2FSPA

Nmr solution structure of bacillus subtilis spo0f protein, minimized average structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution NMR structure and backbone dynamics of the Bacillus subtilis response regulator, Spo0F: implications for phosphorylation and molecular recognition.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Response regulator
molecule keywords STAGE 0 SPORULATION PROTEIN F
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1997-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fspA00
3HZHA 4TMYA 2HQRA 3QEMB 2MSWA 1JX6A 2RJNA 3RQIA 3CLKA 2AYXA 3FFTA 3O1JC 3O1HB 3O2SB 5HKOA 5ED4A 5BRJA 1YIOA 4MS3B 4D6YA 2H3HA 5FBHA 1ISSA 1SXHA 3H5LA 4RZSA 2GX6A 1RPJA 4XARA 5KI6A 4LX8A 1XHEA 3JVIA 3SAJA 1MVOA 3OM0A 3H1FA 4G0OA 1BDJA 3LKBA 3HUUA 1ZH2A 1QQAA 3KS9A 1YMVA 4Z99A 1Z2DA 2PL9A 2PLNA 3CS3A 3EODA 3KYIB 4YRZA 2FLWA 1MIHA 2JVIA 1TLFA 3EAFA 2N9UA 3H75A 2R25B 4E7PA 1A04A 2CHEA 1R8JA 3O75A 1L5YA 1DCFA 5EWJB 5KC9A 2CD7A 2E4WA 2YHBA 4WXMA 5B3JA 2PUDA 1K68A 1U8TA 1QP0A 4KREA 5TQ0A 5BR1A 4MQFA 1PEAA 4RY0A 3EQ2A 4FE4A 4Q7EA 2JVKA 2LPMA 3N8IA 4ZPJA 3EDCA 1URPA 2MYTA 1ZGGA 4EYOA 3CU5A 3NNDA 4IMIB 3JY6A 2FSPA 4PEVA 3UK0A 3TMYA 2FEKA 4F06A 2FEWB 4JP1A 4RK1A 3HJFA 4G0MA 1Z17A 1BA2A 1M5TA 1USIA 3OLWA 3OO0A 5KQPA 3CG4A 1JBEA 4MS3A 4RK4A 4JAVC 4N0QA 2RJOA 3Q7SA 1Z18A 4YP9A 2XDYA 3N6VA 3N75A 3SNKA 4N47A 5CNIA 3A0RB 4KZKA 3RVOA 4RK5A 1JL3A 3I42A 1YVUA 3T95A 4OLBA 2M1ZA 1EWTA 4D74A 2QZJA 4HNRA 2MSKA 3CZ5A 3EULA 3SG0A 3T38A 2PL1A 3W9SA 3BILA 2FKAA 4LRQA 3HO1A 1AB5A 3I45A 3F7NA 2NZUG 5TPWA 2PUAA 4B09A 4N0PA 2M98A 3KTOA 1DCMA 2QVGA 1Z15A 3UKJA 3GWGA 1RXEA 3CG0A 3G85A 2IPNA 3GA5A 4MR7B 1TVMA 4LDZA 1DC7A 3VNAA 3RVQA 3KKEA 2QXYA 2JB9A 4YS6A 4Y9TA 1T34A 3BRQA 4IMJB 3F6CA 3Q7TA 5JNRA 4NQRA 5IC5A 2R48A 3HS3A 4KRFA 6CHYA 5BQ3A 5JNSA 1JH9A 1P6UA 3M9WA 4RXUA 4IRXA 1EWVA 1TMYA 3SQNA 4MS4B 3C6QA 3F6PA 5JNTA 4Z4EA 3DGFC 4MR7A 4MR9B 3LUAA 4Z9AA 2JCGA 2NUBA 3R0JA 1KRXA 2FQYA 5IUJC 4Q6BA 1Y1LA 1ZHHA 2LBPA 3OLYA 4MQEA 4EYQA 1KGSA 1FFSA 1L5ZA 4LE2A 5KC8A 4KVFA 1RZRD 2O20A 1WETA 3CTPA 1E6MA 4YO7A 3OM1A 1JFSA 1SD5A 1Z26A 4TLLB 5B3JC 2PUBA 2JVJA 3N0RA 5IEJA 3N0XA 1EAYA 2Q5CA 2P4UA 3ROTA 2FTKE 3T6KA 3EQZA 2B1JA 3LUHA 3QEKA 1IIBA 4LZLA 4OTZA 4PE5B 2PUEA 1TJYA 1RZRA 4F11A 3S99A 4QICA 4P1ZA 3F73A 1JFTA 2ZAYA 3HDVA 3QX8A 1U2QA 2KYRA 4EYGA 3NNSA 5CNKA 3JS5A 3QELB 4N03A 5CNMA 3IP7A 3IPCA 1DRJA 5JNWA 5KWSA 3SY8A 1D4ZA 4KMRA 2PMCA 4JB2A 4RY8A 1Z12A 4WWHA 4HNSA 3HVRA 3M6MD 4D6XA 3OQMA 1GUDA 2QVCA 2IKSA 1JYEA 2VK2A 3H1GA 4EUKA 3QELA 2W42A 2TMYA 1A2OA 2PUCA 3MM4A 1CYEA 4MR9A 4OG2A 3O21A 1DCKA 1YS6A 3OLVA 2OENG 3TX6A 1DRKA 1QP7A 3CZCA 4GPAA 5E3JA 2AYZA 4LDAA 2J48A 2NT3A 3N53A 4KNYA 4S04A 4DADA 3OQOA 3ILHA 2IPAB 1S8NA 4MAAA 4RK0A 4IILA 1RNLA 2IPMA 4KV7A 4ETIA 1P2FA 1DC8A 1M5UA 3QLTA 1LK0A 3DGEC 4EGSA 3FDFA 3A10A 1GUBA 2FW0A 1DG9A 2JK1A 4H3HB 4MS1A 1JWLA 3JTEA 1QP4A 1Z2EA 4OBBA 1D2AA 2R4QA 4Z0NA 3RH0A 3HSYA 3KG2A 4KK4A 3GL9A 1DBPA 4PYRA 1YTUA 1M2FA 5DKFA 1ZH4A 2LUOA 3KHTA 2WMYA 3I5AA 1NXWA 1QNLA 3E61A 4Z4GA 4MR8A 5EWLA 4E7OA 3H5IA 2WY2D 1E6KA 5KQGA 1KMIY 6ABPA 1CHNA 1QKKA 4FE7A 4RU1A 1YS7A 5JS2A 1ZN2A 2X7XA 2QV0A 4H60A 2QR3A 5IUNC 5EWMA 2HQOA 3FFXA 2A9PA 3GBVA 1QO0A 5IBQA 2GI4A 2PKXA 3IPAA 3NBMA 1NATA 2L19A 4G86A 4GNRA 2FN9A 2HJ9A 4MGEA 1NXSA 3LUCA 4Z4FA 1LJLA 5FBKA 3FFWA 2FN8A 2FMFA 4XAQA 4MR8B 5EWLB 3MMNA 3QEMA 3SM9A 1D1PA 3O74A 5CHYA 4N76A 2ID7A 2WJWA 5JNUA 1GLGA 3A3KA 2L18A 3QLUA 3NNNA 2FVYA 4PZ0A 4OLAA 2IYNA 1VLZA 3H5WA 3L49A 1QQBA 3HM9A 5T3YA 2FLKA 4WT7A 1P6QA 3RVSA 1NXXA 3RVKA 1YMUA 1OXBB 3IP5A 1LBIA 4LE1A 2GWRA 2GKGA 2NT4A 3T8YA 4ETMA 4MS1B 3Q41A 2HQBA 2MYNA 3D02A 2L17A 1M2EA 3GV0A 3OLZA 1GCAA 3IP9A 3OMWA 1GCGA 3QK7A 1NXVA 1RXIA 2IPLA 2IOYA 4G0XA 1JDNA 4YCSA 3TO5A 1E2BA 4YV7A 3TB6A 1PNRA 4MS4A 3HUTA 4TN5A 4W5RA 1U0SY 4NCBA 2JBAA 4Z4IA 5EWJA 3C97A 1JYFA 2FQWA 3LTEA 1ISRA 3CNBA 4F8JA 4RS3A 3DLBA 2F8TA 4HNQA 1QO0D 5TPZA 4F3TA 2MYPA 3NHMA 7ABPA 1SRRA 4WZZA 2R47A 2PUGA 3LOPA 2CHFA 1PEYA 3C3WA 5IEBA 1W9HA 5JNVA 3OO1A 5BRAA 5FWYB 2QSJA 1JF8A 3LUKA 3LUDA 3GT7A 3FMVA 4L85A 3BRSA 5IUKC 1DBQA 3JPYA 4W5QA 3A0UA 4P98A 1ZGZA 3LUFA 3MQ4A 3HCWA 3URMA 3KLNA 4WUTA 1BDHA 3RVLA 1MAVA 4RWEA 5KQMA 3LUGA 2DRIA 3HV2A 4Z4HA 5DTEA 5IX8A 1ZDMA 1BAPA 1UDRA 5HSGA 5FWXA 4RSMA 1J56A 4NV3A 9ABPA 4ZMSA 1NXTA 5GOTA 2RGYA 2BGGA 3QLUC 1D1QA 1ABFA 4IGAA 1F4VA 1PUXA 1B00A 1JHZA 4ML3A 1Z13A 4DQDA 2VUHB 3O2JA 3QLVA 1NY5A 4G0ZA 4KQCA 2H0AA 5TQJA 3CKMA 1OXKB 2E4UA 5CNJA 3C3MA 1ZY2A 1D5WA 4G0QA 4EVSA 1DBWA 3CRNA 3MF4A 3N0WA 5FWXB 2JBAB 3EJWA 4ETNA 5KQLA 5I4CA 4DN6A 4W5NA 4KQ9A 5TQ2A 4O5AA 4RDCA 1JLKA 4S05A 1Z16A 4JB0A 3LKVA 1VRVA 4HYEA 1H9CA 5PNTA 4ZMRA 5C5EA 3JPWA 4OATA 1VKRA 2PAFA 3C3KA 5DGCA 4FB4A 4W5TA 4KFCA 1BVHA 5TPZD 1A0OA 3EGCA 1YK1A 2MSLA 4H3KB 1E6LA 3OLXA 2ZWMA 1BDIA 1LBHA 1XHFA 4ZYLA 4QYMA 5FWYA 2VUIB 4WXEA 3HK2A 2HSGA 2PJUA 4JASB 4YR7A 3Q15C 5TQ2B 1HEYA 3QLVC 2QU7A 4MYRA 4G0PA 4EVRA 5DCLA 1C4WA 1AB6A 1U04A 2NZVG 4MQFB 5TE9A 5GQSA 4N41A 2WRZA 3RVNA 1MB3A 3CHYA 5HQJA 1P8AA 3DZDA 