2FSRA

Crystal structure of the acetyltransferase from agrobacterium tumefaciens str. c58
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
177
structure length
171
Chain Sequence
GRENLYFSIPTLRTERLTLRPLAMADFPAYRDFMASPRSTGVGGPYDLPSTWGVFCHDLANWHFFGHGALMIDLGETGECIGQIGINHGPLFPEKELGWLLYEGHEGRGYAAEAAVALRDWAFETLNLPTLVSYVSPQNRKSAAVAERIGGTLDPLAPRSDPEDLVYRYHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase
publication title Crystal Structure of the Acetyltransferase from Agrobacterium tumefaciens str. C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transferase
total genus 44
structure length 171
sequence length 177
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fsrA00
1YREA 1P4NA 1MJ9A 3ZJ0A 4Y49C 4F0YA 3I3GA 4XPDB 5C88A 2J8NA 3F8KA 4NXYA 5F48A 4HNYB 3FNCA 2QECA 3EC4A 3DR8A 3MGDA 2ZXVA 2AE6A 2P0WA 4KOSA 2B4DB 1NMTA 4HNXB 1GHEA 3IGRA 2ZW5A 3TFYA 1MJBA 4PK3A 3P2HA 1U6MA 2PR8A 2JLMA 4OADA 2BUEA 2R98A 2JDDA 1Q2YA 2B4BA 2WPXA 1CJWA 2PDOA 4II9A 1VHSA 4FD6A 1S7LA 3FXTA 3EXNA 2P6GA 1Y9WA 5F47A 2CNTA 2Z10A 3D8PA 4HKFA 2B58A 1QSOA 2Z0ZA 4IUSA 4AB7A 1LRZA 2WPWA 3WR7A 1YGHA 3E0KA 5J8CA 1YVOA 4KOWA 4QBJA 4YGOA 1QSTA 4AVAA 4NF1A 4RI1A 1K4JA 4KLWA 2PRBA 5H84A 2B3UA 4QC6A 3W6SA 4NCZA 4JXQA 3JUWA 3S6HA 1Z4RA 1Z9UA 4UWIA 4K30A 1Y9KA 4BMHA 3T9YA 4H6UA 3DR6A 2O28A 4ONUA 1IIDA 2FXFA 4E8OA 1UFHA 2GANA 1VKCA 2VBQA 1BO4A 3ZZIA 3PGPA 3S6GA 5H86A 2VZZA 2CNMA 3F0AA 4LX9A 2ATRA 1CM0A 5IV0A 4L89A 2P6FA 2Q4VA 4B5OA 4KUBA 4CAXA 4JWPA 4E0AA 1ON0A 2FS5A 1Z4EA 2VQYA 3QAHA 3R96A 3R95A 4E2AA 3OWCA 4XPDC 3PZJA 1IB1E 1FY7A 3R9GA 4YRHA 2P6EA 2PR1A 4JLYA 1WK4A 3EY5A 2FT0A 2KCWA 4KOXA 2Q04A 1M4IA 2Q0YA 1V0CA 1RO5A 3TCVA 4KVXA 1KUVA 2VZYA 1KUXA 3LD2A 4MY0A 2FE7A 1PU9A 4CRZB 3TE4A 1RXTA 4I49A 5KTCA 3DDDA 4L8AA 5IX3A 4R3KA 1QSNA 2VXKA 2REEA 3CXPA 4FD7A 4UA3A 4QVTA 1MK4A 4OLLA 4X5KA 1XF8A 3LODA 2OZHA 1XE4A 3PP9A 3DNSA 4GS4A 4MI4A 2EVNA 2X7BA 1Q2DA 1YVKA 2Q44A 2G0BA 1YLEA 2FIAA 2BSWA 3TT2A 4KOTA 3D2PA 2B5GB 3D2MA 4R57A 3V8IA 4U9ZA 2D4PA 5DWNA 4PSWA 4CS0B 4NEXA 2J8MA 2B3VA 4KOYA 3B8GA 1S60A 4KOVA 2R1IA 3D3SA 5F49A 4B5PB 1PUAA 4JD6A 4KVOE 4PK2A 3TOBA 3UY5A 3FB3A 4YFJA 5FVJA 5ISVA 4EVYA 4CAVA 4U5YA 5F46A 1NE9A 1Y7RA 2EUIA 2HV2A 4H6ZA 4KUAA 4U9YA 3EFAA 1NSLA 4XNHB 1M4DA 2K5TA 3GY9A 2CNSA 2F5IA 3TO6A 2A4NA 4FD5A 2DXQA 4FD4A 3CXQA 4MHDA 1B6BA 1J4JA 1Q2CA 4AVCA 3KKWA 3R9EA 1KUYA 4R9MA 5JPHA 2AJ6A 4IF5A 1YK3A 5I0CA 2OB0A 3FRMA 1XEBA 1IYLA 1S5KA 5DWMA 2FSRA 1I1DA 1XMTA 2QIRA 3DSBA 2G3TA 1YX0A 2RC4A 4PV6A 4AG7A 2Y0MA 4OAEA 3H4QA 3W6XA 4R3LA 4NSQA 4KVME 3BJ8A 2VI7A 3TO9A 5EBVA 3S6KA 3SXOA 3VWDA 2R7HA 4DNCA 2IL4A 1WWZA 2FCKA 2PC1A 1S7KA 4JJXA 1QSRA 4M3SA 2I00A 4XPKA 2Z11A 2HUZA 1TIQA 1BOBA 1L0CA 2BL1A 3VWEA 1YR0A 2Q7BA 3T90A 2FIWA 4CAWA 4QUSA 1SQHA 4Y49B 2ZW6A 4RS2A 4MY3A 2I79A 3RYOA 3SXNA 3G8WA 1P0HA 3IWGA 2PSWA 3EO4A 4UBRA 3BJ7A 3FYNA 3FBUA 4R87A 2JEVA 4LUAA 3GYAA 2C27A 3W91A 2VEZA 5E96A 1B87A 3NE7A 1OZPA 3S6FA 5J8FA 1M1DA 5KTAA 4KORA 1IYKA 2B4DA 1R57A 4AG9A 4J3GA 3G3SA 1N71A 2REFA 1MJAA 2OU2A 1I12A 3QB8A 2ZPAA 4PSXA 3TO7A 1M4GA 2J8RA 4KOUA 4M85A 3I9SA 2G3AA 2ZW7A 1S7NA 2R8VA 4XNHC 5IB0A 2BEIA 4ZBGA 2Q4YA 2GE3A 2H5MA 3JVNA 3F5BA 4CRYB 4KZTA 4AVBA 3P2FA 2GIVA 3C26A 5HH1A 4H89A 2OZGA 1M44A 3CXSA 1IICA 4QB9A 2QMLA 1I21A 4ORFA 2HQYA 3FIXA 3GKRA 2B5GA 5CNPA 2OH1A 2D4OA 4MBUA 4UWJA 5C82A 2JDCA 1S3ZA 3K9UA 4KLVA 1QSMA 4B5PA 2ARHA 2OZUA 4F6AA 2PQ8A 2ZW4A 3N7ZA 4XPLA 2CY2A 3TOAA 3TTHA 5HMNA 5EC4A 2NMTA 2FL4A 1KZFA 3SHPA 4MJ8A 3BLNA 3R1KA 4JXRA 1XIXA 1S7FA 3R9FA 5JQ4A 5GCNA 4HNWB 5KTDA
chains in the Genus database with same CATH superfamily
