA 5C86A 5C0IB 4FQ2L 4XP4H 4LVHC 3WIHA 5KVEE 4XC3L 3P0VL 4N2KA 4QYOB 2BS71 4QRUA 1ESOA 2EIMB 4HS6A 4M1CC 1A6VH 4TSAH 4Q89A 4PRHB 1A5FH 2IPUK 3F83A 5HDBF 1BQHA 2JKIS 1XCQA 1PJWA 4UT7H 1TZ8A 2DMCA 3FH7A 3ZKND 3MACL 1P5UA 5AOIA 2GB2A 3QT2A 3DXAE 3JTTA 2D31A 2WQRA 3HG1D 5CWSA 1W72L 3MNVA 4PTUA 3POCA 3P30L 4CRPA 1O6SB 3WS6C 3OKMB 1UCTA 3WFBH 3UABA 4N90D 5BS0D 1YEWA 1BVLB 1SXCA 3F6LA 2A3TA 2AVGA 1NUNB 2IQAB 4XMLL 1L7IH 4YE4H 3SE3C 4BEIA 4L8CA 3HNVL 3KEDA 3K46A 1HXMA 2COQA 4NN6B 3VCLA 2JWYA 4TLKA 2NXYC 3H3BC 3WUWA 1EAQA 1F4AA 1K8IB 2QPFA 3T0EE 1V3KA 1EAJA 4EZLA 3SSGA 4ZFQA 2WZ6A 1I9JH 2FATL 4LDOB 2R1XB 5E0QA 2VXTH 4KQ4H 1PZCA 4K5MA 1FVEB 4AQ1C 5E24E 4JZJA 2AVFA 2G5BB 4MNQE 4PSRA 2VDRB 3TASA 4HUKB 2EIJB 2ZKYA 3J8F7 1QNZL 4OZFG 3I75A 1R0AH 1DQQB 3QJTB 4QYAA 2AJZA 2PCFA 3D3VD 4L29B 2H45A 5E2VH 2GSGB 1IFGA 1EJ6A 1QP1A 2B8OT 2ENSA 3F84A 3EYOA 3DBSA 4M9PA 3ASWA 4QRBA 1RUKH 2DQEH 3HBGA 4RAUA 4ODTL 4TOYL 5AYQA 4FQQB 3AG3B 4AGLA 4DCQB 2D3LA 3QUXD 3GLDA 3T0DA 2RB8A 4PGCA 3I9GL 5IMLA 4RMVA 2D03L 2VWEE 4YIQA 2G0KA 1PZAA 4MDJB 3CDZB 1K3IA 1RVFH 2HRLA 3QUKA 1BP3B 3MFGB 1OTTD 4GQZA 3EDEA 5T1MB 4HUVB 1XO8A 2NNCA 3WTSA 1OIOA 3EJRA 4Q7DA 4QWWC 4DP9X 3UCQA 5F1NB 3D0VA 2OJZL 5KBMA 3RTQB 4NM8H 4BE5A 5GRYA 3HPJB 2FT8A 3MXWH 5SX4I 3FQXA 2FUQA 5LBSH 2H2PC 4FXGC 5F7LB 5AVXB 1U92B 1ZLWK 4HPOH 4ZMTA 5I1DB 2QSCL 5E5LA 5AEAA 3WY1A 4OZFH 4QHNA 1RUPH 4MMZC 4WTQA 4OIFA 5CZVL 4HKJB 3QR0A 2C4FU 2MNWA 3G08A 3N0AA 4F24A 1RUQL 3KVQA 3CDFA 4JFQB 1LHZA 3RI5K 4PREB 3ESOA 1ET8A 4IHOA 3UTTB 4LEXL 1JXKA 4NQVB 1A9EA 1NC2B 1E8WA 2DEXX 2V8LA 4XX5A 5FGCE 3ECBA 2D7PA 3HC3H 3J27A 4NKMA 3T0AA 2Y3AA 4ZOCA 1H19A 1A64A 4Z0XA 3X14A 4F8TA 2D9CA 2J57A 2VKXA 1E0OB 2ILLA 3GIZL 4IOSA 4R97B 5CJQL 3RVUD 3WKQA 5FKAA 2AFNA 3AAZA 4KZCA 3L54A 1F11A 4HX1A 5J1TC 2Z0BA 3A6CH 3PU7A 5FV2A 3WFEH 4GBXA 5E8NB 4KK8D 5FB8B 4LP8A 4Y4FC 4HGKC 2J25A 2DJ4A 3D52A 3GSRA 3QJOA 3FCBA 4KRNA 4S0SD 3BHBB 4M48H 3QORD 5I17A 1VCBC 25C8L 2FJFA 3W39B 4Z76B 3BAIA 3LB6D 4G8EA 5HP5A 4HEMA 5CR8A 3A47A 4NM4H 1D5MA 2AI0H 1F90L 4QRPE 4WV1A 4TVPL 5I6LA 5DK3A 4NO2B 2F6AA 1XTLA 3KYMA 1IGJB 1NOLA 3DHMA 5C07E 5BJTA 5C0JB 1MHHA 1R34A 4G6AC 4RZCA 1XH2A 2BWIA 3FRPG 2OL3L 3NIGF 1MJJA 3DTUB 3NVQA 4ONFH 4OZHA 4QXTA 1VGEH 4U1JA 5HDBE 5C0AE 1S7QA 1OAZH 1J10A 1EAPA 1TJIL 4PGDA 5LGYA 1YYLH 3CSYA 4FQCL 5EUKB 2OQJA 4Y5YC 4F9PA 1DLHB 1FYTE 3QRGH 2ZIDA 3L45A 1WFIA 5E6UB 2DWEA 2VERA 1TZHB 2JB6A 4PJEF 4I3SH 5AZEL 3TBBA 2BIHA 5DYOA 1YEJL 2HMID 2ZXWB 1UKSA 2RH0A 3K3QA 3PP4H 4FG6D 4P99A 3CUPA 3U1SH 3U83A 4B9ZA 2C9SA 3QIWD 1NAMA 4HFUL 3WFEL 3QEHA 1OVZA 4YMPA 1WFOA 4TQEL 3BT2H 3QCVL 4IIQB 4HWBL 5CJQH 1W9XA 3KPPA 1U2YA 4NUJB 1DSFL 2CG9X 1JDAA 4ZMXA 4OTXH 4POZC 4AT6A 4P23A 2CBTA 4G6JH 3VGEA 1YCSA 2DWTA 2VQ4A 5CJ8A 4JGMA 1SYVA 5DZLA 2X5PA 2FJGA 4KFZC 1P6AB 4Q6IA 5FHBL 1UGNA 1Y1DA 4LP4A 4PJIF 5A6MA 3NFSH 3WJLA 4OSUL 3QS3A 4D9LH 3CBKB 1IM9A 1UJ3C 4UTBL 1TJGL 3PFUA 4J4PA 3W0WE 4F5CA 3GUTA 1G7LB 2AJYL 4LSQL 4CGTA 4FLQA 1GA2A 2MRYA 1QFPA 4UDUA 3QJVB 4PP2A 3QDME 4QRSA 1SDAB 4ABVA 5IQ7H 5IT2H 4N25A 3VFNB 2WM0A 3DX9A 5C0BA 4B6ZA 2D2CC 3SDCC 1ANUA 5ABAA 4C59B 1UASA 1BF5A 4M6NH 3QP3A 3UTSD 3V7AG 5F0JB 5E4EB 3FSVA 3X12A 2F68X 2J6EA 3APDA 5HYQA 5C0FA 5DQDH 3BKYL 4OFIA 2D2OA 1D7DA 2H0PA 3NH7H 3HBZA 4C83A 2YEZA 4GXVL 2HFGH 2P5WA 4OAWB 4I4WA 2KHAA 3QUMB 3RL1B 1FYHB 4Y4HA 3SGJC 1KPVB 4HVBA 3BIBX 5C0JA 2YEQA 3PP3K 4XNYL 2R7EA 4NLAA 1BIHA 1JZEA 4CKVX 2E8ZA 4XNMB 1OEZW 2WNWA 3EYQC 4FYTA 4PBDA 1RULL 4W4OA 4GBXD 2EDWA 4KJYB 5BCAA 4PYGA 4JRYD 3PWNB 5CIPA 3E8UH 4MQ7B 4AIOA 1GSKA 1JZFA 5GHWL 3DWTA 5TF1L 2XXMB 2PXYD 4L8CB 3EO1B 2D0GA 5C1MB 1NC4A 3LNDA 1LE5B 4WHDA 2FDBP 5AOJA 3QISA 4IRSD 4ZMNA 1EANA 4NQTA 2APSA 2IH3B 2Q6WB 1X5XA 4Y8AA 1HZLA 4D0DA 1I9JL 4KHXL 2QSQA 3GIVA 4M7LT 1NGWA 4JFUA 4MMZB 5EH1A 5IK3A 4OZIA 5JZ7C 1PPIA 3BVWA 1MW2A 2J21A 4BSJA 3FUFA 4WNQB 5EOCH 2IANE 2ICES 2AGJH 4IKJA 3GQFA 4MMXB 1Z3RA 3LXCA 3OXRB 4CVZB 1L7IL 1SLWA 4LGRB 4DAGH 3JWDC 2AJZB 1M57B 5FUOL 2Z7UA 4GAAA 4ONHA 2APBA 2HG0A 5EEYA 1SF3A 5E9DD 3K8LA 3EIFA 3HCVA 2YD6A 4KJPC 4G11A 4UQEA 4DQOL 5I1IL 5T1DH 3SGKC 1KEML 2FGZA 5JNYB 4DESA 4FRWA 4JFFA 4N8VB 4GRWF 4AYFA 2BIPA 4KAQL 2PYEA 2FX9H 3DO3A 4UINL 1E4WL 3FQWB 3H3KA 2O6CA 4WI2A 4D8OA 5ALCH 5CNHA 2Y5TA 1JXDA 5LB1A 3FO2A 1CLZH 4Z0BL 1VFUA 1W16A 2DQIH 1CG9B 1MWAL 4XHJC 1PFCA 3RDJA 3LH9A 2W07A 5MEOB 3PJSB 1JMXA 3G6JA 2V17H 4QRAA 4JFYA 4TLUA 4R2GC 4ZMLA 1LGVA 1U3HA 3S48A 3V0AC 2BIIA 4K4KA 3N1FC 4R26L 2JJSA 1Y0LB 2PMZA 4XMKH 1KBBA 2DIBA 4HFWA 3SKNB 2PXYC 3CFBB 2C8NA 3BFWA 5DD1L 4JY4B 1S7UB 5D1ZC 3NDZE 4Y8DC 1BVZA 4FFWD 4DGIL 3KM2A 3DO7B 5HYSB 1RZJC 1E9QB 3O6FC 4JFZH 3T2QA 5JDSB 3D6GA 5D4HA 1I8LC 2FYYA 2YFOA 2GUYA 4N2AA 1X5JA 4RMQA 3MUY1 1RL1A 2VIRB 5K39A 1E42A 2E7HA 4JB9H 2AF2A 4O2EB 4YE0A 4KV5E 5ANHA 3O45A 3BEWB 3PWLA 1PX8A 2N7SA 3U0TA 4DO5A 2IH3A 1KJMB 5DJ8B 3MDJA 4TNWK 4R83A 3IJ7A 3CBJB 3L17A 3EFOA 1MLCB 3Q48A 4M7ZC 