3ILYA 2WWVD 1ZVVA 3DBIA 2PUFA 3RVJA 1KRWA 1EHCA 4W5OA 4RXMA 1VPWA 3D8UA 2ID9A 3RVMA 4PICA 1FSPA 1ZAYA 2E4VA 1C0EA 4MRMA 4LE0A 3M9XA 4CBVA 1LJUA 4M88A 2E4YA 4F12A 4ZJPA 5ABPA 2E4ZA 1XWWA 3HDGA 2FMIA 5EWMB 4EYKA 3H1EA 3GBPA 5D2CA 4NCAA 1USKA 1PHRA 1PNTA 1U2PA 3H6GA 1MB0A 2A9RA 2HPHA 4Z4CA 2FMKA 4RKRA 3BBLA 3H5VA 3RVRA 5C5CA 1JDPA 4O1HA 1FQWA 3K4HA 1ABEA 2CWDA 2P9HA 4YLEA 3LUJA 3H5OA 4YGXB 5HM6A 2OQRA 5IULC 1NTRA 4UHKA 1Z25A 2A9OA 2V0NA 5TPWB 3E3MA 3JVDA 2FXIA 4RV5A 2QW1A 2VYCA 4RY9A 3LFTA 4Q6WA 1EWKA 1F51E 4UHJA 3MYYA 3RVPA 4TLMB 4RXTA 1DZ3A 2FMHA 2JRLA 5T7BA 1QMPA 3HEBA 3O1IC 2GBPA 5JS1A 3MA0A 3O2QB 3IDOA 4L4UA 3KLOA 4RK6A 3P9YA 4EY3A 3QX9A 1QPZA 3Q9SA 4MPTA 4O1IA 3L6UA 5DLEA 1YK0A 4RK7A 2PE5A 4JA2A 1DP4A 2L2QA 1W25A 1NXOA 3Q7RA 1FFWA 3K9CA 4KK3A 3UUGA 4MLCA 3KJXA 2IDMA 3KSMA 4MRMB 4IF4A 2YHAA 3GRCA 3CFYA 1EFAA 4QYWA 1K66A 2LP4Y 1TM2A 3FGZA 4NICA 3OQNA 2MYUA 3DLHA 2WB4A 1CEYA 2E4XA 4MQEB 1JFVA 1ZITA 3H5TA 4XLTA 3I09A 4G97A 3MIZA 2FQXA 2WJAA 3LMKA 3NHZA 2RDMA 2F8SA 3OMXA 2I6FA 1NXPA 3GYBA 1USGA 3HXMA 5F64A 4JOQA 8ABPA 4XXHA 4Z9BA 1FFGA 4QPJC 4XFKA 3IP6A 4YWHA 1ZESA 4G0YA 4RKQA 3ROFA 1DJMA 3KYJB 3BREA 2B4AA 5TQ0B 1SXGA 3B2NA 3KCNA 1APBA 2LIVA 4MLDA 4XASA 3G1WA 4EVQA 3VNBA 2FEPA 3H6HA 2A9QA 3TD9A 4KPYA 1I3CA 1SXIA
chains in the Genus database with same CATH superfamily
3V1TC 1D9XA 3V8EA 1GGKA 4CUJA 1JMVA 1VXRA 1ADBA 1TMGE 3A06A 4BGIA 3VZRA 2IDZA 4HAXA 4NULA 2BEKA 8ATCA 2I6XA 1KY2A 3O73A 2NSYA 2HU8A 3L7OA 1ZEJA 5I7WA 4OB8A 2R1VA 5ALRA 5IJ9B 3ZV3A 3KO8A 2AZ4A 2AZMA 4BNLA 3GGCA 3H17A 1KJYA 4PC3A 4RL4A 2GM9A 4RZIA 2JFZA 3VPHA 4CMGA 1E60A 3VJRA 1KYVA 3LSTA 2C9OA 3PHCA 1G8KA 2PUVA 5CYOA 4YRKA 5M29A 3CF2A 3PUJA 1Q21A 1CY4A 2QY6A 4GC5A 5ERYA 5HGJA 3SQDA 2UUBB 2DERA 3T1NA 3BWXA 1L3CA 2H4ZA 1CF2O 1EE1A 1FSZA 1XTKA 4KSCA 1RXYA 5EWJB 3MAJA 2YHBA 5KVCA 1JQDA 2QN3A 1M6VA 1E89A 2AJLI 2XZPA 5CM8B 4GDFA 3L1JA 1I6LA 1T4MA 1FNBA 1Z75A 3CXRA 5E9QA 1ODSA 3CA8A 1N2XA 1JMKC 2H2HA 4HXFB 4ZZIA 3FI0A 1DHRA 3FSJX 1U3FA 1CETA 4MVJM 2EBWA 3BJMA 1ZGGA 3G49A 4IMIB 3JY6A 4D3YA 4Q4CA 1JKFA 1Y4DE 1YR7A 2V6IA 1YT5A 2WYOA 2QRPA 5BP7A 3KPYA 4BBAA 4CLXA 2RBKA 4MOWA 3FYDA 1ZA1A 4MGHA 5K03A 1W59A 1X1CA 5LQRA 2R7LA 3CG4A 4BO4A 1CQJB 2C7QA 2BF7A 2VTVA 4DMHA 3GOQA 2ZTVA 2FR0A 3CSUA 4YP9A 4H6WA 3GROA 5TSDA 1O6ZA 5IDXA 2CL7X 2XI4A 1LI5A 3A14A 2VH5R 3L18A 1DKRA 3IUJA 3NHBA 1DCTA 4R1QA 1UCFA 4EAAA 2CNKA 2CL5A 4XFJA 4DCTA 3KVYA 5K5EA 4GOKA 3WHKA 4P33A 1RRVA 2PQ0A 3KEFA 1AHIA 2ONCA 4RORA 1N6HA 1TAUA 2I80A 4BFWA 2B9VA 4OQXA 3F4LA 2BL4A 2TMKA 2Q50A 4I1VA 5BO5A 1CZKA 4L7QA 2XTMA 1C0IA 4BVBA 2CL6X 2UUPA 4G1FA 3ODGA 4UTZA 2RE8A 2G06A 1K7YA 3UKJA 2Z2JA 3CVYA 1G3QA 2HIHA 1JHXA 2QSUA 4MITA 2IPNA 4P83A 4ER0A 4B4KA 4RGQA 1YDHA 3R44A 4LTMA 3ZXXA 1I2ZA 2AXQA 3WJ1A 1BHSA 3S29A 1XA4A 4RF4A 5A4IS 1C9YA 1VJDA 1JZSA 1PG2A 3PK0A 3UO8B 4CCYB 5LJIA 1XRRA 4HEA1 2QD1A 1TX4B 4I14A 5AT1A 4PGMA 3ENNA 3F3SA 1XK6A 2FFBA 5E4FA 3W05A 2XUIA 4UUBA 1UK8A 2V6GA 2V6FA 5KYUB 1I6WA 3CIOA 2GXAA 4BNDA 4FQ5A 3A6EA 5EI5A 2RK4A 2AX3A 5LUBA 2B82A 3VBCA 4BMDA 1XV5A 4ZTUB 1QU3A 1O6CA 3RB8A 3ECSA 3TXXA 3U7FB 3BCSA 3R0JA 3TZHA 5IUJC 3QXGA 2C78A 3C6KA 4OBWA 2QMYA 1XKQA 4IXNA 3RK1A 3WG9A 3ZVNA 1AA6A 3V3TA 5DV9A 4CMCA 4EY6A 3L84A 2VPZA 4L15A 5D1HA 3NWPA 1IULA 3TGLA 1X94A 2O19A 4OGLA 3B60A 3EMBA 4V0LA 1SULA 2Z4SA 2G71A 5JTTA 1SD5A 3AL0C 2RHMA 1PJ2A 1K06A 1U9ZA 2JD0A 2VFAA 4TMXA 3ZQ4A 4EB3A 5IEJA 4DR5B 1SELA 4IXMA 4LQLA 3NV7A 2EC5A 2Q1SA 2X19A 2X6RA 1E3EA 1J39A 5FPTA 4AZWA 2BW0A 2A9FA 1WCXA 1B93A 2XNJA 4MKIA 3SXUB 4DIFA 2VSQA 4GKAA 1ILEA 2QE7A 3DNMA 3WA6A 4LRWA 2Q7DA 2W2TA 3JS5A 3QELB 4RPJA 5CNMA 3U9SA 3EVGA 5AUPB 4C0SA 2JKZA 3DD1A 3K30A 4A16A 5IKOA 3F6EX 3NGXA 4DIMA 1U5AA 1PSZA 2HL6A 3MS4A 4RD6A 1XYVA 2JPDA 5EIXA 1XC7A 1RRCA 4ARIA 5CFLA 1D0IA 2B20A 1SKBA 5AOAA 1VJ1A 1YFZA 3CMMA 4G1MB 4L16A 4YUXA 5B64A 4M9ZA 4D02A 1H1TA 4AULA 1ZD2P 2IFTA 5B7GA 4KGDA 5I7EA 5KYXA 2XRZA 4JH0A 3K6KA 1M1YE 1XZLA 4YBRA 4A0QA 4FMDB 2HPAA 5G0VA 2BV3A 5EIEA 5LYJF 2CEKA 3BZWA 3Q8LA 3EA5A 1FX0B 2Q2OA 2B78A 3BMNB 3H8WA 4UFOA 2Y67A 2G88A 2C2YA 4PHTA 4RIGA 2Y6UA 2HK8A 5EINA 4A3SA 1IBKB 3M5DA 4FHZA 2R6HA 2GCPA 3B8EA 1SEPA 4GPAA 1T2NA 1GGMA 2D5BA 1KS2A 2RIPA 3GMIA 4HLCA 4I99A 3FAZA 5TJHA 3DEIA 3H2YA 3OQOA 4DWOA 3I39X 1IXZA 4GXQA 4ZI7F 3U40A 1RNLA 4B2LA 5HIKA 3WJ7A 2TECE 4KO1S 1OVGA 2CB9A 2DJIA 2JLSA 3B3JA 3BMNA 1CUJA 3BQMB 5CDHA 3K96A 2IKQA 1R8QA 1L5NA 1SBHA 1XOIA 1BQEA 2G76A 4JJKA 3E53A 1JLSA 1DG9A 2JK1A 4CL0A 1P2GA 2CE7A 2W2PA 4C4PA 3GUUA 1PD1A 5BOVA 3BF8A 4CM6A 1HNXB 2X5NA 2G5GX 4Z0NA 3MLAA 1T10A 4HC4A 3IEUA 3GFPA 1ZJJA 5C8DA 3LCRA 1J2YA 4DC9A 1M2FA 1ZM7A 3EEIA 3K0KA 4IIJA 4NBSA 3ZHUA 2BEVB 3D8SA 2YN4A 4YRDA 5JSFA 2UXDB 3BE4A 4N40A 1U9YA 4QVGA 3UMVA 4P3KA 5BUCA 4XIFA 2C57A 4GF5A 1SRQA 1XO1A 4U6QA 1HURA 1ZN2A 4LFAB 2SCUB 5FI1B 3B12A 1IUKA 5BPFA 3G5LA 1H1DA 2ONJA 5FD8A 3UG6A 5FYQA 3ZCUA 4W8HA 1IY9A 3SDSA 2HWKA 4UNPA 1QK5A 1A2KC 2QJRA 3T94A 1PNOA 4FZVA 2CGEA 1Y8ZA 2FN8A 5IKEA 3DLPX 3PHHA 4Z53A 2OV2A 2YX1A 5EP3A 3MBKA 4MKXA 3MRXA 3VPDA 4YI5A 1YZGA 1GLGA 1IONA 3GFBA 