2FSPA

Nmr solution structure of bacillus subtilis spo0f protein, minimized average structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAGE 0 SPORULATION PROTEIN F
publication title High-resolution NMR structure and backbone dynamics of the Bacillus subtilis response regulator, Spo0F: implications for phosphorylation and molecular recognition.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Response regulator
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1997-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fspA00
1D1QA 1PHRA 3JY6A 4Z99A 4FB4A 3LKBA 2CHFA 4XAQA 1RZRD 1MVOA 4Q7EA 3LUAA 1OXBB 1ZH2A 2FTKE 1Z18A 3O75A 3FFWA 1EWKA 3JTEA 3OLWA 1ZDMA 5T7BA 2WMYA 1FFSA 4UHKA 3K4HA 3F73A 3KS9A 3O2SB 4LX8A 4RY9A 5GOTA 4WT7A 1A0OA 3RVMA 4XXHA 5IUNC 4WXMA 3IPCA 4EY3A 3HJFA 3KTOA 4QPJC 1ZHHA 2FN9A 1MB0A 1NXWA 4O5AA 2M1ZA 1VPWA 1KRWA 2FQYA 4YR7A 3HK2A 4FE4A 5JNTA 4EYGA 1W9HA 2PUDA 4Q6BA 2PUGA 1USKA 1C0EA 3H5LA 3OQMA 4HNQA 5FWXA 5IUKC 4YGXB 5BRAA 3JVIA 5FBHA 1QQAA 1SD5A 1DCKA 3Q15C 3DLBA 1IIBA 2WRZA 5BR1A 1B00A 1M5UA 2ID7A 1QNLA 2AYZA 3CNBA 3IP7A 2WY2D 3NHMA 3H5OA 5JNRA 4Z0NA 1DRJA 4MR9B 3IP5A 4LDZA 3Q9SA 5IULC 3D8UA 4WZZA 5CNIA 1Z2EA 1USIA 3O2JA 1T34A 2JBAB 4D74A 4KK4A 3SM9A 2QR3A 3OQNA 1YVUA 1BA2A 2R48A 4MS4B 4M88A 4P1ZA 3RQIA 4DQDA 1S8NA 4ZPJA 5DLEA 2HPHA 3OMXA 1NXOA 2IYNA 4G0QA 4PZ0A 2A9QA 4RK6A 2WB4A 1DCMA 2MYUA 4YCSA 4NICA 2XDYA 4TLMB 5CNJA 3CG0A 3QEMB 3CRNA 3KG2A 3LUKA 4RDCA 5EWLA 5JNWA 3MMNA 6CHYA 4F11A 3DGEC 3QEKA 3T95A 2FVYA 3T38A 4HYEA 1TLFA 1MAVA 5CNMA 5GQSA 1JDNA 1AB6A 1M2EA 3LFTA 1QP4A 1PNRA 4N41A 1YS7A 2MYTA 2IPLA 4MS3B 4PYRA 1JHZA 3QX8A 4RSMA 3GL9A 5KQMA 3SY8A 4YV7A 1DCFA 4OTZA 4H60A 1ZITA 3UUGA 4PEVA 5F64A 1DBPA 2ZAYA 3H6GA 5ABPA 3O2QB 3DBIA 3CKMA 4G0OA 2L17A 1DC7A 1DP4A 1ABFA 2QV0A 1JLKA 4NV3A 2RDMA 3N0WA 3CFYA 5HSGA 1EHCA 3C6QA 2JVKA 4Z4IA 2VYCA 3MM4A 1P2FA 4RK4A 5TQ0A 5D2CA 3LTEA 4W5QA 5EWMA 3HEBA 4RY0A 3H5IA 3JS5A 4N47A 3QX9A 4E7OA 3RVNA 2MSKA 4EGSA 4EYQA 3FMVA 3NNSA 3HXMA 2JVIA 3LUDA 3TMYA 1BDJA 1JF8A 2QU7A 1U2QA 2FEKA 4L85A 4Q6WA 3JVDA 1Z12A 2PKXA 2PL1A 3KKEA 3ILHA 3LMKA 2Q5CA 2GI4A 3EDCA 1Z15A 2PUFA 3E3MA 1P8AA 2IPAB 2RGYA 3EULA 3RVLA 3A0RB 1Z13A 3JPWA 3O74A 1ABEA 1URPA 2FMFA 2V0NA 1GUBA 2VUHB 4L4UA 3RH0A 3LUJA 3OMWA 4MLCA 3HVRA 1RNLA 1NXXA 2FW0A 3EGCA 3R0JA 2R25B 3VNBA 3SAJA 3IPAA 4MAAA 1DRKA 1J56A 9ABPA 1C4WA 3HSYA 2RJNA 3GA5A 4Z4GA 5IBQA 2YHBA 2HQRA 5TE9A 1RPJA 4LDAA 1E6MA 3D02A 2PAFA 3URMA 1Z25A 1ZH4A 2R4QA 1P6QA 2E4WA 3M6MD 3QELA 4G0XA 4Y9TA 1E6LA 4N76A 1FSPA 2H3HA 2L18A 4RWEA 3IDOA 1YK1A 4MRMA 3FGZA 2CWDA 3GRCA 3N53A 5TPWB 4EUKA 5KQLA 4ZMRA 4UHJA 3LUGA 1AB5A 2B4AA 2M98A 3F7NA 3EJWA 1QPZA 4NCAA 1HEYA 3JPYA 4TMYA 5JNVA 1JX6A 3KHTA 1JWLA 3VNAA 3RVQA 5E3JA 4YS6A 3H1EA 4RK1A 1EFAA 2PJUA 4MS1B 5C5EA 2B1JA 3KYJB 3O1HB 4O1HA 3RVRA 3RVOA 1F4VA 3OO1A 1ZAYA 7ABPA 4IMIB 2KYRA 1FQWA 3OM1A 4W5TA 1OXKB 3H5VA 4MQEB 3O1JC 3RVJA 2IOYA 4W5OA 4JA2A 2RJOA 5EWLB 3ILYA 2FMKA 1LJLA 3Q7TA 3GV0A 4N0PA 3RVKA 2PUAA 5TQ2A 4G97A 4GNRA 2QVGA 4TLLB 3SG0A 2YHAA 8ABPA 5IEJA 1D4ZA 4OLBA 2F8TA 2GWRA 3C3KA 4KRFA 3FDFA 3LUHA 1QKKA 4EVRA 3CTPA 4YLEA 1M2FA 3QK7A 4MQFA 3CG4A 1RZRA 1BDHA 1KRXA 2IKSA 4YP9A 2MSWA 2QVCA 2E4UA 1YTUA 4OLAA 2FXIA 1ISSA 3HZHA 3H1FA 3TO5A 4KQ9A 3M9WA 2GKGA 1E2BA 2FQWA 4N03A 5KQGA 2DRIA 5IUJC 4YO7A 5KC9A 3H75A 1Z26A 1NY5A 4IGAA 3CS3A 4JOQA 5ED4A 4S05A 2X7XA 3EQZA 1EWTA 1SXGA 3BRSA 2HSGA 3HS3A 4IMJB 5DKFA 3KSMA 1EWVA 1EAYA 3NNDA 5DCLA 4QICA 2PUCA 3MF4A 4F12A 4YWHA 3GBVA 4ETMA 1K66A 4JB2A 2PL9A 1DBQA 4XARA 5EWMB 1UDRA 4ZJPA 3QLUA 4KVFA 6ABPA 3KJXA 1SXHA 3GBPA 4RV5A 4KPYA 3EAFA 2R47A 4CBVA 3I45A 2HJ9A 5CNKA 2FQXA 2IDMA 4EYOA 1YMVA 2P9HA 4RY8A 4RXTA 2WWVD 2P4UA 3BRQA 1JH9A 1VLZA 4Z4FA 3CZCA 1ZVVA 2WJWA 3HCWA 4MR9A 1FFGA 3HDVA 1FFWA 4W5RA 1JFVA 3MYYA 4TN5A 3ROFA 3RVSA 1JFSA 3HV2A 4S04A 3GT7A 4WXEA 4O1IA 3NBMA 2FMHA 4JB0A 4PICA 4KNYA 3FFTA 3MA0A 1QO0D 4P98A 3KLOA 4E7PA 1ZGZA 2LPMA 3KCNA 2FMIA 2GX6A 4IF4A 4RK5A 4DN6A 4IILA 1APBA 1GUDA 1XHEA 5DGCA 5FBKA 2VUIB 4MR8A 4OBBA 3QELB 1A04A 2PUBA 3HUUA 4RK0A 4RKRA 4EVSA 4MRMB 5B3JA 1Z16A 4H3HB 4MGEA 5TPZA 4LE1A 1PNTA 1U2PA 2PE5A 4JAVC 1XHFA 2MYPA 4LZLA 2E4VA 2JK1A 3M9XA 4FE7A 3TD9A 3HO1A 2ID9A 1DZ3A 1DJMA 3BILA 4ZYLA 2HQBA 3K9CA 3CZ5A 4KQCA 2NT4A 3A10A 1ZESA 1NXSA 4QYMA 3DZDA 1USGA 3TB6A 2IPNA 5FWXB 2J48A 2L19A 1NTRA 1NXTA 1LK0A 1TJYA 4KK3A 3NNNA 1P6UA 5KWSA 3IP9A 1YK0A 4B09A 1TM2A 3OO0A 3N75A 3CHYA 4NCBA 1BDIA 1SRRA 2FN8A 3N6VA 4KMRA 5DTEA 1JYEA 1MIHA 3O21A 1MB3A 4MR7A 3H5TA 4RXMA 4RZSA 1L5YA 3LKVA 3SNKA 3QLVA 3H6HA 3A3KA 3C3MA 3FFXA 2A9OA 5FWYA 2A9PA 3W9SA 1GLGA 1W25A 3IP6A 2JB9A 4KZKA 2I6FA 4WUTA 3OQOA 2FSPA 3LUCA 4LE2A 1NATA 4ZMSA 4RS3A 4RK7A 3P9YA 4XFKA 5EWJA 1L5ZA 1I3CA 2TMYA 1TMYA 3QLTA 1VKRA 2E4XA 4OG2A 4RKQA 2MSLA 3I42A 5IX8A 5JS1A 4XASA 3S99A 1RXEA 3OLVA 3L6UA 3O1IC 4KFCA 3GYBA 3Q7RA 3GWGA 1QP7A 1E6KA 3G1WA 1KGSA 2E4ZA 3N8IA 4D6XA 1ZN2A 3F6PA 5KC8A 2PLNA 3QLVC 3T6KA 4D6YA 2NZUG 1ZGGA 2NUBA 4MQFB 3H5WA 3SQNA 3UKJA 4IRXA 5IEBA 3EQ2A 4EYKA 1YIOA 1QQBA 5TPWA 3HUTA 1DG9A 