4MRIA 1YREA 1P4NA 1MJ9A 4MCSA 4Q36A 4X3RA 1NSAA 3ZJ0A 4G1PA 4Y49C 1IOFA 4F0YA 3I3GA 2VL1A 3D68A 4NGTA 4XPDB 4F9UA 4MFZA 2F7VA 2J8NA 3F8KA 4JYWA 5C88A 1IOIA 4NXYA 1Y7EA 5F48A 3B35A 4HNYB 3BXMA 2O4HA 2QECA 3FNCA 3EC4A 2PJ5A 3DR8A 2AFWA 3KI9A 4KSFA 4NGRA 3MGDA 4P4BA 5G22A 3ISZA 3MN8A 4P4FA 2ZXVA 4KS9A 2AE6A 3IU2A 2P0WA 4KOSA 2PJ7A 4UFXA 2B4DB 4MFKA 1NMTA 2DPSA 4MHYA 5LYLA 4HNXB 4IK2A 1GHEA 3IGRA 2ZW5A 3TFYA 1MJBA 4PK3A 2PJ8A 1LCPA 3KQZA 3P2HA 1U6MA 5AG4A 2PR8A 2JLMA 3D66A 4OADA 1VGYA 2XEFA 2PJ9A 2BUEA 2R98A 2JDDA 5LRJA 1Q2YA 1KWMA 2B4BA 1PCAA 2WPXA 1CJWA 2PDOA 3SJEA 3IC1A 2C6PA 3FEDA 3KHXA 4UEZA 4B12A 1VHSA 2PIZA 4II9A 3IFEA 3PB9X 4OC3A 4R7MA 1JQGA 4R76A 4FD6A 1S7LA 3FXTA 1IGBA 3EXNA 2P6GA 1Y9WA 5F47A 2CNTA 2Z10A 2ZOFA 3D8PA 2Z3KA 3NH8A 3D4UA 4HKFA 3S9MA 3IJ3A 4CYQA 2B58A 1QSOA 3RZAA 2Z0ZA 2ZEDA 4IUSA 4AB7A 1LRZA 2WPWA 1YMEA 1Z8XA 1F2OA 3WR7A 1YGHA 4NFRA 1Y0YA 3E0KA 5J8CA 2WUUA 2ODFA 4A94A 1YVOA 4Q7AA 5K8NA 1HDQA 4KOWA 4QBJA 4YGOA 1QSTA 4B11A 4A33A 3RAMA 4AVAA 3D7GA 4NF1A 4RI1A 6CPAA 1K4JA 3SJGA 4KLWA 4MMOA 2PRBA 5H84A 2B3UA 5A28A 4QC6A 5ELYA 3GUXA 3WC7A 3W6SA 4NCZA 3TX8A 2DEAA 4JXQA 2WYRA 3JUWA 4IAVA 3S6HA 1Z4RA 1Z9UA 4UWIA 4RUHA 4K30A 4EWTA 3CT9A 2QYVA 1Y9KA 2XEIA 4PXCA 3TC8A 4BMHA 3T9YA 1LOKA 4H6UA 3CPXA 4EFDA 4B13A 3DR6A 2O28A 4ONUA 1IIDA 4UFWA 2FXFA 3PB6X 4ZGYB 4E8OA 1UFHA 1R43A 4X2TA 4R8FA 5THWA 2GANA 5J1QA 1GYTA 3I1UA 3IWEA 1VKCA 2PJ0A 2VBQA 4OC4A 4UFVA 1BO4A 3ZZIA 4A31A 2EK8A 3PGPA 4DYOA 5CBMA 3S6GA 5H86A 2PJAA 1XMBA 2VZZA 4PXEA 2Z3LA 2CNMA 2EWBA 3JTKA 5HXDA 3F0AA 3N5FA 4LX9A 2ATRA 1CM0A 3FJUA 4L89A 5AG7A 5IV0A 2P6FA 2Q4VA 4B5OA 3BI0A 4KUBA 4CAXA 4OMEA 2V8VA 2PVWA 4JWPA 4CGLA 4KSIA 4B6ZA 5A27A 4E0AA 1ON0A 2FS5A 4UIAA 1Z4EA 5I4MA 2XEGA 5LRGA 2VQYA 2EBJA 2JBJA 3QAHA 4PPZA 3R96A 3R95A 3GLJA 4MHPA 4E2AA 1DE4C 4A38A 3OWCA 3JRUA 2FVGA 4M6IA 4XPDC 3PZJA 2C6CA 4EMEA 1TKHA 3H5ZA 3VARA 1IB1E 1FY7A 3R9GA 4YRHA 2P6EA 2PR1A 1IY7A 4JLYA 1WK4A 4WWVA 4C7IA 2DF5A 2FT0A 1TXRA 3EY5A 4OC2A 4TWEA 5CPAA 3KGQA 2YNDA 2KCWA 2CF4A 3DLJA 4KOXA 1Y0RA 4MCPA 3KASA 2Q04A 4A30A 4NGQA 1M4IA 1TKFA 2Q0YA 1V0CA 4P4EA 5HVGA 3D7HA 3GIUA 1DTDA 4CGMA 1RO5A 3SJXA 4OC5A 4FBEA 1Z8LA 3TCVA 2JEWA 4LQ6A 4MHNA 1ELMP 4BD9A 2J9AA 4KVXA 1KUVA 2VZYA 1KUXA 5AGEA 1ARLA 2PVVA 2BOAA 2YGWA 3LD2A 4MY0A 2AFXA 2FE7A 1PU9A 4AXVA 1EE3P 4CRZB 3TE4A 1Z2LA 1RXTA 1YW4A 4I49A 3CPAA 4UIBA 5KTCA 3DDDA 4L8AA 4P4IA 5IX3A 4Q38A 1QSNA 4R3KA 2VXKA 3RO0A 2HB6A 2REEA 4HPSA 3FF3A 2JBKA 2CXAA 1HEEA 1VHOA 3B3TA 4KSAA 4MFJA 2ANPA 3CXPA 4FD7A 4OKOA 4UA3A 4CYOA 4QVTA 1MK4A 2Z3PA 4OLLA 4X5KA 1XF8A 3LMSA 5G21A 4ZY0A 2C1CA 3LODA 4NJQA 5EMIA 1VHEA 2OZHA 4RN7A 2OOTA 1XE4A 3PP9A 3DNSA 4GS4A 4MI4A 2EVNA 1XOVA 2X7BA 2PIYA 2Q7SA 1Q2DA 1YVKA 2Q44A 1YSJA 1YLEA 2G0BA 2FIAA 2HC9A 2BO9A 2ZELA 2BSWA 3FH4A 2GU2A 3TT2A 4KOTA 3D2PA 2B5GB 3D2MA 5G20A 4NGMA 3KR4A 4R57A 1F2PA 1ZG8A 3V8IA 3NA6A 3K9TA 3PFOA 4U9ZA 3DGVA 5IB9A 2D4PA 2QJ8A 4PSWA 5DWNA 2V8GA 4CS0B 1TF8A 4NEXA 2J8MA 2B3VA 4KOYA 3B8GA 4B10A 1S60A 2AFZA 4KOVA 2R1IA 4PXBA 5K8PA 3D3SA 4GM5A 3H8EA 5K8MA 3H8FA 5F49A 4B5PB 1PUAA 1XBUA 4B14A 2V8DA 1CBXA 4YU9A 4BBHA 4F8ZA 1YLOA 1QMUA 4JD6A 4KVOE 4PK2A 4W9YA 2IJZA 3TOBA 2PJ6A 3UY5A 3FB3A 3PB8X 2ZEHA 1CPSA 5FVJA 1ZLIA 3QNVA 4ZX9A 4EVYA 4YFJA 5ISVA 1RTQA 3PRTA 4CAVA 3IIBA 3B3SA 4U5YA 4C2YA 5F46A 4A95A 2PJBA 3KR5A 1NE9A 2PJ2A 2IMOA 5AG6A 2PJCA 2C6GA 5HVHA 1Y7RA 2EUIA 2Q4ZA 2HV2A 4H6ZA 3WC5A 4ZX8A 2CIJA 4DUKA 3D7FA 4KUAA 2NSMA 4U9YA 1AUGA 1FNOA 3EFAA 5D29A 2Z3MA 1NSLA 2BCOA 4A37A 4XNHB 1M4DA 2K5TA 3GY9A 2NYQA 4C68A 2CNSA 3NH4A 1X12A 2I3CA 2F5IA 2ZEGA 3IO1A 4UEEA 3TO6A 2A4NA 4FD5A 4CGOA 4DJLA 2DXQA 4FD4A 3CXQA 4MHDA 5LRKA 1B6BA 1R3NA 1J4JA 4OP4A 1Q2CA 4AVCA 3KKWA 3R9EA 3PEIA 5D8NA 2Q51A 1KUYA 4FUUA 4R9MA 4BINA 5JPHA 1ZG9A 2AJ6A 4IF5A 3RBUA 1YK3A 4P4JA 3FVLA 3A9LA 4UEFA 5I0CA 2OB0A 3FRMA 4M6HA 1XEBA 1IYLA 4F0XA 3D67A 1Z5RA 4Z65A 3V38A 4MCRA 1S5KA 3SI2A 5DWMA 2FSRA 1I1DA 1FT7A 2YNEA 2AFOA 1XMTA 2QIRA 3DSBA 3QAYA 4CAEA 2G3TA 3LACA 4CGPA 1YX0A 1YW6A 2RC4A 1IU8A 4ZI6A 4OIDA 4PV6A 1BAVA 4AG7A 2AFSA 2Y0MA 4OAEA 4TNUA 3H4QA 4R6TA 3L2NA 3W6XA 3HLPA 4NGSA 4R3LA 4NSQA 1LAPA 3IWWA 4KVME 4NGPA 4OC1A 7CPAA 1F57A 3BJ8A 3KQXA 5F09A 3B7IA 2WSAA 2VI7A 3TO9A 1LANA 4X8IA 5EBVA 1BPMA 3S6KA 3SXOA 3VWDA 2R7HA 3CDXA 4DNCA 2IL4A 2EO8A 1WWZA 2FCKA 3KHZA 2PC1A 4LQGA 4CYNA 1S7KA 4JJXA 4P44A 5G1ZA 4CAFA 1QSRA 2POKA 4P4DA 4M3SA 2I00A 4XPKA 4C2XA 2Z11A 1UWYA 1TIQA 2HUZA 3PB4X 4CPAA 1BOBA 1L0CA 2BL1A 2GLFA 5K8OA 2ZENA 3FX6A 4P10A 3VWEA 1LAMA 