1JEOA 2V4MA 3GPBA 3UJ8A 5C52B 3HLYA 1T4DA 2IIBA 4IJVA 1P4SA 2OHFA 4X44A 5LXTF 4OLAA 3M89A 1KYYA 2FLKA 4WT7A 4KQXA 4YUAA 1UBHS 2FEOA 1I2DA 2EFYA 5ALOA 4YAFA 4ZU6X 2ZZKA 5U9CA 1E3IA 1SIOA 3MT7A 2J9RA 2W6QA 1ENOA 1UWKA 2D5AA 2O4CA 4OK3A 3ABZA 2GWRA 1R4NB 2EVWX 4MW9A 1L6IA 3G2JA 4E30A 4BV2A 2SICE 3FCEA 2WAXA 2C95A 2HCFA 3KOWA 3WGJA 1C2TA 1XHLA 4DDWA 2YW2A 1ZMOA 1E64A 1M2EA 4H6PA 4LYFA 1F0NA 3IJEB 3NC0C 3A4IA 2D0IA 1JDNA 1KI3A 2ZYTX 2O8VA 4J9UE 1IHXA 2C00A 1F4PA 4GT1A 1WVGA 3IUNA 4GPD1 4HATA 4NV1A 3UGTA 3GI1A 4AYTA 4DLSA 1MJGM 2F6RA 2PGDA 4WOBA 2MDTA 2OYRA 3DE6X 1IUPA 1LWNA 1Z56C 1HWYA 2OPBA 3F7TA 3OPYB 3TRJA 4E5SA 1OC4A 1B0AA 4TKLA 2CKDA 3CLRC 2FUCA 3ML1A 4L27A 4ONEA 3PQ7A 3KOMA 1O4WA 2VIIA 1FPQA 5FBRB 4HNHA 1YV9A 1QRSA 3H6KA 1UXHA 3ZDFA 1EPUA 4UAJA 3R6GA 3L1KA 1QIDA 3S2IA 2R47A 3T5BA 2H85A 4IQ0A 2PYZA 5FWYB 1G8GA 3ZV4A 1JF8A 3MWKA 2ID8A 4TLCA 3VYVA 2FLVA 3O92A 4REMA 3WRXC 1H8EA 1AKWA 1H2YA 3PQEA 2PL3A 2YDXA 4GPBA 1OASA 5EZ5A 4EGFA 5AUNB 5A3RA 5JAPA 1D5CA 1FYVA 1QK3A 1PR4A 3AR4A 2JZNA 3D2AA 1ZUD1 2H16A 3N8KA 4BTLA 2AN3A 1INLA 3CUEF 3HY3A 4X8OA 4A8TA 2Z5GA 3G82C 5LBTA 1AQLA 2JIRA 1T4BA 2ZIUB 4ESVA 5AVJA 3G68A 4KQGA 4HWPA 2W70A 1Y8QA 3LWZA 3OC6A 1AUPA 2OBLA 4HUQA 2C5BA 1B00A 2QUBA 2RMKA 2VK1A 1PTJC 3WMXA 4K88A 1G6Q1 2VDJA 3JCZA 5T6BA 2HNAA 3GGPA 1X14A 4WIAA 2QMUA 4B2YA 4QDTA 1V6AA 2Q1YA 3FPGA 3BAZA 1WMDA 2B99A 3O8QB 1QH1A 1JR2A 2PTGA 2JBAB 1LV8A 3RGWS 4RH0A 4C01A 1TKRA 3ZU6A 4B4UA 4JVLA 4QRHA 1ZFNA 2OVFA 2WSIA 5J1TB 1V4BA 2O2GA 3Q5DA 3UXHA 4I50A 4PPGA 2UYOA 5B1YA 4ZZ2A 1NN3A 3IUSA 4X6YA 5B4VA 1JIIA 3MGKA 3OQBA 3C7DB 4M55A 3KAQA 4TKVB 2GHIA 3OLXA 4XM1A 1H0HA 1XHFA 4Q24A 4FDAA 1HL3A 4X54A 5FAKA 1MDFA 3PUZA 3TW4A 2Z2XA 1PU2A 1JALA 3D8RA 3EIOA 1HEYA 1PEKE 3KD3A 3HKCB 2QNIA 1OZAA 3A31A 4ZQHA 5FLYA 3RHFA 1H3NA 5CFRA 5IABA 1N2CA 4DIUA 4PYOA 1KGDA 4Y1GA 4B80A 1UZUA 3F6RA 2OBFA 5KTYA 4YX9A 1GZSA 4ZCSA 3B1FA 3GA0A 4G9GA 4YJGB 1VL0A 1FLAA 4QBIA 2IBMA 4NZYA 4YMTA 2VBCA 3Q2OA 4RPIA 3BFVA 3DBIA 4EEZA 5H8WA 5LC1A 5AVRA 3EWAA 2Y0CA 4YECA 2GNOA 1W5AA 4G6ZA 2D5IA 2HIAA 3PI7A 3RVMA 3IE2A 2AKEA 1QYIA 1FSPA 1N8KA 4Z8XA 3SXJA 4TMZA 4B6RA 1FYWA 5JT1A 2LGJA 4EMBA 4WUVA 3I3SR 4ND8B 1NZDA 2HHJA 3P0RA 4QE3A 4ENQA 3ET5A 2QUZA 3ZWQA 5AVWA 1T8UA 5DH9A 1PNTA 8ADHA 3T3OA 2O3SA 3TIGA 1NW5A 1BN6A 3EZFA 3HU2A 5HM8A 4F2GA 4MW2A 3S4YA 1W5SA 1O5OA 2WWGA 5CAEB 2QP3A 4OCZA 4ZT5A 5KEIA 3F8TA 2H06A 4DAEA 4ZJZA 2W8BA 3WLTA 5JZMA 1Q0LA 3JQAB 3H5OA 4HYYA 1U5BB 3ABSB 4FCWA 4E2YA 2EW8A 4CUKA 1A4RA 4JI7B 2DUWA 3WWZA 1CIPA 3SHTA 5I4KA 1EWKA 3HBJA 3CM0A 3MRTA 2FG7C 3QBEA 4RJ2A 4TLMB 1LNZA 2GHRA 1DZ3A 5HBGA 4IXWA 1X8KA 3HR4A 4ISBA 3WKCA 4FIDA 1NM5C 5C7OO 2X3UA 4CQMA 4F9EA 4I3FA 3PC6A 2GAFA 5EN4A 3TLXA 3WIOA 2QM8A 4L4UA 3KLOA 3EFBA 1LRLA 1FDWA 3H04A 4CKEB 2FMUA 3DWEX 1WUTA 3JATB 1RQLA 1S02A 3IALA 1ZU5A 4XDHA 1CX9B 1VCIA 3A6JA 3PKZA 1HYBA 2R5NA 2WMNB 1FZQA 4MLCA 1TZ2A 3EWIA 2C5AA 3R09A 2Q3EA 3H1BA 1CQXA 3IAUA 4HLNA 4KE9A 1S4QA 1TL7C 1KDTA 2B0JA 2ZUTA 3W5JA 4B33A 1WPRA 3PQ4A 1V1MA 4DGSA 1V1RB 1RXVA 2N0SA 4YDHB 2LP4Y 2XUDA 3CNOA 3HKEB 1DFGA 1NFFA 2VVTA 3G5UA 1XAIA 3DLHA 1J4AA 2NO1A 2C8KA 5DHPA 2HNBA 3L7LA 3FVWA 3RJMA 5CT8A 4UTOA 5DJ5A 4QOJA 3Q3VA 3VZBA 4KB5A 1PZEA 3DTVD 2QENA 1JUDA 1T3HA 3DWIA 3KXPA 5IN5A 4LHSA 1TZJA 2QN9A 1IBMB 1Z4MA 3JW8A 4GRDA 5LKRA 1ZVQA 3HWX1 2X8AA 4PZZA 2UXBB 1HDXA 1HOXA 1TJ4A 3HPRA 4MW4A 4P54A 4S0XA 3S7TA 3QITA 3PNYA 3TZKA 5LNK6 4MW7A 4CMEA 4CGZA 4AZ0A 1JDTA 2O7VA 2H1CA 1PGOA 3IPYA 4GNKA 1SZJG 4EJSB 3NRBA 4HXEB 2RHTA 3LBIA 3KCNA 1ZHFA 1LPBB 4G4JA 1OFHA 4DDKA 4XIJA 2EG9A 4ECEA 3TQTA 1NI4A 4IDFA 2F43B 1TGYA 3WB9A 4D4LA 1XBTA 2FSFA 1SQFA 3NM5A 2DWQA 1RZ3A 2PMKA 4C4TA 3RQIA 4G4IA 4YQFA 3EGXB 2XE6A 3T35A 3E5RA 3O2SB 4Q1AA 3KTFA 1JAHA 3R7BA 5LBIA 4H0CA 1UBCA 1Y1SA 3KDSE 1FMJA 3NC4A 3RYFA 2F55A 1T43A 3BA6A 2M6KA 1DB3A 3D7LA 3M5CA 5KI6A 1UJ6A 1ZZEA 3OZFA 3LRPA 4QUHA 5TVKA 1A9TA 1GN9A 5DM2A 1GPAA 1MVOA 3BWCA 3M1LA 4BLOA 3BDAA 4ZDKA 3D64A 3KBBA 5FNVA 2HMWA 4QC2A 1ZIYA 1BE6A 1EP9A 3EEOA 3L41A 4CTOA 2CW5A 3PTZA 5F7XA 3A3YA 3EMKA 3I2JA 2ENUA 3MGCA 4OSOA 5KVQA 3TRIA 3IBTA 2F1RA 4MYHA 2ANBA 4DV4B 4IDGA 2CHEA 3JRNA 3WSWA 3FSGA 3G8DA 3NCTA 1MJGA 1RKXA 4X8LA 2JD1A 1HR0B 3LH5A 1ZM9A 4UHCA 3W9YA 5COQA 1E7QA 4JLMA 1F0YA 5DVZA 4O6VA 1PJRA 2AJCA 5B57C 2IYOA 3EQ2A 3O9ZA 4ZVTA 1W5FA 2A0UA 1FFEA 4G9EA 1XCGB 4WNAB 5JEEA 1R37A 3FJ1A 4BLWA 2PG3A 1MOZA 5I9BA 3RFXA 3T5DA 5BV2P 3R7SA 2NVUB 2B1RA 4I3GA 2IZOA 3D0RA 1JSXA 1AK1A 2OCBA 1J8DA 2DFDA 2X14A 4YREA 1YGPA 2C2BA 1FS4A 4IP0A 4MCJA 1M33A 4RK4A 1KDRA 3WZLA 3E9EA 4UUNA 1FTGA 1LLDA 5C9ZA 2R1VB 3T7AA 4GKJB 5CXSA 2YJ3A 3LLVA 3AK4A 2DM6A 1QDEA 3LY5A 4LS3A 2M1XA 1Q57A 1NI3A 3DZGA 3EGOA 3K92A 4MIYA 1GUFA 3RVOA 5BYKA 4OLBA 4IHKA 1AG9A 3FUCA 1E62A 4B5KA 3K0CC 1XF1A 1Z0KA 2B2XA 3PQ3A 2A5FA 2PJDA 2XUZA 4WOJA 5IM4A 4AQDA 3MRVA 4FGSA 4AJ1A 1NJ1A 2CUNA 1E1NA 1BS2A 2P41A 4E15A 4ER6A 2PUAA 2OQVA 4BQPA 5A1TA 1XROA 1Z4NA 2XDWA 2YS6A 4RA9B 3SWWA 2Z4TA 3QJGA 2CUKA 3BXXA 4FEAA 3VTAA 4QTYA 3TQIA 1FTYA 2JH8A 4O1MA 4BQNA 2HM7A 5HP4A 4MJ3A 1Q20A 1TU4A 4JC8A 4BO5A 1KU0A 