3LUFA 3MQ4A 2CD7A 4EVQA 4JP1A 2CHEA 2NT3A 1BVHA 1JYFA 4H3KB 3C97A 4WWHA 4Z4HA 4HNSA 4F3TA 3OLYA 4MS1A 2JRLA 1JL3A 1YMUA 4RU1A 5TQ0B 5C5CA 1QP0A 1CEYA 2ZWMA 4Z4CA 2FEWB 2LUOA 2QXYA 1VRVA 3NHZA 4Z9AA 2HQOA 4YRZA 5T3YA 4MQEA 3Q41A 3CU5A 1Z2DA 4OATA 3ROTA 4F06A 1D5WA 3KYIB 4MPTA 5KQPA 1NXPA 3H1GA 1ISRA 4MR8B 5CHYA 5JNSA 3TX6A 1F51E 5PNTA 1YS6A 4KREA 5BQ3A 2FEPA 1M5TA 3Q7SA 5TQJA 4W5NA 3EODA 1PUXA 3B2NA 4ETNA 2A9RA 1U04A 1XWWA 1Y1LA 2JCGA 2PMCA 5JS2A 5TPZD 2JBAA 2LBPA 1QMPA 2LIVA 4G0MA 4XLTA 5HKOA 5HM6A 3OLZA 2MYNA 4MS4A 3MIZA 3N0XA 4GPAA 1D1PA 2H0AA 4JASB 2FLWA 2QZJA 3DGFC 1JDPA 1U0SY 2BGGA 1A2OA 1GCGA 5IC5A 3QEMA 3A0UA 4Z4EA 3QLUC 4Z9BA 3KLNA 1RXIA 1LJUA 3UK0A 4NQRA 4F8JA 1PEAA 3L49A 1LBHA 2QSJA 3BREA 3CLKA 5JNUA 4LRQA 3HDGA 5KI6A 2FKAA 5I4CA 4MLDA 1D2AA 2PUEA 4QYWA 2N9UA 2OENG 2WJAA 1H9CA 2O20A 4RXUA 3RVPA 2NZVG 4MR7B 1JFTA 2E4YA 2W42A 2IPMA 2L2QA 2FLKA 2VK2A 4MS3A 1TVMA 1K68A 1BAPA 4G0ZA 5FWYB 1KMIY 4N0QA 4G0PA 3E61A 1WETA 3N0RA 1Z17A 3OM0A 3C3WA 4G0YA 2OQRA 2QW1A 3OLXA 3I09A 1CYEA 3LOPA 3BBLA 5EWJB 4LE0A 1U8TA 1PEYA 4G86A 3T8YA 3HM9A 3F6CA 2F8SA 1DBWA 1NXVA 4ML3A 4DADA 1GCAA 2GBPA 2JVJA 2LP4Y 3DLHA 1LBIA 4MYRA 4ETIA 5TQ2B 1CHNA 1QO0A 5BRJA 3I5AA 4KV7A 1DC8A 1SXIA 1JBEA 4PE5B 5B3JC 1ZY2A 3G85A 2AYXA 4HNRA 1R8JA 5HQJA
chains in the Genus database with same CATH superfamily
3CH4B 5DBFA 5HKKD 3H1BA 2Q5JA 1KVUA 3S1AA 5ALTA 5BSFA 3IIIA 1JIKA 3IAM1 1AH2A 1C7ZA 4R9SA 5GM2A 3JRNA 4I6GA 4RD2A 3UJNA 3LFUA 1A8QA 1CEXA 1QGZA 5ENDA 5F5XA 3CCBA 4QGGA 4RKFA 4C0JA 4OV6B 5KPJA 2W2VA 3WWCA 2A9VA 3SVTA 2EYUA 5CX4A 1BXZA 4ZCMA 2J0QA 3ZZ0A 1ZGBA 1DWUA 4M8NE 4QNNA 4UVHA 2YXBA 2W37A 3PLRA 1YR9A 3HR7A 5AK6A 1ZHHA 4P7GA 1SR8A 5B7PA 2O2XA 5HF6A 4YRBA 1E2KA 2D3WA 1CK4A 2J3KA 2HJSA 2W6ZA 4FNAA 3Q88A 4RZ3A 3ROKA 3WGOA 1QIGA 1AY0A 4REQA 1XYVA 1C0EA 1PKEA 3UZUA 1Z2AA 4KOAA 4EIWA 2BSXA 4ZHQB 1TTHA 1P2BA 1HT3A 1GZ7A 1DJPA 3K15A 3OJLA 4ITRC 3TOVA 2IVZA 4ZN6A 2O8EA 3D7LA 3I04M 4I08A 3VC2A 1CR6A 1DAMA 2Q0QA 3NXKA 3VPXA 4BFCA 4E94A 2UZ4A 2I66A 3JZFA 2EKZA 1LS6A 1PV1A 1W4AA 4HO1X 3PC8A 5FFFA 2AYZA 3Q0EA 1D0IA 1I3LA 2QLTA 1Q3HA 2WJIA 1R5NA 3AONB 3PDWA 3DQQA 5JNRA 3OOHA 4QFDA 4E11A 4DSNA 4Q4JB 1W85A 1TAQA 2O3JA 2NQ8A 2P0EA 2V7QA 3V7UA 1WOYA 3M4ZA 2N47A 3A2NA 2DZDA 3L4SO 1RM3A 1XQXA 1F17A 1RHUA 3ICPA 3OZEA 1SVWA 1LRLA 1W5FA 4BMPB 5BWMA 1WPGA 3BXFA 2OFWA 1V11A 2VPPA 3BF7A 5DLEA 4ZK6A 1XNQB 1P1RA 2F9MA 2D3TA 2PKWA 3FGOA 3EASA 3C2QA 1WLSA 4XQ9A 2D1FA 2GTHA 2EKLA 3SIXA 1MO3A 3CLSD 4D80A 4NICA 3D6FA 3AETB 5GJBA 3CT4A 3V7NA 2CDBA 3ND8A 4S1OA 1THMA 2YWHA 5IK2D 1TM4E 3L8GA 2FVYA 2HFKA 3BCUA 3HYSA 4IHKA 1AKVA 2BMJA 3T3MB 3SLRA 3N8DA 4HYEA 4GPZA 3PC8C 2BEKA 1LEHA 4KO2S 1BKDR 4E15A 1K0FA 1MKYA 1IOVA 1JQJC 3ZY6A 2FNAA 3ND9A 5GZ6A 9ATCA 1O96B 1G20A 1NYTA 2QMEA 3EEIA 3D8BA 4LSMA 2ZZMA 1PR5A 3VO9A 4DA7A 1JJBA 4IQFA 1NIPA 5BUCA 3TOZA 3HHEA 1P4GA 4K6KA 3DQPA 1E9VA 5DYIA 3S2IA 4TTIA 3RVDA 1QG0A 2MR6A 3CKMA 3IQDB 1J2EA 3H9CA 4E4RA 1PG5A 3TQCA 2VK4A 4FPXA 1E1KA 2JFYA 2NIPA 1GKIA 4WMLA 3AOGA 2QV0A 3TSAA 5AW7A 3EF0A 3AM3A 3ZR4B 2IYZA 4TKUB 5HZGA 4K7JA 5GGYA 4ASUD 3PEFA 1V47A 4GKVA 1R4NB 3K6SB 1UR5A 4Z4IA 2IHZA 2OM6A 2WYUA 3PWZA 4PQYA 5ALGA 5EWMA 3C6YA 4MIYA 2RI6A 1RM0A 1TI7A 4QX6A 2QE6A 1JKXA 2JI9A 1QRUA 4TKZA 2V54A 3BC1A 3U44B 2X0NA 4L9WA 3L0ZA 1GTMA 4S1TA 3Q2OA 4YCBA 3C8HA 4CQMD 1RIIA 1QIMA 4E5UA 4RF3A 4GUAA 2ZT7A 3DHVA 5G4LA 2ZT6A 3UB4A 3K73O 5B3KA 4FW8A 5GV7A 1WUTA 1MQ9A 2H5JA 2P77A 1JQAA 1P5ZB 3HJAA 4YREA 4J91A 3E3MA 5J9FA 1P8AA 4OMCA 4JOSA 4KLRA 3BKWA 2G6TA 1WY5A 1FSGA 3ZNPA 3ZWYA 1VYUA 4DLLA 2YKGA 5ICGA 4NABA 1M76A 4Q19A 3HVRA 5JJKA 4MP3A 4NZMA 1AN0A 5EJEA 1GUZA 3EARA 4O4HA 1RPAA 1T8YA 2GPBA 2Y1CA 3K5HA 4B6FA 5AVUA 1C8KA 2YHBA 4X8HA 1Z29A 1Z75A 2HRRA 3TNFA 1T24A 2EG5A 2HEIA 4ZQBA 1ZH4A 3LAWA 4TZ6A 2O59A 3W05A 2COEA 5FRDA 2IXTA 4AN4A 4NR0A 4C4RA 2QQGA 4L5YA 2A0UA 1I94B 5IXJA 1O54A 5CR9A 4NHOA 4L7QA 1KK1A 5JECA 1QPZA 3SQLA 1HTTA 3DNFA 3NANA 3WLNA 1ZOOA 2NZ8A 3OHPA 2CNWD 4CFSA 1KSJA 4IQ4A 5IVIA 3MJHA 4R40A 1XJCA 5E3JA 4BWFB 3NBFA 2I8AA 1LNSA 1W5AA 1PJTA 1SKUA 2QX9A 2RHDA 3A1CA 3L2OB 1UZAA 3ESYA 1TPZA 2V7QD 5KKAA 3ZIAA 1ZK2A 2HZBA 4FSHA 4R8VA 4XD7D 1H6DA 4XUGB 4P81A 1YE8A 3K71B 3ZLJA 2WFAA 2XUDA 4KQMA 3L0OA 5AI9A 4W5TA 4HX9A 2HIAA 1FU8A 1SUAA 2I6QA 2PEYA 2FW8A 3GLSA 3I5YA 4DR5B 3V6MA 3V1YA 5IN5A 4EI7A 4CETA 1HOTA 4BU0A 3R0ZA 2VDPB 2QM3A 1OYVA 1W0KD 4J3JA 4J1SA 3GIDA 2PUAA 5E4TA 2D7DA 4I4IA 3H5AA 4OX9Y 1CUBA 1NONA 1FQOA 1UWLA 4MO9A 3GU3A 2CFRA 3W3AD 1D07A 1N2XA 5TR9A 3WQSB 2IGBA 4G41A 4EB3A 1T13A 5TGZA 4ZT6A 1XQVA 1TT5A 5K0CA 5SY9A 1E20A 3UAYA 3QYAA 1XJQA 1H65A 3QVXA 4K28A 2NM0A 4OLAA 1GPH1 3K94A 3AT1A 3TO5A 1PK8A 4TUYA 2DT8A 5GJWC 3FHJA 1SD2A 3WHKA 2GKGA 2H4WA 4B6QA 5C1PA 5JXIA 2XMBA 3AUUA 3A6DA 2AK3A 3H2SA 4GRIA 4Q3LA 2ATEA 3I58A 4RIIA 1GNPA 1V7CA 1W87A 1KZHA 3PDIB 4JHXA 5DYYA 4B82A 3MLBA 3DOHA 1K4YA 2XD9A 4ZQCB 5AW1A 3ELWA 1SHUX 3IBSA 3IQIX 4S05A 5LB4A 4CF5A 1NFQA 1R3DA 1DUSA 1QM5A 3L7NA 4FS3A 3ZDDA 2LVBA 1WCWA 3SHTA 2V03A 3N07A 2AI3A 3MVEA 1ORVA 4RSRA 1RAHA 3M8KA 4XSVA 3WA7A 2ZB2A 4U4AA 