1TCRB 5B1AB 3U7YL 3WELA 1WCQA 3S36H 4XWOD 2IC2A 2A9NH 5FC9A 4UNIA 4C4UA 2CLRA 1W0VA 3P9MB 3O41B 5JW5B 5B7FA 1EHAA 4LPYA 1IEBB 2BHYA 3JTSB 4HP5A 2YEVB 5FB8A 3B6SB 3GS4A 3QUYD 1C7SA 4LHUG 4JKPH 4FMFA 4L3EE 4B5ZA 2WPGA 1B6UA 3MBEC 4JG1H 4X7TA 3SYAA 3VXPA 5L88L 4TLSA 1R5IA 2AJSL 4OVUA 2Z8WC 3L6FB 4F3FA 4PP1D 5FO7B 3SJVE 1JK9A 1IAOA 1HCYA 4NO2A 4K3JH 1CG9A 4XZUA 3TNMB 5JTWA 4MD4B 4OUOA 4BGLA 2BVPB 2AJ3A 2J88H 2X6VA 3EO9H 5BRZD 5C0BD 4L3EA 5FIEA 5IW3A 4X9BA 4JFZL 5E99L 1BVNP 3PL6B 4XWGL 3MJ9A 1T5KA 4PM1A 2B16A 3GDCA 1M7XA 2HFEB 4AZUA 1XH3B 2XHNA 1S9KC 5IJKA 3VTAA 2YA0A 2Z92A 3RNQA 4X5WB 2A6KB 1I8UA 4CSPA 1PNDA 3BKCL 4JFVA 3BCDA 4EDXB 1G7PA 1L9RA 3CE1A 4QOKD 1PD0A 2GJPA 2OCCB 1JRHL 5KSAA 4B3VA 2NLJB 2OMXA 5JPMC 4Y16D 4BQCA 4Y5VC 4LCIH 3ARVA 1PIGA 2C3HA 2ADFH 3OXSA 3L3IA 4HF5L 3SY6A 4AH2A 2YPVA 5JIHA 1AG6A 1VACA 5D72L 1SGKA 5MEPB 3IDYB 2VZVA 5MENE 5L4JA 1F3DH 5CD5C 3V0VB 3C2AH 3RKDD 2WJ7A 1GR7A 2WWMC 1H8SA 5FYJU 2ZCLL 1HYRC 1J8RA 3BFOA 2A83A 4D9QE 1OALA 1A1OA 3TESA 3B7RL 3I9PA 1CLYL 2YMXH 1T3FB 4WWNA 4FG6C 3QDAA 3FN0L 2Z7WA 1ZANH 2YA1A 2W9EH 3AY2A 1ULVA 1FGNL 1PG7X 5I0WA 1XD0A 1ND0B 1KZYA 1Q72H 3OPUA 3MHZA 1C8PA 4L3AA 4NN6C 4PJ5B 4ERSH 2VQ1A 5EHFA 2G75A 1Z6JT 5I1AA 4DAGL 1NCBL 2VLKA 1NGPL 4GP4B 5ESAB 1SLXA 3D4YA 2P5WB 1JWUA 5CSGA 1HCVA 1UOVA 2BP5M 5I30H 3NCWA 2BSTB 2BC4A 2IH9A 2R1YB 4JRWA 3ZR5A 1RI8A 4YO0B 4WW1B 5C0DA 3LS4L 5KYNA 3I50H 3N42B 1MRFH 3O8XC 4PJ9B 2BP0A 1JZJA 2VR5A 4LSRH 3BW9A 2H1PL 3QFGA 4WJG3 1QRKA 4H13C 3TU6A 8FABA 1RD6A 4J28A 2AHIA 2PYEE 1I8IB 2C1PA 3FU8A 4D3CH 2AJVL 4E5XG 5IESH 5AAMC 2QADC 1T0MB 1NEZG 4IOFD 3G08B 3W82A 5H8DA 1T04B 5A2BA 2N7AA 3CSTA 4B95C 2QGDA 3VGGA 1KXQE 1WITA 1ZANL 1G6RL 1EV2E 2W8CA 4KKLD 3MRJA 1XF5A 1A4BA 1S7VB 2OTUB 3CHQA 2AQ2A 4OLUH 4M6OL 3RPIA 1NIDA 1QD0A 5AL8A 3ECBB 1JV2B 3B2UD 5EIIG 3SY0B 4OIIH 3US9A 1QVOA 4ABUA 3RWEB 4ILDA 1A8JH 1B0GB 3FCUB 1I7UB 2YSSB 4ZPVA 1HI6B 3FONA 2JCCA 5ANME 4H1LA 4JDEA 1MG3C 1HEZA 1FDLH 3ZKQD 4PRBA 1RH8A 3JZYA 3A21A 3LKNB 1MFEH 3GSRB 2CKNA 3K71A 3IDNB 3MGOA 2GUOB 1KXTB 5IT2L 3HN8A 1LEIB 4KMLB 1RIVH 4LEBA 2FR4B 5IG7B 3PV6A 3DYPA 2R0WL 5MENA 4AM0A 4E9TA 4HWZB 1CICB 4ELMF 1ZEAH 2EXWD 1F6LL 1FDLL 2HKHL 2VLJD 1N4XL 1TR7A 4X7EC 3KXFA 5ETUB 1EVUA 3BUYA 4HCGA 3F85A 3F65A 1E65A 4RZCB 3EYVA 1CL7H 3QO0B 2ICCA 4FQXC 4XB7A 1R3KB 4ZS6C 5LN8A 5DRXA 4Y16B 1YY9C 1NGYA 3EOAB 5GIRA 3UROR 1DZ0A 4E36A 4KNUA 2XQYA 5T5NF 2J5LB 5LLIC 2VXUH 5D7JA 1DVQA 4A7QA 5G4OA 4OTXL 5EF0A 1NIAA 3SDYH 1X9LA 1EO5A 4ES9A 1AQKL 1A4AA 1HINL 3K8KA 4ODXB 4YQXH 2GFBA 1HHJA 3BUBA 3DMMB 1QQDB 4JG1L 2I32A 4IDLA 1BQHG 1IJNA 5DHEA 3KXFE 5AOZA 1JI1A 3V4LA 5IROA 1SYSA 3QUGA 2DV6A 1AXTL 4KJPD 4W9HC 1MCWW 4W9ZA 1UKTA 3OZ9H 3B9EA 2JKSA 2Q0ZX 3GMMB 4OLWH 5EU6B 4RQQA 3NJIA 4Z7UE 3OPZH 1Z0NA 4RRPA 1WAEA 2AITA 2BVTA 3SCMC 1V3MA 2Z6FA 1JN6B 5I6PA 1OTUC 2P24B 3PGCA 2BSRB 3C5ZB 1XD1A 3H2WA 4MD5A 5D2NB 2NY5C 4YZWA 3X3FH 4YHZL 1KCKA 5F9WB 3EJYC 5E8EA 4GRWH 3BZFA 1UXSA 3ZTEA 4ERSL 2P5EA 1BJMA 5LAXB 3PUUA 2CLRB 3I2CL 1WWWX 4NM4L 4PJFF 4XCNB 3ULUH 2FO1A 1RZIA 2ZWNA 3UAJC 5JW5A 1OAYL 1BAWA 2AV1A 2YMXL 2X87A 1SUJA 1MLCA 4W9CC 2B20A 1CQYA 4LLYA 4ODUA 3QIBC 3QIUD 4P2OC 2UWEA 5HDRA 5B7EA 5A2JH 5AAPA 4HV8B 3PV7A 3T77A 2CSPA 3MMEA 1XR9A 1KXTA 2JJWA 3PE9A 2MOGA 2WANA 3ZRFC 2ZYHA 5CGYC 4KK9C 2P5EE 4AZ8A 1UB5B 3LMJL 5CJXA 2UX6A 3UPCA 3RUGE 1IL1A 2CGYA 4IU2B 1FG2A 4GW5A 4R26H 4HLEA 5FR3A 2CAKA 3EH2A 3IMRA 3TX4A 3HC3L 5EU6E 3GB7B 4NUGL 4FFVC 4B3EA 1KLUB 1UM4L 3CVHL 2ADIA 3FF7A 2VLMD 1VZIA 2H2PD 4KTDH 1JZ3A 1Q9KB 3MRBA 4LL1A 1YMHA 4YL4A 5IQLA 4KGJA 4I48B 3L3HB 1WS8A 2DTMH 4J1UA 4L8DB 4C4KT 4XTRD 1E4WH 4XB3A 1KACB 1JD9A 3KW7A 2X6UA 2J88L 3MRKA 1UQSB 3GTTA 3RNQB 1TIUA 3S3PA 4OFYD 1G7PB 2O4EA 2HB0A 2FQEA 1A14L 4PN6A 1RMFL 4IKNA 3QEQA 3A3YB 1T7YA 4B27A 5C0IA 2YQ2A 3ERXA 4CU6A 1AO7B 5DMGD 1BGXH 3KDMA 4Z3JA 5K9OB 4P2RB 4YUEH 1TNNA 1WF5A 1T80A 4PI2A 1L7TH 1NSNL 3FQTA 4FYQA 5F7WC 3WO4B 3FRPB 3SE4A 1LEGB 1NGQH 5IEKA 4X5LA 4O2FB 1PW3A 1B9ZA 1S9YB 2D03H 3O11A 4GAYA 4ONHB 3O9WD 1MAKA 4LPCA 5E5MA 3NJXA 1O7DE 4XCFH 1FVCB 2CXGA 3OKMA 5HGAA 3LV3A 4F7TB 4N2IA 4XN8A 1YVLA 5FYLD 3TM6A 3FC8A 2XQ0A 3IDGA 3VH8G 1MCIA 1E4JA 1XSOA 2PTUA 2VM4A 4M3HA 2X3CA 3T3PF 3F00A 2ADYA 4HJEA 5IW6A 5TF1H 15C8L 3RDTD 1ZLUH 4I1PA 3RPBA 1ORSA 4EO5A 3QHFL 3RILA 2A7BA 4FFZL 2EUXA 5DURD 1LM8V 1T0NA 2O6PA 3WFDH 5LWYH 1WAAF 2WV3A 1A1NB 4LF3B 3SJVB 3JVGC 1CICC 1LK2A 1R17A 5C3TA 2B77A 1AFVL 4B0MM 2KS0A 1ZS8B 3QIBB 4ACPA 2J43A 4FZEH 4WI0A 4GXVH 3VI4E 5GRUH 43CAA 3HZKB 4JBSA 1ZSHA 1M7DA 5I1EH 4AGMA 1U8KB 2JTYA 2B9BA 2MJWA 1O6VA 3MRMA 4AIEA 4F7PB 1L3NA 1NCNA 2FB4L 2RCSH 3F05A 4UDTB 1H15A 3BO8A 1KCUL 1AQHA 2ENQA 2NTFB 1QSEA 2NY7L 2VRKA 5EO1A 3N6YA 5IQ7L 3L4ZA 3V5KA 5ESVA 3B5GA 1KELH 3DX0A 2NY2C 4KRLB 4HOXA 3MZTA 3MRHA 5EA0L 3QRFM 3MV8A 1WWBX 3RWGA 4YAQA 1F56A 3RVWC 1W72B 4RGMB 4IDJH 1CLZL 4Z0BH 3L1EA 1YMMA 4IMLA 4QNPE 3MXVH 2WYZA 1XF3A 3D30A 3SKJL 1X4ZA 