2E87A 1TVMA 5IT4A 1UP6A 2PUJA 1WR8A 5D1NA 3O0TA 2J3JA 3KZOA 4NDNE 1QU2A 1G64A 1T34A 2G4CA 3UJ7A 4YEDA 2RHOA 1SVUA 1U6IA 4RA9A 1CKEA 1ULHA 4FFLA 2AMYA 4L2IA 3S68A 5JD6A 4H3SA 1EWVA 4NBNA 4OYRA 2Z4RA 4I2VA 4F46A 3OE7D 3Q1LA 4R9VA 4S1PA 4ZOCA 5KOHB 4Q16A 4BNFA 1E1CA 1KXJA 1C7FA 3AR6A 4JU9A 4R8RA 1VHJA 2FV8A 4R2MA 2B6HA 2Q6OA 2ZSKA 3KPWA 4QAQA 4XRRA 4EYQA 3MUEA 3M8KA 4YMVA 1Z4JA 4TX1A 5J40A 3SFZA 2R79A 3D8NA 3AUTA 3IT0A 2JIQA 2H0QA 1PUJA 4KGVA 4Q5IA 3OFND 1E6MA 3UPUA 3VV2A 3NIWA 3AKYA 4WJKB 3N0RA 5CDYA 2AHOA 1ZGBA 1ATIA 3DKRA 3ZWNA 2Z04A 3S8MA 1U2TA 4G1CA 2IEBA 4KWHA 4XQ0A 4A92A 1P9NA 2IE0A 3AVPA 3ZNNA 2VDMB 3HRKA 3MINB 3ZY2A 2B98A 2OECA 1M2WA 3CPEA 1L5OA 3NUGA 4OXRA 1B14A 5HRUA 1Y3AA 3CQ9A 4QFBA 4KPUA 3LPLA 3DEJA 3F4BA 2EATA 3OSUA 1RXUA 5A5VA 3NNSA 3N2GA 1W1UA 3TWOA 4A2PA 5ARDA 4UPDA 3MT8A 1CVIA 4P4LA 4QFMA 4CU2A 1D4ZA 4B6SA 2RI1A 3H3XA 5HCUA 3ORRA 3W8DA 1YR6A 2PMCA 4UCFA 3EHDA 3T1YB 1WPQA 1GT91 4UCXA 4WWHA 3KSAC 2P2CA 1D03A 5T8KC 4AU1A 1FEZA 4ZVVA 2KM1A 1XJWA 3R5FA 2QVCA 1NHGA 3RV3A 4BGVA 4Q9IA 5L7YA 1YVEI 4PX2A 1W2GA 2CJWA 4QT0A 1PZNA 5DYNA 4B6GA 1MBZA 4NXNB 1DRVA 1W4BA 1E7SA 4LV5B 4OBXA 1HDIA 1D2RA 3P27A 5L9AA 4Z3OA 4AJ9A 4I4TA 2G36A 3QXSA 2H2WA 1O6FA 3C4QA 3VC1A 4MVJI 3CZCA 3COVA 4ZI5A 4ZYZA 1E2LA 2UZ1B 4HLUC 1HDGO 1EVIA 4W8GA 3ILHA 5HNKA 1N9KA 4ZHQF 1V5WA 4FOPA 5TC4A 4EFKA 4L5AA 2WD8A 2Y77A 2ZE5A 4XKJA 3T3PB 2C42A 3G0DA 1DC8A 3MVEA 2CLSA 4NHOA 4BNMA 5C32A 1DEAA 1W5BA 3DD5A 4MPPA 4BNUA 1DXOA 5B58T 3E9MA 4J3JA 3LOUA 4UPVA 4KO2S 2ACEA 3LVFO 3UC5A 1NAIA 4HJXA 4GPEA 2NPIA 5I7UA 1NF2A 3A10A 1US8A 2FOLA 3T5TA 4RM2A 3W6NA 1GZ5A 3R77A 1NBAA 1MTOA 4U8GA 5A6VA 1RLTA 5C8ZA 2R4QA 1K6JA 4FHCA 4G65A 4FOSA 2AOUB 1TF2A 2ZB4A 3WWPA 1V5EA 1P81A 1N8SA 5ED0A 1BQ4A 2OZKA 4LYEA 1ZH4A 3K70B 4MUNA 3QUSA 3C1UA 1A27A 4PX5A 3E61A 4Z4GA 4QQFA 1YQTA 2GEUA 3HRHA 4ICIA 2CDCA 1M2KA 2ZR8A 4G0NA 1CJUC 1P61B 1L5WA 1YS7A 1I51A 3DQQA 2VSXA 1MN6A 5HF9A 1CF9A 1SCUA 1UMCA 2FSGA 4Q34A 2QT9A 4Q4DA 2B69A 4HMPA 1D6NA 1K3FA 4R2KA 4KXYA 1PJTA 2O8EB 1PJAA 3ZYZA 4UNRA 2JGAA 3PTLA 4C21A 1RFLA 1U7DA 1DO8A 4CHGA 3GRKA 2ZUFA 1R27A 2OC4A 2PQ6A 3V2GA 3H4MA 1KDPA 1NBWB 2RHJA 3KVRA 4FZJA 3IJPA 4L8LA 4XEUA 1RQPA 5IJ0B 3MHPA 5CHYA 4FYYA 2WKQA 4BKOA 1R0KA 3WWDA 1VGRA 4JY7A 2BOVA 3H5AA 3HUEA 4NAUA 3P4XA 2I4MA 3T7KA 1IQRA 2RGRA 1HNWB 3ASYA 3FNGA 1XL0A 4HO1X 4MWSA 1QQBA 1OFTA 1VZ3A 3TCXB 4V03A 3A9TA 3R6WA 3PPXA 2AOVA 3RVKA 3AY7A 2VATA 1OXBB 2IPOA 1BROA 2JJYA 2RJ3A 4DA4A 1TQDA 4PSDA 1P17A 2EAUA 1WB5A 3QBTA 4LE1A 2A33A 4LPKA 4URWR 1NU6A 4EG8A 3ZIAA 2JFGA 4DBLE 7YASA 2DZDA 4RTNA 2ERYA 5CX4A 2D1SA 4MMZB 1F0PA 2XXAB 1BRMA 1I3NA 1P33A 1F8YA 2DWCA 4IZHA 3FAKA 3ZCRA 4ESOA 5CBPA 3HFJA 1E1RA 3UMJA 4ZI7B 4OOFA 5C1PA 2XITA 4OHYA 1W30A 1R0SA 1N3IA 1FXSA 2EDAA 4IGEA 4JMLA 2R6GA 2QRUA 2QYSA 4MO2A 3AIKA 5DSTA 4BO8A 4CM4A 2OPHA 3V4PB 2WDPA 4WN9A 4C0AC 4D46A 5AVXA 5IAOA 1KDVA 2YHIA 3S2ZA 2OCIA 1HOTA 2ZSHA 3RS5A 3TQRA 4XGRA 3TQSA 2CJFA 4EMTA 5TQVA 3X3HA 1FLDA 4YACA 3W3AH 3DLBA 4HNQA 3L79A 5GJVC 1X1DA 4FBGA 3CZMA 4EKIA 2MT9A 2MTBA 3SC2A 3LP8A 3AFNA 2WM2A 3NIGB 4M54A 3DC2A 3RR2A 1YL7A 4HY3A 2DYKA 1N0IA 2J0EA 3U4HA 5CXUA 3C3WA 1W0JA 3RAFC 4QPCA 4BNYA 2ZI9A 5BSMA 1G6OA 2J87A 1XELA 3G0GA 2XWQA 4U0KA 1POWA 1UMBA 2FW1A 3T3HA 2E55A 1C8LA 1IPEA 2FA9A 3V46A 3ESRA 4JJGA 3VU0A 3IKTA 4HPJB 4EGCB 3GY0A 1B7GO 3P9SA 3DDUA 5DGXA 3ZJ4A 1CR1A 4ZVLA 4RIHA 3S5JA 1KPIA 1KZ4A 2CWWA 5M04A 1N34B 3UZUA 4JYCA 4R2IA 3OLCX 2VYND 3MUOA 3OOWA 3ZWXA 3OZRA 4Z4HA 1RADA 3KSRA 1VI5A 2XNDA 1N3BA 1UDRA 1YNOA 3E58A 2A4KA 3QVJA 4JX8A 1LDGA 4NFLA 4P92A 4Q1CA 4YCNA 1R12A 3BSYA 4RHYA 1RYYA 3QLUC 4G85A 3GLGE 4D96A 2AQHA 3EZYA 3HZRA 3L40A 3DMFA 4H77A 1FYDA 1YWGO 2GEBA 2XMSA 3QHPA 3W4JA 3LRTA 1IN5A 3KFLA 4GXRA 1U2SA 1T36B 1FIUA 1G2OA 1LC0A 3TOXA 3P9ZA 2C82A 1ANKA 1D2NA 1FVOA 1SVLA 3HZOA 4OFXA 5BW6B 2I3GA 5BV7A 5MGNA 2VHEA 2FOIA 3QNMA 4DLLA 5KQLA 4GBED 2EFEB 1UJBA 1FMFA 1GY8A 4DDMA 1UMDA 3FPJA 4YC7A 1CUZA 4NBKA 2H92A 2F59A 3L4BA 3PJDA 2WM3A 2AOTA 4JB0A 2DTDA 3SE7A 1UBSB 1U4OA 1ZUIA 3QE4A 2ZT8A 2G1KA 2J41A 4JGIA 2PZ8A 4ND6A 1Y6RA 3QI7A 4U2GA 3S2FA 4F6CA 1JAYA 2I03A 3WL3A 3NVMB 4TWRA 4H3KB 4U7HA 1S2IA 1X9GA 1JPUA 1B6SA 4Z9FA 4RPKA 5HXAA 4DV5B 4LOIA 1H66A 2LE0A 3ZK8A 1U2GA 1M7BA 3MB8A 5FUMA 1QCYA 3DC7A 2XYVA 3H9CA 3RLIA 3NH9A 3X1XA 1XU9A 1TUBA 1ZVMA 2WMOB 4BAZA 4FKBA 4C3VA 1N32B 3U4QA 1CRLA 3FR7A 1R18A 2WRZA 3QBVA 2FSSA 3SSOA 5AJVB 2F62A 2H1HA 3PUVA 5ALYA 3I32A 5F35A 2EZ9A 4DSOA 1E7RA 3MN1A 4YXFA 6LDHA 2O54A 3AU8A 1ODIA 3P5BA 1DQZA 1MEOA 2G09A 1ZL0A 3TUJC 2OLJA 1VPWA 1M1ZA 1RCUA 4ES6A 1Y8QB 3IP1A 4HUQB 4XR9A 4WA7A 4ZIRA 2NTEA 3U7QA 3EG9A 1WCIA 2I1VB 3E9NA 4LE0A 4BMYA 4LQCA 2W6IA 3WMGA 3W6UA 5EJ6A 2ROQA 1CRPA 4ZODA 3EEYA 5JBQA 4AKHA 1W88A 4V2IA 4QOSA 2Q6KA 3MTJA 3H1EA 4F6RA 5K6AA 1A1SA 3DE0X 3PGMA 4LY6A 3I9LA 1ZCBA 3DTVA 1LLCA 3H6GA 2TSYB 2J30A 3PF9A 2QP9X 3AEYA 1R4AA 2GDZA 2QBYA 3FMFA 4KXFB 2C7GA 3V7FA 4M8SA 2J59A 1VIVA 3KSUA 4NJEB 5EZQA 4Q9NA 7GPBA 3D6TB 4EJ6A 2NPFA 3AO0B 1AKVA 3TN7A 3K1YA 1QFMA 2G9RA 2WNIA 1DFHA 4YJHA 4JWTA 3KHKA 2DTEA 4Z86A 2Q8NA 1BOOA 