1DWQA 3DF7A 4NMWA 1TVKB 2JFWA 1Y8CA 5HNKA 1C29B 2WYWA 1QZUA 2W2XA 1HLPA 3GFPA 1TDJA 5EOVA 1E5TA 4AT1A 4F21A 4RHTA 4GNKA 5DBHX 3H2JA 2OV1A 1SZDA 2QUKA 1LBQA 3ZCQA 1K9VF 1NUPA 4OQMA 4IVNA 3PSHA 4RVHA 2WD7B 1B43A 2E7ZA 4BGUA 1YZGA 2R4UA 5AXBA 3CUTA 5L6LB 4H7HA 5EUCA 3UFBA 4M6WB 3EGEA 5E3HA 5T8KA 1P7PA 1H93A 1NR7A 3AEZA 3EVFA 3VH4A 3WJ2A 4MVJH 1JH9A 1VSVA 3OQJA 2NU6B 1AA6A 2GMWA 1R5OA 1ZVVA 4OA5A 4TXMA 2KX7A 3R09A 1M5RA 3CO0S 1U2GA 5HUJA 3HDVA 5DM70 3PUYA 1P4HA 4G23A 2Z3WA 5IARA 1CIVA 3R3UA 4Q21A 4PLWA 1CBUA 4JMLA 5MGBA 2QY9A 3CWCA 3JWIA 4XYLA 8AT1A 1RZVA 3WK5A 2FRVA 2RE8A 1DLIA 5G3ZA 4B3TB 2WU8A 1FX0A 3P0RA 1Q20A 2PKEA 4P33A 4P98A 4UBLA 5DWVA 1VPTA 4I99A 1RWBA 4B3HA 1YMQA 5AW3A 5E8JA 4OJMX 2WTUA 1CVLA 3PYMA 1U3TA 1DB3A 3QOFA 4RVUA 3AHDA 4OEHA 3EBLA 5LQKA 2NVUB 4KO3S 3IQHX 3NOVA 1LI7A 5IF9A 1Q57A 5KOJA 3S6JA 1YO6A 2Q5QA 3K4PA 5T8KC 3AVWA 3D7MA 2MYPA 1MUUA 3CUUA 2ISSD 3E4CA 4O0LA 5DGXA 5DM0A 4BNDB 4FE7A 5D85A 2FK8A 2ZLBA 1WZCA 3IR6A 3BILA 5C8DA 2JIBA 4ILKA 1H3EA 3CLTC 3KE8A 3NT2A 1U2GC 4OSOA 1BQ4A 4K2AA 3CZ5A 3EDYA 4Q3NA 4R1SA 3LK7A 4H6XA 4FNOA 4ND1A 3BWBA 4FIZA 3I2IA 4ZT4A 1BCRA 3TLBA 5HTOA 4E14A 2BFNA 1NBIA 3DCIA 2ZDHA 2EZ8A 5A3JA 2BR3A 4QODA 4EUSA 1AQIA 3RI3A 3BD7A 1DOAA 3LY7A 4EKIA 3C15C 1UJNA 1TVCA 3DTVA 2CF5A 3D6MA 1UFOA 1W0CA 2P2LA 4Q4LA 5DTEA 1GDTA 1REQA 4PC1A 1MIHA 3CMMA 1G3IA 3ZI0A 3H5TA 1L5YA 3LK6A 2F1IA 3MYRA 4P58A 3VR3A 4LOJA 1KI6B 2A5LA 3H8WA 3A1WA 3L0YA 2ZUSA 4F2GA 5BN5A 2G09A 1E9AA 1Q92A 5CAEA 1PVOA 4U00A 5BN4A 1SIOA 3C1UA 1EBFA 1PRYA 1AOXA 1AUXA 4FZ3A 5FTKA 3UXYA 2WHEA 3WLJA 5KNCA 4WLVA 3HJUA 4G4JA 5A1JA 3SYTA 1KKLA 1NATA 1ZK3A 3VJLA 1AN9A 2VF8A 4BP1A 3NBYC 1S7GA 5EWJA 4FHFA 3LGXA 5EKXA 2P1ZA 2YH2A 4TTSA 4C4YA 3RR2A 2CLHB 3JD1A 2PU7A 1CB7A 1K86A 1E89A 1ECCA 1XTUA 4BNXA 5CG2A 1FDTA 1QP8A 3DD1A 4JBNA 2ZJ3A 1L4MA 4Y30A 5EMMA 3REFA 3CWZA 4ODIA 3EOAI 4WINA 5KWEA 5LLTA 3AM1A 1LDYA 1VJ0A 1ZVQA 2XUGA 3DPUA 3JD2A 3TW0A 4NJEB 2PH5A 1VYVA 2OE2A 3C7CB 4OK5A 1NG9A 1QQ6A 1QP7A 4U0KA 5EVCA 3WJAA 5JSQA 3JQ8B 4G5HA 2Z9BA 3L40A 4RD0A 3E7DA 2QLLA 3QBEA 2QRMA 1D6JA 4OM7A 1NVXQ 4MHTA 1EXNA 2FRXA 2VUTA 1YSCA 3LECA 1T8UA 3FWYA 4MX8A 4F84A 4CQNA 4A5OA 3K53A 2XCLA 2G9RA 2CVOA 4FYWA 4J0GA 4DCNA 1XN1A 1EGVB 2QVZX 1R8XA 1XEAA 1LQTA 3E05A 3GARA 3TMKA 5CCDA 2WWGA 4LC1A 1QZZA 1V1RB 2XLCA 3HDTA 3X1XA 1YZFA 2Y6UA 4MKFA 4AJLA 5JYEA 2R6GA 2I2FA 3CLTD 4V0RA 1DDOA 4FJ2A 3TD2A 5ER6A 4K6OA 5P21A 3UWMA 4AX8A 1Y80A 4JU9A 1GTJ1 3QXXA 4PQRA 4D3SA 4EJSB 1BRTA 5AR1A 4G0VA 2HADA 3PUIA 4Z9AA 3VSCA 3WKCA 4XTCS 2G7MC 2ZRCA 3U4CA 4DQXA 2CEKA 2R8XA 1W46A 3ELBA 4JFAA 2POCA 4M3NA 3SR4A 1SQ5A 3EXEB 2J45A 4MVJP 4YUYA 1ISRA 4IV8A 1DELA 4EHIA 3I2YX 1QPBA 2IL1A 5JUWA 1U3GA 1YC2A 4L57A 2Q3HA 4Z53A 5BV1A 1GLVA 1BWRA 3JWHA 3UMBA 1WU7A 5C1IA 3UBTA 2PMCA 2RG7A 4FFLA 4BZPA 4IHQA 4Y2GA 2WAOA 2ZTLA 1PUIA 2DHEA 1SULA 2HK9A 2UZ3A 2YW2A 4ZQGA 2YICA 4ARIA 3Q9UA 4MS4A 1P33A 2BP7A 2OWEA 2Q6LA 5H3CA 1A82A 1VMEA 1M1YE 5FOWA 1M8FA 1S1MA 4GWLA 4N3CA 1QGDA 1CUUA 4MB0A 1NT2A 4HLNA 4NOLA 1EFCA 3DWGA 4H7KA 5HIIA 5K5EA 1TEZA 1L6IA 1X86B 4LJ9A 2BGGA 1A76A 2P4QA 3NIWA 1JILA 3GJXC 3OKFA 3S2UA 4B2YA 4Z4EA 3QLUC 3ADDA 2PSDA 2VH5R 4GMDA 3G2IA 1UAYA 1OZ0A 3R7DA 4KHPB 1VA5A 1H0HA 3MUNA 3LC7O 2EDCA 4R5MA 5BSUA 4U3JA 4LS3A 5LVAA 2ONZA 3NWOA 1JWAB 1I7LA 1NW8A 1BXGB 2HRBA 4AUNA 3TG2A 4AQ7A 2XECA 4EPRA 1F2UA 3DJYA 3EYWA 1EIZA 4H1VA 3UCFA 2FZ5A 3N8KA 4AF8A 1D03A 2YY7A 4ARSA 5B3AA 3EDMA 3TZLA 3VPFA 2GWHA 4E12A 1ZEMA 2TMKA 5CX1B 4EK9A 3EAQA 2AN9A 1XIVA 1KQOA 1OXUA 4Z6KA 4G8DA 4KIGA 3DMTC 1EUDB 4M0DA 1AMNA 1M34B 1PS0A 3IDZA 5BOSB 1SA0B 5IJWA 2C4VA 5AW0A 4LXIA 5KB3A 5EP2A 4YJ2A 1K7CA 3COPA 1E5VA 4NENB 3CMCO 1M8KA 1XFAA 5DH9A 4GX0A 5CTJA 4L5IA 4TWBA 5CXQA 2OG2A 1GPDG 3EEFA 5AI4A 4HH4A 1R10A 4HUQA 3WWDA 3ZWXA 3LUBA 1H4TA 1UIMA 2Q07A 4JJ6A 4QJBA 4BBPA 4BNGA 1DADA 2H9AA 4KMMA 4R2MA 4PE5B 4OJYA 1I51A 3U4AA 3VYVA 3JYPA 4I7EA 1P0MA 3BWVA 1Y9ZA 3KWJA 4A7PA 2PZMA 3KAQA 3LBAA 4DL9A 4E2WA 3AF4A 3PQ2A 3HY3A 3OJEA 3H2GA 4NC9A 3F1KA 3LDFA 2B78A 2CHFA 3LYHA 1I3MA 1W88B 4PR3A 5EE1A 5GY7A 4MCHA 1Z9BA 4CEHB 2GHIA 3G82C 7REQA 3RBXA 2YZKA 1LTHR 1RBMA 4RX1A 5DFAA 4BFYA 1FIUA 1J8FA 1LB1B 3SM3A 1WDMA 3UMRA 1JEQA 1Z06A 3JYOA 4DXAA 2OM2A 3D8HA 4E33A 1A5ZA 3PVZA 2KBEA 5KQRA 1G2IA 2Q50A 5H3LA 4PS1A 4EGAA 5BWOA 2HBYA 5HIAA 3RV3A 1YE3A 2R97A 3KTOA 4YPOA 1ZG3A 4JLDA 3RUEA 1Q7CA 2YWGA 4QULA 3JZIA 1YU9A 2M1ZA 3LCVB 2K7ZA 3L7AA 4HDNA 3ZE1B 1I5EA 4AZVA 1V45E 4UNPA 3OCWA 4PC3A 3RYTC 2P2ZA 4C2BA 2XXBA 2PUDA 3ZDEA 1LU9A 3FDZA 3MQ2A 3MD0A 1N3BA 2AZ4A 2QN6A 2B7CA 3HU2A 3QKRA 5FWXA 3DXFA 4WEQA 1T6XA 3PCTA 4DE5A 3QNUA 2JFZA 5E95A 4W9NA 3NT5A 3QKSB 1DC5A 4AP5A 1XG5A 2PYZA 2V55B 1QNFA 5F5LA 1AQ6A 1Q17A 2PLWA 3DLBA 2DR0A 3I9LA 1B00A 2BGNA 2BEWA 5TMBA 4X6YA 5I51A 4WOBA 3S40A 1JHQA 3KJHA 4BGIA 3GD5A 3OC0A 4DIDA 1NLYA 1EGAA 2K4MA 2FJ0A 1B3BA 3ZN2A 3EG5A 4JOCA 1C3VA 3EDOA 4D74A 4BVHA 1YRAA 3L9WA 1ZH6A 2VH1A 2WA1A 4WOCA 3WJ1A 1GAJA 1EP9A 1G7RA 1B23P 2CXHA 1YZNA 4CKZA 2EX0A 1GIAA 3Q3EA 2DUJA 3GFGA 3KFLA 5EESA 4URXR 1B6RA 2ZS9A 3DUFA 4JBGA 1AZSC 3RAPR 5ELMA 2VAPA 