1YR0A 2ZOGA 2Q7BA 3T90A 2Z3OA 2GLJA 2FIWA 2XEJA 3IEHA 1AYEA 3D7DA 4PXDA 4CAWA 4QUSA 1X10A 5DS0A 5LYIA 1XFOA 1SQHA 1ELLP 4NJRA 4Y49B 2ZW6A 4P6YA 4RS2A 4MY3A 2I79A 1XJOA 1ZO0A 3RYOA 2PCUA 3WC6A 3SXNA 3G8WA 1P0HA 1AMPA 3HUVA 2PSWA 3IWGA 3EO4A 3PBEA 3PBBA 4UBRA 3NH5A 4UCNA 3GB0A 5LYFA 4UCMA 1ZG7A 3BJ7A 3H8GA 1CP7A 3FYNA 1A2ZA 3FBUA 3KL9A 4R87A 4A32A 4IHMA 2JEVA 4LUAA 3GYAA 1ARMA 2C27A 3W91A 2VEZA 4FAIA 5E96A 1B87A 3S9LA 1CX8A 3NE7A 3B3CA 1OZPA 3S6FA 2GFQA 1CP6A 2QVPA 4MHZA 3SI0A 1JWQA 4H2KA 3WABA 5JGFA 2ZEMA 3PB7X 5J8FA 1TF9A 1M1DA 2YNCC 3FMCA 5KTAA 4KORA 1IYKA 1LFWA 4UCPA 1H8LA 4NGNA 1BPNA 3B3VA 3NE8A 4P45A 4FWUA 5AG5A 3SI1A 4A2ZA 2B4DA 3ISXA 1R57A 2IQ6A 4AG9A 1YQEA 4J3GA 1PYTB 4ZY1A 1HDUA 1N71A 2REFA 1MJAA 2OU2A 1I12A 1QQ9A 3B3WA 3G3SA 3QB8A 4O23A 3T8WA 4WJBA 2ZPAA 4PSXA 3TO7A 2PE3A 3BHXA 3PFEA 1M4GA 2J8RA 4KOUA 3NFZA 4M85A 3I9SA 2G3AA 4MFLA 4OIWA 2ZW7A 1S7NA 2R8VA 4XNHC 5IB0A 5JM6A 3SJFA 2BEIA 4ZBGA 2Q4YA 1CPXA 2GE3A 2H5MA 2Q43A 3F5BA 3JVNA 4CRYB 4F9VA 4MFQA 2Z3NA 4KZTA 4AVBA 3P2FA 2GIVA 3C26A 3K2KA 5HH1A 2ABZA 4H89A 4UF4A 2OZGA 1M44A 1OBRA 1IICA 3CXSA 3IU1A 2PJ1A 4A39A 2O53A 4QB9A 2QMLA 2AFUA 1XRYA 1I21A 1Q7LA 2HQYA 3FIXA 3GKRA 1TKJA 3MRUA 4ORFA 4ONWA 3FECA 4ZY2A 2B5GA 8CPAA 3KZWA 2RFHA 2V8HA 4C2ZA 5CNPA 2OH1A 2ZEOA 2D4OA 4OC0A 2AFMA 3LWUA 4MBUA 4UWJA 5C82A 2JDCA 3B2YA 2DPTA 1S3ZA 4YWYA 2PRQA 3K9UA 5BWAB 4KLVA 2ZEPA 3S9NA 1QSMA 2V77A 5LYDA 4MCQA 3V7ZA 4B5PA 2ARHA 4K3NA 4MXUA 4CGNA 2OZUA 2OR4A 4F6AA 1BLLE 4PQAA 2PQ8A 2ZEEA 3RNZA 2WZNA 3VATA 2G9DA 2ZW4A 3N7ZA 4ZYQA 4XPLA 2CY2A 2PJ4A 3TOAA 3TTHA 5HMNA 5EC4A 1Z8TA 2NMTA 4M6GA 3FEEA 3BI1A 1ZLHA 2FL4A 2YNCA 1KZFA 3SHPA 2RB7A 2F8HA 3BLNA 3R1KA 1Z8WA 4MJ8A 4JXRA 3VH9A 3WT4A 1M4LA 1XIXA 4JZ0A 4MFPA 2EK9A 1VIXA 2CTCA 2CTBA 1S7FA 4CYPA 2GREA 3R9FA 4GXHA 3CZXA 5JQ4A 5GCNA 5HVFA 2ZEFA 4HNWB 1CG2A 4C7HA 2PJ3A 5KTDA 5JH9A
chains in the Genus database with same CATH topology
1YREA 1P4NA 1MJ9A 4Q36A 3ZJ0A 4Y49C 4F0YA 3I3GA 4XPDB 4MFZA 2J8NA 3F8KA 5C88A 4NXYA 5F48A 4HNYB 3FNCA 2QECA 3EC4A 3DR8A 4KSFA 3MGDA 5G22A 2ZXVA 4KS9A 2AE6A 3IU2A 2P0WA 4KOSA 4UFXA 2B4DB 4MFKA 1NMTA 2DPSA 4HNXB 1GHEA 3IGRA 2ZW5A 3TFYA 1MJBA 4PK3A 3P2HA 1U6MA 5AG4A 2PR8A 2JLMA 4OADA 2BUEA 2R98A 2JDDA 1Q2YA 2B4BA 2WPXA 1CJWA 2PDOA 4B12A 4II9A 1VHSA 4FD6A 1S7LA 3FXTA 3EXNA 2P6GA 1Y9WA 5F47A 2CNTA 2Z10A 3D8PA 2Z3KA 4HKFA 4CYQA 2B58A 1QSOA 2Z0ZA 4IUSA 4AB7A 1LRZA 2WPWA 3WR7A 1YGHA 3E0KA 5J8CA 2WUUA 1YVOA 4KOWA 4QBJA 4YGOA 1QSTA 4B11A 4A33A 4AVAA 4NF1A 4RI1A 1K4JA 4KLWA 2PRBA 5H84A 2B3UA 5A28A 4QC6A 3W6SA 4NCZA 4JXQA 3JUWA 3S6HA 1Z4RA 1Z9UA 4UWIA 4K30A 1Y9KA 4BMHA 3T9YA 4H6UA 4B13A 3DR6A 2O28A 4ONUA 1IIDA 4UFWA 2FXFA 4ZGYB 4E8OA 1UFHA 2GANA 3IWEA 1VKCA 2VBQA 4UFVA 1BO4A 3ZZIA 4A31A 3PGPA 3S6GA 5H86A 2VZZA 2Z3LA 2CNMA 3JTKA 3F0AA 4LX9A 2ATRA 1CM0A 5AG7A 4L89A 5IV0A 2P6FA 2Q4VA 4B5OA 4KUBA 4CAXA 4JWPA 4CGLA 5A27A 4E0AA 1ON0A 2FS5A 1Z4EA 2VQYA 3QAHA 3R96A 3R95A 4E2AA 3OWCA 4XPDC 3PZJA 3H5ZA 1IB1E 1FY7A 3R9GA 4YRHA 2P6EA 2PR1A 4JLYA 1WK4A 4C7IA 3EY5A 2FT0A 2YNDA 2KCWA 4KOXA 2Q04A 4A30A 1M4IA 2Q0YA 1V0CA 4CGMA 1RO5A 3TCVA 4KVXA 1KUVA 2VZYA 1KUXA 5AGEA 3LD2A 2YGWA 4MY0A 2FE7A 1PU9A 4CRZB 3TE4A 1RXTA 4I49A 5KTCA 3DDDA 4L8AA 5IX3A 4Q38A 1QSNA 4R3KA 2VXKA 2REEA 2CXAA 4KSAA 4MFJA 3CXPA 4FD7A 4UA3A 4CYOA 4QVTA 1MK4A 2Z3PA 4OLLA 4X5KA 1XF8A 5G21A 3LODA 2OZHA 1XE4A 3PP9A 3DNSA 4GS4A 4MI4A 2EVNA 2X7BA 1Q2DA 1YVKA 2Q44A 2G0BA 1YLEA 2FIAA 2BSWA 3TT2A 4KOTA 3D2PA 2B5GB 3D2MA 5G20A 4R57A 3V8IA 4U9ZA 2D4PA 5DWNA 4PSWA 4CS0B 4NEXA 2J8MA 2B3VA 4KOYA 3B8GA 4B10A 1S60A 4KOVA 2R1IA 3D3SA 5F49A 4B5PB 1PUAA 4B14A 4BBHA 4JD6A 4KVOE 4PK2A 3TOBA 3UY5A 3FB3A 4YFJA 5FVJA 5ISVA 4EVYA 4CAVA 4U5YA 4C2YA 5F46A 4A95A 1NE9A 5AG6A 1Y7RA 2EUIA 2HV2A 4H6ZA 4KUAA 4U9YA 3EFAA 2Z3MA 1NSLA 4XNHB 1M4DA 2K5TA 3GY9A 4C68A 2CNSA 2F5IA 3TO6A 2A4NA 4FD5A 4CGOA 2DXQA 4FD4A 3CXQA 4MHDA 1B6BA 1J4JA 1Q2CA 4AVCA 3KKWA 3R9EA 1KUYA 4R9MA 5JPHA 2AJ6A 4IF5A 1YK3A 5I0CA 3A9LA 2OB0A 3FRMA 1XEBA 1IYLA 4F0XA 1S5KA 5DWMA 2FSRA 1I1DA 2YNEA 1XMTA 2QIRA 3DSBA 4CAEA 2G3TA 