3OX8A 1TMQA 3CFNA 1XCWA 1NCTA 4U1HB 3KPQA 1N59B 3UYPB 1LE9B 1INQA 1P5UC 1RLBA 3G3LA 1OOAA 3FT0A 2HLEB 4NNXB 2Y07H 1FYTD 2IBBA 1ONQB 5EZOH 3RGVA 2JB5L 3ET9F 3UC2A 2AEOA 2JMRA 2FHBA 4X4ZA 3T6QC 3LXAA 4WLCA 1FVCA 5HGAB 2R2BB 1A6PA 2FQFA 3TYGH 1WIUA 1AZNA 2G60H 5D2LF 1XZWA 3P4OB 1Z7JA 1BXUA 3HMXA 3W5NA 2GUOA 2E7CA 3WTYA 1S3KH 3SYOA 3UTPE 2XKSA 2QKSA 4MJHA 3U1SL 3DVGB 3MRNB 5EU4A 3V95A 2E9JA 3QRGL 1NCHA 3ESMA 4U1SA 2CDFA 3A22A 4ODHL 3EG9A 4QHLB 4W9DC 5E8PB 4KROB 3AQZA 2P7TA 1BFVH 4PJ8A 1MIML 4J5VA 5L4MA 2B4CH 5ESQA 1FF5A 1MJ8H 5C0ND 4GBXB 3ZRCC 2HX9A 1FC1A 5EFIA 4MCZB 1QSVA 2WO3B 1T03H 3ZMRA 2YQGA 2ZWLT 3VFOA 3WD5H 4R4ND 1MH5A 4Z7VB 4OAWA 2MQGA 3AQXA 4N0UE 3T6VA 4APXA 1J8KA 1DQJB 1FNFA 4LOUC 4MXWH 25C8H 5C0CB 2A4CA 1ZA6A 1G9HA 5EB9A 1Q90A 3EXJA 4QEGA 1XT5A 1TTFA 3S97C 4OIBA 2P1YA 3RWJA 2LTQC 3H0TB 2CBOA 2EVIA 3FTSA 5T1LB 3BPLB 2HFGL 4BKLA 3A6CL 4MDIB 4UM9B 2CJUL 2VXVL 7TAAA 2YC1B 3RWFA 3OXSB 4JDTL 3IKCB 5DS1A 3MJ7A 2ADFL 2Y1VA 5EZPA 1BXXA 3UPRA 2Z91B 2XV6B 4UI2A 5I9QC 3AC0A 5ACZA 1HXKA 3KPSA 4FOMA 3NJFA 4F8QA 1BFTA 2UV3A 4A2GA 1XGUB 2LAGB 5DUPH 4R6UA 4IGBD 1R19A 4UWQB 3NCBB 3LRSA 1CE6B 1X3DA 4TSBH 4P8QA 4NRYA 3ZKMD 4ZDHB 5KSBA 1CN4A 3CCHA 4LCWE 5LBSA 3R8QA 4I87A 2P42B 4R3SB 5F1IA 2K1MA 4UT6H 5HHMB 4N9OB 3S8WA 1VKXA 1IAII 1GZHC 2BVUA 4PLJC 4U2YA 3B1UA 3IFNL 2PO6A 2AJYH 5B8CB 2J71A 3RGVB 3IFNH 1RUPL 2F1BA 1F8TH 2ZNWA 4P5TA 4M61A 1NIBA 4RFEB 4EUPH 4Q74A 1MJ7L 2YJQA 2IIJA 1UA6H 5HJGA 1YUHA 2Z4TA 1FFPB 2KH2B 3KPOB 4MWFB 1RP8A 3CV5A 4PJ9D 2OJZH 1VEMA 2BOCB 3VUAA 4EXPX 3BVDB 2OMTB 4PJBE 4UDUB 4XC1L 1IGIH 3FW6A 3CFIC 2HYMA 3PNWB 1UM5H 3NP4A 4NPYB 1DLHA 1WPCA 4HWBH 3SD2A 4CKQA 3EGDA 2ERJB 1H3UA 2BNQD 2PPAA 5BQDA 2KC0A 3MOBH 2L7UA 1YAIA 5D1ZD 3ESNA 4FZ8L 5CCKH 4K9EH 1QAWA 5EFIB 4XBGB 2AK4D 5E9DE 1ZT1A 3GHPA 4J3TA 4WO4B 3SKOA 4JRXD 2ZCZA 2AV7A 2XTSA 1Y6MR 2MFNA 4WKZB 5GS3A 1DVYA 2Z7YA 2DD8L 2CCWA 3NRPA 3ZLQC 4NN7B 3LDBB 5F7MC 2VSDA 3DUUB 4I2XE 1HXMB 4OCYH 4A68A 1MCOL 3VFRA 3GKWH 2K70A 3ZHFA 1FZOB 3VI4A 4A38A 1QNZH 1KBKA 1SHSA 1V7NL 5AWNH 4KY2A 4LAQL 1CPUA 4ZFOB 4MLSA 1EHLL 3GXFA 5EO0A 3QJHA 4BFOA 3BKJH 2ZXEB 4XWOC 2FATH 5ICZA 5IHZA 4JS7A 2J55A 4HIEA 1CGWA 2MKWA 3VG9B 3GDBA 3HC4H 4GP5B 1QI4A 4L8SB 1IC7L 4NAMA 3QUZC 1QBAA 3RBGA 4ZQKB 5AB9A 7FABH 4U1IA 2BWQA 2PWGA 1LEIA 1QATA 1QHOA 4RGNE 5IW6B 2DY2A 4CVXA 1BZDA 1OT2A 3BPCA 1R3JB 1SXSA 5E03A 1IARB 5FGSA 4UQDA 1P0SE 5AYTA 5I8OL 3R18A 1THAA 2UX7A 2FQDA 1A47A 1KC5L 3O4LB 1E40A 4M62L 3REVA 1CWVA 5ISZE 2WQSA 2QVFB 4NOBA 4NQDD 1NUDA 2ARJB 2OSXA 3CJJA 4WI9A 3C60C 1A6TB 2MIZA 5D93C 1Z3GH 2UUDH 5GSRA 3C5JB 3UZEC 1A5FL 4YSAA 1A6VL 4HETA 4FQXA 2G3XA 3VMOA 2ADJB 2K9UA 3B8SA 2OA9A 4JGUA 3U30B 3AZUA 2GBAA 3BN9C 1OL0A 2QTEA 4FLHA 1UB6B 3EJSA 4FXTA 4PMEA 3D69B 3NUKA 2GEEA 3NK4A 1F41A 5BOZG 1EXHA 4YHPB 1YY8A 2P8MA 4LLWB 2J1XA 3RUGF 3TJHC 5J6GA 2H9GB 2ZKHH 4YFLF 3F5WA 2H0JA 3S4SG 2FSEB 4KO5A 4TVPE 2YWZA 1OY3B 2D0HA 4YK4B 2OSLB 3VGDA 4ORGA 1UT2A 2NT0A 2ID5A 4HH9A 3KPMA 4PGJA 4YLBA 4MAUH 3E80A 4ZFGH 4M8QA 4F8LA 3OAWA 5AW0B 1BSIA 3ZDWA 4JFQA 5HHOB 1NMAH 2FK9A 3GMNA 4LLQB 4LARH 3S3JA 3ZHNA 4OZGE 4IHOB 3N41B 2VUOA 3ZKMC 1XVSA 5I5MA 4Z7QF 1CDBA 4ZQTA 2NY2B 4O4YH 3UYRL 4Y16C 3MLRH 3G6JE 3T3PE 2O61B 2DEYX 3JWOH 2YWYA 5I19H 4AC2A 2BY2A 1I7ZA 4FULA 2AGJL 4WNQA 4B9CA 2FE0A 2IG2H 4N2MA 5D1ZI 2CDEB 4FCAA 3QSKB 4XTRC 3NPZB 4LLDA 3SBWC 3ZL2A 3DK0A 2D8KA 4XMZA 2WCPA 2BFVH 1AKPA 3GI8H 1LP9A 3AS3A 2BDNH 4FQPA 3FPXA 3QRLA 1OP3H 3L5JA 2A74B 5IFAL 3I85A 1J8HE 2PO6D 1YAZA 5C0BE 3BVNA 3ARWA 3FB7A 4NNXA 3NK3A 3CFQA 5K9QI 1IM9D 1JF1B 1GYCA 1OANA 5AENA 4JHUA 1H3WM 4Y7MA 3TEWA 5I1HH 1L0YA 1ZK5A 2X42A 4S1RL 5H2BB 3BPCB 3IFOB 2APWA 1AKJA 2ZD0A 1U8MA 2XPGB 3QC5X 1R24A 5E1AA 4OCSH 4CL7A 4GI6A 4L0PB 4LSVL 4YX2H 2QV4A 4N0UB 4AKPA 2A38A 3RIAF 2BVQA 2ZG1A 1S7QB 2WAHA 2WSDA 5CGBA 3VWJB 4CUCA 1U3HB 5I19L 1M9SA 2IPKA 4QF1B 2BP3A 1ZLDA 4OIAA 4UTBA 5BVPH 4D9RE 2YAHA 4KKCC 4JRXA 5J8OA 4JKMA 1EGJL 1NIEA 1AGFB 4OZIF 1UJ3B 4R90L 1AC0A 1ZVSA 3RFRA 1EO7A 5EOTB 1TLMA 5EZLA 4WCYH 2VSMB 3QUMH 5A2FA 1J0JA 2CHDA 3DUSA 3H6JA 1WHOA 12E8H 5C6TH 3QQ9C 1KGYE 2JE8A 1R46A 3CC5B 5I74B 3ARBC 4KVNL 4LSQH 5HGHA 3TZVD 2PPEA 4FQ2H 3Q43A 3RNKA 2WLZA 3F7KA 1XF4A 2X1XR 1KF9B 3PDGA 3G6AA 2C7UA 3W9DA 5BOJA 1GZHA 3C60A 4MD0B 3MNVB 4DK6A 4WK2B 1JYXA 4UT9H 3O3BA 4F15C 2V7HB 4M4RA 3MRQA 2Z31D 5FHBH 3S37L 3IVKB 3GBEA 4K23H 3QZWG 3V0DA 4N28A 1BQ5A 3UXFA 1MJUL 4PJXB 4JCWA 3GMQA 3U4EB 1DSFH 1YDPA 4FFWC 2IQ9H 4ZT1A 4G7RB 1JZ8A 5DHVA 3K6SB 2XTJE 2R1XA 4BFNA 1QTSA 2DI8A 4MBOA 3JTSA 2RQEA 1J1OL 3F64A 3ZZSA 4PJGB 3FB6A 4GQRA 1B88A 3VE0B 4P5TB 1JTPA 3II3A 3UZEA 3AG1B 3BGFC 3PP4L 4YHYC 2K78A 1ZY9A 3HB3D 1KUMA 4AYDC 3O4OC 3L3OB 1MCWM 1QSFA 1GGCH 2BZDA 2G2NA 4WTZG 4MHHG 3VX0A 5J4MA 4KJQD 1E7UA 3COOA 4WFFE 3T8MA 2G9HB 4NDMB 2R0ZH 1YEKH 1HH9B 1IAOB 4GAGH 2PW2A 2R4RL 3IGAB 3U0PB 3WUZA 4WGVB 5AQ0A 4JHWH 3N2JA 2H1LM 1U4EA 4GIOA 1UZ6F 1MFUA 4KFMA 1YMME 3SYCA 