4KLZA 1I13A 4RW0A 1OI3A 3TUJC 1EFLA 1DCMA 2O0LA 1J8MF 4PXSA 1Q1NA 2WLTA 1R8YA 1OY1A 3QE2A 4MLPA 3WYEA 3CZQA 4A73A 4YJDA 3AYZB 5K8UA 3OQIB 4Q1AA 1JAZA 3MT9A 3CPEA 4KCGA 3R9IA 1NW3A 4W9NC 6CHYA 1HDRA 2DJIA 5JYCA 2B4YA 1QCCA 2RG1A 3EDRA 4WH0A 2OD7A 5D3QA 1BVRA 4DCGA 1YOVB 5I3CA 4G36A 2ZJ1A 3V00A 4LXHA 4NAVA 2H85A 1A50B 2P8SA 4KRXA 4RCYA 4ER6A 3PEYA 4CTMA 2QX8A 3EK2A 1JPUA 2CDNA 3P2EA 4LXYA 4CEJA 2PY6A 1MPXA 2Z58A 1HE4A 3LVQE 5REQA 1N0VC 4OTZA 1IY0A 3WB0A 4P0PB 3FYUA 3IJ5A 2W6OA 2C82A 1KAQA 4WNIA 2P3QA 2C0CA 1K89A 1WG8A 3LC0A 1NNLA 1U7OA 2JIOA 5ABPA 4OI0A 2WSBA 1L4NA 4UTVA 1FNBA 5BSTA 4DEYA 3I05A 4JVSB 4XX0B 1E3SA 4EPVA 3T9DA 1GT91 1DWPA 2CLSA 1ULZA 4RV9A 3RJ5A 2D59A 3UY4A 4X95A 5DI3B 1L8XA 3TTUA 3C6QA 2GF0A 3SP1A 3ZV3A 2G9NA 1U6JA 3NYIA 4BWGA 5LDDC 3ZE6A 4M8IA 3AXTA 3CVOA 4U9IS 1J9EA 3B52X 4RH3A 5JZVA 3ZDQA 4JSRA 2JGDB 1CP3A 4W5QA 1MEJA 1Z62A 5F3WB 4E7OA 3L3BA 3UFXB 2O8DA 3L06A 3LHDA 5I9IA 3PE6A 1NF3A 4XDZA 4ZRDA 3S1AB 3DZGA 1N0UA 5ILGA 2I7DA 5CVUA 3C7AA 3OD5A 1Z5WA 1MENA 5F7JA 1XCPA 2H5IA 3UFXA 3BFVA 2W90A 3OEWA 3JVDA 2Q6OA 2YBEA 1IDOA 5SY4A 3VBEA 3N3BC 3TKYA 2NNLD 1OA1A 1F60A 5EP4A 2J5XA 3AW9A 3BOSA 5BYAA 3SQDA 2GAIA 1Z35A 1SBCA 4NMMA 2TYSB 1SCDA 2VDWB 4WGGA 3W2EA 5LP6A 3AJ9A 3DEHA 2C2MA 1K6IA 3SYRA 2R1VB 4CCYA 1KMNA 3IDQA 4MV3A 4AN1A 2C2OA 3ENQA 1JDSA 4BFVA 2AEMA 1G5FA 3VU0A 1E3WA 1VG0B 3R5JA 3MJEA 4PPGA 3ITKA 3GA5A 1Y7PA 2QPLA 4OHFA 2C97A 1V5FA 3CF4G 1YZTA 3IVXA 2X5OA 2O8EB 3PXEA 1B16A 4EUHA 5SICE 3C87A 5FEUA 3C3BA 4FC6A 4CKCA 4BX3A 2VZEA 1C0IA 5KQLA 4H1TA 5TPWB 5DCYA 2FRDA 4OHKA 4ABTA 2AVNA 5DN6D 2IY7A 2M98A 3B3AA 1PSWA 3RASA 1JE1A 1QRAA 4B6JA 2O8CA 2X5NA 5FI5A 1W85B 1WVMA 2XTMA 4FFMA 3D2CA 3U39A 4QQFA 3E1GA 4HXGA 3SHOA 1R5BA 4HGYA 5LP6C 4DBLC 3W90A 3WYCA 1ZXBA 4ITVA 5M34A 1H94A 1V11B 1TYDE 3HWX1 1XP5A 2H2DA 3RG8A 4DC9A 2A0KA 4Y9RA 4XX1A 1QH0A 1ORIA 5K6AA 1FS6A 1WAMA 4EO9A 3RVJA 1VKJA 1N77A 2RGDA 4TMFA 2ZQYA 5CM9C 1F8XA 4YCAA 1FFHA 1AKRA 3ADKA 2HZ7A 5K0SA 1TXGA 1W30A 3EXG2 5C5DA 1FYVA 4OHVA 4G0UA 2OLKA 1H8HA 2RC6A 2ANBA 4X6LA 5TQ2A 3MWEA 1N9GA 5CIWA 1YJQA 1X3SA 1V5GA 2JL1A 1JFLA 2YHAA 2Z5LA 3GH3A 3RW9A 1Q95A 2HB6A 2O2IA 2QNIA 1L1FA 3ZD6A 1QKKA 3UN1A 1ISMA 1YS2X 3BD9A 5IBRA 4E5DA 6GPBA 2NU8B 4F5YA 1WX1A 2I1LA 3MCAA 4C2UA 4TMWA 2DOKA 1PHPA 4WZ6A 3VC7A 5DGTA 3ZGOA 4DM3A 1M6WA 1DXHA 2FCRA 3FOAA 4GYJA 1YUNA 1E2PA 5AHWA 1PZMA 1GPKA 2VHZA 3BERA 3HVJA 3O4VA 3UOGA 4WESA 3V48A 5HEKA 1S0UA 2OA0A 3Q8KA 3EIOA 2FCAA 2HBQA 4DQUA 1V4VA 1XKLA 4GOND 1DARA 2XJ4A 1UOEA 1E62A 2X7XA 3P0FA 1P5FA 1EWTA 4JX8A 1N4AA 4TMZA 1R4MA 1IN4A 1LTQA 1WEHA 2J6BA 2O7SA 4G26A 1Z5NA 2O9JA 2F3QA 2DPLA 4OYLA 1DEXA 4ZZ1A 2XLBA 5ILQA 1Q2XA 3KDSE 3DEKA 1DBQA 3GRUA 4K26A 2WW8A 5EWMB 3AB8A 2O23A 1KY4A 4RC9A 1N33B 3P52A 1ICIA 5LYJA 1XQ9A 2EX4A 1NQUA 1Z4PX 4NVRA 3NOXA 4BNJA 5KVSA 2HJ9A 3WIDA 4C1BA 4RXTA 2WWVD 3ZHOA 3JASA 4LV5B 2QLNA 1V6CA 4KE9A 3VDXA 3CLVA 3DKKA 4TSFD 4EVIA 4EHJA 1BHJA 2WFLB 1A5AB 1O57A 5BUQA 3Q12A 4J90A 4N7JA 1KP3A 3KL4A 3T7RA 3RVSA 1TZKA 3N86A 4XCQA 1JMYA 4GX1A 4PICA 1RLTA 3ANNA 5BYJA 1HQDA 3OEED 5I7FA 1FDOA 1G2PA 2DPYA 2OHOA 4M0FA 5CVEA 2YXNA 3FPBA 4O4HB 3CVVA 4DSAA 2UVQA 4QVKA 5J4VA 5GIPE 2R7NA 4IILA 1BFKA 4X97A 3CIFA 1G8MA 2ACKA 2C95A 4M1KA 1ZBQA 5LUAA 4Z2YA 3DV0A 5EJ4A 1GV0A 3MGCA 1NW7A 1TW2A 2XMPA 4AD8A 3REQA 4CL2A 2O8FB 5ADWA 5KSPA 4EKNB 1U7HA 2AEEA 1N0IA 1PK9A 2H59A 2J9GA 3HLKA 1G0OA 2B8TA 3B20A 3BN3A 1IBKB 2GEBA 2VSQA 3E3NA 4WASA 5AXAA 4UXJA 5DF1A 3SMQA 1PX2A 1L5VA 2YY5A 3K9CA 4YK7A 3HP7A 3KR2A 1KJZA 2BV3A 5TC4A 3LLSA 4XQCA 3TSYA 1IG0A 1TOAA 1HDCA 2A30A 4B74A 4DVGA 5KOYA 1IM8A 1ES9A 3PC7A 4MVJG 1HLGA 3QVJA 4YT2A 2ZVPX 1G1AA 5BURA 1EQUA 1IBRA 2XTAA 4D98A 4GI5A 4YT8A 1BVUA 2VQ6A 1FFCA 4PYKA 4DHEA 1KQGA 4DW8A 3M70A 4ZMBA 2UYQA 3BXXA 1RLUA 4E5SA 3FOCA 3NNNA 3ZLBA 3TRJA 1E9CA 2VTVA 4QDKA 1RWNA 1TM2A 3WGMA 2FG6C 1LWNA 4K9NA 4PHTA 2D1QA 5HKLA 4ZKDA 1JYEA 3DHEA 1P44A 3MWJA 4AF7A 5E7IA 2HLDA 1UK9A 4A2WA 4X92A 3PKIA 2DFDA 3TFOA 1KSGA 3H6HA 1V4NA 4RFLA 4UUQA 2I9KA 3SMVA 1PJCA 4NNPA 5GADl 1U2EA 5DGIA 4Q48A 2PJDA 2IA5A 4OHXA 2X8BA 5AW4A 4TUYB 1HTWA 4RY2A 3OQOA 1NW5A 1T2CA 2FWIA 2B1QA 2LDXA 2RHBA 3CN7A 2GBFA 4BO1A 2Q6KA 4RK7A 1LXCA 2HWXA 2IP1A 3JQDA 3TYXA 2FWAA 5KJCA 3TZBA 5GZ3A 4NESA 3LTNC 4JT8A 4UUPA 3V3TA 1CX9B 3E7WA 4DV6B 2JI8A 4NPHA 4MW6A 4LTDA 3R5SA 2AC4A 2BGIA 3OLVA 3O1IC 5IDQA 1XEWY 1EHYA 4FHDA 2XMGA 4JJAA 2WAYA 3UHAA 3Q7RA 4R2JA 1QE5A 1AUOA 4IIUA 3T5CA 1CY6A 2AOXA 4PVDA 2OFXA 2HWKA 3G1WA 4JLPA 3I76A 3N7AA 4X41A 3HP4A 3RIHA 1CR0A 1IVNA 5DSZA 5JD6A 3EGIA 1CNMA 2P8JA 3IMGA 3HB1A 2LD4A 5AJZA 5CCXA 1R9GA 5FUXA 2XZOA 3SXJA 4ZZIA 2XKKA 1E0AA 3EQ2A 4EYKA 4FK8A 2QVLA 4EHLA 1DG9A 4F3RA 4B5LA 3RYCA 3INGA 4BB5A 4DMFA 5JH7F 4AKTA 2AQKA 2QN8A 3R9KA 2NQTA 5DW0A 3VR6D 3OG9A 1JYFA 4BNUA 2G4LA 3AVPA 3C97A 2XCUA 4ZGWA 4JR2A 1A8IA 4HNSA 2YASA 4EY4A 4J0HA 1E2IA 3GCZA 1HT0A 3W5JA 2RHWA 4JS0A 4RU1A 1MQ8B 4V1CI 4AM8A 3GDOA 3L7KA 2ICAA 4K46A 4ND6A 1FX0B 3AFNA 1A8SA 2QR2A 5TJ9A 1X0VA 4IX9A 3AF6A 1COZA 2JATA 1Z5ZA 3CU5A 1UDXA 1GSIA 1ODIA 3ZGZA 2PMDA 2NNWB 5CUQA 3ZWCA 5JRJA 4EATA 3K6KA 