2GN6A 4IIGA 3PI6A 4Q6WA 1NVWQ 4BB0A 2XMGA 4Y0VA 2ZROA 1MG0A 3PEVA 2B92A 4DPLA 3HCRA 1WPXA 3Q4GA 3I0NA 4YK7A 3LP6A 3QQPA 3DNFA 2OBNA 3WV4A 3BB3A 5TF4A 1H2WA 5EERA 3R3XA 4W99A 2AD5A 3ANSA 4S24A 2O5CA 3EK2A 4EA8A 2FSVA 4J7UA 4B3TB 4PYJA 3L6UA 1VE3A 4CLRA 1UOPA 5CA1B 1ISMA 2BMWA 2DY0A 2GZ2A 3IAXA 1C3LA 5AO9A 2ZRMA 3RPEA 3UHOA 2OHHA 4BGEA 3QQ5A 2XSZA 3DHVA 3NAGA 3NC1C 3BL5A 3FZNA 4KK3A 3MBIA 3NOVA 4EKEA 1GKYA 4TKUB 2GN4A 3EZ9A 3Q7QA 1HLGA 2WYWA 4GR9A 2DULA 4YNBA 4AY4A 3GRCA 1M7HA 3THYB 2A2ZA 4UOQA 2HLPA 5ERGB 3HVJA 3OOEA 2J5XA 4NE2A 4EO7A 4JROA 2YWRA 2MYUA 1SIUA 2WHYA 3AOEC 4LVUA 2E4XA 3KTDA 3RS8A 3OQNA 4YAEA 3ZDEA 3ZQUA 4RQBA 4JODA 4DMUB 5FL3A 4L6CA 4D0SA 3M0EA 3WSVA 1IOVA 2HO5A 1KWGA 1JSLA 3LMKA 3WLIA 1KVUA 3NHZA 1IN7A 2JLXA 2OTCA 2ZWVA 3HFGA 1ZN9A 5AW7A 2RD2A 3ZXIA 1DKUA 2O07A 2ZVQX 3GYBA 5TIIA 2F3UA 1G5FA 3VNQA 1SCDA 1CR4A 1T3ZA 2JEZA 2P90A 3L0DA 4L73A 5EPEA 2FZ4A 1ODJA 1S2MA 3BICA 3PNBA 4XFKA 3ZWMA 2V0CA 4D3XA 4K9SA 3MJCA 1QTIA 4CMHA 2DX7A 2ECQA 1PLKA 3TB4A 2X42A 3QG5A 4FMCB 4FLMA 2Z2IA 3NP7A 3R5TA 3DDHA 4MJLA 1KIFA 4OKSA 4US0R 1CJCA 3U61B 1N2OA 3LA6A 4GBJA 5E38A 3OKFA 2AFVA 4MDHA 3NRCA 3SZ3A 1XQYA 2WV9A 4OJQA 1T0UA 3BMOB 1XF9A 4JGGA 3WGTA 5FWDA 3I76A 2B4RO 5ENDA 4IZIA 1NZFA 1TAQA 3OCWA 3U81A 1B8NA 1J2UA 3F5SA 5ADVA 2PUTA 4NKRA 2AQ8A 3UAZA 3FUTA 4AFNA 3AF1A 1GPWB 2D0PB 3FOEC 4H7DA 3WGNA 1J0EA 4LGMA 5TJ9A 4YYEA 5I9MA 1HYEA 4U7FA 3H1FA 5DCYA 3ZZNA 4RTQA 3LX4A 2UUAB 3C1OA 1A9SA 1J9ZA 1MQAA 3QOWA 2EBFX 2QYHA 2GGSA 3GNQA 3PZBA 3QKSB 5DTQA 1FJGB 2EKPA 5HIIA 1VE6A 3G0OA 1ECLA 4FCCA 3SBDA 3R9XB 4UM7A 4H1HA 1ZN7A 4JLWA 5K3DA 2JVIA 2P6MA 2X6QA 2BR4A 4LQDA 5TGDA 3ZBPA 3EAFA 3A25A 3BBPA 5HJ2A 1CUVA 2W2NA 1VZ2A 2V7QD 3E05A 4OQDA 3VHXB 3QX3A 1T9ZA 3GJ3A 3R9KA 2BFDA 4LF9B 3H8SA 1JZQA 2KLBA 3D7SA 4NU5A 4N49A 4LRXA 2XWSA 3LY8A 1V3UA 5GZ6A 2GK4A 2VT7A 2A78A 4HZUB 4HQOA 1QH8B 4L0MA 4RY0A 5G53C 2VBIA 5F73A 5JAQA 3WR5A 2CK3D 4FE4A 5J63A 2JVKA 3WL6A 1JEEA 3EDCA 1ADYA 3JX9A 5TT1A 4WK4B 2ZDQA 2CXOA 5JO0A 5F1PA 4POOA 2RHRA 3OF2A 3U31A 3ME5A 4WASA 3REFA 1W4RA 3TZEA 2R0QC 3VYWA 1Z17A 3OJOA 1BA2A 3S2UA 4GLLA 1II0A 2BBOA 1C9KA 2ZIEA 3A1DA 3BSSA 1A8PA 1STOA 4FCVA 4MS3A 3KB6A 1KVTA 3AR2A 2VA9A 1FDRA 2XZDA 1N5MA 1DWPA 1Z88A 3LOQA 5DOVA 3B5EA 5DYTA 3OEEA 4E09A 1WRBA 1VCHA 2JCBA 4M9SA 4QPNA 3WRVA 1CUWA 2RGBA 3EWNA 3EVTA 1DMRA 1JL3A 4JZYA 1K6XA 4PXYA 4DZTA 4DR4B 2AXEA 2FPGA 4G09A 1SXJE 5JYBA 1A50B 1K5HA 1GRNA 3FFBA 4MARA 1T3LA 2OXFA 1N8TA 1NBHA 4NJMB 4A8PA 2NNLD 3MS7A 3VYSB 3D3EA 4EENA 4MB0A 4B46A 4P38A 2Z98A 5EZYB 3KOXA 1L5LA 1W2WB 3KTOA 3TJMA 4AVYA 2Y2UA 4DQLA 2YKGA 1Z06A 2CVFA 5HFAA 4C29A 1OA1A 3CUTA 4RHFA 1GGFA 3EGIA 3GA5A 5MN6A 3K6SB 2Z6UA 1CY6A 3JYNA 2PZEA 1G59A 2VL7A 4AZVA 3FHTA 2FW9A 2QIOA 1MT0A 1XVLA 2Q4EA 3LAWA 2Y71A 1GPLA 3ZUPA 2ZPAA 2QEQA 1XALA 1JHRA 3NHAA 1EJBA 3L7JA 4IHJB 1VHLA 4B5LA 3WK7A 3FJYA 2FCRA 1PDWA 2VDUE 5JNSA 4AUKA 4Z1MD 3UY4A 1RJ9A 4Q9HA 4F84A 2VDPB 5FOVA 2O2SA 1P0IA 1II8B 3DGFC 4MR9B 4BP3A 1BW9A 1G4UR 4JLPA 5KSPA 3K94A 3K6SA 2A6PA 1U0GA 1NQWA 1OXUA 1WO8A 2EKDA 2ZAIA 1L5RA 4IEIA 3OURA 1KJIA 1WY7A 3RANA 5I9NA 4MXDA 4DMMA 1Q17A 2GCGA 1TQ4A 4AJLA 4Z4QA 2B1IA 2VNHA 3I6YA 3M49A 5KC8A 1OH8A 4RYDA 1JAXA 1FFHA 2IOHA 4RWZA 4EB8A 1VFPA 1G8MA 1M6YA 3DVAA 4KITB 1JFSA 1GAJA 2PUBA 4LIPD 2FQQA 2X5JO 2YYZA 3FHCB 2OO5A 1PTJA 2NQTA 1WOMA 4CEHB 2BHRA 1R8SA 3T6KA 2GNAA 4XQEA 2HCJB 1KQ3A 3PS9A 3UEOA 3KV1A 3OZUA 2DQ4A 1T8WA 3SXPA 2V0GA 2JCSA 4F11A 3T4XA 3WWYA 3U19A 4HBZA 3DLIA 2FEAA 2Q1WA 3QU4A 4AD8A 1XRSB 2GEJA 4FPXA 1QC5A 4M3NA 1VMAA 1NASA 4GI2A 2A1IA 1VYUA 5CJJA 2C9DA 2A0WA 2B94A 3PGJA 1C14A 5C4IA 3GPDG 2PVSA 4LTDA 3SF8A 1Z7YA 1Y5NA 4HNSA 5JHHB 1S8AA 1FE8A 5EMKA 2FP4A 3LK7A 2VK2A 1B8UA 3EXAA 1M67A 5JYDA 3HI4A 5FLEX 2FWJA 4CMJA 6AT1A 1IAVA 5BXYA 2A58A 3AM5A 4DR1B 3A2NA 2YJZA 3I9JA 1Q0QA 3DT6A 2H4WA 5CT6A 1CR0A 3JTMA 1L6RA 3KAKA 2H54A 3O84A 3PXCX 4HDMA 4O2BF 2ZS8A 1YS6A 2Q5FA 1YCGA 3JQAD 1VPLA 2D3TA 1U9CA 5JXGA 1E6CA 1LTHR 3FNQA 4MVJG 3QWBA 1KMHB 4RLFA 4I4TF 2IV3A 4BFVA 4BP1A 4RZXA 2Q6IA 1ZQ9A 2I8AA 1RT9A 2XUQA 1YR9A 2Q62A 3GCZA 1FFCA 3OU7A 2C2WA 2LDBA 2OO7A 3DQZA 4OXYA 5FPQA 3RD5A 5IXYA 5KINB 1RYNA 2QGZA 4MVWA 1GTMA 1M5UA 3FE2A 3OX2A 4W5JA 4YJ3B 5KJEA 4QJ3A 5F9HA 1JPVA 3QLTA 4O0LA 2HLNA 1EZ1A 3GEMA 1C1YA 5BYBA 3WLOA 1GUZA 4Q93A 3RC2A 4PSKA 1X7ZB 2EHDA 2ISCA 2P9GA 4R0NA 1YVPA 4BEBA 1M2OA 3DSRA 3ZCXA 1F1BA 4K9PA 1I2BA 3VJMA 1DLJA 3AY0A 4OA5A 2QD2A 4N5MA 1MA3A 1E1RD 5HR5A 1ZUNA 3A6ZA 5I7RA 3KG2A 3Q88A 1N7JA 1V71A 4KK4A 3O3MB 2PBZA 3V7UA 4K1LA 4B4OA 4TMFA 4J94A 5IZCA 4D56A 1FP7A 2WMYA 1ZKMA 2Q3LA 3C3EA 3THXB 2H29A 1BMFA 2BONA 1YL5A 3MYRA 1PI3A 2P5TB 4HEQA 1JKIA 4DR3B 1JEYA 4H60A 4BKMA 1GKUB 3H11B 5KTNA 2HSZA 4XSGA 2VJBA 4F86A 4TYNA 4PBRA 4LF6B 3R7WB 1XVTA 4KP7A 2ZYGA 1UINA 3RFVA 2YW9A 2WWRA 4KN6A 1FVHA 4Y2PA 3IPAA 3VISA 1XD2B 3KT8A 4QXRA 2DHQA 3CH4B 2I2XB 3DMPA 3IV6A 3SS8A 4DLPA 3OCCA 1VMDA 3BHMA 3FFWA 1E1MA 3MMNA 3D2LA 1BFUA 4HPXB 2D7DA 3S8EA 3I6BA 3LX5A 2EW2A 2IOQA 4OQPA 5EHNA 4YXWA 3GRUA 5ALJA 2IV7A 2VHCA 3NNNA 3S8YA 3B3FA 3KKPA 4ND5A 3MC1A 1VLZA 4QGFA 5FIUA 