2HN7A 3DGGB 4ZO8A 1R5IB 1UA3A 1MCOH 4BZ1H 1XGPB 2GKIA 4R96A 5L7XH 4L3EB 1YEEL 5GGSB 2OXHA 3B8YA 4LLMA 5F9OH 5DA0B 1T1WA 3UTQB 5L2KA 4CN4A 2DD8H 2UXVA 3LQAH 4HJ0C 4XNQA 1IQDA 5T1KA 5T1KD 4PJAB 5DZPA 1G9NL 5AL0A 4F57H 2R56H 2V2TA 2A1WH 2HPTA 2Y06L 2QFPA 2BERA 2EIDA 3BP5B 4NO0A 2ARJQ 4P9HC 4JG9A 5GJSL 5HSFA 2DPKA 4XN7A 5D7KE 1E67A 2O5XL 3D48R 3ILPB 5HDQL 1I8AA 2J20A 4QTIL 2IV9A 1NINA 4ADGA 1FSKC 1MCQA 3EYFB 1HINH 4OJYA 3T08A 5ID1A 4P4KB 4AYID 4ZUSA 2K9FB 4WWKB 3HG2A 4MQSB 5ICZB 1UZ8B 1AO7E 3IJ9A 4F7CA 1WISA 1HQ4B 4KUCF 3OLEA 3KW8A 4LEXH 5E2TL 2W80C 2E75C 3NJKA 4XCCL 1HWHB 3FXIC 4JFED 2XWBA 3FNKA 3OB0K 4MMXC 2F53D 4KKAD 1ZGLB 1IX2A 4X4YB 1U58B 3DOHA 5ABZA 5GS1A 3NGBC 5CJBA 1U3NA 3R7QA 1O6TA 3MRFA 3IPEA 5LG6A 4Z7NB 4Z3IA 2P8LB 1CYWA 2BW5A 2X53A 4H8VA 4Y9BA 2NZ9C 4XO4A 2Q86B 3SY0A 3ARTA 4HWUA 3MA7A 3M17A 3CVHA 1F11B 3PAVA 4HX1B 4A6YA 1NFDF 5IMKB 4A39A 5E8NA 4EOWH 2UWEF 3O6FB 2XN9B 2BCKB 3THMH 3PGFL 4JPIB 1QR1A 3LQMA 1FN4B 5DUPL 4MRCA 4FTVA 4PY8J 3IEAA 4Y89A 2GCYB 3VXUA 3L3OA 1R9FA 4XPBH 2CKBH 2YK1L 3NN8B 5FO2A 1UEYA 1YY8B 2DMKA 5T3XH 4NQCA 5I0VA 3GTNA 1FYTB 1KIRA 1HAUA 2CJUH 2CK0H 1S78C 1D2OA 2VXVH 4P3DA 3VFOB 1F45A 1DE4B 1LTXA 1MFDH 3MLUH 4NT6B 4H1LG 5E4OA 3TBVB 3TONA 3LZFH 4AUYA 3HZVB 4YDVA 3I9GH 3LNHA 3L9RB 5DD6A 3KYMB 4TL4A 5DDHB 3S9DB 1FHGA 3ARSA 4WW1A 3ESVF 4TKWA 3OLDA 3FFDA 3E1ZA 3F7QA 3VFWA 4F33A 1CDYA 4XP5H 4P59H 5E8DH 1YN7B 3GC3A 4UQ3B 4JM2C 3VWKA 4Z3FA 2I5YH 1X7QA 2X09A 4YBLB 5T1LA 4EAEA 1MHPH 5CSBA 3KYKL 3UZVB 3IAGC 2CUIA 4Y19E 1T03L 1QPXA 1KYAA 4X9IA 5EEVA 1UACL 5CN3A 5IOKA 3L4WA 3BLKA 3HZYB 2MCPH 3BEWA 3PWLB 4GSDL 4GSUA 3U4BH 2ATPA 3VI3A 4CADA 3U82B 4LLDB 4RAVA 2X9ZA 1MIMH 3FRUB 4Z7QE 1D5IH 1BD2B 3H1ZA 1E8YA 3GBNH 4NO5B 1HHJB 5JOEA 4V11A 4IKIA 2X88A 5B39G 4J3BA 1Q9OA 5EU5A 1JS4A 4NCC2 2J2ZA 1ACXA 1BX2A 3QE5A 4I9XA 5A1AA 3KPRD 5IB5A 3KPLB 5GZOD 4AYEC 1KBPA 1G9ML 1C12A 1NMCC 2HH0L 4FEMA 5CBEA 3S5YA 3O41A 2ED8A 4E5XB 2G60L 1PFOA 2NYYD 2D0FA 3NA4A 5MI0C 3U36B 2C34A 1VZGA 2X38A 5E4IA 3LKRB 4GQ9L 3QC6X 1TQCC 1FNSH 2XLLA 4WWID 2Z3FA 4KRPB 1JNLL 4MA3B 2BSRA 4HUWB 3I75B 4X0KB 4KO9A 1CLYH 3CG8A 4MSWB 4ELMA 3T0ED 3WE1A 5IQNA 2GITB 4GSQA 3CU7A 1ZSDA 2BNUA 3LDBC 5E00B 4AV5A 2FR4A 1N6QL 3MV01 1F4HA 2WINA 1ZPUA 1JTOA 1VA9A 2CGZA 3NGBB 3OC8A 1LO0L 2EZ0C 1E3ZA 3BE1H 4OZGF 5BS0A 4K5PA 2AV1B 1PD1A 3HG4A 3TN0C 5I26A 1VADA 3L4UA 3LZOA 1G94A 1AGFA 4PCTA 4UUJA 1I53A 4FKKA 5T1MA 3BKCH 3INUH 3TIDB 2LR4A 2BVEA 1VF5C 5EDSA 5DEZA 2DWDA 1YEGL 2OCFD 4U6XB 1XBRA 1XR9B 3W38A 3ARFA 3EF4A 4PGEA 4DN3L 2K8QA 3QUXC 4LCWA 1XSJA 4XO5A 3AXLB 1NBZA 3HJEA 2EADA 2KT6A 2XBTA 2CUAA 4L4VE 1GPOL 2A4ZA 3FUDA 2EE6A 1UM6L 4EDXA 4HZ1A 5K9QG 2HZHA 1E30A 4UV7L 1AQMA 4WO0A 4HOWA 1IJ9A 1RUAL 2V7HA 4ZFOA 1U8PB 4XN2A 2MNJB 3SYQA 4KZEH 5CCJA 1WTLA 3CZUB 4G9FB 5FGCB 1IZKA 1Q9LB 1ZT4B 5F7EH 3NZHH 1IFHL 4TNEA 3MRBB 1I1YA 1XR8A 1T66C 3WIIL 2NYKA 2BSSB 4C58B 4MD0A 4JJ5B 3W1ZA 1K5NA 1XMEB 3MBXL 1EJFA 3FN9A 2DI7A 2XBDA 4PJDA 5H35B 4WHTB 3DJTA 2ZUTA 3FCTB 1BZEA 2IBGA 3O0RL 1G7HA 3CPUA 4ZTEA 1HEHC 2NTSP 5KSUA 5GRJL 4WU7A 4Z7AA 2KZ1B 2QFRA 3O3DB 1L4IA 4L18A 4Q2ZA 1M6OA 4Z3GA 3G5YA 1UH4A 1EK3A 2ZICA 4AK1A 4WFHD 4MX7B 1ODAA 5IBUB 3BZ4B 1QHQA 3E38A 3ESUF 1C1EH 1MAMH 3TOPA 3KS0J 4AG4H 3UADA 1GJUA 3LEYH 4XHQA 1DJIA 2FT6A 5JUEH 1SBSL 3RDTC 4MA3A 3N44F 5IGXH 4P49A 4ZD3H 5KS9F 2QHRL 3BAJA 1OP4A 1HHKB 4PRNB 3FO9B 3CXDL 4B50A 1ITCA 1H3GA 1GZPA 3ESPA 4AX3A 4L8SC 1HQRA 4EI5A 3LV3B 4HJJH 3D18B 1N0LB 4AIZA 4N6RA 4FDWA 1CICD 2EDHA 1RXLA 4MA1C 4QRQB 5I1KL 2FO4B 3CU1A 5T1KB 2OMUB 5FYJH 5JHDE 4BSWB 1XL4A 2X2UA 3KGUA 1EAOA 1AR1D 3DPBB 1PMYA 2W07B 5TH2B 3W11C 1LQSR 3IDXL 3FZUD 4HW6A 4LLVA 3AMKA 2WVUA 1A0QL 3F6JA 4KPHH 2VH5L 2I7OA 1TYJA 2NY1C 2BS8A 1VDGA 2YAMA 1AHMA 3SO3B 4M6ML 4KKPA 4KKQA 4R7NB 4WI3A 4OUUA 2ZG3A 4O02B 1WC7B 4LEEA 4PV9A 2XPYA 3LNIA 3MRKB 4J3OC 5FGBC 2DM4A 1DBBL 3WUWB 1RERA 2AQ3A 1HEZB 2FYYB 3QDJA 4EZMA 1AGDB 4JZOB 3SDCD 3TWCL 1OCWH 4UM9A 3LMJH 5L6YL 4EMZA 1D7BA 3L4XA 1LO5B 1Q9WB 2W5PA 4JM4H 5F93C 3SYPA 4NNYB 2VLKE 1GGTA 2J3SA 2B2XL 2VAAB 1KIQA 1AZRA 1UATA 3LEXB 4RISH 1G4RA 2CPCA 1NGZB 5ESVB 4DP8X 3R0MA 2XZCL 4U33A 1WK0A 1YJDC 2MHAA 3VTTA 4H88L 1GCFA 2NY0D 4MHHI 1QFUH 1I9RH 3AS0A 5I0DA 4JPIA 5EO9B 3VXRB 3IE4A 3ZKSD 2VLRA 1M6OB 3MO1A 2P8LA 4WDIB 2Y7OA 4PI0A 3ARBB 4I8DA 4L0ZA 3ILQD 3LKPB 1G5AA 5C0BB 1PAZA 1ZA3B 4NENA 4M3JA 1R1CA 3BN3B 1PKQE 4YHZH 3SDDB 3DSFH 4LSSL 2AZAA 1HCZA 4PJ7A 4YDLC 2UY7A 5HVFB 1EDYA 2DQDL 2R27A 3QDMD 4Y5YB 2DLHA 4MCYB 5BZWA 3UBXG 3NCXA 1U8QB 1QABA 4AVJA 4QY8B 5EMYA 5EEWA 2HMIC 1X7SA 1JZ6A 2ZSWA 3ZR6A 3EOBA 2CHXA 2PPCA 2H1XA 3GJFA 3Q5TA 4HSAC 3SOBL 5KYYA 1O9WA 3WLBA 1SJHA 3BI9X 4MB4A 3NIDE 1BOGA 1J8HA 2G2RB 5TH2A 4ZMAT 2P5PA 2J8UE 3V10A 1ZIAA 3NSXA 4BDVA 4BKTC 4CW1A 3O3BB 4AXWB 4GG8A 1P4BH 4JPWL 5DJ6B 4CU8A 2H26A 1HL5A 3CXHK 2V3DA 1NBYB 3EOYG 2BX5A 2IJ0C 4LASH 5D70L 1JF5A 1KGCD 5BW7A 1F58H 3MLPA 3QNZA 1H0DB 4NFCA 2N3JA 5E9AA 