1UBMS 3E15A 1DIRA 2NYAA 2XE6A 1QIIA 1ZC3A 4CHTA 1WHTA 3H65A 4OHYA 4J94A 1NVMB 4IYRA 2A9FA 4KRYA 2Y05A 5KOJB 2HK8A 1JAHA 3DCJA 5EQTA 1P9NA 5CH5A 3VRHA 1HO3A 1ZOIA 5DISB 4XWKA 3L82B 2IC5A 1G9TA 5BWCA 2IUUA 3KDAA 5GM1A 4Z1MD 2JGRA 3B89A 5HOQA 5CFQA 3OZTA 5CTAA 1GSAA 1BCRB 1NV9A 1THZA 2FFQA 3WSWA 2JC3A 3V8EA 4N8EA 1ENPA 1T25A 3GEEA 2VIIA 3BF8A 2EJVA 3UHOA 2C20A 1EB9A 2V98A 3H9BA 3AVVA 3A0UA 1RWMA 2EGUA 2F8LA 1M73E 4Z9BA 5G1PA 3ED5A 3ZYCA 3W06A 1LJUA 1QXSA 4DNPA 2UUAB 3DHNA 1LBHA 1T4MA 3DTVB 3ME5A 2IIBA 3N28A 2CV1A 1DXQA 3DYBA 4EFKA 3R4CA 1YRLA 5ECGC 3OFND 3K1JA 1REQB 5EJFA 4JB8A 2NYUA 2NZVG 1NN0A 2YQ5A 4QPCA 5EG5A 3ZS9A 3V5NA 2AFHE 1F4PA 3NORA 4JC8A 2XT9A 5BN5B 4EHNA 4EHKA 1WW8A 2LKCA 4KUHA 4XWOA 5C7OO 3EZXA 3KJFA 1ZCFA 2ID4A 2D8AA 3C3YA 3L8ZA 3NT4A 5DGHA 2HT6A 3SBOA 1M10A 1EZ4A 2QN1A 1KZ4A 5EXEA 2RKBA 3WVNA 5LUBA 6AT1A 3WP0A 3QVMA 5IDXA 4MDFA 4W63A 2QR5A 3H9GA 1J0EA 1ZD4A 3TFQA 1OF1A 3G8CA 1F3OA 1PKXA 5K1ZA 3NZEA 5EWJB 3UJ7A 3GZNA 2WTXA 4U8HA 4V1CA 1TQDA 2WDZA 1GL6A 1DBWA 1E3TA 3C5CA 1H0RA 3C7TA 4QFCA 5CEEA 2OT3B 3ZI7A 3GLFE 1OWLA 1T10A 1P77A 1V43A 2FDRA 1OUMA 5IAEA 2VDQB 1DC8A 2WU3A 2HT1A 2HDOA 3CZRA 4MYUA 4POAA 2J46A 5EQDA 4XVHA 3FR8A 3H86A 5LU8A 1Y33E 2QT1A 3IURA 3M33A 3TFWA 3GGGA 4X94A 2BDEA 4OFWA 4Z99A 2B3DA 1RWWA 5CEJA 1P1FA 3OFKA 4BGEA 4K9QA 1VB5A 1V5WA 5BWLA 3FFWA 4I5EA 3JTEA 4RH1A 2QRQA 4U7FA 2O2ZA 4GL2A 1ZP6A 2ZJ2A 1J39A 1ZD8A 2CUTA 1EFDN 1C9NA 3MXOA 4M1MA 3VPHA 4CIYA 1D8TA 1NRIA 2GYYA 3O8CA 4GDFA 5SYMA 4BLPA 1ESZA 1P1KA 3IKMB 5IUNC 2A6PA 2YVUA 5KNCH 5H9VA 3MJ4A 2ZW9A 4C4AA 3IGFA 1H5NA 3TTSA 1AF4A 1M54A 4UEKA 1X7HA 4XTRA 5K2OA 1KMMA 1X9IA 1PJLA 1HETA 2BFPA 4Y2VA 3L8DA 3WYAA 4J2HA 4FZRA 1UOOA 2B4KA 3RWMB 2AOUA 2YWCA 2NADA 1TF5A 4Z8YA 5J2TF 3UICA 4KR3A 3B6EA 5AKHA 5KQSA 4F5WA 3UATA 2X1LA 3Q15C 3WYNA 1KMHB 1T0JB 1YFZA 2QPTA 5CLIA 3O47A 4JNCA 1L4FA 2OGUA 4Q3OA 3WGNA 4TTPA 1FVOA 5EPEA 4DDMA 1WXHA 2YJ3A 4JT2A 3TIXB 1OU0A 5DHAA 2VF2A 5EL0A 1QDEA 1Z88A 2EAUA 1LJ8A 1Z2EA 5LPNA 3AF0A 1TQ2A 1HQYE 3P4YA 2IS2A 1NJ1A 5BVHA 3ZHBA 5AM0A 3PENA 3KT8A 3A3OA 3LBFA 2JIPA 5FLKA 1JPVA 4MS4B 4M88A 2BP7B 4NNJA 1GTVA 3T7CA 2DUMA 2H92A 4JI0B 1U2RA 1P18A 4BX2A 3HXQA 1GPNA 1NF2A 4OLFA 3QVGB 5CM2Z 5DBGA 4C21A 3PI7A 3CW8X 3I1FA 2ZSIA 2MYUA 3G9UA 3DBLB 1UIRA 3LY9A 2XDYA 4GMHA 2IEZA 4RKEA 4EPYA 5CDHA 2FEAA 4F4JA 4DV0B 2B4TO 2BHLA 2OZLB 1UP4A 3BE6A 3LV8A 3OBBA 3ESQA 2EZTA 1V95A 4QU8A 2RHGB 2Y1DA 3DYIA 2IY9A 1BMFA 3FNBA 4QUIA 1RYYA 2O8NA 2YV2A 4KQGA 4KR7A 1FP4A 2HM7A 2V7VA 2FPKA 3A25A 3CH6A 3H42B 3H9UA 1B1CA 2QEQA 1N2BA 4IINA 4U2FA 4N41A 1HFWA 5EE5B 5JCXA 1C1XA 3I01M 3U19A 3Q7PA 3GL9A 1IN6A 3QW4B 1CR1A 3J81k 3LD9A 4M0KA 3OX2A 1J06A 3GVXA 4OOEA 1EUQA 2JAWA 1MB4A 5KAPA 4BECA 1P1JA 2O14A 1JKFA 4G63A 4GEKA 4M36A 4PCAA 4WUVA 1RWXA 2BJHA 1YZYA 5AKIA 3B1ZA 3JXEA 3SSOA 3LPDA 4YJ2B 4BX9A 2R9VA 2PUJA 5TEVA 3ZW7A 1T3ZA 2CVZA 2BN4A 4KPGA 4EA6A 2ZI4A 1AVTA 4HUQB 3TM4A 4DA9A 1X7XA 1GLNA 4GC9A 5JWRA 3W3ZB 2PFSA 5M29A 4RK4A 2W00A 4AMBA 4LKRA 3C98A 4BEWA 4F6RA 4CIVA 3WK8A 3JS5A 1W36D 3QX9A 3A4VA 2MSKA 2AZMA 2Z3ZA 4LJRA 4AJKA 2A0YA 4GR9A 3PT5A 1YS4A 2YQ4A 3QA9A 1AU9A 2GJ9A 4HVCA 1RLJA 4ZTUB 1U2QA 1OT5A 3SS8A 2Y1GA 9LDTA 3HU3A 3SZUA 7REQB 1R6VA 3QHPA 4I5IA 3VHLB 2PGXA 3T41A 5DW3A 4CM3A 1ACLA 5EN4A 1MQAA 1JEQB 2DJ5A 4MKHA 1KOFA 1KPGA 1XZCA 1U90A 3TMAA 1CFJA 2FGKA 2IUTA 4KDCA 3ZC3A 5C53B 2PVSA 2V4UA 3CJTA 4CXMA 1OX6A 4W7HA 1J20A 1GUBA 4C0WA 2DM6A 1CS0A 4IEFB 2TSYB 3MELA 3OMWA 3V8BA 2Q29A 3CJQA 5EFZA 4KPFC 3KQKA 4G5QA 2YUIA 5JASA 5J2UF 3UPDA 1W34A 2HTEA 1ZHOA 3FOFC 4LF5B 9ABPA 3FDZB 1G42A 2FW1A 3I53A 3MOGA 3X1JA 2OD9A 4Z7OB 3QKRB 1RPJA 1KYZA 1E6MA 5D51S 2PAFA 1ID8A 3HCFA 6LDHA 2J6CA 3M6MD 2ZQ5A 1J1UA 4P22A 1E6LA 1IU9A 2EBHX 3MJTA 5F23A 4DMCA 1UAGA 2DHCA 4FZ5A 3PF8A 3IDOA 4MRMA 3UMJA 4BP8A 5T4BA 4ENVA 1DTWA 5ITWA 2HK6A 2YJ4A 2BEWB 2B4AA 3PEWA 3L46A 1EFKA 3N6XA 3OFSA 5LB2A 1DQRA 1ZW6A 1CUDA 1YR2A 3AEKB 3RVQA 1X77A 2UXDB 1BHSA 1NBMD 3QQ5A 5FBWB 2PJUA 2R4TA 1QGED 2IOQA 3KYJB 4J76A 3H5NA 4MPRA 2QYHA 4AMUA 2PL5A 1KXZA 2RH4A 4GOKA 3RVOA 3EZ6A 4FTWA 2N0SA 4BATA 4I14A 1OXKB 3NVAA 1ZRMA 2C9MA 2QE7A 4M1ZA 4ZU6X 3Q7IA 2B9VA 4MTLA 1T8TA 4IM7A 1X7WB 1PR3A 3OCVA 4NPAA 2RIPA 3KQNA 3ZTTA 2NUPA 4MWCA 3TLEA 4EX7A 121PA 1MJGM 2QD2A 2HA7A 3BB3A 2H1RA 2PRJA 1FJ2A 1OI7A 2Y1WA 3AKYA 3ZWBA 2XD4A 2V9PA 4OKNA 4V0ME 1XVIA 4EB6A 2HA2A 4P4TA 4ND4A 4Y1RB 5KTNA 2WEKA 1F5SA 3KQOA 5J40A 4P3NA 4DDKA 1BMFD 5AH0A 4OKSA 1MAWA 3AY6A 1L2TA 5TS2A 1Q1EA 5JYDA 4PNEA 1U1GA 1RHMA 1NW4A 2IUYA 2D5CA 2VP0A 3BHIA 1B73A 3EIEA 4KXNA 2F1HA 4E32A 5DNUA 2BZ0A 2M2IA 3R2JA 1LLUA 1VL2A 1G5RA 2IGTA 4GPEA 3RANA 4CEJB 4JYCA 2HH9A 2AA3A 5REQB 1XD2A 3JQ7B 2H31A 4CCSA 2AN5A 3VNSA 4DEVA 4OAOA 1V7PC 1VZ2A 2FB9A 3FZNA 4HDOB 1DL5A 1ESEA 4MWSA 4UFNA 4XSHA 3R5TA 1U9YA 5AOAA 3V4PB 2I0FA 2VWPA 3MNFA 2R85A 3AF2A 2PRZA 2QSUA 3UMSA 2IU6A 1H42A 2FUKA 3D0RA 1SIUA 3MRXA 4GW3A 821PA 4ALMA 2YWDA 1YR1A 3QG5A 3W4IA 2WQ7A 4RENA 2GZHA 1K1EA 4KODA 1BEZA 3O9VA 2WZBA 1M1YA 4QU0A 4PZEA 4D81A 4EB8A 2O8DB 3T15A 2OPHA 5JCJA 3AXSA 1E7YA 4TPKA 4LDNA 2YVAA 4ZTBA 3HLYA 