3HM9A 1GO2A 1MKYA 3HO8A 4H7JA 4JT4A 3FTQA 2NU6A 4ZCTA 2GPSA 3G2MA 4G4SO 1K27A 2WSSD 1KFKB 4F5DA 1GYPA 1ZW6A 3T12A 5BUQA 2GKGA 1P1CA 3OE4A 5GMOA 4L8FA 1DO0A 3KZMA 2GEDA 3K1JA 3L05A 3LQ1A 4DIEA 2F4VB 1DAKA 1IEXA 2B8NA 1N6KA 2QB5A 3AWDA 4K3UA 4UUPA 5FFNA 4AY6A 4DLRA 2IUYA 2J5KA 1XCOA 1TVCA 3OLZA 2JIZD 4NEGA 2VP2A 1M8GA 2Y92A 5THXA 5I7SA 4MO9A 2IPLA 4IZ6A 5KTTA 2Z6AA 4MLZA 1UBJS 4BX9A 1KS9A 3CR8A 1BCRA 1NVVR 4XZ3A 1BH2A 1PNRA 1EFVA 3NASA 1EK6A 2GYUA 5T3UA 4BBZA 4BYMA 2BI7A 1TW2A 1AMUA 1XJ0A 1WDLA 1RQXA 3HFRA 3AHFA 4HYQA 1O9BA 2QD4A 1MAUA 5KZMB 2OHJA 4KDRA 5JO9A 2DCMA 3ZE7A 5F98A 1P2DA 5THKA 1QO0D 1CZUA 3IPXA 3DM9B 4OMDA 4DQKA 2EF0A 3C2QA 1PV1A 3E9CA 3NIFB 4QJBA 2ONZA 5CMLA 3WK5A 3PRHA 3AT1A 4TKVA 3LNCA 2CJPA 2XOKD 1W9HA 3ABIA 4Q4AA 5IEBA 1K4YA 5L40A 1KJ8A 3D2CA 3DE3X 2GN0A 3DE2X 3KKNA 4P3XA 2PH3A 3EISA 5E1BA 1RBYA 3K8ZA 1ZGZA 2BMJA 4HFMA 1P2SA 3QXCA 3KYCB 4IHQA 1RQNA 2Y3IA 1X7YB 2QLLA 4GAEA 2PXAA 1K0UA 3BGWA 2J0UA 4KPUB 1SKMA 2WJGA 1YQWA 4UE3S 3A37A 5IX8A 5JPDA 2HZ7A 1NUUA 1BAPA 1IYZA 3L6RA 2C5EA 1JP7A 2OKCA 1XL1A 2HREA 5I5GA 3W3AD 3O26A 3AUXA 3GIWA 3L0IB 5DXAA 3UG7A 2HXGA 2QPOA 4J49A 1NNEA 3ZUGA 4FGZA 4P3PA 1MA0A 1F8GA 2B61A 2IV2X 1J9GA 1BQ3A 3UA4A 1UIMA 3CVVA 3SSMA 3TQHA 4ZD6A 1OZHA 3P20A 1LC3A 4PZCA 1HTBA 2E89A 5IS2A 1W4LA 3KEMA 1EUZA 2W2MA 2ZYRA 1JQKA 1UXKA 4DN6A 3DHYA 4HTFB 4YAOA 5JR3A 5KSZA 1RI5A 4X45A 1IEVA 5DWVA 4KN8A 3LKVA 5CD1A 3SC2B 1E2IA 2FZVA 5AVZA 2WFLB 3P0JA 3QTTA 3M70A 2VJLA 2PEZA 3KQTA 1CZOA 4JCCA 3EZ7A 4OQZA 1E59A 2ZWMA 1XMXA 2EHJA 2Q5LA 2DJ5A 2VAVA 1UPCA 4WXEA 4A4DA 5ITZA 2CUZA 3G0BA 3I64A 5K0GA 3SOZA 4TTPA 1ZMBA 2JHFA 1QYCA 3NALA 4G07A 1ZD4A 3AVVA 3NKLA 1EGMB 1KAMA 2OV6A 3S1LA 3ZWBA 2BFPA 4NH0A 5LYJA 3JQEA 2YYSA 3OQIB 1U1GA 2IIVA 4OMUA 1XQ1A 3X1KA 4D98A 5AJHA 5ENVA 1EQUA 1VOTA 3MZ0A 5SZIA 3PFGA 2ATIA 3DQPA 1WLSA 1SB8A 2RH8A 3IP3A 3IESA 3JQ6A 4FWTA 5D8DA 3JQ9C 3O9VA 4C76A 3ND9A 1JS1X 4JEUA 4TWJA 3NEJA 4IUCS 1UKEA 4W8OA 3AZQA 2MSDB 1CJBA 2RH5A 1M2VA 1V8FA 1WM1A 3N8DA 5H1YA 4BO7A 4DDHA 4YMLA 1N1EA 2ZM6B 1TZMA 3BERA 3LHFA 2DETA 5HKKA 4MV5A 3QXJA 4KMMA 5SY6A 3H5RA 1FBTA 4RL6A 5FA6A 3PHGA 1W8DA 4LC0A 4EAQA 3FOCA 3RM3A 4BVJA 4HAZA 3CEMA 4B9AA 5IBCA 4NEQA 3IQGX 1AURA 4HF7A 4OXXA 4BX3A 2I91A 2X9VA 1XD8A 5LQKA 2RHGB 5T4HA 4JA0A 3JALA 3PDCA 1G3MA 2XWJI 2R2GA 1DEHA 1EYZA 1Z25A 3MUFA 2Q07A 1YASA 4WEQA 3IXLA 2HT6A 1MOQA 1S4MA 4EO9A 5FQOA 2CLEB 2OCDA 4L9WA 2E37A 5EIOA 3B7WA 4D4MA 4EYEA 1Y7IA 5TMEA 1FX0A 2OM2A 3WRWA 4MUXA 2WPDA 4HQRA 1XAGA 2WF8A 1B0ZA 2X1LA 4XVQA 4PIPA 5E9WA 2AE1A 3ZLVA 2FSUA 5F52A 3UYKA 4ZYVA 1USUA 3D4IA 1W93A 3ZQJA 1J90A 1L1EA 3WJAA 4HPWA 1P9RA 1W5EA 1GSIA 3SVLA 2FGKA 2MIIA 4I9UA 3MWEA 3Q7RA 4LNAA 3EZLA 3QYFA 2F3TA 5LQAA 2ZSEA 5AW3A 1YZYA 4GZ6A 4IDBA 4PNZA 4URFA 4O3MA 1YRLA 1PQPA 4M37A 1I3OA 3TGWA 2REQB 3H2GA 3PJGA 3OJ0A 1RYMA 3I52A 3D3WA 1WNTA 3HBFA 3EQ8A 4MIEA 3SC6A 1W88B 2Y0EA 3B1ZA 4LPSA 3AP3A 3PCTA 3V9PA 4BKRA 5EJ7A 5HTKA 3CKYA 4Q3KA 1QWSA 4C6RA 4EKDA 3G9QA 2WIDA 5IKPA 5K2OA 3SR3A 1XLWA 5BOSB 2Q27A 3AI3A 4OXIA 1DEKA 2RKBA 3S0JA 2FQXA 3ZLJA 2OHGA 1IZ8A 3CGWA 4N9WA 4DRZA 3RF6A 3ZHZA 5JLJA 4UM9D 2V7QA 1D1TA 4AKSA 2F3QA 5ITSA 1RHUA 5EEGA 4Q9LA 4XFDA 1UOOA 2VDOB 2XT0A 3EF1A 2DY1A 2YOHA 3FPKA 4YAKA 4Z0PA 1EUDB 2P5SA 4GOND 3EYWA 3VVMA 1LVHA 2FPLA 1CZNA 2E85A 1BFDA 4RKQA 1EJ0A 1ZK0A 3CLTD 2QRMA 3U7IA 2P65A 1RWMA 2XQFA 4I4LA 2RGEA 4ME6A 2R8PA 3TG2A 4ZHQB 2OGTA 3R7NA 4HH1A 2RAFA 2VK8A 3O3CA 1I2MA 2MU1A 3IA2A 1V35A 4E03A 4WI1A 4A2QA 5HZHA 2EBHX 2XUGA 3SYKA 2GZAA 2UV8A 2RJNA 5CYGA 3O1HB 2DCUA 4CE6A 1CQIB 4R9SA 3TI7A 4GUDA 1U0NA 3SZGA 3V4OA 4A8JB 4C4YA 3H5LA 2RONA 2HLDD 3OBIA 5BNTA 2F1KA 2VNJA 2FXVA 3U0BA 4EG5A 2B6NA 3GFSA 3PNOA 4HGZA 1J97A 4ZEOA 1S3SA 3LKBA 4PYIA 3UAGA 4PCAA 2I3AA 3L8GA 3KR9A 4YLGA 5DOZA 2R1ZA 3PNKA 3RABA 4Z99A 1BMQA 3JQFA 3AVTA 1KEKA 1KOFA 2PD3A 4U7WA 1KEVA 5CURA 1E9DA 1QIMA 1SO8A 1ZPDA 4LYYA 1AJEA 1I1HA 3WKBA 4U6NA 4D4KA 1SCJA 3Q9NA 1GKLA 1NNUA 1ZD5A 4HDSA 4JLOA 2BUBA 5FA8A 3BDIA 3EXFB 4J1TC 1G9TA 4DLYA 1Q95A 2AWOA 3AI7A 3G2KA 2QZ9A 1YKGA 1PL7A 3LFUA 3W1VA 1YIDA 4YV1A 1GZ6A 1GQ2A 1LSJA 2C9ZA 5DP1A 3UH0A 2E5LB 3OBBA 4Z0TA 3WLHA 1JI3A 1TVKB 1K4KA 4F3RA 3PJFA 4HVLA 2A94A 3KQNA 2X0IA 1CUCA 3NNDA 4J0CA 4HR7A 3RS3A 4XX0B 1M7GA 1UBEA 4EF5A 2IHUA 5ICSA 1X3LA 1TT5B 3IP8A 2QAGA 4LJ6A 1ORVA 3HGQA 4TYWA 5AKGA 1DMSA 3BFXA 2CLMB 2ZIGA 1BHQ1 4KOEC 1GAXA 4PGAA 1TQ6A 5IT5A 3JARB 5DEIA 4IHJF 1NRXA 4QNNA 2WJIA 4A7PA 3RBZA 1K5DA 3N6VA 4JLKA 2V4ZA 5D3QA 4CF4A 4HXYA 4D9GA 1QYRA 4WDQA 3WAJA 2KSQA 4TZTA 2AW3A 1JG2A 2FUG1 3OF3A 4HOYA 2I6UA 4MYUA 2XH8A 2DSTA 5JSHA 2GEKA 2M1ZA 1EWTA 3GIDA 5AVTA 5I4IA 5K6AC 4YRTA 1E5VA 1XRMA 3GFOA 4MVJE 4C7OA 3LG2A 1E1QD 1NVUQ 5G1NA 5HJEA 4W5WA 1EAMA 1HQCA 2HXSA 4CIAA 1JI0A 5DHRA 1FUYB 3TUZC 2WFMA 1R3UA 1DJOA 4ODIA 3FRJA 4JUFA 1QONA 5IWAB 2JFFA 2M98A 1FTNA 2AI3A 2H00A 4K03A 4MQ4A 2GKOA 4FTWA 1WP4A 2GAJA 3PSAA 3N05A 1Z15A 2QKYA 3BEDA 4LX0A 1L8AA 5JV5A 4N9QA 4ZQEA 1I7DA 3FROA 4LDZA 1BXRA 4LNHA 4EJFA 1DC7A 4EYSA 3U62A 1MC8A 1L5VA 2Z58A 3FF1A 4CKCB 4MZXA 4CM1A 3ZZMA 4K8RB 2VJKA 2UZAA 4BVLA 3MCTA 2IP4A 