1QA9B 3CBRA 3D87B 3HJ0A 3OKLA 2VDML 3GSQA 4Y2DC 5IB5B 3N1QC 3GMQB 3ZSTA 2ED6A 3RWGB 1KMGA 5KAQG 5B38A 1CFVH 2GK2A 1RLWA 4LP5A 1QUNB 2HKHH 4QT5A 4NRZA 2BP8A 1I1AC 2EDBA 5HJ3B 3ZT7A 2G30A 4G43B 3WIAA 4NQDB 1OP5H 2PP9A 3D1MC 1U8IB 2AK4E 2UWEB 2ZUYA 3PRZA 3BRDA 3MRIA 2OKMA 2V4LA 1S9WB 3VFPA 1OCOB 2BNUB 3ZE2E 3Q0HA 5K39B 2NQCA 3VXMB 3IKCA 1MFEL 4HPYH 4RSVA 4PJXE 3HHSB 2OXGB 3LN5A 1T5WB 2A83B 2XY1A 2FUTA 1CL7I 1RQ5A 3SPIA 5E8OA 1DQDL 2WO4A 2E4FA 3ECUA 1TJGH 1K4DA 4HGWB 5FYKE 4LCYA 5DI8B 3NEEA 2Z34A 3QJSB 4OSUH 1Z9SB 1JCKA 1OGAA 4WENB 3DBXA 2ZP8A 4K3EH 5F89A 3LB6C 1HU8A 1CD9B 2GAZB 5GGSA 5FLVA 1T7ZA 4TF4A 3MA9H 5ISZA 1TCMA 3REWA 4XNQB 3UP6A 1MH5B 4Z7VA 4OZ4A 1J0KA 3DGDA 1P6FA 5FGBA 1T2JA 4WUKL 1EDHA 5KBLA 2BC4B 2ITEA 2R1YA 1NBZB 3BT2L 3QCVH 5D7LD 3BESR 2OJEB 2ZX8A 3BX7C 4D3CL 4E9RA 1MFAH 4KI5F 3KS0H 4GO9A 3HRPA 3NPSB 1IC5L 1A21A 5FCUH 3TT1L 5JR1L 1HH6B 2YGPA 1E6OL 4JG0L 4KH9A 3GZQA 4TNVK 1HFUA 3Q9PA 4NQDE 3AREC 1E5YA 1MRFL 1KJ3L 2NY1B 4DPCX 4HC1H 3BPLC 2LGNA 1K5NB 4FQCH 4E9WA 4XZUB 2CZNA 1BWWA 3FB5B 1M1XB 4PJDB 2O5ZH 2WBJB 2XWBB 2R29L 4UV4L 3MV7E 1CU4H 3PF2A 3VD4A 3KJ4C 4BKLB 1LMIA 1HHHA 1PZBA 1NCBH 1H0DA 1Z9MA 3OGOE 1N5YH 1D5ZA 5DLML 1X5YA 1XIWA 4F7EB 1FZJB 4MA7H 2R23B 3BDBA 3AXIA 3CZSA 1XF2A 1JZIA 1ZHBA 3QCTH 2AI0L 5LDUA 3C5SB 4XI5D 2OCJA 5LKNA 2OMWA 4YOKA 2F54A 3FN0H 3KJ6H 1WSST 2XTJB 4ZO9A 2ROYA 1WGVA 3KJ4B 3STLB 3SKMA 3OKDB 5DMIH 1OWRM 4AYMC 4KXDA 4E9XA 4Y2LA 1AGBA 2A73A 3VFGL 5DHYB 4E9SA 4GKOA 1S7WA 1KENH 1FGVH 2BY1A 2HJFB 2ZUQB 2YPKA 3G9VA 3QI9D 3QI9A 4X5PA 3UIYA 1QLFA 5KAQF 2AEPL 1JERA 3EYOB 2A9MH 5A6LA 1EZUA 2GIXA 2CBMA 2Y7MA 1MCDA 2EAEA 5I28A 4Y4FB 4C4BA 4AGOA 2DLFH 1D5BA 2JJVA 1GIGL 1RK7A 1R3JA 5A2AA 3U9PH 3ZTCC 1TOXA 3RA7H 2IVFC 4UNUA 3L6FA 4ZUWA 4YN3A 1YECL 3PJNA 4UDTA 2BNRA 1RHFA 3VWJA 4NHCL 4M1GH 1GJWA 4HUVA 3OF6D 4GS7C 1I9EA 5E23A 2OMUA 2MQ3A 2RBLA 1OM3L 1KPRB 1NKRA 2ICWJ 5GGTH 5DMKB 3WU1A 2LOEA 3DPBA 3K0WA 3KL0A 2VDOH 2NX5B 3VU1A 2DZEA 1RK0B 2DWSA 3S34L 4G8IA 5CEZL 3GNML 4GYBA 3CH1A 2VOTA 2XTJC 2Q6WA 3SBPA 3VB9A 4ELKA 3WE6A 4DTGL 4NQEA 2QPEB 3K1KC 1I1AD 4LLAA 1YEHH 1OQXA 1YMMB 5F7DB 2BCMA 3HBQA 4YR6A 4AK2A 5F3BA 3L95B 2J2ZB 4OU3A 1TJMA 5C0CD 4IRSB 2A6KA 2UXTA 4UNVA 3V6ZB 4FQ1H 4Z7WE 3FYEB 5TDNA 4I3RH 4U7KA 4BK8A 1DP0A 1MG2C 4P5KA 5LGJB 5HPMA 4LL9A 1C08A 2J8UF 3FS9A 5EO0B 4ONGL 2F53A 2WXJA 5CAYB 1HHHB 1KXVA 4XH2B 1AR2A 3CHSA 3Q6FB 4GW1B 5E4AA 4KRPD 1E5ZA 1M6UA 4RWYH 3MRJB 3HBPA 3LHPL 3WNKA 1ODUA 3B37A 3NJNA 5JW3L 2IWEA 5HYJB 4N4YB 2XT1B 5L2KE 3IETB 2C9UA 4M5ZH 4WWOA 4CDGC 5EU4B 4DK5A 5EOCJ 2DBJA 3GLAA 2GI0A 3AS1A 1TTBA 3FB6B 4IS6B 2A4EA 3GUFA 1J5OH 1B4LA 4X99A 5GS1C 3ULUC 4PJCE 4TRPL 4Z3HA 4AMWA 4WDIA 2WLLB 2QR0B 1E90A 4RGNB 5C7XH 3V55A 1C16A 3KPRB 4NQEE 3QZBA 2VLLB 1HHGA 4FFTA 2VR9A 2XACC 2Z31B 4Z1PA 3S7GA 4L2YA 1WAPA 3BPNB 5F9WC 4HBQA 3N42F 3ZTJH 1PS3A 5I2IB 3ZKXC 4QRUB 1DO6A 3D69A 5B38G 2JJSC 2WVTA 3Q2WA 4YE4L 3UO1H 5CLWA 1I7TA 5FX3A 4U6VH 3TBCA 2WBXA 3TYFA 1KLUA 1KCRH 2C4XA 2NR6C 3N41F 4KZ0A 1HTYA 4S10A 5DD1H 3VSVA 2J5WA 1GYVA 3KEHA 1DJXA 4A7VA 1IKNC 5BO1L 3K74B 5AW5B 2CIIB 1T1WB 3UTQA 2ZCKL 4WSGA 2BVOA 3UC0L 4ZMQA 3EGXB 2YC1A 4KNTA 4H8QA 3QQ4A 4WFFD 1E28A 2BSSA 2FX7H 2QHLA 2B1HH 4NCC1 1QVOB 1RIUH 3Q01A 1CFMA 4XOBA 1BYPA 3VO0A 2FIRT 4G1MA 2ZOUA 3GSOA 3GNMH 2QQNH 4KK8C 1HYSD 4JRXB 4ELME 2EIEA 4PD4K 2XIIA 2V2XA 3ULVC 3EJZD 1BQSA 4JCLA 5AW7B 4L8BA 3D85A 4M5SA 3UJJL 3HMXH 1YMMD 3BN9D 1YPZF 2Q1EA 1URIA 4QOKA 3JVGA 1NFIB 3JYCA 3SB3A 4Z6AT 2FX9L 4HUXA 4KRMB 2GT9A 1T83A 5DK0A 3FQ4A 4WFEE 5DR5L 1FJ1B 3E6FB 2LW3A 4XXDA 4ZTPH 5T3XD 2H8PA 4UMSA 2PTVA 4MLIA 4K3DL 3G6AB 2TRHA 2CMRH 3AT8A 5E5MB 5BV7H 2FJSA 5E8OB 3C5ZA 1L3WA 3IMWA 4MD5B 1TYRA 2NXZC 3MRFB 1JGIA 4XBEL 5T3ZH 3UG4A 1IKNA 4PP2B 4N68A 5EOQH 3M1CA 4LPXA 1M71B 4NZRH 1G7QA 3OKKB 4OGXH 2EXYC 3F7VA 4HWZA 4OLXL 3LXBA 2QQKL 3N0PB 1CD1B 2VM3A 5TE6H 3T0VA 3IK2A 2YS4A 4CC1A 4DP7X 3CFEA 3DRTA 5KS9E 1CVRA 1U8OB 3BAYA 1AE6H 2D7MA 2E27L 3GWJA 1SM3H 4NWUH 3QQ3A 4F7KA 2F53E 2QV2A 3K2KA 4UTAH 4F2MB 7PCYA 4J6RH 1JHTB 2VLJE 1QFWL 2RQ8A 2YEZB 1ZS8A 3LVEA 4G8AC 1S7TB 1TU2A 4JEGB 3HZVA 1ETJA 1PQZB 32C2A 5E7FA 1SFHA 4POUB 5KANI 3RTLA 1E9PA 1S7SA 5I18L 3T4AA 5TPWL 3CK0H 4JFHE 3KCWA 2D7TH 3ZIMA 1HYSC 2OR9H 3PGCB 4YBQC 2W94A 2A9DA 2WXRA 5C0AA 5AB1A 5I1JH 2ZYRA 1U21A 1IKFH 2KUTA 4RQQB 5AW6B 4B9KC 5IJDC 3MKGA 5JR1H 3V4UH 1S5IH 3UIZA 1QFOA 3VD1A 5K1VA 3S4SB 2ATPB 1OGTB 3VI3B 4Z7OE 2LABA 1JPTL 1NCJA 4WW2C 4KX9A 5HI3C 4OI8A 3IDYC 4MZ2A 2IBZX 5D1QB 2XWDA 1FFRA 2HKFH 4OVVA 3UBXB 4N8CL 4WU5B 2K7PA 4PBVC 4PRBB 5D4JA 1RZ7L 1SVBA 4LPUA 2KQMA 5ITFA 4P2OB 2HJFA 5DCCA 1U3YA 2OI9B 3BWAA 1AO7A 1Y6NR 2JLLA 4KQ3L 1CDJA 2Y5QA 2VLKB 3OV6A 3VFMB 3TV8A 3IN0A 4AYBA 4BINA 3KWVA 2ZAIA 1FH5L 1BJ1H 3PWPA 4HH8A 3PWPD 5IV2A 1AKJD 2AQNA 1D7FA 4I5BA 3RVXD 1TKWB 4LKCA 3W0WB 2V9QA 3GSUA 4CA4A 1VHPA 3UMTA 1M71A 4BFKA 4U1JB 1L5GB 3VXRE 3EOBB 4O00A 5K33A 2GIYA 2N0MA 4KXZH 4J1UB 