3VJKA 3I45A 3ROEA 3G2HA 2F4NA 2IDMA 3UNXA 4PYOA 4TVOA 1MLDA 2GO1A 4O6VA 5I7HA 4YCNA 3SJ7A 1PJ4A 4MWZA 4YH1A 3D6AA 3B12A 1VJDA 1RQ7A 1O77A 3OIVA 5F2EA 3WGGA 1DMSA 2YS7A 1NR1A 3T61A 1W49A 3TDMA 2UYOA 5CK5A 4F5ZA 1FFWA 4J1NA 1Y1RA 4LZZA 5I7OA 5LP6B 1JFVA 2QRUA 3NRJA 4FFPA 4CCYB 1XCGB 4IIJF 2J59A 2F62A 2OVBA 3UA4A 3FFTA 4M4SA 4BMDA 1E3WB 2R8PA 3K0CC 3OICA 3HJTA 4QRDA 2ZCJA 3NG1A 1JG4A 1M33A 5AOVA 1MX3A 1VHTA 1WCV1 1LPNA 4QT0A 2C5FA 2WKRA 1QWOA 1YACA 2YCBA 1SC9A 2QA5A 3KX2A 1SH7A 4HF7A 4MVYA 3KZNA 5LOVA 5FOTA 2HO5A 3DM5A 4HEA1 1XL1A 1P81A 1TIBA 2VXCA 1G8AA 4K9PA 1CDZA 1GARA 3ACDA 3GLIE 2ORYA 2ZB4A 3MS2A 3CRVA 4KXFB 2CHQA 4EZEA 2P40A 2Q7DA 1D04A 2A59A 2O8CB 3IAS1 3PQ3A 1EBUA 2Q46A 5HMLA 2M6SA 1BW9A 2CFCA 3L1VA 4LJYA 4G4SP 5G0UA 1GQYA 2IV7A 1NQXA 1VL0A 1X7YA 2J7PD 2R7AA 1PQ4A 1C81A 4IDNA 3E35A 3CLRC 1ISJA 2JAOA 2NW6A 3ZWKA 2WV7A 3AGPA 4ZANA 2J3DA 4S1NA 4C7BA 1GPWB 4R1NA 1XMSA 4YCJA 1TE2A 2N1BA 2RFLA 4YRIA 7AT1A 4JXZA 3OE7A 1JIQA 5KWSA 3LQYA 1UANA 1RI1A 3SYKA 2YJ5A 1QR2A 4WIAA 4Q9NA 1KJ8A 2O50A 5EKDA 1PJ2A 2C9ZA 4ZI7A 2C54A 3VR5A 3MWEB 1KFEB 1N9GB 2QMUA 5C5IA 3GPIA 4U02A 1AHPA 3LT1A 4QSMA 3Q7QA 3C3AA 3V7YA 3WKDA 3EVGA 5FWDA 2XVAA 3HQ4O 3GT4A 3QU4A 4KLNA 4KAAA 2V8BA 2O0JA 3MWFA 3HCDA 4HDMA 2OLEA 4PINA 3W9SA 2QS9A 3IP6A 1UFQA 2JB9A 1UDBA 4GE3A 4M9SA 3LA6A 2VPYA 3JATA 5E0OA 2BGTA 3U31A 3VX3A 1VDZA 1LPBB 3D5QA 2WMOB 1VXOA 3EVAA 3G88A 4WESB 4ZU1X 3ZS8A 2AFRA 2ZYWX 4FYIA 3RK1A 4A0GA 2BFWA 2DSTA 4M9CA 1XVAA 4P7FA 1VKRA 2E4XA 2E6UX 1X42A 1YA4A 2C2XA 1W47A 1R4MB 2ISCA 4JSYA 4BLSA 3ZCVA 5EIHA 4KKVA 3HYTA 1DZIA 2C4WA 2JZNA 3D3JA 3OZGA 4QKQA 1N6NA 1ENOA 1MJ5A 1T0HB 3FCYA 3GFOA 1JWBB 1UFVA 3P45A 1UMDA 1QB8A 1MO2A 2Y76A 1X14A 1E2EA 1II8A 3CX4A 4AKGA 1Z4JA 1EWYA 5FCDA 3OAAA 5LYJB 3UMYA 1OAKA 1ZGGA 2BONA 2Q5IA 4WEOA 3QMPA 1K2WA 1YIOA 1RBZA 3EEYA 2RGEA 4WLUA 1U9JA 2W8BA 4N6NA 1D4AA 3DMDA 3JASB 2ON6A 1W44A 4GM0A 4YMIA 4TL8A 2NT3A 2GTPA 3TBHA 2JLAA 3MK31 4BO4A 3ANTA 2FJUA 2GPJA 3K31A 3SK0A 4BFZA 5FLXA 4GICA 4IXMA 2DG2A 2Z1NA 3MS4A 4OMUA 3BXHA 3N2NA 4QOFA 4DMGA 1DIGA 3HKEB 3P0HA 4J0FA 1S2IA 2F3SA 3HBFA 4LWQA 2Q0HA 4PBRA 5EQJB 1Q1ZA 4MCIA 1R0YA 2P4HX 2DMRA 3CLRD 4MW1A 1L5GB 5HS4A 2B98A 1K08A 3FD8A 4OMDA 3OECA 5T3YA 1GL3A 2W7TA 1LSJA 1PYOA 3Q41A 4DDTA 1Z82A 3P94A 3DULA 4CDGA 1I4OA 2P62A 4MPJA 3L5KA 3R3YA 4BN5A 2RGUA 1RM5A 1D2EA 1F51E 1W4ZA 3DV0B 3DZ8A 2HHHB 3NIBA 3REQB 1X1TA 3BL8A 4INOA 4PSCA 2DFLA 1CDEA 2ZEJA 2X4IA 1UODA 5DK6A 4Z0HO 3M83A 1E1MA 4G0WA 1CY7A 3IMFA 3ZE9A 2WF8A 5FTLA 1FPQA 4FLMA 2PNFA 3FPGA 3IOCA 4YROA 1QMPA 1DSSG 2XCOA 2VEDA 4JJ4A 3OQVA 5E7QA 4ETWA 4NCXA 3CRZA 1DBSA 1YU6A 2PT6A 3INTA 4PGAA 4R2KA 5C7IO 1UINA 3RBAA 5J23A 1RXYA 3PIIA 4KITB 5JD3A 3NBXX 4LRSB 2XOEA 4MKZA 3IEVA 3MCZA 5DEOA 3PA8A 3T34A 3T7TA 1UBRS 1PFWA 2C00A 3ADOA 2NTYC 5ALJA 4I4CA 4UM9D 2NXJA 4E5VA 3EGWA 5I9MA 1DHTA 1SUFA 4KFTA 3VGJA 1GCGA 3G8BA 4A92A 2AG0A 4AJOA 4HTFA 4I55A 4OGLA 1TA4A 4DV7B 4F8JA 4GHWA 1Z63A 5C1DA 2JS7A 4BASA 1AMUA 2YV3A 3D0QA 1SCUA 3GLRA 4H77A 3PXGA 4L8GA 1AO0A 1JFTA 3SEFA 4RPJA 2GHQA 4TYQA 2XXAA 1ML4A 1A8UA 2AQ8A 4W4TA 1I2BA 1XTJA 4US2R 4DPMA 5E4YA 4G0ZA 1DG3A 1CULC 5JOQA 3P9CA 2W4IA 4RS4A 4LG1A 1WIWA 1PZXA 5EZYF 4AWAA 2V7UA 4LVCA 1WULS 1KZ7B 3JZMA 4XZ3A 2HNBA 4BX8A 2BH9A 5CD1A 1BE8A 4EFDA 3KB6A 4C7JA 5FHRA 3L4JA 3F4BA 3CZAA 4DMMA 9LDBA 2GBPA 4ZYXA 1KFCB 3W8DA 4ZFNA 5L3SA 4R1PA 5L6MB 1GGMA 2NU9B 4ILEA 5MDHA 3R0XA 1QO0A 1N2IA 1S9HA 1QH1A 1POXA 2LRHA 4G09A 3HFGA 2B6HA 3IALA 2CHVA 5LQRA 4FQ8A 3LO8A 4QHTA 3NHUA 1D1QA 1UMBB 1C0PA 3BGDA 3PITA 2ECPA 1AHHA 1XZMA 2XHZA 4QYIB 5CLHA 5KCMA 3GHHA 4FB4A 4GOLD 4EKYA 2J0SA 1LK7A 2J9FA 1RZRD 3DR3A 5DHTA 1T4DA 3Q11A 4PM4A 4OFXA 1T0UA 4D0SA 1E0KA 1YFJA 3TTXA 4M7RA 3B3FA 2W9XA 4G5SA 3K4HA 4CODB 2OKGA 3KS9A 3RYCB 5K8LA 4COKA 1A0OA 1C50A 4LCEA 4ZQIA 3RVMA 4WXMA 4EY3A 4LQLA 1KDRA 3TVYA 3HJRA 3WLAA 4DLAA 2BGUA 1M7BA 1YHYA 1H4QA 1KRWA 5CDGA 4UJ5A 2H8GA 1V7ZA 4L9RA 3RU3A 3LPAA 4NYMR 1CUWA 2OGWA 4QO8A 1USKA 3H5LA 4PZDA 4WZBE 4YI5A 2BMFA 3WKEA 2YOGA 4HNQA 5BYBA 4CNBA 4BKUA 2CT8A 1VSUA 3HO6A 1E2MA 1EFHA 1JG1A 3X1WA 4FOTA 5FBHA 1SB8A 1O4VA 1V5EA 2XTJA 4ENSA 3G79A 4UVIA 3F9CA 4KVZA 3PDHA 2WRZA 1O5IA 2C03A 1JV2B 1Q14A 4YRAA 4F6LA 4OUDA 3CVYA 4PO1A 1S2DA 1OQAA 1WHTB 2HIGA 3NHMA 1JIIA 2JFFA 3L0IB 1B3RA 3OETA 4MO2A 3PD0A 3TKAA 3TTWA 1QTNA 4Q9DA 5K6TA 1VIMA 2VQFB 1Q12A 1QYVA 4U5QA 3U6KA 3OPMA 3M5PA 4TM8A 4BMOB 4A03A 2TRSB 3ZGNA 5FL7D 3L1JA 3PXXA 2J5KA 1J5PA 2DULA 1NMQA 2E6KA 2V58A 3SD7A 2H2WA 4DLZA 1XRLA 1CQIB 3WLTA 4AUKA 2BFCA 1RAEA 3D6TB 5K03A 3GBSA 3M6IA 3B2EA 4LVNA 4LYGA 4EJFA 5IYZA 1BHO1 1QV9A 3CEJA 3L0PA 3ADPA 4GQBA 1Y7HA 3K9BA 3DBRA 3MMNA 4YWJA 3R8CA 4UMVA 4QDZA 5K4GA 4CIBA 1G6KA 3DP7A 3G02A 1SCAA 4R1UA 2ZROA 2EKQA 4K5QA 4TV8F 2GYVA 1SK8A 2BCJQ 1PNRA 1SCNE 4Z0TA 2A5YB 2I4OA 3U26A 4EY5A 2ZYSA 3ZEAA 2ODAA 4JLUA 1QRRA 1SUBA 3IXLA 1T91A 5FV7A 3EW9A 4IUDS 1YHZA 3W8RA 5L3VA 3Q3CA 3KR0A 4D4KA 1ZA2A 2QD4A 4GXRA 2EXXA 3AI3A 3PZRA 4FYPA 5HWSA 3DONA 3HXPA 3TE7A 5FTNA 1JDTA 2EERA 4MUHA 1QR6A 3I0NA 4TT3A 1C4XA 2YXEA 3FYDA 3MGBA 5FYDA 2QN3A 3AEXA 3H6GA 