3H2KA 4J8PA 2YZ2A 4ZYTA 1V48A 1A7KA 4J7AA 1N4DA 2VHTA 4ZO6A 4EW1A 3LM8A 5IFKA 2X0DA 3F4KA 1TMYA 4I08A 1RP1A 5FOWA 1B8PA 2V74B 4K26A 3MPUA 1L4KA 5FA5A 4JNKA 3KEGA 2CD9A 2VXOA 2QN8A 1U1CA 2V6BA 2Z30A 3LLUA 2JKYA 2P5UA 3NFYA 3HJNA 3RSZA 3AESA 4DCNA 1E9BA 1T6BY 2PV7A 3EDYA 3MTIA 4FMCF 4EA6A 4LE2A 5NULA 4GWGA 3NQ41 4L5YA 3KU4A 4XR4A 4COOA 3QFCA 1TMKA 3ZE1B 3NMUF 4LJRA 3L8CA 1WE2A 1JQBA 4TV9A 4GR5A 1YS4A 2QGNA 4KAFA 3N0XA 3FPBA 4MULA 5IHPA 1LZLA 5UKDA 2R60A 3ANXA 4NZZA 1TCUA 4JVMA 3QU7A 1DKMA 3RUEA 4XWOA 3OJLA 5EZYA 2D2XA 3H8JA 5CFPA 1WMAA 3OFNA 3QUCA 2WQZA 4P1ZA 4XWWA 2O23A 3F73A 1JFTA 1A5BB 1XCJA 3BIWA 4ZV9A 2C4TA 2C58A 1V6SA 3KQMA 3VVLA 1L7EA 5AI8A 3IPCA 2IDJA 4H15A 3ZDDA 1CB0A 1KJWA 5KWSA 2AOUA 2CLKB 4BMZA 2J3DA 1YZQA 1DADA 5ALHA 4KMRA 2XT6A 5C3UA 4B4VA 4NXMB 4JB2A 1P0FA 3FWNA 2VHVA 4Q03A 3TSZA 4NS4A 3JQBA 5H9WA 4XLLA 4CTMA 2HWUA 4U2KA 2GZ3A 3PR1A 3ZI0A 1PZMA 1DAOA 2P1RA 3FPAA 2WZQA 1HDZA 2EP7A 3F9IA 4DJEC 1XTUA 1RD4A 2B5OA 3BFJA 3QELA 4AJEA 3JR3A 3KEQA 3IR5A 4WKNA 4IVQA 4UTPA 2Z9DA 5MN4A 3VYTB 3PNPA 5J2UA 4MR9A 5CDSA 4C7BA 5A06A 1T6NA 3HI6A 1NSTA 2D4HA 1W29A 1KYWA 5J23A 4EGQA 1SA0A 3RU7A 2VPQA 3OLVA 1SOAA 1IATA 3MAGA 3OUZA 4IIXA 3LC1O 5DHFA 5HMLA 4PC1A 3RDPA 4DQXA 3MQ2A 3CF6R 1A5TA 3QGMA 4NOKA 2W4MA 3T9BA 4CV0A 4G3XA 3HU1A 1NVFA 3VR2D 2BE9A 3ORSA 1X8XA 2WP8J 2KB0A 1Z8NA 4CKEA 4MAAA 4AN4A 1E2KA 5C7LO 5DNCA 1JLMA 3HFSA 1SBCA 4DCGA 4JT9A 1K9SA 3U16A 4PFJA 4PZ9A 3DGEC 4YIKA 3I92A 5E9JA 1TLLA 3SZMA 1EZZA 4ADSG 2R44A 1IRIA 2EEPA 5JEDA 3C6MA 1GU0A 1CRWG 1M0TA 4OJKA 1O0CA 3EVNA 1B2RA 3V8PA 4HZUA 2FETA 3OF5A 3QWFA 1D4FA 1FUKA 1JWLA 3VUFA 1BHJA 2DUJA 4ACBA 4BNXA 5M34A 1QORA 4K9KA 1CD5A 3U80A 1KEEA 4OY3A 2IPXA 4DCSA 1YBAA 1H5QA 3FPHA 1JHOA 1U81A 3IDQA 3G6KA 1DUIA 3LWNA 2K5UA 3DMHA 3ZXSA 2GJ8A 3UPTA 2H1OA 4AUMA 1WPGA 3GCGA 4D9JA 5CA1F 4KUEA 1QO0A 2Q3MA 3FSRA 5CDUA 1LQTA 2C4KA 1YONA 1SCBA 3NBMA 4XARA 3W5SA 4OFBA 2O3UA 2AR9A 2PS0A 3QKRA 3BQNB 3VOSA 2H9YA 2O0HA 4LDQA 3FWPA 3VPCA 5BPHA 4YJ2F 4OGWA 3KM0A 3IAHA 3NJRA 1T5IA 1TNDA 4J0IA 1ZK2A 2BZ0A 1T25A 2IXEA 3I9OA 3LIIA 1NJ6A 4CL8A 4CDGA 2ZVDA 1XR3A 3FHLA 1V16A 4DXHA 1KETA 4X7RA 4JI0B 3AX6A 5BUZA 4R8VA 3QWHA 2A9JA 2EYQA 4AG6A 4HN2A 4RIFA 3BAFA 1G63A 1P6QA 1V7PC 4UHDA 1PK9A 1QBGA 1NLMA 4XQ9A 4QU9A 3RWMB 1QVWA 1I30A 4HGPA 2BT4A 1GADO 3AHCA 3LT0A 3Q7PA 1K75A 5FI0B 3STUA 3VVBA 4D42A 2CFRA 2XB9A 3C4JA 3R6DA 1WHTA 4K0KB 1WBDA 1A4IA 3GLKA 3TEMA 2MYNA 3SFTA 3ZWPA 4AY3A 4QYSA 1L4YA 4G24A 5CB8A 4A6PA 1M8KA 4YDRA 4A8HA 2IU0A 1Q84A 1PCXA 2VHJA 3AGPA 4IGFA 4F92B 1F3LA 4RMGA 2CC2A 5AKEA 4RJKA 5DIFA 3AVUA 3CTMA 1Q6ZA 3ABRB 2NXJA 2Y27A 5BW4A 4CKWA 2G1AA 2FUEA 4KV9A 3KQPA 4OAPA 1JKJA 2XRFA 1K92A 3V6MA 5M7EA 4BLTA 3U6BA 1EE9A 1OC2A 6PFKA 4DA7A 3L3BA 5BSWA 1ADFA 4GYKA 1HE5A 2BWJA 3H7IA 1E5LA 3M4NA 3ZHCA 4DJTA 5I3ZA 2P6PA 1SM4A 3D7RA 4QRIA 5JS7A 1AK2A 1FNNA 1IEWA 1MFPA 3ANYB 1Y4ZA 3D7MA 4JJ8A 3X1YA 5HS4A 2BGWA 1SRRA 4HQKA 3GJ0A 3AF4A 3DBLA 2CHFA 1F8XA 1GG9A 3NYRA 4TLAA 5BSGA 1NR5A 1OAOA 4LF4B 3OKCA 3GXOA 4R1LA 4UU0A 1HMYA 4URZR 2IUSA 4WZAB 4CKZA 3KEOA 4JLJA 4IDQA 3W79A 1WABA 3LUFA 4M21A 5B4TA 1SB9A 4WZ6A 3KLNA 4WUTA 1L4EA 4FNOA 5LOVA 3QKTA 1JQJC 1XTSA 1YRQA 3ADOA 3KAJA 3KLMX 2PD4A 3NYWA 2WZCA 3D6JA 4KKXB 3CJRA 4ZYXA 5LNK1 2DFPA 3A1TA 1P4AA 2Q5JA 2VJMB 1NVTA 3HV2A 3O4HA 4KXXA 3Q3JB 4EGAA 3PTAA 2ILVA 1PR0A 2UYCA 4LW8A 1CJVC 2Q1XA 2RH4A 5T4BA 3INNA 1F8UA 4EHDA 4XWKA 5HSGA 4RSMA 3GZ4A 4ZXPA 1L1FA 1L5GB 2PXXA 3G0IA 3A11A 4BLPA 2BGGA 3KE9A 3M6WA 2R7MA 1WSDA 4DSZA 4W9MC 3UJAA 3FTCA 2B8JA 2J5QA 1YVRA 1PUXA 2HMAA 2YWGA 3BPSA 3FOBA 4GECA 5GONB 2I8LA 2YY7A 2FSVC 4JQOA 4KQCA 4L4XA 4R41A 2E4UA 2FB9A 1JBKA 2EF1A 1CRZA 3E82A 1DBRA 2YIVX 3AR8A 4YWJA 1T6ZA 3MF4A 2IJGX 3N0WA 1TKBA 2Z2KA 2BFCB 4NAVA 5JWRA 1EFPA 1XRLA 4HDMB 4B2IA 4KIGA 4C06A 5MDHA 5ADHA 1CUHA 4WXYB 4CIBA 2DWOA 2GF2A 2FG5A 1AGYA 1CY0A 4WNYA 3GLFB 2Z43A 4V0ME 3HUFA 5KO2A 4OATA 4LMBA 4P0PB 1P74A 4ZCMA 1NDQA 3PDIB 4JUDX 1FQKA 4X95A 5KX5A 2YFHA 4PC7A 1K7EB 3EOBI 3G79A 3CNEA 4HH3C 5F33A 1TADA 4BDTA 5BN4A 4ZZ1A 2C3MA 1QH1B 1SZCA 1XYGA 2G4VA 2R751 1GPBA 2FU5C 3FNFA 4TXMA 3MCVA 2AW5A 3SYTA 1EK2A 1M0EA 2NMVA 3MJDA 4UBJA 1XE3A 3V1LA 1M6NA 3NBKA 3STHA 4QBFA 3DXZA 1QUEA 1HRKA 2CNWA 4GS5A 1FU4A 1ND5A 3TL3A 1KSHA 3R1IA 3T7JA 5IFLA 1MU0A 4BV9A 4DWJA 1OI2A 4QBTA 5E6SB 3R76A 3OQ6A 2I9KA 2DQKA 3HCEA 3ELWA 5BN4B 2WWVD 2LCFA 2OVBA 4BNZA 2J9ZB 4E1AA 3K20A 2BMDA 1ZVVA 1L8OA 3JYHA 1NRJB 4R84A 2IWHA 3MMSA 2Y0PA 2ZT6A 1YFKA 3DV9A 2QL6A 4D9HA 4I1OA 3K2QA 5KWJA 3H13A 2O2YA 2ZBRA 2V7BA 1EIWA 3HG7A 5CEEA 3WAKA 1ZOOA 4H27A 4H59A 4RMNA 1G8HA 4XGNA 4WERA 2IZ0A 5ABPA 4YJGA 1C1DB 3W78A 4DRXB 1YB4A 2OFPA 3TTXA 3ONFA 4J16A 4L9RA 3RIGA 2J32A 4D3SA 3MTEA 4S2EA 5EQFA 2PPLA 3WNQA 1Y6JA 1A98A 1I0LA 2G6TA 2PPVA 4KI7A 2PX6A 4OLHA 3ZYCA 4BCDA 3K7EA 2IYQA 3MNFA 1NDUA 7REQB 2DBQA 5LLDA 4HAUA 1MHPA 4JC4A 3IKLA 3EC1A 3CRVA 4JVNA 4A5OA 1SC9A 3X43A 4R2LA 3NRJA 4C6TA 3D8TA 2VYCA 3M6AA 4MCHA 5JCZA 4HVTA 2WA2A 2Y4OA 1U0JA 4ZOLB 5IVDA 1WXEA 4UHJA 3MYYA 3RVPA 3VAYA 1P7YA 4MW5A 2D2IA 3JQ8A 1KMMA 1JE1A 2BKVA 3F8SA 3MJFA 3NBZC 