4CGPA 1YX0A 2RC4A 4PV6A 4AG7A 2Y0MA 4OAEA 3H4QA 3W6XA 4R3LA 4NSQA 4KVME 3BJ8A 2WSAA 2VI7A 3TO9A 5EBVA 3S6KA 3SXOA 3VWDA 2R7HA 4DNCA 2IL4A 1WWZA 2FCKA 2PC1A 4CYNA 1S7KA 4JJXA 5G1ZA 4CAFA 1QSRA 4M3SA 2I00A 4XPKA 4C2XA 2Z11A 2HUZA 1TIQA 1BOBA 1L0CA 2BL1A 3VWEA 1YR0A 2Q7BA 3T90A 2Z3OA 2FIWA 4CAWA 4QUSA 1SQHA 4Y49B 2ZW6A 4RS2A 4MY3A 2I79A 1ZO0A 3RYOA 3SXNA 3G8WA 1P0HA 3IWGA 2PSWA 3EO4A 4UBRA 4UCNA 4UCMA 3BJ7A 3FYNA 3FBUA 4R87A 4A32A 2JEVA 4LUAA 3GYAA 2C27A 3W91A 2VEZA 5E96A 1B87A 3NE7A 1OZPA 3S6FA 5J8FA 1M1DA 2YNCC 5KTAA 4KORA 1IYKA 4UCPA 5AG5A 4A2ZA 2B4DA 1R57A 4AG9A 4J3GA 3G3SA 1N71A 2REFA 1MJAA 2OU2A 1I12A 3QB8A 2ZPAA 4PSXA 3TO7A 1M4GA 2J8RA 4KOUA 4M85A 4MFLA 3I9SA 2G3AA 2ZW7A 1S7NA 2R8VA 4XNHC 5IB0A 2BEIA 4ZBGA 2Q4YA 2GE3A 2H5MA 3JVNA 3F5BA 4CRYB 4MFQA 2Z3NA 4KZTA 4AVBA 3P2FA 2GIVA 3C26A 5HH1A 4H89A 3IU1A 2OZGA 1M44A 3CXSA 1IICA 4QB9A 2QMLA 1I21A 4ORFA 2HQYA 3FIXA 3GKRA 2B5GA 4C2ZA 5CNPA 2OH1A 2D4OA 4MBUA 4UWJA 5C82A 2JDCA 2DPTA 1S3ZA 3K9UA 5BWAB 4KLVA 1QSMA 4B5PA 2ARHA 4CGNA 2OZUA 4F6AA 2PQ8A 2ZW4A 3N7ZA 4XPLA 2CY2A 3TOAA 3TTHA 5HMNA 5EC4A 2NMTA 2FL4A 2YNCA 1KZFA 3SHPA 4MJ8A 3BLNA 3R1KA 4JXRA 1XIXA 4MFPA 1S7FA 4CYPA 3R9FA 5JQ4A 5GCNA 4HNWB 4C7HA 5KTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRE A;  1P4N A;  1MJ9 A;  3ZJ0 A;  4Y49 C;  4F0Y A;  3I3G A;  4XPD B;  5C88 A;  2J8N A;  3F8K A;  4NXY A;  5F48 A;  4HNY B;  3FNC A;  2QEC A;  3EC4 A;  3DR8 A;  3MGD A;  2ZXV A;  2AE6 A;  2P0W A;  4KOS A;  2B4D B;  1NMT A;  4HNX B;  1GHE A;  3IGR A;  2ZW5 A;  3TFY A;  1MJB A;  4PK3 A;  3P2H A;  1U6M A;  2PR8 A;  2JLM A;  4OAD A;  2BUE A;  2R98 A;  2JDD A;  1Q2Y A;  2B4B A;  2WPX A;  1CJW A;  2PDO A;  4II9 A;  1VHS A;  4FD6 A;  1S7L A;  3FXT A;  3EXN A;  2P6G A;  1Y9W A;  5F47 A;  2CNT A;  2Z10 A;  3D8P A;  4HKF A;  2B58 A;  1QSO A;  2Z0Z A;  4IUS A;  4AB7 A;  1LRZ A;  2WPW A;  3WR7 A;  1YGH A;  3E0K A;  5J8C A;  1YVO A;  4KOW A;  4QBJ A;  4YGO A;  1QST A;  4AVA A;  4NF1 A;  4RI1 A;  1K4J A;  4KLW A;  2PRB A;  5H84 A;  2B3U A;  4QC6 A;  3W6S A;  4NCZ A;  4JXQ A;  3JUW A;  3S6H A;  1Z4R A;  1Z9U A;  4UWI A;  4K30 A;  1Y9K A;  4BMH A;  3T9Y A;  4H6U A;  3DR6 A;  2O28 A;  4ONU A;  1IID A;  2FXF A;  4E8O A;  1UFH A;  2GAN A;  1VKC A;  2VBQ A;  1BO4 A;  3ZZI A;  3PGP A;  3S6G A;  5H86 A;  2VZZ A;  2CNM A;  3F0A A;  4LX9 A;  2ATR A;  1CM0 A;  5IV0 A;  4L89 A;  2P6F A;  2Q4V A;  4B5O A;  4KUB A;  4CAX A;  4JWP A;  4E0A A;  1ON0 A;  2FS5 A;  1Z4E A;  2VQY A;  3QAH A;  3R96 A;  3R95 A;  4E2A A;  3OWC A;  4XPD C;  3PZJ A;  1IB1 E;  1FY7 A;  3R9G A;  4YRH A;  2P6E A;  2PR1 A;  4JLY A;  1WK4 A;  3EY5 A;  2FT0 A;  2KCW A;  4KOX A;  2Q04 A;  1M4I A;  2Q0Y A;  1V0C A;  1RO5 A;  3TCV A;  4KVX A;  1KUV A;  2VZY A;  1KUX A;  3LD2 A;  4MY0 A;  2FE7 A;  1PU9 A;  4CRZ B;  3TE4 A;  1RXT A;  4I49 A;  5KTC A;  3DDD A;  4L8A A;  5IX3 A;  4R3K A;  1QSN A;  2VXK A;  2REE A;  3CXP A;  4FD7 A;  4UA3 A;  4QVT A;  1MK4 A;  4OLL A;  4X5K A;  1XF8 A;  3LOD A;  2OZH A;  1XE4 A;  3PP9 A;  3DNS A;  4GS4 A;  4MI4 A;  2EVN A;  2X7B A;  1Q2D A;  1YVK A;  2Q44 A;  2G0B A;  1YLE A;  2FIA A;  2BSW A;  3TT2 A;  4KOT A;  3D2P A;  2B5G B;  3D2M A;  4R57 A;  3V8I A;  4U9Z A;  2D4P A;  5DWN A;  4PSW A;  4CS0 B;  4NEX A;  2J8M A;  2B3V A;  4KOY A;  3B8G A;  1S60 A;  4KOV A;  2R1I A;  3D3S A;  5F49 A;  4B5P B;  1PUA A;  4JD6 A;  4KVO E;  4PK2 A;  3TOB A;  3UY5 A;  3FB3 A;  4YFJ A;  5FVJ A;  5ISV A;  4EVY A;  4CAV A;  4U5Y A;  5F46 A;  1NE9 A;  1Y7R A;  2EUI A;  2HV2 A;  4H6Z A;  4KUA A;  4U9Y A;  3EFA A;  1NSL A;  4XNH B;  1M4D A;  2K5T A;  3GY9 A;  2CNS A;  2F5I A;  3TO6 A;  2A4N A;  4FD5 A;  2DXQ A;  4FD4 A;  3CXQ A;  4MHD A;  1B6B A;  1J4J A;  1Q2C A;  4AVC A;  3KKW A;  3R9E A;  1KUY A;  4R9M A;  5JPH A;  2AJ6 A;  4IF5 A;  1YK3 A;  5I0C A;  2OB0 A;  3FRM A;  1XEB A;  1IYL A;  1S5K A;  5DWM A;  2FSR A;  1I1D A;  1XMT A;  2QIR A;  3DSB A;  2G3T A;  1YX0 A;  2RC4 A;  4PV6 A;  4AG7 A;  2Y0M A;  4OAE A;  3H4Q A;  3W6X A;  4R3L A;  4NSQ A;  4KVM E;  3BJ8 A;  