1VJTA 1J1ZA 3ITNA 4GLOA 2BBOA 2HJWA 5SYAA 4P7KA 3I52A 5IRCD 4V1CB 4CTNA 1DC7A 3GPBA 4RA6A 5E9WA 1U7PA 3NGMA 1TU3A 2AJTA 3DTNA 3A9VA 3L8YA 4E5PA 4J6EA 2BRUC 2ZXFA 3BTUA 4MYDA 4RLHA 3N0WA 1ULTA 4HQRA 5J5VA 5K3DA 4ZCTA 3DWIA 4TXJA 1L5MA 1AXGA 4RGQA 3Q8LA 1NJ6A 3X3HA 3AR5A 5JNSA 1DU4A 3NKLA 4E5YA 2VZ0A 4KWCA 1RC0A 3EWAA 2OXFA 1DQNA 2JJQA 1BS2A 2Q0SA 3KVYA 3K09A 3H2BA 3H4IA 5FH9A 2B4QA 4Q6WA 2FSVC 2C59A 2CCJA 2GD6A 2NO7A 1TEXA 3EA5A 1UJ5A 3ID6C 2EJWA 1G16A 4ATNA 2B8EA 2F1RA 4M1WA 4FYHA 1JHAA 5J58A 2VS1A 5T4EA 2WHRA 2RHTA 3GFTA 3TCXB 1GFIA 1RYNA 2IDKA 3O0TA 4HS9A 1BXKA 2HXGA 2G72A 4IIBA 4KN9S 4PRYA 3PS9A 4L4ZA 1G8JA 1W5EA 2ZM5A 3ODGA 4JELA 2O1XA 1JHUA 3DL4A 3IMCA 4R8LA 1CVRA 4FYKA 2E1PA 5CJ2A 5EKUA 1ARZA 1U8AA 3EQ7A 4PN7A 4FFNA 1YB1A 2I99A 3CZMA 4PX5A 5BMVB 2ZAMA 2RJNA 3CF6R 3DL7A 4UULA 5IJ0A 1EX1A 3DHWC 4F7WA 4AWXA 1ESDA 1BWPA 2AOUB 3FXAA 1D2GA 3IVAA 3HCBA 3IKLA 1V39A 2CWWA 3WLQA 3Q40A 1FSPA 2GKOA 1A5TA 1I6LA 4DZRA 3KALA 4KXVA 3K0HA 4RFSA 1QIJA 5JIBA 4YVFA 2C7GA 3O8OA 1VECA 4FYVA 4HAWA 1Y6ZA 3HBAA 1EYZA 5MN5A 4ZOEA 1VC2A 1DJLA 2ORIA 4P7BA 5AD1A 2VLBA 4G1UC 2YN0A 3WRWA 3LCJA 3RFTA 4G5FA 4ENTA 1E9RA 3IDAA 3MJCA 5DVZA 5G0TA 1EFAA 2Q1UA 5BVHB 3RUPA 1USWA 3O1HB 2O4UX 2YZMA 3D4LA 4LF8B 2SKEA 2QDXA 3TECE 1UPBA 2WJGA 2VNSA 1Y4SA 2ZIVB 1KJJA 3IUQA 2ZE5A 4D5GA 3VR1A 3ZDCA 4EZBA 3GGSA 1TKRA 5LP1A 1P4SA 2Q2NA 1LVUA 2Z09A 5K0GA 3NTRA 3CE9A 4OHOA 5A3VA 1TGYA 4IAOA 4CLEA 3IEMA 2FMKA 1XDSA 3TINA 3F5MA 1FL9A 1CUCA 1JDBC 1WD7A 3P4XA 4G01B 4G97A 3ZK8A 2DX7A 2KBFA 2NYRA 2H06A 5F78A 2VPTA 1FP4B 1MO6A 4YP5A 1XPJA 3FDFA 4FYJA 1HYHA 3G2PA 1T3SA 4YLEA 1M1UA 4EBFA 5TGDA 3NHPA 4IIFA 3VU9A 2IKSA 5DDIP 1WNFA 4RPIA 2CBZA 4LGVA 4PPQA 1JECA 2AXEA 3DL0A 4ALLA 2CYCA 3WRXA 1C1XB 3CB2A 3DOUA 2VT7A 3RU7A 1FRVA 5D6NA 2Q8NA 2GKSA 2DRIA 4I8XA 4N0EA 3VZDA 3M3HA 1DWOA 3EE6A 4LMRA 4IGAA 4JOQA 5CGZA 2C8KA 3O26A 4MWDA 2HTFA 2NUTA 3FM9A 4CMHA 3EQZA 1YQXA 1H2HA 4WK6A 1IG3A 1P2DA 3OCJA 13PKA 2ORED 4R6XA 1P0QA 3SZMA 4A0QA 2OCAA 3ZQJA 1G9XA 2C3PA 5LKRA 5E3IA 1NQ5A 1X7XB 3WP1B 2D2XA 4HEQA 5DGDA 1X1BA 5FO1A 4HZUA 1FQJA 1YKFA 2PBLA 3KR9A 3S2YA 3ZD9A 4ZEMA 3P20A 2M9MA 2WVAA 4XARA 3THOA 5LD2C 2CLLB 4KVFA 5KTPA 6ABPA 3HCOA 3PJDA 3MB5A 3HL0A 4B40A 1W2HA 4R1OA 5BW4A 2ZJ7A 3SXUA 2RHJA 2XKJE 2BGWA 4D9NA 5LM3A 5BNWA 1GA4A 2GA9A 3OJ0A 2ZUUA 1AUVA 4NZYA 3QRWA 3DT8A 2B20A 3D8NA 3I5MA 2J3QA 1QIHA 4KE7A 2RARA 2F1KA 2R8OA 5IANA 3UAGA 1P80A 1N2GA 3T7KA 1DOHA 3ZWVA 3WIEA 2GCEA 4NS4A 5T4HA 3PCXA 1E6CA 2YHUA 3CUSA 1IHUA 2VSNA 3FVVA 1CUIA 2AFHA 4OQEA 1V0JA 1Q7RA 2UUBB 2Z8YA 4XM1A 1V2HE 1VLJA 1KJNA 4P3OA 1W2GA 3PR3A 1FDIA 2R00A 1B76A 3KEOA 2CKMA 1G5PA 4MTCA 1QIKA 4RK5A 1GZDA 5HCIA 3IP8A 4R05A 1GRRA 1DBRA 3K2EA 3OM8A 1E3DA 2G5PA 3LQKA 1QE3A 1R4AA 2I29A 3AHCA 3C3DA 3GUCA 4CG2A 2PUBA 2V3VA 3AVXA 2A4MA 3CISA 4MRMB 4Y2UA 5KDLA 1DTWB 3TZ6A 2VPXA 4LE1A 3UUEA 1PNTA 3GLFA 1XE3A 4CGZA 3PNKA 1V8PA 5E2BA 2FMTA 1DJMA 5C8XA 5EJ7A 2JFQA 3B3QA 4EHDA 2I3DA 2MMCA 3LGAA 4EF4A 1SURA 1FP1D 1UMKA 3HFSA 3G5MA 1ZESA 5TEWA 3F5DA 1PBTA 3V4LA 4PWYA 2BFFA 4J16A 5ALLA 4UJ3A 4AG5A 5K3FA 5K4AA 2DLCX 1SCQA 2G08A 2R00C 1YE5A 4HFRA 1LSSA 1T2FA 2XQVA 4CIXA 3GEPA 3CX8A 3IP9A 1CW2B 4H08A 2NUPB 1EG7A 4XVCA 4LDJA 2VRWA 4O29A 2Z98A 4Z9FA 5IAKA 2D74A 2ZSKA 3KPWA 3FTEA 1QHIA 3RF7A 2BFBA 4IQ0A 1P4JA 3MTDA 3QIVA 4EB6B 4PGFA 1Y7LA 4MYCA 4D9EA 4KYIB 4RJJA 4ZICA 2ODBA 2CYAA 3CX6A 3QF7A 3QLVA 4CKEA 5KTKA 1YBFA 3NX4A 3F4KA 1AK2A 3KJZA 3LDUA 2HOQA 4G65A 5IT9A 5EKSA 2PMWB 5JQWA 1WSWA 2BI8A 2C7QA 4WUTA 2PSHA 3OTOB 4KVAA 5JSZA 1CZOA 2C3UA 4ZVMA 2AZDA 1JLRA 3X1DA 1XD2B 4G9BA 3SF8A 5EC8A 1EGQA 1OX5A 2NV0A 1T5SA 3UK1A 1QK4A 5BVGB 4A0SA 1A9ZA 1U7WA 3ULKA 3QLTA 1VKZA 3QOYA 5TT1A 5KYYA 1N75A 2P1RA 2BTQA 1OLOA 1L4UA 2K5UA 1N5MA 4F7DA 4DHWA 3DEAA 1SC6A 1ZUIA 3LI2A 3NHWA 4U63A 4EA7A 5BPFA 4CDRA 2XE7A 2O2EA 1FUYB 1U3VA 3SHWA 3CVUA 4OQQA 1KNXA 3CX7A 4F9TA 4JXXA 1EINA 5LA6F 1A95A 2RCYA 4KIUA 3QLVC 4DYDA 2NZUG 3FSGA 4AFNA 3SQNA 1TA9A 1U0NA 4HN4B 4X1KA 4UKDA 3FKQA 1IVSA 3AR9A 4QYTA 4B31A 2JANA 3EF1A 3QTBA 4FGJA 4YAKA 4RHYA 3CB4A 2IZ0A 5KTYA 2HA5A 2J6HA 1Z73A 2VKQA 4BNFA 4F2HA 1NSFA 4TQ9A 4PYJA 3IRUA 1KEWA 4S1PA 2WIGA 4MMXB 1FFEA 5DNDA 3V34A 1HFJA 2MOKA 5DBOA 1VHDA 2BWJA 4MS1A 1GSOA 4JUIA 2JRLA 5F9MA 4BO3A 4DJEC 1WW2A 1YMUA 2QHXA 4E2XA 1CEYA 3TRHA 4G9EA 2LUOA 4A6XA 4MULA 2GF9A 2BHNA 3N2LA 1Z6TA 2JLUA 1BA3A 1Z2DA 2GXSA 4HXEB 2HX1A 3K9LA 5U1PA 1RBYA 2ZUTA 3ROTA 3ZGLA 4DUZB 4YJ3A 1L7EA 5JQGF 1ZIXA 3GJQA 1O9HA 2QG4A 3HM2A 4INZA 1PT9A 5LOVB 1Q0RA 3Q1LA 2BLNA 3EPLA 2OXCA 2H1VA 1TZJA 3FCEA 3KL2A 3PWKA 1M5TA 3F8TA 2ZAOA 4X3OA 1I9CA 1Q84A 1PUXA 4CF4A 1IH8A 3PPXA 3ORRA 3USES 1X2EA 1YQWA 2ZRIA 1LPOA 3GG9A 3HGMA 2WIJA 2XIJA 4JI8B 1OXSC 4U0JA 3MIZA 2C84A 5FTWA 2HPAA 1ULSA 3L18A 4LAFA 4UM9B 4P9NA 4E4YA 1X7YB 1X9GA 4ZGBA 4KI0A 3HFRA 3W5BA 1WUHS 3I2JA 4ZYZA 2O7VA 5ALFA 5CB4F 1E9BA 1N36B 1MAAA 3G3EA 3SKXA 3O8RA 5DRYA 3SC2A 1NTOA 2G28A 3SZLA 5A5FA 2QUJA 4S04A 1AKWA 4NOMA 4CEIA 4HD8A 5KI6A 2WHPA 3DC7A 4MLDA 3GRFA 1E1NA 3ZVMA 1UAAA 5CYGA 2ZSBA 4KDFA 4D9GA 2WOJA 2Z43A 4OP1A 1JEYA 3HBJA 3FYHA 1H1DA 