1C9SA 5E1HB 3TEZA 5JW4R 1NCCL 1H8LA 3V6OE 5F9DC 2BW4A 3UG5A 4L9LB 4GLRI 2IH1A 5CLZA 4CW1B 3OKEB 4DP2X 2X05A 4E9QA 1BIIB 4WNJA 3PWUB 4JR9L 2A77H 5EU3A 4H20L 4D8PA 5LJYH 1R3IL 3FMGL 1N64L 2CH8A 4WEEA 4G6ML 3ULAB 1F58L 1IGFL 3JZ7A 1T89A 5ANMA 3VXOA 5I16A 3FU7B 2OL3H 1DE4A 3TBVA 3BQUB 4ODSL 1B0GA 5GS2D 4TNGA 5HHNB 1E6JH 2HWZH 5KVFL 3ALPA 4DGVL 1MCJA 4TQIA 4Y2DA 4HKBA 1IEAB 3VG0L 1BXAA 2VLRE 3MRMB 1PL3A 2ODHA 2HCZX 2AJUH 2XA3A 4Z7UA 3B9KD 1BQKA 1NCDH 3NZSA 4KK5C 3BKMH 1S3RA 1OM9A 3MJ7B 2F54D 1CO1A 3IDIA 2DM7A 2HLAA 1IFRA 4G8GB 5FOJA 3WTVA 2VW4A 1TZIB 4U6TA 3A6BH 3QIBD 4UILL 1BM3L 1XGZA 4KX7A 4UBDD 5DK2A 4NQSA 5TE6L 2XDHA 5BOPA 2DIAA 4JL1A 2QQQA 4GG6A 3WNPA 3DX8A 2M83A 3AU0A 5TJWK 3E3QE 3TA3A 4L37A 1FQ9C 4K5OA 3GIZH 3QWRA 3AXHA 4U4IA 4HQQH 4LHUD 2ZOLB 1R5VA 3QQXA 1A7PL 1J87A 1L0XA 4X83A 4ZRGA 5CF3A 1AQDA 3NA9L 4I4WB 5JW4N 1MHEA 1SDDA 2HTLC 2ZKMX 2UVFA 4BCZA 5B21A 4G8EB 1M7DB 2HJLB 2ZXDA 4GSXA 3MCYA 4HS8L 1QEWB 4LOVA 4NLHA 4ODXA 5IQ9A 3RUGB 3TBWA 2TAAA 5GJTH 4UB0L 1KB9K 5CZVH 4B96A 1BZ8A 3U9UB 4A04A 3UJJH 3HAEG 2QDVA 1UT9A 4N0CD 2LT9A 3ZL1A 1JZHA 4N86A 4HEPG 4Z77A 1PX4A 4LCCC 2FX7L 4N8UA 4XAKE 5IM7A 2XX0A 3ETSA 3HFML 5I74C 2XQYK 4JFDD 1HOEA 2ED7A 2P49B 5B1BB 5HHQB 1SOKA 5CLTA 3FRUA 3TA3C 2ZP9A 2B59A 3MRDB 2Y7SA 3E3QC 3MJWA 4JO3H 4GXUM 5IK3B 1CF8L 4OZIB 3PABB 1SVCP 4M8UA 3D85B 3FO1B 1OSPL 3KBFA 3NESA 2YGNA 4HLZG 3BAEL 3BDYH 2DF3A 3GSNB 1WZMA 3SKUD 4RA0C 3BMVA 5LAXA 3IMUA 2KLSA 2F9BT 2YPLA 3ARFB 3QHZL 4YAQB 4QRRA 1CD0A 2X4PA 3LTVA 3RFZC 3K2MC 5J9PB 4GI8A 5SV3A 2HLFD 2Y3NA 4Y2OA 4JVUA 3UTZA 1AI1H 3VWKC 1HOCB 5K9OA 3N5AA 3L1OL 3RVXC 1EBAA 1SEQH 3FQTB 3HI6L 4R0LA 4QMEA 1AHWA 2A73B 3P4OA 1B2WL 4TRPH 1SJXA 5BRPA 2QKIB 3SDAA 4UOZA 5CCGE 3R06B 2F74B 4BBWA 1CGXA 1XR8B 3V6FA 3HMWL 5I6MA 4TNWF 5E2UH 2WQAA 3KE0A 4CBZA 2JFCA 4UYPA 2ZSVB 5TE4L 1LK3L 1F97A 4NWTH 2WK2A 4BWWA 1RV6X 4L37B 4MSWA 3MLWH 1HVXA 3IXAA 3RU8L 5SWZE 4MVBC 5TD4A 3H54A 4ELDA 4H44C 1MJJB 3P0YL 5CEYB 3G5VB 3HNVH 2X70A 5AVRB 3ULVD 1FFTB 3FUIA 3BP7A 1CYGA 2V2WA 3STZA 5K9JL 4XMLH 1AJ7L 3TIDA 3L3HA 2YPVH 3FH5A 5J1AA 4PWHA 1H5BA 1A1NA 4LF3A 4KK6D 2CR3A 3WOVA 4HFWB 1H8NA 4MCYA 1IC0A 3T0EC 3X1NA 3HKFA 1CFQA 2HUHA 2WOBA 3EHBD 2X4TB 3X1GA 2X2JA 4QTHA 1TT6A 2ZJSH 2XG5A 4UUJB 2EIKB 3DROA 4XNDA 2IADA 3RZWA 2IOOA 4XODA 5TF0A 5J89A 2IF7A 2PW1B 2YRBA 4RETB 5F9JA 5KYXA 1MI5B 1LILA 1JXFA 5D1ZB 3FQ2A 1G0XA 2WQUA 3GMOA 1BVKB 4OV5A 3AWFA 3MV9B 3P0VH 2XQBL 4Y2DD 2WGXA 1D5XA 5FO7A 4PRID 5E6IC 2WQXA 5FUCC 3T2LA 3QAQA 3EAKA 1SFDA 3P4MB 5DO8A 1FVDA 1SHWA 3P3TA 2X2HA 4A2MA 1R4XA 5FYLH 4RMSA 2EEDA 4XPFH 2Q8AL 2IQAA 1U58A 2FBJH 5GS1B 5DA4A 2AEQH 3MLSH 1MREH 4JAMB 1Z2KA 4LCUA 4YDZA 3GSQB 4FL4C 5DURB 5IHHA 4UIKH 3FUHA 3P9MA 4E42A 3TPKA 2CRMA 1XWVA 4P5MA 3IMSA 1PIFA 5T33H 1ORSB 4BZ2L 3GXIA 4A7UA 5F88B 4MMYB 3ES6B 2X44D 1FORH 5J6HA 2PCPB 2BCKA 2WXFA 2GC7C 1G7IB 4BZ2A 1BVOA 1UCBL 4DP0X 4MASA 4XMTA 5LQBL 5C8JA 2VN3A 2HX7A 8CGTA 5CLYA 3BUTA 3PWPB 2LLGA 3GRWL 3SQBB 3IJEB 1KB5L 3CHRA 4ANVA 3HE7A 1MPAH 3BWAB 4HAFA 3HVDA 4N0CC 5FO9A 3AW5A 1KWGA 5D7SH 4BXVA 1JHKH 2VXSL 3IFOA 5HHOE 1CIDA 3ARGA 1BZ9B 1DBAL 4NEHB 1OAKL 4LIQH 5JHLA 3O2VL 1CLOH 1R75A 1TVDA 4J3WA 3CSBA 3WHE1 5I5IA 1A1OB 4ADJA 3KM1A 4YFEA 4GMTL 1QNIA 4JN2B 2XWTB 1AJ7H 3BVTA 1UWXH 4WO4A 2DQCH 3T09A 3UAFA 3BWUF 1P2CB 3PP3H 2KQNA 3Q6GL 1OLZA 1YSOA 3ATBA 3UL4A 5EN2A 2V8MA 1HILA 3OC5A 1DHKA 1MFBL 2VMCA 3OVUB 4EIZC 3QUZD 3MPCA 1IQWH 3GO1H 3MLVH 4GSDH 1E6OH 2IANA 2W60A 3SODB 3WMQA 2ZUUA 2COVD 2PWDA 2JI3A 3RDTA 2VZTA 5D6DA 4MRBA 1BX2B 2W81C 1OCCB 4YLQT 1IGYA 2I5YL 1FI8C 4JDVB 1HWGB 5A43C 3HI6H 4LXFA 1N7ML 4FN0A 5LO7A 1NOFA 2KL6A 2ZXCA 4AVHA 4CMHB 3DV4A 4JLRB 5B8CC 2OSYA 4Q4EA 1BV8A 4U6YA 1J1XL 1G7JA 2DJSA 5FM5O 1MFDL 2GSIA 3LX9A 1I1FA 2JCCE 5BQ7B 1GH7A 2BRRH 4NQQA 5BS0E 2OAAA 3U9WA 2YK1H 5T3XL 4ABQA 3BPNC 1A3LL 5BRZA 3QYCA 1E4HA 2NCMA 4MMYA 1FZMB 4AQAB 4YNYB 1EMTH 2HJKA 4HBCH 2NNRA 4N85A 4PRDB 3C9NB 4ALAH 3O6MH 5A3ID 3FB8A 3MROA 5DD0H 1OAJA 2QL1A 1WBXB 1DCEA 5ADPL 4C55A 5E5UB 1V10A 3U9UA 2OMVB 4JFXA 4DH2A 1TU2B 5A2LH 1ZD6A 1CFVL 2RJMA 4HHAB 3B2VL 5EIIA 5FM5M 3ZO9A 4GPVA 5I0YA 1BJ1J 4Z5RA 1UUSA 3N1MC 4OQTA 1G9MC 1XGPA 3ROOB 1IAIH 4U3XA 5JORB 3WTXA 1KYFA 4F91B 1CZ8H 4RVBA 3EJYD 1P4BL 3HLAB 4JPWH 3N55A 5MP6L 4NBZB 4ZW7A 3WXWH 1AYRA 2P80D 1QBLH 2W9DH 4HJTA 2O5YH 2Z91A 3IF1A 3NP3A 5HDQH 1LJMA 1RZPA 2E46A 5ACZB 1U8NA 3CSFA 3LQAC 3QJZA 5D6CA 1MFBH 1KLFB 4J3UA 4H8WL 3EFOB 4PJ5E 4TUJA 4E9YA 1V3JA 5D1QA 3T04D 2FBOJ 4PGBB 1MIEH 5AVTB 1YEIH 1I31A 1IGYB 3UZQA 4YHIB 3H53A 3RBSA 5D5MB 4F7MA 3LPPA 1ZT7B 2OMXB 2WXMA 5CZXD 4HJGB 5I66B 3S8FB 3EJJX 3P3RA 3CWGA 2DQMA 4UZGA 4K94C 3MRRA 5F2FA 2NUPB 2J6EL 4HIIB 1DBJH 3AY4C 3LN9A 1UGKA 3NCYP 4MZIA 3UTTA 5LXGL 4O5LH 5CN2A 1X7TA 1LDPL 4M4RB 1T4WA 1U8CA 1IGFH 4KKCD 4M7JH 1NC2A 3D09A 4JK0D 5I75C 3RWCA 4Z95H 1WEJL 5E2WH 4PJXF 4GY4A 3UTSB 3K2IA 5H2BA 2Y4SA 1LD9B 5E94B 1QUPA 1OTTC 5F6HJ 4FI8A 2ALAA 3O8XD 