2VI7 A;  3TO9 A;  5EBV A;  3S6K A;  3SXO A;  3VWD A;  2R7H A;  4DNC A;  2IL4 A;  1WWZ A;  2FCK A;  2PC1 A;  1S7K A;  4JJX A;  1QSR A;  4M3S A;  2I00 A;  4XPK A;  2Z11 A;  2HUZ A;  1TIQ A;  1BOB A;  1L0C A;  2BL1 A;  3VWE A;  1YR0 A;  2Q7B A;  3T90 A;  2FIW A;  4CAW A;  4QUS A;  1SQH A;  4Y49 B;  2ZW6 A;  4RS2 A;  4MY3 A;  2I79 A;  3RYO A;  3SXN A;  3G8W A;  1P0H A;  3IWG A;  2PSW A;  3EO4 A;  4UBR A;  3BJ7 A;  3FYN A;  3FBU A;  4R87 A;  2JEV A;  4LUA A;  3GYA A;  2C27 A;  3W91 A;  2VEZ A;  5E96 A;  1B87 A;  3NE7 A;  1OZP A;  3S6F A;  5J8F A;  1M1D A;  5KTA A;  4KOR A;  1IYK A;  2B4D A;  1R57 A;  4AG9 A;  4J3G A;  3G3S A;  1N71 A;  2REF A;  1MJA A;  2OU2 A;  1I12 A;  3QB8 A;  2ZPA A;  4PSX A;  3TO7 A;  1M4G A;  2J8R A;  4KOU A;  4M85 A;  3I9S A;  2G3A A;  2ZW7 A;  1S7N A;  2R8V A;  4XNH C;  5IB0 A;  2BEI A;  4ZBG A;  2Q4Y A;  2GE3 A;  2H5M A;  3JVN A;  3F5B A;  4CRY B;  4KZT A;  4AVB A;  3P2F A;  2GIV A;  3C26 A;  5HH1 A;  4H89 A;  2OZG A;  1M44 A;  3CXS A;  1IIC A;  4QB9 A;  2QML A;  1I21 A;  4ORF A;  2HQY A;  3FIX A;  3GKR A;  2B5G A;  5CNP A;  2OH1 A;  2D4O A;  4MBU A;  4UWJ A;  5C82 A;  2JDC A;  1S3Z A;  3K9U A;  4KLV A;  1QSM A;  4B5P A;  2ARH A;  2OZU A;  4F6A A;  2PQ8 A;  2ZW4 A;  3N7Z A;  4XPL A;  2CY2 A;  3TOA A;  3TTH A;  5HMN A;  5EC4 A;  2NMT A;  2FL4 A;  1KZF A;  3SHP A;  4MJ8 A;  3BLN A;  3R1K A;  4JXR A;  1XIX A;  1S7F A;  3R9F A;  5JQ4 A;  5GCN A;  4HNW B;  5KTD A; 
#chains in the Genus database with same CATH topology
 4MRI A;  1YRE A;  1P4N A;  1MJ9 A;  4MCS A;  4Q36 A;  4X3R A;  1NSA A;  3ZJ0 A;  4G1P A;  4Y49 C;  1IOF A;  4F0Y A;  3I3G A;  2VL1 A;  3D68 A;  4NGT A;  4XPD B;  4F9U A;  4MFZ A;  2F7V A;  2J8N A;  3F8K A;  4JYW A;  5C88 A;  1IOI A;  4NXY A;  1Y7E A;  5F48 A;  3B35 A;  4HNY B;  3BXM A;  2O4H A;  2QEC A;  3FNC A;  3EC4 A;  2PJ5 A;  3DR8 A;  2AFW A;  3KI9 A;  4KSF A;  4NGR A;  3MGD A;  4P4B A;  5G22 A;  3ISZ A;  3MN8 A;  4P4F A;  2ZXV A;  4KS9 A;  2AE6 A;  3IU2 A;  2P0W A;  4KOS A;  2PJ7 A;  4UFX A;  2B4D B;  4MFK A;  1NMT A;  2DPS A;  4MHY A;  5LYL A;  4HNX B;  4IK2 A;  1GHE A;  3IGR A;  2ZW5 A;  3TFY A;  1MJB A;  4PK3 A;  2PJ8 A;  1LCP A;  3KQZ A;  3P2H A;  1U6M A;  5AG4 A;  2PR8 A;  2JLM A;  3D66 A;  4OAD A;  1VGY A;  2XEF A;  2PJ9 A;  2BUE A;  2R98 A;  2JDD A;  5LRJ A;  1Q2Y A;  1KWM A;  2B4B A;  1PCA A;  2WPX A;  1CJW A;  2PDO A;  3SJE A;  3IC1 A;  2C6P A;  3FED A;  3KHX A;  4UEZ A;  4B12 A;  1VHS A;  2PIZ A;  4II9 A;  3IFE A;  3PB9 X;  4OC3 A;  4R7M A;  1JQG A;  4R76 A;  4FD6 A;  1S7L A;  3FXT A;  1IGB A;  3EXN A;  2P6G A;  1Y9W A;  5F47 A;  2CNT A;  2Z10 A;  2ZOF A;  3D8P A;  2Z3K A;  3NH8 A;  3D4U A;  4HKF A;  3S9M A;  3IJ3 A;  4CYQ A;  2B58 A;  1QSO A;  3RZA A;  2Z0Z A;  2ZED A;  4IUS A;  4AB7 A;  1LRZ A;  2WPW A;  1YME A;  1Z8X A;  1F2O A;  3WR7 A;  1YGH A;  4NFR A;  1Y0Y A;  3E0K A;  5J8C A;  2WUU A;  2ODF A;  4A94 A;  1YVO A;  4Q7A A;  5K8N A;  1HDQ A;  4KOW A;  4QBJ A;  4YGO A;  1QST A;  4B11 A;  4A33 A;  3RAM A;  4AVA A;  3D7G A;  4NF1 A;  4RI1 A;  6CPA A;  1K4J A;  3SJG A;  4KLW A;  4MMO A;  2PRB A;  5H84 A;  2B3U A;  5A28 A;  4QC6 A;  5ELY A;  3GUX A;  3WC7 A;  3W6S A;  4NCZ A;  3TX8 A;  2DEA A;  4JXQ A;  2WYR A;  3JUW A;  4IAV A;  3S6H A;  1Z4R A;  1Z9U A;  4UWI A;  4RUH A;  4K30 A;  4EWT A;  3CT9 A;  2QYV A;  1Y9K A;  2XEI A;  4PXC A;  3TC8 A;  4BMH A;  3T9Y A;  1LOK A;  4H6U A;  3CPX A;  4EFD A;  4B13 A;  3DR6 A;  2O28 A;  4ONU A;  1IID A;  4UFW A;  2FXF A;  3PB6 X;  4ZGY B;  4E8O A;  1UFH A;  1R43 A;  4X2T A;  4R8F A;  5THW A;  2GAN A;  5J1Q A;  1GYT A;  3I1U A;  3IWE A;  1VKC A;  2PJ0 A;  2VBQ A;  4OC4 A;  4UFV A;  1BO4 A;  3ZZI A;  4A31 A;  2EK8 A;  3PGP A;  4DYO A;  5CBM A;  3S6G A;  5H86 A;  2PJA A;  1XMB A;  2VZZ A;  4PXE A;  2Z3L A;  2CNM A;  2EWB A;  3JTK A;  5HXD A;  3F0A A;  3N5F A;  4LX9 A;  2ATR A;  1CM0 A;  3FJU A;  4L89 A;  5AG7 A;  5IV0 A;  2P6F A;  2Q4V A;  4B5O A;  3BI0 A;  4KUB A;  4CAX A;  4OME A;  2V8V A;  2PVW A;  4JWP A;  4CGL A;  