4JQYA 4HHEA 2O7QA 4M53A 2OB1A 1M0WA 3QF4B 4OHUA 4OHKA 1EX6A 3C3YA 5FNVF 3GUYA 4D8UA 3FTNA 3D6FA 4X41A 4DV3B 4TQ9A 2E49A 5AKHA 1XMQB 5F9MA 2ZB8A 3H9UA 4H31A 4HB2A 4FYPA 1TQ8A 2GRUA 1L5HA 2GPNA 2CZQA 1QZXA 4OU5A 2PE5A 4M1TA 1WULS 4L5JA 3I5UA 1NRWA 2JHAA 1GG2A 2WHEA 3RSSA 5ADUS 1VDZA 4MV1A 1F6WA 2R84A 1MX9A 3ILVA 1FYEA 3GH3A 2P2NA 4TRNA 3PDJA 4RTOA 3FWZA 4PPYA 5JMPA 1DAMA 1G5HA 1NUPA 1KR5A 3EQ6A 3UOGA 2IC5A 1UEXC 3HMQA 3TIVA 3JYOA 1JFVA 1YC5A 4ZTBA 5B3AA 1TGVA 4WFKA 4IJ5A 2Q1TA 3C3BA 3B53X 2WKRA 4F45A 5LB4A 1A5AB 1UQTA 4Q18A 4E46A 2Z3VA 2YVQA 4QTUB 2CLLB 1NVGA 3FSGD 3WGZA 2OQIA 3V00A 5KWVA 4C2TA 2G9QA 4GXTA 3TTTA 2VTBA 1CR6A 3EF0A 3A70A 5BVHB 3P2IA 5FR2A 3LLSA 3OECA 2V1XA 4GM0A 1G16A 2V6MA 3PJRA 2BSQA 2FSIA 3BH6A 4TTJA 2VXBA 3MJRA 1E1KA 3FVRA 1ESCA 2IXAA 4EI2A 5TQ0B 2B4AA 2XZTA 3LQ4A 2QRKA 2BVNA 3N7AA 4TZKA 3WZMA 5CTAA 2HH9A 4KAXA 1VA5A 1R3DA 2GUGA 1NPDA 2BMAA 3FLAA 3TTVA 1SXQA 4QGBA 4EGJA 3IVCA 2HUNA 4KPYA 5T67A 1I3CA 3AONB 1K8QA 1GUYA 3DA8A 4RSHA 2CVZA 3HZHA 5CFMA 1TIPA 4YT2A 4G8JA 2VZ8A 2FW7A 2HY7A 5SV2A 5DYGA 3W5VA 1NQVA 3VI3B 2WJ4A 2GZSA 3EAGA 2OZLB 3L6EA 3K31A 1F7UA 3IDAA 4LSWA 4MS3B 4QEKA 1OJLA 4WD3A 3VZPA 3C70A 2I4NA 3JWIA 2GX6A 3WMFA 2SBTA 1LQ2A 3C5VA 4Y9UA 5LP6F 2O8CB 2QX9A 3TE7A 1GWNA 3P9IA 1LWOA 1OZFA 3HJAA 4G1UC 3G8CA 2QUHA 4MAMA 4MKHA 2GZDA 3V8MA 4U3JA 2C03A 2EFCB 4ZV4A 2VQSA 1QAMA 2GLXA 2WQ7A 2GR9A 2RG1A 2UXCB 1AZTA 1ZM4A 1GL3A 4EDFA 1ZR4A 4P4UA 4QOIA 4YRZA 4ARZB 3E7FA 3RROA 4HGRA 3SJUA 5HUHA 2L82A 3AMVA 3ETHA 5BR4A 5AM4A 1X77A 4KZPA 5EZYF 3ERCA 1SU6A 2X0RA 2O8CA 2HK7A 1O8BA 1T1IA 4WVFA 5HK8A 4C7JA 5BN3B 2ORWA 1U99A 1GGEA 3W5CA 3ANMA 5LUAA 1W19A 3EGEA 2ZWAA 4WXMA 1QCCA 3G0CA 2Q0SA 3T4EA 3IDFA 1RHQA 1YNSA 3K5WA 2DVMA 4MPRA 3UWSA 5DGTA 2IXFA 4UASA 3KWJA 3OZEA 2LDXA 2JGMA 4OQNA 5HILA 3WLFA 4LJ9A 1H0SA 5AK3A 4DCMA 4F60A 4WK2B 4P36A 2MYTA 2A86A 2GBIA 1RW4A 4A03A 1BWPA 4OFZA 1AMNA 1KKLA 2FSPA 3ZW9A 2R6R1 2CL0X 5AXAA 2VYVA 4RZ2A 3ZE9A 4CETA 4G0MA 2CLOB 3PPYA 5CDFE 4UD6A 1FFDA 1JB1A 2VSNA 1USIA 3CT6A 3HLTA 4KBYA 3WFJA 4AIRA 4RHCA 4LY0A 1UBOS 3T7TA 2FPSA 2XUPA 2RGNC 3DF7A 1OGYA 3OOJA 2BDUA 2ZZNA 4NNJA 3C1AA 5EJIA 1XDDA 3GZNA 3N7TA 1TC2A 1Z7GA 1IUNA 1FDTA 1V47A 1G2QA 1T8TA 4JGBA 3RSLA 3KT6A 2HFKA 4YBZA 4J0EA 1QZZA 1SHLA 3KXKA 3UK7A 4LFBB 5ALZA 3QBDA 3EOAI 1BGVA 2X8WA 2V3CC 3KSBC 2QTFA 3A6LA 2YWEA 4DEVA 3ONDA 4KXWA 2NPOA 2QVGA 1H5NA 3L82B 2VKQA 1E94E 1B3RA 1GZDA 2N1MA 3CPJB 1WDKA 3VM6A 2ZSIA 3AXSA 1JHVA 3LHIA 4Y9SA 2JFNA 4UEWA 4LECA 5EE0A 4ZVRA 4BNGA 4QXPA 3HL0A 2JCYA 1TVKA 4X3PA 4B84A 2J67A 3K8YA 1IVSA 2J7PA 4FBMA 3K2IA 2FJUA 2R1TB 4XYEA 2WJYA 4H08A 1E92A 2PVCA 4P2BA 5FV7A 3FDXA 1MH9A 1LRJA 1M72A 2BM8A 1U3DA 1II9A 4RZUA 4PTZA 2ID4A 4L07A 4OAQA 3DT8A 9MHTA 4NTZA 4U2FA 3LC2O 3WB0A 3U4QB 2FY8A 1Z2CA 3P45A 4RD0A 2ZJ7A 1JLLA 3GLQA 2C77A 3UT0A 2LBPA 1WBJB 3NTUA 2WVGA 2P8JA 1FFSA 1HZZA 1KAEA 1X1BA 1LF0A 5GV7A 3UJNA 3TMAA 5I51A 3SBXA 2HN9A 4LV8B 3OWXA 1VC2A 3D8HA 4DB4A 2P91A 1P5FA 1Z5VA 2J5RA 3ADPA 2JHPA 2P9CA 5KOHA 4F4JA 1RLJA 4XVCA 4Q1EA 4I3HA 4ISCA 2GRAA 2CMDA 3W5IA 1R0YA 4C3UA 3DEZA 1NVAA 2CV1A 3T3DA 3AB3A 5IWCA 3JVVA 3LUHA 1IIBA 3ODPA 4AMYA 3ETCA 2XUJA 4Y6PA 4NAHA 1RZRA 1Z6QA 4PR3A 1WB4A 4QIHA 4TTIA 4QICA 3ZDRA 5IVPA 2ZAYA 3V32A 1L8XA 2A30A 2ZETA 3HCAA 1J0AA 1JB9A 5GVRA 1O3YA 2XVYA 2RGDA 2NZJA 5KU7A 2WOOA 3QVLA 4PG4A 1K7SN 4U02A 1IY1A 2QRJA 4B76A 1X1EA 4FX5A 4RY8A 1T1JA 4NCHA 5IH3A 4CG1A 1LQUA 1IIRA 4L8YA 3ZGNA 5LZ7A 4CMKA 5G0WA 2XV1A 4FLFA 2XTJA 5SYMA 1BD4A 2QLMA 2I34A 2ZKIA 3W8NA 1CVLA 3GMDA 3IYLW 1KBQA 3NGMA 1LPPA 2FZWA 3AJRA 1DTWA 2V3WA 3Q2IA 2AVDA 4GEKA 3TINA 4HX9A 3O8QA 4EA9A 2WM9B 4JMPA 5CX1B 4B4WA 1FDSA 3OPQA 4QARA 4LXGA 2DOKA 3O21A 5KMGB 1RACA 1DCKA 3L7NA 1RSZA 3X2EA 4ZYYA 2ETVA 2Q5IA 3L6CA 1PBTA 2RGGA 1Q1GA 4ZVQA 1JHMA 1IJEA 1NWHA 4JDPA 4LDAA 3NIDB 4QLAA 2QTWB 4S04A 1X70A 1FUIA 2IPAB 2WKWA 4TL8A 5DMHA 5H3HA 1Z5NA 4P86A 2DP4E 5CLLA 3N87A 1BWRA 2GD1O 2OSBA 2VNAA 3A1NA 2JFHA 1VRWA 3KYDA 5KKCA 2NIPA 3L5KA 3OTHA 3LFHA 3A9UA 3K0AB 3UXEA 1YR8A 3CCCA 1MW8X 1J1IA 1EXNA 5HZKA 3THYA 1M73E 2ZQZA 3K35A 2CVPA 4ER7A 1AQJA 3VNVA 1PV4A 1Q2UA 2W6MA 3HXTA 1GV1A 1W2HA 2ZXFA 5ICEA 1KI2A 4KTTE 1WMEA 4JL6A 1V11A 2ORYA 3EZNA 2H9AA 5CH5A 3STXA 3VUEA 3ZD9A 1H9AA 4KXUA 3RARA 3L7BA 1JDUA 2XGOA 3HCDA 3TTYA 4YCDA 4GX2A 5JSQA 3E1SA 1NXWA 4C0QC 2N46A 1KMIY 1EUQA 1Z8FA 4CR8A 4DR2B 3R8XA 4MP8A 5DM0A 5EIHA 5EMJA 5FPHA 1ZJZA 3IVRA 5DNAA 3VPXA 4ACAA 1VSTA 2HQOA 3P97A 2JATA 2VPTA 2PMWB 1PJBA 1TPYA 4IJUA 4IR7A 3RYHB 1J6UA 2OMKA 4DANA 5CAEA 3OVMA 4XAQA 2JAHA 3TXYA 5A9SB 5FULA 2X1MA 1Q50A 4M0LA 4DA6A 1L7MA 4LXTA 1E2GA 2WZDA 2Z8YA 3NKVA 4MH0R 2P27A 1U5BA 1S7CA 1SD2A 3QE2A 5ALGA 3Q8KA 2H2AA 3B6IA 4WLUA 3LXUX 2QTAA 4B43A 3RC1A 3RV4A 4GPTA 2I99A 3BXFA 4BQIA 4DABA 4HX5A 1T6YA 1DIBA 1YU6A 4N3AA 1PX0A 4QODA 2IY8A 1P0CA 2HPVA 3TSCA 3BK7A 4A8JC 4ZZ0A 5FBVB 1H4SA 3QV1A 4DQUA 3CZAA 1JHUA 3V8VA 4IIUA 1USVA 3QKSA 1ZIPA 1V8PA 3IHTA 1SPBS 5ALUA 2XJ4A 3EXHB 2XCIA 2J0QA 2JGRA 2QAIA 1JIUA 3R5SA 3GDFA 3ITNA 1CUBA 4IYJA 2ZKLA 4IQGA 4QTXA 5JH7B 4HVAA 4YCJA 1WCV1 2E5FA 1FQOA 1JIVA