4YHKH 4MYPA 1K72A 4ZJ9A 1WD9A 1JVOA 1A66A 3WKML 1MFNA 1UOKA 1V5JA 5DD0L 1ZT1B 3VM5A 2EEAA 3KPNB 2WHVA 4JPQA 5FUZH 4IBZA 2CA4A 5CSZB 1M4KA 4JRLA 3D0LA 3L9YA 3QUMA 3RL1A 2EDNA 4I0PB 4YBHA 4XAWH 4ZPTA 2XCMC 3WEOA 4GUQA 3P69A 1CFQB 3RB7A 5HYSG 3NJHA 5I0XA 3PY9A 43C9B 3TO4D 4QYOA 3IBOA 2X3BA 4H25B 1KXHA 5BJTB 3EH3B 1ZVHA 1YQ2A 3CFKB 1K85A 3EYUL 1U41A 4JZOA 5EC2B 2DQJH 1BCIA 1ZDSA 3AG4B 5C0AD 4NQED 2AAVA 1LO5A 1Q9WA 3CQFA 4NZ8A 1WD8A 2VDKH 2HKFL 5KVDL 4XPAL 1J5CA 2F7OA 2DWEB 4DKDC 1WA2X 3DIFB 1JHLH 1ZLUK 2WKLA 1BD2A 1MZZA 3IU3B 1K6QL 1OV8A 1MUJB 3HZMB 3RWEA 2J72A 4GQPH 4KK6C 5CJOL 3RKPA 1MVFA 2ODIA 4H26B 5B1JC 1N6VA 2NDGA 1JZ2A 4ISVA 3MLZL 5EO9A 3VXRA 3K72B 1N70A 3QFJA 3MV7B 4JKNA 4Q9CA 4GQQA 4W9JC 1KBGL 1XXFC 4YHYB 3C09C 3QORC 3PGDA 3QI9B 4RFOH 4XE5B 2OR9L 2WWMD 3LHAA 3BVNB 3QXWA 3GRGA 1E5AA 2DMHA 2BIOA 3KDPB 3TJEH 4C4KO 1JPGB 1CYXA 4QXGL 3Q8AA 2BHFA 1MNUL 2E9BA 4AW7A 1CFNA 3MBEA 4Z9KB 2J5LC 2I24N 2VZUA 4LLUB 4QRPA 3MLZH 3LS5H 1MKFA 2XTJD 4BHUI 1UT1A 1EHKB 5GGVY 5BXFB 5KVGH 1UEMA 1IEHA 3C6LD 1ZTXH 1QLEL 3O0RH 1CGSL 5C08B 4PTTB 1MF2H 3L1OH 4ORGB 1OAKH 3DGCR 4JQXA 5F6HI 4EUPG 1DBAH 1EFXA 3ZJAA 3NJLA 4XPAH 5T3XE 4OH2A 5I6OA 1I1AB 3U6XA 3PJSA 4HZAA 5TQ0L 3SO5A 3NZHL 3Q7JA 3GGWA 4R7DB 5GZNA 3LPWA 1JXGA 3MQIA 2CDGA 2LVEA 4X9GA 2WXQA 4APQB 1BQLH 3GMPA 3BGAA 4IBLT 4Y4FD 2ZONA 4H1LH 2C3VB 2WBJC 4MFHA 5B4MD 2HXAA 3HEIB 5IJCC 1CF8H 1KG0A 4QPEA 3UYRH 4XR8C 4JO3L 2VRQA 4S0TD 3IDJB 2E86A 2ZUSA 2IAAC 4DEPC 3QI9C 1V54B 4I1RA 2X4PB 1YQVH 1HZHH 5G4NA 2NZ9D 1I82A 3UJTH 1DYZA 2VDKB 4FYSA 4R0LC 4WY7H 4ICXA 1A9BA 1JSYA 1I7TB 3UTZB 3WLWD 2NSQA 1ROCA 4EI6A 3EGSB 4ZUSB 2OZ4L 2AEQL 2ZCHH 4O2CB 2IEPA 4F7CB 3GINA 5FOBA 4HG4K 1FIGH 4K71C 5DZ9A 4JY5L 1FG9C 3FT4B 4LESA 5TDNB 2W0KA 1FNGA 1JFQH 4UAHA 1NQBA 4U3SA 5IG7A 3EJCA 1J0YA 2QQNL 4XRCA 1KTKE 1K8DA 1QLRB 1U8MB 3I3DA 3U79A 5AW3B 3VWJD 1XGQB 4G1MB 5AAWC 3V6OC 2ENJA 2FGWH 5GQBA 1WZAA 3X17A 3OJVC 3VFSA 3D2UD 5EPMB 4X99B 2W92A 4PRDA 1A7QL 4M7JL 1ASOA 2VDNH 1Z3GL 4UZSA 1CDHA 2PO6B 5KJ7E 1V8HA 1P7KA 1WJ3A 3F04A 4R9HA 3RVTD 1PZUB 2QBWA 1BBDH 5JHAA 1SXBA 4KMTL 5I8OH 1FZMA 3BZEB 4JM0A 4I88A 2EEBA 4A1RA 2VITB 3OR6B 2LFEA 3OQRA 1JWSA 5K9JH 4NDMA 4JNXA 1BM3H 4HIHA 3TH4T 1MIEL 7FABL 2DN7A 4NO3B 3RWDB 1GC1L 4P3CL 4X0KA 1EEUA 4HWEH 4P3WA 5JNYA 5DJAA 3VVVA 4H8WH 2GITA 3V7MA 1WICA 2H0EA 3MLWL 1EEZB 3PS6A 1GGIL 4PTTA 5GISL 3MV11 4WQOA 3NFPA 4K71B 5DDHA 2BVOB 1ICTA 4KROC 4MNQA 4KO6A 5CUSL 2GTWB 2XZAL 2XVGA 1HN1A 1AGCB 1YYMH 3ZDYE 3N40F 3WXWL 2XZZA 3L3DA 3IJHB 4GG6E 2VDPH 1WLHA 1KTJA 2LLLA 4PJEA 4ANUA 1W72A 4JREC 2NNFA 4KTEL 2GJ6E 5GRZA 4RX4D 5A3IC 3WHE0 3UEQA 1EJOH 4YLCA 3V4VL 1GGYA 4QOKB 5FDYA 4ANKA 2FJUB 2X89D 4JR9H 4N2FA 1SY6L 1W2KT 3PPSA 2Z92B 3C5SA 3T9WA 2QEJA 1IC4L 1ZT7A 1T66D 4X50A 1IEAA 1UHVA 2GQHA 2BRQA 3B3BA 3U30C 2LTQB 4NZUL 3EGSA 4GMSL 3DARA 3KG5A 1QMUA 5M7QA 4Y9CA 1MQKH 2Q2EB 4ODUB 3CZFA 3V9EA 2NW3B 4ZUUA 2CR0A 2A9CA 3NEXA 4P46C 4ZBJA 2LU5A 2EYSA 2ZUWA 4GLRH 1QO3A 2HT3C 3D12B 4HUWA 4P2QB 4XPBL 4RFNB 1S9YA 3O6ML 1ZGLA 3GHEL 3N9GH 5E9DB 2BY0A 5C70A 3U6RA 3SO3C 2RAMA 1EMTL 3WKNA 4DSYA 5HHXH 3DVGA 4DTGH 1NBCA 4NCDA 5E6RB 1XGQA 3U4AA 4FJYA 1XB6A 3PXJA 5CEZH 3RRQA 1T0PB 4KQ3H 2JI1A 1MELA 4AQEA 5GGTL 2OBGA 3QNXB 2R0KL 3EBIA 4JFYB 1QYGL 2XXGA 2EDTA 3SDCA 3II2A 1J0HA 5E1GA 2F54E 4U1KB 1JPFB 1F4WL 2CU9A 2W9LA 3TBTB 3ARRA 4Q9BA 5DU7A 3H2QA 2WKGA 3GSVB 1UB6A 2BM3A 4YBLC 4OLVL 2QMJA 1N7MH 2PO6C 5J11B 3V6BR 1A65A 3FN3A 3WE6B 3UCRA 5JIDA 1JNHB 2AQ1A 2A6DA 1VZHA 4NYLB 4PV8B 1G87A 2WZ5A 2EDDA 3MX0B 3OSVA 4PVBA 5K9KB 1JYVA 2XZQH 3NFPB 1AY1H 5DJXA 4EKXA 3CMOH 1LO4L 3ASOB 1AZVA 3VFGH 1T5XA 4HU2A 1I1YB 3IGFA 5I1GL 1QSED 3Q2NA 1QFWI 1BZ7B 5I18H 4OF5A 2FSDA 2FD6H 3BKML 1FFOB 4S2SA 1NZRA 3R8BB 4AL8H 1J5HA 4L4VD 4DOHE 1DDHB 4IRJD 3CFCH 3CAFA 1XCTA 1MI5D 4CN6A 4JFWA 2XYBA 1JWMB 4CGUB 5EF2A 4P5SA 2VR3A 4I9WD 5C0GA 3WEMA 5JOFB 4GKLA 3IMTA 1AIZA 2E4TA 2HWZL 5KVFH 3KCPA 4GAGL 4ODSH 3CVHB 1B0RB 4EUPA 1IEBA 1ASPA 4U1HA 1UD6A 3B2DC 4GJTB 5D7SL 1ZV5A 3QJFB 2IDFA 1FL6A 1AE6L 1UC6A 1LVEA 2WUCL 2WVVA 4M7LH 1FUNA 2LQRA 1TFPA 2A77L 3VXUB 1CDIA 1HHKA 4PRNA 5IV2B 2C9PA 4L29A 2GYSA 3GKZA 2XZQL 4JG0H 4GO8A 4IBUA 1B3JA 1KGXA 4I18A 2GSGA 5CGTA 5DQJB 1U93B 1I3GL 4YBQD 3O2DH 3V6FB 2WN3A 3D4GA 5CJXC 4AM0B 4IRZH 2X4RB 5T3ZL 4PJHF 2C9AA 4B9PA 3EOTL 2Z31C 1U8LB 1LLAA 1R24B 5E1AB 5TDPB 3VXNB 1FAIL 3IJ8A 3BT0A 2BJML 1NM4A 2NNAA 4S1DC 1NDMA 4OLVH 4ODWB 4F1SA 2I07A 4L3FA 2Q7YB 4AIXA 2Y5TB 4Z5RB 2AXHA 4N3UA 4F7PA 4PJIA 2IAMB 2DB8A 2CO7B 1G6RA 1GS8A 5HHVH 3FQYA 5ISZB 4ADIA 1VRSA 5T5NG 4HHWA 3Q2LA 5DEFB 2HP4A 1NCUA 2G5RA 4X7SH 4NENB 1HIML 5IQMA 2XX1A 2VCOA 1YUKB 2FNBA 4WEMB 5E6ZA 2DI9A 3NCMA 2WBKA 1X5GA 1BMGA 2AK4B 7PAZA 5BUGA 3HNSH 4WHCA 1DBML 2WXHA 4TSCH 4NO5A 1IB5A 5JHDD 3P73A 5FWRA 4FLOA 1KNOA 1PBYA 3FHQA 4GG6F 3WXVL 3IFLH 4HUXB 5AZUA 4YEFA 4H0GA 1EGJH 1DLFH 2MCAA 2EVJA 3WS3A 3QXVA 3Q9QA 5KYYB 1MWAA 4YGVA 1BZ7A 4PREA 4J2XA 