4KSI A;  4B6Z A;  5A27 A;  4E0A A;  1ON0 A;  2FS5 A;  4UIA A;  1Z4E A;  5I4M A;  2XEG A;  5LRG A;  2VQY A;  2EBJ A;  2JBJ A;  3QAH A;  4PPZ A;  3R96 A;  3R95 A;  3GLJ A;  4MHP A;  4E2A A;  1DE4 C;  4A38 A;  3OWC A;  3JRU A;  2FVG A;  4M6I A;  4XPD C;  3PZJ A;  2C6C A;  4EME A;  1TKH A;  3H5Z A;  3VAR A;  1IB1 E;  1FY7 A;  3R9G A;  4YRH A;  2P6E A;  2PR1 A;  1IY7 A;  4JLY A;  1WK4 A;  4WWV A;  4C7I A;  2DF5 A;  2FT0 A;  1TXR A;  3EY5 A;  4OC2 A;  4TWE A;  5CPA A;  3KGQ A;  2YND A;  2KCW A;  2CF4 A;  3DLJ A;  4KOX A;  1Y0R A;  4MCP A;  3KAS A;  2Q04 A;  4A30 A;  4NGQ A;  1M4I A;  1TKF A;  2Q0Y A;  1V0C A;  4P4E A;  5HVG A;  3D7H A;  3GIU A;  1DTD A;  4CGM A;  1RO5 A;  3SJX A;  4OC5 A;  4FBE A;  1Z8L A;  3TCV A;  2JEW A;  4LQ6 A;  4MHN A;  1ELM P;  4BD9 A;  2J9A A;  4KVX A;  1KUV A;  2VZY A;  1KUX A;  5AGE A;  1ARL A;  2PVV A;  2BOA A;  2YGW A;  3LD2 A;  4MY0 A;  2AFX A;  2FE7 A;  1PU9 A;  4AXV A;  1EE3 P;  4CRZ B;  3TE4 A;  1Z2L A;  1RXT A;  1YW4 A;  4I49 A;  3CPA A;  4UIB A;  5KTC A;  3DDD A;  4L8A A;  4P4I A;  5IX3 A;  4Q38 A;  1QSN A;  4R3K A;  2VXK A;  3RO0 A;  2HB6 A;  2REE A;  4HPS A;  3FF3 A;  2JBK A;  2CXA A;  1HEE A;  1VHO A;  3B3T A;  4KSA A;  4MFJ A;  2ANP A;  3CXP A;  4FD7 A;  4OKO A;  4UA3 A;  4CYO A;  4QVT A;  1MK4 A;  2Z3P A;  4OLL A;  4X5K A;  1XF8 A;  3LMS A;  5G21 A;  4ZY0 A;  2C1C A;  3LOD A;  4NJQ A;  5EMI A;  1VHE A;  2OZH A;  4RN7 A;  2OOT A;  1XE4 A;  3PP9 A;  3DNS A;  4GS4 A;  4MI4 A;  2EVN A;  1XOV A;  2X7B A;  2PIY A;  2Q7S A;  1Q2D A;  1YVK A;  2Q44 A;  1YSJ A;  1YLE A;  2G0B A;  2FIA A;  2HC9 A;  2BO9 A;  2ZEL A;  2BSW A;  3FH4 A;  2GU2 A;  3TT2 A;  4KOT A;  3D2P A;  2B5G B;  3D2M A;  5G20 A;  4NGM A;  3KR4 A;  4R57 A;  1F2P A;  1ZG8 A;  3V8I A;  3NA6 A;  3K9T A;  3PFO A;  4U9Z A;  3DGV A;  5IB9 A;  2D4P A;  2QJ8 A;  4PSW A;  5DWN A;  2V8G A;  4CS0 B;  1TF8 A;  4NEX A;  2J8M A;  2B3V A;  4KOY A;  3B8G A;  4B10 A;  1S60 A;  2AFZ A;  4KOV A;  2R1I A;  4PXB A;  5K8P A;  3D3S A;  4GM5 A;  3H8E A;  5K8M A;  3H8F A;  5F49 A;  4B5P B;  1PUA A;  1XBU A;  4B14 A;  2V8D A;  1CBX A;  4YU9 A;  4BBH A;  4F8Z A;  1YLO A;  1QMU A;  4JD6 A;  4KVO E;  4PK2 A;  4W9Y A;  2IJZ A;  3TOB A;  2PJ6 A;  3UY5 A;  3FB3 A;  3PB8 X;  2ZEH A;  1CPS A;  5FVJ A;  1ZLI A;  3QNV A;  4ZX9 A;  4EVY A;  4YFJ A;  5ISV A;  1RTQ A;  3PRT A;  4CAV A;  3IIB A;  3B3S A;  4U5Y A;  4C2Y A;  5F46 A;  4A95 A;  2PJB A;  3KR5 A;  1NE9 A;  2PJ2 A;  2IMO A;  5AG6 A;  2PJC A;  2C6G A;  5HVH A;  1Y7R A;  2EUI A;  2Q4Z A;  2HV2 A;  4H6Z A;  3WC5 A;  4ZX8 A;  2CIJ A;  4DUK A;  3D7F A;  4KUA A;  2NSM A;  4U9Y A;  1AUG A;  1FNO A;  3EFA A;  5D29 A;  2Z3M A;  1NSL A;  2BCO A;  4A37 A;  4XNH B;  1M4D A;  2K5T A;  3GY9 A;  2NYQ A;  4C68 A;  2CNS A;  3NH4 A;  1X12 A;  2I3C A;  2F5I A;  2ZEG A;  3IO1 A;  4UEE A;  3TO6 A;  2A4N A;  4FD5 A;  4CGO A;  4DJL A;  2DXQ A;  4FD4 A;  3CXQ A;  4MHD A;  5LRK A;  1B6B A;  1R3N A;  1J4J A;  4OP4 A;  1Q2C A;  4AVC A;  3KKW A;  3R9E A;  3PEI A;  5D8N A;  2Q51 A;  1KUY A;  4FUU A;  4R9M A;  4BIN A;  5JPH A;  1ZG9 A;  2AJ6 A;  4IF5 A;  3RBU A;  1YK3 A;  4P4J A;  3FVL A;  3A9L A;  4UEF A;  5I0C A;  2OB0 A;  3FRM A;  4M6H A;  1XEB A;  1IYL A;  4F0X A;  3D67 A;  1Z5R A;  4Z65 A;  3V38 A;  4MCR A;  1S5K A;  3SI2 A;  5DWM A;  2FSR A;  1I1D A;  1FT7 A;  2YNE A;  2AFO A;  1XMT A;  2QIR A;  3DSB A;  3QAY A;  4CAE A;  2G3T A;  3LAC A;  4CGP A;  1YX0 A;  1YW6 A;  2RC4 A;  1IU8 A;  4ZI6 A;  4OID A;  4PV6 A;  1BAV A;  4AG7 A;  2AFS A;  2Y0M A;  4OAE A;  4TNU A;  3H4Q A;  4R6T A;  3L2N A;  3W6X A;  3HLP A;  4NGS A;  4R3L A;  4NSQ A;  1LAP A;  3IWW A;  4KVM E;  4NGP A;  4OC1 A;  7CPA A;  1F57 A;  3BJ8 A;  3KQX A;  5F09 A;  3B7I A;  2WSA A;  2VI7 A;  3TO9 A;  1LAN A;  4X8I A;  5EBV A;  1BPM A;  3S6K A;  3SXO A;  3VWD A;  2R7H A;  3CDX A;  4DNC A;  2IL4 A;  2EO8 A;  1WWZ A;  2FCK A;  3KHZ A;  2PC1 A;  4LQG A;  4CYN A;  1S7K A;  4JJX A;  4P44 A;  5G1Z A;  4CAF A;  1QSR A;  2POK A;  4P4D A;  4M3S A;  2I00 A;  4XPK A;  