5IT0A 4WJLA 5L3RA 1AG9A 5AKYA 3ZE7A 4FOSA 4GAEA 4HDMB 3U7EB 2IE8A 4RGVA 1L5RA 5KYXA 2BF4A 2V6MA 1HNNA 1FDWA 1WWKA 1ZKMA 2XE8A 3Q8XB 4G0PA 4N0QA 1L7NA 1U9IA 3UJ3X 1JR6A 3JATB 2DH6A 4HFJA 1AQJA 1U4OA 3VA7A 1O6FA 4LC9A 1U0FA 4OXRA 4OH1A 3T52A 1XPRA 3GFQA 4Z0PA 2PXXA 4JXJA 5FTMA 3C45A 2EJUA 5E6RA 3ZIUA 3CRW1 3PQ6A 2VZLA 2JIDA 2XXJA 1PFVA 3W8FA 4F86A 5JSFA 3FSRA 4C88A 1P1BA 4XJSA 1ZISA 1ZL2A 5DZSA 3TOSA 4YV0A 3JZAA 3K1ZA 4QPNA 4RTPA 1EK1A 2A3RA 4MAFA 2X2OA 1UMDB 3RRNA 2HFJA 4LZAA 1SVMA 1WF6A 2I22A 5JBNA 4LJKA 1RXCA 4FMCF 3VR5H 3INRA 3PXBA 3H87A 3UJ8A 3VKWA 3DDWA 3FAKA 3ZQ6A 2PGJA 4EEXA 1GYRA 3LLMA 5ISMA 4F0JA 1ZINA 1ZH2A 1AMOA 4ER0A 4IDHA 2EKBA 3OLWA 1VJRA 2NPIA 3ML1A 3IXQA 4V0KA 5T7BA 3QU5A 5DBIA 2RGCA 2W8BB 2C2GA 3Q3VA 3CVWA 2VHUA 1GFSA 1KDOA 3O2SB 2HIHA 4BFSA 4V0MA 1T9HA 2GEFA 2JFNA 4GE0A 3H2ZA 5I7SA 4YRKA 3LX5A 4FCVA 2E3JA 4EABA 2POQX 2WJZB 5B7NA 3PFBA 5KVVA 2G9QA 1CQPA 2PHZA 3MLAA 1E0JA 2FQYA 4KSYA 4KWHA 3VI4B 4BN4A 4EDFA 3RAEC 4WLFA 4Q24A 2XOKD 5JNTA 2JD0A 8MHTA 3ZJUA 1T3GA 2JW5A 1SU6A 3O8NA 2JGKA 2JLQA 3H11A 4PXYA 3U80A 2FSUA 4K03A 3BZWA 4X20A 2WBLC 5A02A 2RONA 5EHNA 3VPCA 4AKIA 2O4CA 4JN6B 1QQAA 2F7SA 3B6ZA 4JQZA 2CW5A 4L4SA 4F5EA 3HKBA 4YFYA 3DZBA 3QFTA 3RNOA 2WF7A 4CW7A 3KJIA 1C30A 1V96A 3FWNA 3MWLA 1DC3A 4L0DA 3IELA 1A5SB 3KYCA 1ENYA 2VYVA 4ZAVA 3WLIA 5IH3A 2FHPA 2QIPA 3ZDFA 4O3MA 3PCRB 4LDZA 1YCGA 4YBRA 2X0EA 3DFIA 5FADA 3R5KA 2DC1A 1VL5A 4QD3A 1OBCA 3DXYA 1QLWA 4UARA 4E21A 3SM9A 5GONF 1RMTA 1NVDA 5KUTA 1YVUA 1NFFA 3OQNA 2VCYA 1SU7A 4FFOA 1OFUA 1RD4A 3QJGA 3RQIA 3ZWQA 1MC5A 3RFXA 4N0DA 4G1MB 3QMVA 2HPHA 1XBTA 1NXOA 4BV8A 1G60A 4Y2SA 3L43A 4PG7A 3UTCA 4LY6A 4ALIA 2A0WA 4N76A 2WB4A 3SXPA 2DAPA 3FVRA 1N8KA 4EKDA 3EYAA 5AJTA 4MWOA 4P86A 1GRVA 1E1LA 4HTFB 4YXWD 4RGBA 1Z83A 3GUUA 3SSAA 3P0IA 5D6OA 5I8WA 4EGJA 1IZZA 1PW5A 1XCJA 4J7AA 5T67A 3M4YA 3DMNA 1SCUB 3CWQA 1X7GA 1ZVJA 1MAVA 2ZRNA 4Q1CA 4HRXA 4EG0A 1NI3A 1YJXA 4P53A 3Q6IA 2CXRA 3OUTA 4LKOA 3RARA 4RPHA 2WOOA 2XXAB 4MEJA 2QP4A 3BCSA 1JI3A 1ZLXA 3I6IA 4P3YA 3T1QA 4J2TA 3OJCA 2IZ5A 4N3BA 4QPPA 3BPSA 4YV7A 1BSVA 2AT1A 4I5DA 4OFZA 4UAVA 1HUQA 4HNGA 2QOEA 1KDTA 3S3TA 4EG8A 5HPYB 3W78A 1PFQA 1KGDA 1XDBA 2DBYA 2WWTA 4D0LB 1F48A 1MRZA 1S3IA 2XQIA 3PQ7A 2QTAA 3O2QB 3DBIA 3AW8A 3GLIA 1FCJA 2ONKA 3G0OA 2W2OA 1SHJA 3BMOA 5CRIA 3LW8A 3QUBA 1C8BA 1RKUA 4NV3A 4EUEA 1CUHA 4L2IA 4ZYWA 2CE2X 1QLHA 3LLCA 3HI4A 2OHVA 3GVPA 1LI4A 1IVYA 1QH1B 4TZTA 4YDHB 3RSQA 4DILA 1DE0A 5D2CA 2PTHA 4MVJE 3OPNA 4MUKA 3SFVA 3T0FA 2IX9A 4IWNA 4NH0A 1WZIA 4RE5A 4YBZA 2DETA 2IWHA 3AU8A 1E4OA 1PAUA 3OZUA 2REQA 4NAUA 1YH3A 3VUEA 1PT5A 3F49S 3LUDA 5SYNA 2J9FB 5FUWA 3U3RA 3PKZA 4B73A 1F9AA 2FPRA 4UM7A 3IAHA 2Y77A 3GR6A 4O4JA 1E66A 3DKRA 4WY5A 1BKSB 4ZREA 4D3XA 1D5CA 4EMBA 2IP4A 1T36A 4G1BA 4OBWA 4JYBA 3W6UA 1C7IA 4UD2A 1QOQB 2OLJA 3GNLA 2HU8A 3GH1A 1AKNA 3OTHA 3D2LA 3N39C 4IRMA 3K05A 4LXXA 1XALA 2Y0CA 3DVQX 4ZC1A 1Z13A 4LXQA 5B37A 5INTA 2Q4RA 2AN1A 4BFLA 2O0MA 1X3LA 2PCLA 2QB5A 2FG5A 2JGNA 5JVDA 1NVBA 1YS9A 5ENVA 5HE9A 4TMKA 3EGCA 3R0JA 4TWRA 3F6YA 3K0BA 3I30X 4MAAA 5IM5A 1UBKS 5HKAA 1J25A 1C4WA 4KC0A 1DAHA 3TW8A 2OG1A 4BRZA 1K6EA 2HQRA 3E2IA 4CMEA 5EI5A 3G68A 1D4FA 2XV1A 3AHEA 4QXOA 3PFWO 3B51X 3DE6X 3QELA 4L95C 3VO2A 4BB0A 1XRPA 2G8NA 3ZGYA 4DAOA 5BO5A 1FTYA 1XZHA 4M76B 2R96A 1MOSA 3I9FA 3N53A 3TJMA 1VI2A 1ZI8A 4OUDB 2YHIA 2ZZKA 3KB2A 4A6PA 3I5UA 2ZB3A 2P6OA 3EJWA 3JQCA 3F5QA 3R3WA 3TRKA 5B55A 3IT3A 2VF7A 2AE2A 3HBLA 2YFHA 4TMYA 5CT6A 1ZM4A 4QDTA 3MHPA 4ZQEA 4CM5A 1EJBA 3O7WA 4UVDA 3VPSA 1B41A 4YJGA 4QC2A 2B1JA 3LLVA 4DLUA 4UQPA 2PS0A 2FKNA 3T94A 3WDKA 4EJ6A 5A3QA 1FSFA 4NCKA 4QDUA 3AZQA 3DVSX 4BL5A 5K8TA 2HRQA 3PQEA 3C43A 2ZSEA 3MLEA 3ENNA 3NEYA 1Q11A 3IQFA 4IXNA 2A84A 5AXDA 1IQ0A 4BO0A 1NSTA 1U5CA 3PEUA 4EOGA 2RJOA 2WYHA 5HK9A 4MI3A 3OPQA 3ES9A 3UW1A 3RSFA 4DCCA 4DPKA 3CQ9A 5IWAB 3DBRB 1IUNA 4IOJA 4KIWA 1KZ9A 4L3VA 3NV9A 1HSZA 1PR4A 3RKRA 3VH3A 3PIRA 2XJ9A 4P4UA 2GWRA 3TSCA 1RHQA 3H4MA 4GYWA 4K9SA 4QNRA 2GF2A 3ETLA 5EIFA 5EXTA 4BDTA 2XRMA 3I5XA 1JG3A 1PYDA 2R1TA 4M21A 4RTOA 4EF6A 5F35A 3RE1A 1GT6A 1H05A 5BW8A 2A5FA 3T7IA 3L8CA 4LN1A 5IUJC 1E6UA 1F06A 1FY2A 5DJ5A 3KOUA 5ALMA 3SR0A 1N32B 3GGPA 1QV7A 5IKXA 2Q6IA 4BWVA 2JLXA 5ENZA 5DULA 3TPFA 2GFHA 4BE4A 4QBIA 4QT4A 3WWZA 1FRQA 1X8XA 4C5AA 1GPYA 1KO5A 3CS3A 1GNQA 4Y1FA 5C18A 4EG3A 4V0QA 4C4TA 3RC9A 2ZYGA 5F1PA 4JL6A 4DMHA 5A5GA 1G59A 4FP9A 1RDFA 3KOOA 3QFSA 4RA6B 5I7UA 3QUQA 2EFHB 3PU6A 1T6BY 1J4AA 1XTRA 1YVRA 3AB7A 4I50A 3BT7A 4CNQA 5FFNA 5JE8A 2QXUA 5DU2A 1A2QA 3AH8A 3IQEA 1QU3A 1SEVA 4JB2A 3C1OA 1NMXA 2I6UA 1CFZA 1F6BA 2W2MA 2ZRDA 3BSSA 5BYKA 3HCRA 3LHKA 4IIVA 2JA2A 3GBPA 3WXMA 1K6XA 4LRTB 3BIFA 3A3YA 1U9CA 4ITUA 4CBVA 4LDQA 4IOMA 2HUNA 1UQTA 2HKIA 4P31A 5C34B 4CMJA 1Z4QA 3OP4A 4CTJA 4J49A 4B47A 4Y2PA 2O54A 3RC1A 1H23A 5CFNA 2GPAA 3L7MA 1OH6A 2HCJB 1DPGA 1XEFA 3WIVA 1WP4A 1DO8A 3BK7A 1U81A 4NE7A 2Z8ZA 2ENUA 4CL8A 1FW8A 3OZXA 3FHTA 5DNYB 1MFZA 4GZMA 4HRVA 4OXKA 1A1SA 1RI3A 3HV2A 3VH2A 3VO8A 3NR2A 1IRXA 1NUQA 2FMHA 1YS1X 2VZ9A 4KNVA 4QSHA 5DYGA 3UV7A 1Y8QA 4BUCA 4GI1A