1PF3A 2ZT9C 3VSQA 1M1XA 1S5IL 4K8RC 2HA1A 4LFHD 4EI6B 1S7XB 5FDWB 3P3YA 1RY7B 1GL4B 4LIQE 1IC4H 4NPJA 4TYUA 4XRCB 4UNTA 1VB9A 1SMAA 4ENZA 4N1CA 3ZMNA 4TL5A 4TQHA 4FZEL 1N2RA 2ZAHA 3HS8A 1DBKL 4MNGA 1XCTB 4MZ3A 5GGVH 3TO2A 4J3OD 3RU8H 1EJOL 3NPSC 3CK0L 2WUBL 5EBGA 1DQVA 3ARBA 3LJ3A 1CVSC 2WINB 1ID5I 5D70H 5C7XL 2WB1A 1KJ2L 4YSTA 4I0PC 3QFJD 1CD1A 2LVCA 3U2SB 2M1KA 3SOTA 1M42A 1BJ8A 4XMPH 4NOFA 2WBWB 3BXNB 5KWYC 1EEQA 1TO4A 3UH8A 3HNTH 4XBMA 4YPGB 3RX8A 5CUSH 4WI7A 1EIBA 4YVNA 1H3VA 5IROD 3WNLA 4ZX4A 2MTAA 3WAKA 3HG0A 4NWUL 3WUWG 1NCIA 4UCFA 2XRAL 4ODVL 3S35X 2FTAA 2VW7A 4HXAL 3QDJD 1FO0H 1P7QA 1KBVA 2QQKH 3D18A 1U8QA 3BP6A 4MNQB 4J3VA 4IOSD 1AKJB 4A63A 3PJLA 1FCCA 4FQQA 1AGCA 5DJ0A 3L3OC 2XWRA 1RZ8A 2WY3B 3JWOL 4KMTH 2XN1A 2Y2YA 3CSPA 4JFSA 3BGFB 3EHBC 3VWKD 3QVAA 4PLKD 5EEXA 4R4BB 1IZJA 2EABA 1OAQH 5G4MA 1TLKA 1HL4A 2PN5A 2WJ5A 5TE7H 2EICA 5KTEL 2X2YA 4BQBA 3F3HA 1WFTA 2X9WA 4ZTPL 2R0LH 4PVNA 3KLAA 2Q9OA 2CXKA 5F8QC 4PUBH 1GC1C 1OPOA 3HS0C 4QT5B 1G9EA 4J8QA 4NUJA 2KZWA 5EZLB 2PR4L 2PLTA 4AEFA 2ZKHL 4K0OA 2UZIH 1EJ8A 2J1KA 1FIGL 4JDVA 4FI6A 3CVDA 3MV7A 2XNAB 3D39B 2FBRA 2VRAA 1Z66A 4M02A 4PJAF 1O7SA 2XPZA 2Z8SA 4N9GB 4LKXB 5AOMA 3MC0A 5MEPA 1DJWA 2VR8A 1UFGA 2XKUA 5HXMA 5KBPA 1JN6A 1JI2A 2FECI 1TXKA 4U1IB 4HQQL 3LQZB 4OJAA 2GHZA 2WTPA 5SWSA 4LKCB 1T21B 3FQUA 4I89A 4GI9A 3K7UA 3MA7B 4A2EA 2AXWA 1FL3A 3WN5C 5DO2C 3ZYZA 2ZWKA 4HISA 2YD1A 5IB4B 1UD3A 4HJIA 4MKMA 2LU3A 2VH5H 2X4OB 3B2UC 3OQ3B 5DMIL 3ATDA 4L5FE 4MJIE 4WGKA 2FO8A 5F1NA 4KKNA 3VWJC 2N7BA 3B2XA 4YDNA 2KI6A 5CJ5A 4PH8A 3BQUD 4XOAA 1IVLA 5EOTA 4UOJA 4LK4A 2AJUL 4XT1C 2YPLD 4QRRD 1LQBC 1AGBB 1SMDA 4APQA 2CGRH 3T77B 3JSSA 3ZHDA 3LPFA 4ZW3A 4R7NA 1WA0X 4IQHA 3GSXB 5ADOH 1LDSA 5I16B 1ZK9A 4NO0D 4B97A 1KJ2A 3ARDB 1SBSH 5GGUB 4G6MH 5IB2A 4MJJA 4X0NA 2O5NA 5ICXB 2ZKWA 3QPXL 4OD2A 2DM3A 2FHCA 3LHPH 5DWPA 3QJHB 3AWEA 4QNPF 1A9EB 4XXWC 4X6DA 3WAJA 2VLME 1HT6A 1Q9KA 5AVZB 4GAJL 1MEXH 1XIWB 3KYOA 2YRZA 4LCUB 1RK1A 4MJIA 1WT5C 5GRJH 5CD3B 2VZSA 3T6WA 4UMGA 5IJVA 4BZ1A 4JFTA 1UM5L 4GW4B 5DZJA 4HOZA 3EBHA 4EI5D 1IGIL 4TUJB 1INEH 4PCYA 1GY2A 3D07A 3O9WA 4QJ3B 4YXHH 1RJZA 3T3MB 1T22B 1HI6A 5D1XB 4KY1L 5GS0C 3WIIH 3X11B 1MLBA 4XN9A 1DBMH 1EFQA 2NY4D 4TSCL 5F3HA 1X9RA 4J39A 3G5XA 1MJ7H 1N10A 2Y7QA 2VN6A 2IALB 3QS2A 3IJEA 1H3PH 1CL7L 4K7PH 2YSTA 1X5ZA 3HG5A 3MCKA 6FABH 5JOPD 1PG7W 3FOMA 3V6ZA 3SDAD 4Q6IB 1G7IA 2X4RA 5IREA 1CFTA 3D3VE 3INOA 4Y5YA 2VTFA 2XXCB 3OMNB 4R5XA 4JPKH 3E7JA 4WGWB 4FLRA 1SJVA 3U46A 3D2TA 2YPKB 1H6TA 2EDOA 2IOIA 4R84A 5BV7C 2GBTA 4X6CB 2AXJA 4BH7A 3D4CA 3V52H 5INCA 4LCYB 5DI8A 5F7KC 4OKVB 3FJTA 4DUXA 1MVUA 4MJ5B 2O26U 1THCA 1IM3D 1MCBA 4RNRB 4ZFOL 4TUUA 1WIPA 7CGTA 2HPOA 2HSIA 2IPKB 2L8AA 1MW1A 4YHKL 3G6JB 4UAOB 3K4AA 2EP6A 3NMEA 4HJUA 4ZMVA 1JVLA 3BEVB 5CSZA 2NUTA 3V9CA 1GY1A 1T7VA 3FSAA 4N2NA 3RWIA 1C16B 3KPRA 1P1ZB 4L0YA 3D0LB 5E56A 5FK9A 2V5TA 4OIIL 1D5RA 1AMYA 3EH4B 3I6KB 5EN2B 3S36X 4DP1X 4CSTA 4JVPA 1DL7L 1FPTL 4JFFD 4UQIM 1BA9A 5DC0A 3KJ6L 5JHLH 3MLTB 4IRSA 1DBJL 1FNSL 2WZAA 5B38B 4P2RA 2HT4D 3HRZA 3KBEA 3QUHA 1I85A 4L4VA 2HVJA 3A23A 3FUKA 1V55B 3O8XB 4NKQB 1QFWH 4PJ9C 1QKZL 2QGBA 2WXPA 3RWFB 2HH0H 4LVNC 1Q9LA 1ZT4A 4F8PA 1O75A 1LNUB 2CO6B 3U2JA 3WG7B 1N0XL 4Y88A 4IJ3C 2O5ZL 2WYIA 1DUZA 3CFDB 1S8DB 1UWGL 2TSAA 4P5TC 3AG2B 1G43A 3P02A 4UANA 4B7LA 1HKFA 2LV4A 5D71H 5D1XD 3IU3A 3ZYJA 2YRLA 1KTBA 1WFMA 1F3JB 1U3HC 2LLNA 1NMCB 4RAVB 3VGAC 3O6FA 4NZRL 3ZT5A 3BXNA 3MUZ1 4PJAE 1CXLA 1EO8L 1TITA 4NRXB 1A8ZA 3LZPA 5KUMA 4AQEB 5MP6H 3FB8B 3KL3A 3V0GA 1WBXA 4OD1H 5B1CA 2WN2A 1SZNA 3V2AR 3TS8A 1JGVH 4F9LC 4P59L 4DETA 5CEXA 4AQAA 1FE8H 1QFUL 4LOUD 4LSUH 3C9NA 1F4WH 1OW0A 5FO8A 3UMNA 3BD4A 4X7FC 5DC2A 1M1SA 5ECGA 5JPMA 4Q4IA 1UB5A 4OLZH 4PR5B 1W6WA 4S1QL 2IV8A 4JRFA 4IU2A 1CXFA 2R0KH 4EPSA 3NTCH 4X5RA 3MLUL 4H8HA 3CHPA 3PLYA 1HCFX 4ANXA 2CK0L 1JK9B 3JTBA 5C07D 4OFKA 5H4ZA 1M53A 3CNKA 3L5IA 4YHOH 3UTPD 1IBZA 3TP4A 5HGHB 2B1HL 5FYKH 3P9WB 4P0DA 5BZXA 5F96L 5DD3L 5SX5K 2HT4C 1TDQA 3C5XA 5C9JB 3ISWA 5FCSH 3F6IA 3WS6A 1OAXH 1L9SA 1PZ3A 1A3LH 1N19A 1TPXC 3APFA 1T1ZB 3KWWA 1SOQA 4X8GA 4BFIB 1F6AB 3CH1B 1ILSA 3P4NB 1ZLVH 4R7VA 4ZOAA 4YZFF 4TN9A 4JAMA 4PRHD 1XF3B 4XVSH 5DRWA 4AQ1A 2OX5B 3LY6A 3S2AA 3VDBA 1AGEB 2VN7A 3Q5YA 4ZOBA 4PJGE 3ZOAA 4YJZL 1OWWA 1J1XH 3WTWA 3CMGA 4FP8H 4E2OA 3O4OB 1VFOA 2DH3A 4RIRA 3T5WA 4L4VB 5GRUL 5IW1A 5KBKA 1U6AH 5PCYA 3U1PA 3VB8A 4U31A 3F8UB 1EZLA 4LMQI 3T8XA 4Z7UB 3KL5A 5AUMA 2AQQA 3CXFA 4KTEH 3ZDXB 5D7JD 2I27N 4Y4HD 4W4NA 1VJSA 2CJ3A 5G2NA 4G9FE 4UU9B 4MQTB 3RVTC 1R3HA 1X4XA 2L3BA 4XVTH 3FQWA 4CILA 1W8NA 2K6ZA 3UPRB 4I3GA 2WP3T 3IXTA 4M5ZL 5HYJA 5D2LE 1KJVA 1E4KC 2I60H 4K2UH 2NY2D 2XOTA 1JNNH 4KHTH 2VXQL 5EPMA 2NSMA 3MO1B 2Q7YA 3ILDA 4NI3A 4P2RD 4R5TA 2IPTL 2EH7L 4NFDA 2ITCA 3LQAL 5I24A 3U0WH 1HDMB 4MJ2A 2E76C 4ZFZB 5L2KB 1YEEH 4XP1H 3HR5A 3ETTA 1S7TA 2EDMA 1WAAE 3S36L 1KPRA 2YD7A 5B8CA 3WTTA 3D85D 2Z31A 4NJ