4C2X A;  2Z11 A;  1UWY A;  1TIQ A;  2HUZ A;  3PB4 X;  4CPA A;  1BOB A;  1L0C A;  2BL1 A;  2GLF A;  5K8O A;  2ZEN A;  3FX6 A;  4P10 A;  3VWE A;  1LAM A;  1YR0 A;  2ZOG A;  2Q7B A;  3T90 A;  2Z3O A;  2GLJ A;  2FIW A;  2XEJ A;  3IEH A;  1AYE A;  3D7D A;  4PXD A;  4CAW A;  4QUS A;  1X10 A;  5DS0 A;  5LYI A;  1XFO A;  1SQH A;  1ELL P;  4NJR A;  4Y49 B;  2ZW6 A;  4P6Y A;  4RS2 A;  4MY3 A;  2I79 A;  1XJO A;  1ZO0 A;  3RYO A;  2PCU A;  3WC6 A;  3SXN A;  3G8W A;  1P0H A;  1AMP A;  3HUV A;  2PSW A;  3IWG A;  3EO4 A;  3PBE A;  3PBB A;  4UBR A;  3NH5 A;  4UCN A;  3GB0 A;  5LYF A;  4UCM A;  1ZG7 A;  3BJ7 A;  3H8G A;  1CP7 A;  3FYN A;  1A2Z A;  3FBU A;  3KL9 A;  4R87 A;  4A32 A;  4IHM A;  2JEV A;  4LUA A;  3GYA A;  1ARM A;  2C27 A;  3W91 A;  2VEZ A;  4FAI A;  5E96 A;  1B87 A;  3S9L A;  1CX8 A;  3NE7 A;  3B3C A;  1OZP A;  3S6F A;  2GFQ A;  1CP6 A;  2QVP A;  4MHZ A;  3SI0 A;  1JWQ A;  4H2K A;  3WAB A;  5JGF A;  2ZEM A;  3PB7 X;  5J8F A;  1TF9 A;  1M1D A;  2YNC C;  3FMC A;  5KTA A;  4KOR A;  1IYK A;  1LFW A;  4UCP A;  1H8L A;  4NGN A;  1BPN A;  3B3V A;  3NE8 A;  4P45 A;  4FWU A;  5AG5 A;  3SI1 A;  4A2Z A;  2B4D A;  3ISX A;  1R57 A;  2IQ6 A;  4AG9 A;  1YQE A;  4J3G A;  1PYT B;  4ZY1 A;  1HDU A;  1N71 A;  2REF A;  1MJA A;  2OU2 A;  1I12 A;  1QQ9 A;  3B3W A;  3G3S A;  3QB8 A;  4O23 A;  3T8W A;  4WJB A;  2ZPA A;  4PSX A;  3TO7 A;  2PE3 A;  3BHX A;  3PFE A;  1M4G A;  2J8R A;  4KOU A;  3NFZ A;  4M85 A;  3I9S A;  2G3A A;  4MFL A;  4OIW A;  2ZW7 A;  1S7N A;  2R8V A;  4XNH C;  5IB0 A;  5JM6 A;  3SJF A;  2BEI A;  4ZBG A;  2Q4Y A;  1CPX A;  2GE3 A;  2H5M A;  2Q43 A;  3F5B A;  3JVN A;  4CRY B;  4F9V A;  4MFQ A;  2Z3N A;  4KZT A;  4AVB A;  3P2F A;  2GIV A;  3C26 A;  3K2K A;  5HH1 A;  2ABZ A;  4H89 A;  4UF4 A;  2OZG A;  1M44 A;  1OBR A;  1IIC A;  3CXS A;  3IU1 A;  2PJ1 A;  4A39 A;  2O53 A;  4QB9 A;  2QML A;  2AFU A;  1XRY A;  1I21 A;  1Q7L A;  2HQY A;  3FIX A;  3GKR A;  1TKJ A;  3MRU A;  4ORF A;  4ONW A;  3FEC A;  4ZY2 A;  2B5G A;  8CPA A;  3KZW A;  2RFH A;  2V8H A;  4C2Z A;  5CNP A;  2OH1 A;  2ZEO A;  2D4O A;  4OC0 A;  2AFM A;  3LWU A;  4MBU A;  4UWJ A;  5C82 A;  2JDC A;  3B2Y A;  2DPT A;  1S3Z A;  4YWY A;  2PRQ A;  3K9U A;  5BWA B;  4KLV A;  2ZEP A;  3S9N A;  1QSM A;  2V77 A;  5LYD A;  4MCQ A;  3V7Z A;  4B5P A;  2ARH A;  4K3N A;  4MXU A;  4CGN A;  2OZU A;  2OR4 A;  4F6A A;  1BLL E;  4PQA A;  2PQ8 A;  2ZEE A;  3RNZ A;  2WZN A;  3VAT A;  2G9D A;  2ZW4 A;  3N7Z A;  4ZYQ A;  4XPL A;  2CY2 A;  2PJ4 A;  3TOA A;  3TTH A;  5HMN A;  5EC4 A;  1Z8T A;  2NMT A;  4M6G A;  3FEE A;  3BI1 A;  1ZLH A;  2FL4 A;  2YNC A;  1KZF A;  3SHP A;  2RB7 A;  2F8H A;  3BLN A;  3R1K A;  1Z8W A;  4MJ8 A;  4JXR A;  3VH9 A;  3WT4 A;  1M4L A;  1XIX A;  4JZ0 A;  4MFP A;  2EK9 A;  1VIX A;  2CTC A;  2CTB A;  1S7F A;  4CYP A;  2GRE A;  3R9F A;  4GXH A;  3CZX A;  5JQ4 A;  5GCN A;  5HVF A;  2ZEF A;  4HNW B;  1CG2 A;  4C7H A;  2PJ3 A;  5KTD A;  5JH9 A; 
#chains in the Genus database with same CATH homology
 1YRE A;  1P4N A;  1MJ9 A;  4Q36 A;  3ZJ0 A;  4Y49 C;  4F0Y A;  3I3G A;  4XPD B;  4MFZ A;  2J8N A;  3F8K A;  5C88 A;  4NXY A;  5F48 A;  4HNY B;  3FNC A;  2QEC A;  3EC4 A;  3DR8 A;  4KSF A;  3MGD A;  5G22 A;  2ZXV A;  4KS9 A;  2AE6 A;  3IU2 A;  2P0W A;  4KOS A;  4UFX A;  2B4D B;  4MFK A;  1NMT A;  2DPS A;  4HNX B;  1GHE A;  3IGR A;  2ZW5 A;  3TFY A;  1MJB A;  4PK3 A;  3P2H A;  1U6M A;  5AG4 A;  2PR8 A;  2JLM A;  4OAD A;  2BUE A;  2R98 A;  2JDD A;  1Q2Y A;  2B4B A;  2WPX A;  1CJW A;  2PDO A;  4B12 A;  4II9 A;  1VHS A;  4FD6 A;  1S7L A;  3FXT A;  3EXN A;  2P6G A;  1Y9W A;  5F47 A;  2CNT A;  2Z10 A;  3D8P A;  2Z3K A;  4HKF A;  4CYQ A;  2B58 A;  1QSO A;  2Z0Z A;  4IUS A;  4AB7 A;  1LRZ A;  2WPW A;  3WR7 A;  1YGH A;  3E0K A;  5J8C A;  2WUU A;  1YVO A;  4KOW A;  4QBJ A;  4YGO A;  1QST A;  4B11 A;  4A33 A;  4AVA A;  4NF1 A;  4RI1 A;  1K4J A;  4KLW A;  2PRB A;  5H84 A;  2B3U A;  5A28 A;  4QC6 A;  3W6S A;  4NCZ A;  4JXQ A;  3JUW A;  3S6H A;  1Z4R A;  1Z9U A;  4UWI A;  4K30 A;  1Y9K A;  4BMH A;  3T9Y A;  4H6U A;  4B13 A;  3DR6 A;  2O28 A;  4ONU A;  1IID A;  4UFW A;  2FXF A;  4ZGY B;  4E8O A;  1UFH A;  2GAN A;  3IWE A;  1VKC A;  2VBQ A;  4UFV A;  1BO4 A;  3ZZI A;  4A31 A;  3PGP A;  3S6G A;  5H86 A;  2VZZ A;  2Z3L A;  2CNM A;  3JTK A;  3F0A A;  4LX9 A;  2ATR A;  1CM0 A;  5AG7 A;  4L89 A;  5IV0 A;  2P6F A;  2Q4V A;  4B5O A;  4KUB A;  4CAX A;  4JWP A;  4CGL A;  5A27 A;  4E0A A;  1ON0 A;  2FS5 A;  1Z4E A;  2VQY A;  3QAH A;  3R96 A;  3R95 A;  4E2A A;  3OWC A;  4XPD C;  3PZJ A;  3H5Z A;  1IB1 E;  1FY7 A;  3R9G A;  4YRH A;  2P6E A;  2PR1 A;  4JLY A;  1WK4 A;  4C7I A;  3EY5 A;  2FT0 A;  2YND A;  2KCW A;  4KOX A;  2Q04 A;  4A30 A;  1M4I A;  2Q0Y A;  1V0C A;  4CGM A;  1RO5 A;  3TCV A;  4KVX A;  1KUV A;  2VZY A;  1KUX A;  5AGE A;  3LD2 A;  2YGW A;  4MY0 A;  2FE7 A;  1PU9 A;  4CRZ B;  3TE4 A;  1RXT A;  4I49 A;  5KTC A;  3DDD A;  4L8A A;  5IX3 A;  4Q38 A;  1QSN A;  4R3K A;  2VXK A;  2REE A;  2CXA A;  4KSA A;  4MFJ A;  3CXP A;  4FD7 A;  4UA3 A;  4CYO A;  4QVT A;  1MK4 A;  2Z3P A;  4OLL A;  4X5K A;  1XF8 A;  5G21 A;  3LOD A;  2OZH A;  1XE4 A;  3PP9 A;  3DNS A;  4GS4 A;  4MI4 A;  2EVN A;  2X7B A;  1Q2D A;  1YVK A;  2Q44 A;  2G0B A;  1YLE A;  2FIA A;  2BSW A;  3TT2 A;  4KOT A;  3D2P A;  2B5G B;  3D2M A;  5G20 A;  4R57 A;  3V8I A;  4U9Z A;  2D4P A;  5DWN A;  4PSW A;  4CS0 B;  4NEX A;  2J8M A;  2B3V A;  4KOY A;  3B8G A;  4B10 A;  1S60 A;  4KOV A;  2R1I A;  3D3S A;  5F49 A;  4B5P B;  1PUA A;  4B14 A;  4BBH A;  4JD6 A;  4KVO E;  4PK2 A;  3TOB A;  3UY5 A;  3FB3 A;  4YFJ A;  5FVJ A;  5ISV A;  4EVY A;  4CAV A;  4U5Y A;  4C2Y A;  5F46 A;  4A95 A;  1NE9 A;  5AG6 A;  1Y7R A;  2EUI A;  2HV2 A;  4H6Z A;  4KUA A;  4U9Y A;  3EFA A;  2Z3M A;  1NSL A;  4XNH B;  1M4D A;  2K5T A;  3GY9 A;  4C68 A;  2CNS A;  2F5I A;  3TO6 A;  2A4N A;  4FD5 A;  4CGO A;  2DXQ A;  4FD4 A;  3CXQ A;  4MHD A;  1B6B A;  1J4J A;  1Q2C A;  4AVC A;  3KKW A;  3R9E A;  1KUY A;  4R9M A;  5JPH A;  2AJ6 A;  4IF5 A;  1YK3 A;  5I0C A;  3A9L A;  2OB0 A;  3FRM A;  1XEB A;  1IYL A;  4F0X A;  1S5K A;  5DWM A;  2FSR A;  1I1D A;  2YNE A;  1XMT A;  2QIR A;  3DSB A;  4CAE A;  2G3T A;  4CGP A;  1YX0 A;  2RC4 A;  4PV6 A;  4AG7 A;  2Y0M A;  4OAE A;  3H4Q A;  3W6X A;  4R3L A;  4NSQ A;  4KVM E;  3BJ8 A;  2WSA A;  2VI7 A;  3TO9 A;  5EBV A;  3S6K A;  3SXO A;  3VWD A;  2R7H A;  4DNC A;  2IL4 A;  1WWZ A;  2FCK A;  2PC1 A;  4CYN A;  1S7K A;  4JJX A;  5G1Z A;  4CAF A;  1QSR A;  4M3S A;  2I00 A;  4XPK A;  4C2X A;  2Z11 A;  2HUZ A;  1TIQ A;  1BOB A;  1L0C A;  2BL1 A;  3VWE A;  1YR0 A;  2Q7B A;  3T90 A;  2Z3O A;  2FIW A;  4CAW A;  4QUS A;  1SQH A;  4Y49 B;  2ZW6 A;  4RS2 A;  4MY3 A;  2I79 A;  1ZO0 A;  3RYO A;  3SXN A;  3G8W A;  1P0H A;  3IWG A;  2PSW A;  3EO4 A;  4UBR A;  4UCN A;  4UCM A;  3BJ7 A;  3FYN A;  3FBU A;  4R87 A;  4A32 A;  2JEV A;  4LUA A;  3GYA A;  2C27 A;  3W91 A;  2VEZ A;  5E96 A;  1B87 A;  3NE7 A;  1OZP A;  3S6F A;  5J8F A;  1M1D A;  2YNC C;  5KTA A;  4KOR A;  1IYK A;  4UCP A;  5AG5 A;  4A2Z A;  2B4D A;  1R57 A;  4AG9 A;  4J3G A;  3G3S A;  1N71 A;  2REF A;  1MJA A;  2OU2 A;  1I12 A;  3QB8 A;  2ZPA A;  4PSX A;  3TO7 A;  1M4G A;  2J8R A;  4KOU A;  4M85 A;  4MFL A;  3I9S A;  2G3A A;  2ZW7 A;  1S7N A;  2R8V A;  4XNH C;  5IB0 A;  2BEI A;  4ZBG A;  2Q4Y A;  2GE3 A;  2H5M A;  3JVN A;  3F5B A;  4CRY B;  4MFQ A;  2Z3N A;  4KZT A;  4AVB A;  3P2F A;  2GIV A;  3C26 A;  5HH1 A;  4H89 A;  3IU1 A;  2OZG A;  1M44 A;  3CXS A;  1IIC A;  4QB9 A;  2QML A;  1I21 A;  4ORF A;  2HQY A;  3FIX A;  3GKR A;  2B5G A;  4C2Z A;  5CNP A;  2OH1 A;  2D4O A;  4MBU A;  4UWJ A;  5C82 A;  2JDC A;  2DPT A;  1S3Z A;  3K9U A;  5BWA B;  4KLV A;  1QSM A;  4B5P A;  2ARH A;  4CGN A;  2OZU A;  4F6A A;  2PQ8 A;  2ZW4 A;  3N7Z A;  4XPL A;  2CY2 A;  3TOA A;  3TTH A;  5HMN A;  5EC4 A;  2NMT A;  2FL4 A;  2YNC A;  1KZF A;  3SHP A;  4MJ8 A;  3BLN A;  3R1K A;  4JXR A;  1XIX A;  4MFP A;  1S7F A;  4CYP A;  3R9F A;  5JQ4 A;  5GCN A;  4HNW B;  4C7H A;  5KTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...