2FSRA

Crystal structure of the acetyltransferase from agrobacterium tumefaciens str. c58
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
177
structure length
171
Chain Sequence
GRENLYFSIPTLRTERLTLRPLAMADFPAYRDFMASPRSTGVGGPYDLPSTWGVFCHDLANWHFFGHGALMIDLGETGECIGQIGINHGPLFPEKELGWLLYEGHEGRGYAAEAAVALRDWAFETLNLPTLVSYVSPQNRKSAAVAERIGGTLDPLAPRSDPEDLVYRYHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Acetyltransferase from Agrobacterium tumefaciens str. C58
rcsb
molecule keywords acetyltransferase
molecule tags Transferase
source organism Agrobacterium tumefaciens str.
total genus 44
structure length 171
sequence length 177
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fsrA00
1P0HA 4AVAA 2HQYA 2K5TA 2P6EA 2B4DA 1KUVA 2NMTA 3CXQA 3DDDA 3SHPA 1Q2YA 3C26A 4JXQA 3FIXA 4U5YA 2B4BA 2GIVA 2D4OA 2J8NA 2BUEA 2ZPAA 5IB0A 2J8MA 5JQ4A 3FBUA 4KLWA 4II9A 4XNHC 3D3SA 1I1DA 4HNXB 4DNCA 1KZFA 4K30A 3V8IA 1MJ9A 4H6UA 4KOVA 2JLMA 2JDDA 2OB0A 4GS4A 1S7KA 2R1IA 4YRHA 5H84A 1M4DA 3S6HA 3EC4A 1R57A 3D2PA 4ZBGA 3SXNA 1Y9WA 1FY7A 1YGHA 4OLLA 4AVBA 3QB8A 5EC4A 1MK4A 4HKFA 2HUZA 2PC1A 2Z0ZA 1OZPA 1XMTA 4U9ZA 4XPKA 4MBUA 2ZXVA 1V0CA 2B4DB 3BJ7A 4L89A 1S3ZA 1IB1E 1GHEA 4PSWA 4H89A 2I79A 5KTCA 3CXSA 4KORA 1Y9KA 3SXOA 4FD7A 3GYAA 3IWGA 1S7NA 2FCKA 2WPWA 3S6KA 5C82A 4KOUA 4UWIA 3TO6A 1M1DA 4F6AA 4MY0A 4F0YA 1Q2DA 2Q4YA 1P4NA 2QIRA 2IL4A 4KOTA 1S60A 1IICA 2OU2A 4MI4A 2EVNA 4OAEA 2EUIA 3W6SA 4MHDA 2FT0A 4M85A 2AJ6A 4E8OA 4R9MA 5GCNA 5IX3A 3TFYA 3MGDA 4LX9A 3UY5A 1UFHA 2ZW7A 2PR1A 3NE7A 2ARHA 4PK3A 4B5PA 5ISVA 4QC6A 4UWJA 1IIDA 2B3VA 3DNSA 3BLNA 2FL4A 4MY3A 4CS0B 1MJAA 4QB9A 3FRMA 2BSWA 2GE3A 2RC4A 5DWMA 2OH1A 3DR6A 3P2HA 5J8CA 5KTAA 3PZJA 4U9YA 3FXTA 2VXKA 4AG9A 1XEBA 3ZZIA 4PK2A 4QVTA 2ATRA 1Z4RA 2G3AA 3RYOA 3TT2A 3T9YA 3W6XA 2JEVA 3TOAA 4YFJA 4UBRA 4R3KA 4JD6A 3IGRA 5FVJA 4BMHA 4HNWB 2WPXA 2Z10A 1U6MA 3TOBA 2G0BA 1M4GA 5KTDA 4B5PB 2C27A 3D2MA 3EY5A 1QSOA 4ORFA 3QAHA 3R9FA 5EBVA 1YK3A 4M3SA 2VZZA 1ON0A 4ONUA 2JDCA 2REEA 1SQHA 2Q44A 1B6BA 4AVCA 3TO7A 2F5IA 1BOBA 2OZHA 3TO9A 1QSTA 2PQ8A 1YVOA 4I49A 4FD5A 3KKWA 4NSQA 2PDOA 5CNPA 2REFA 3EFAA 5J8FA 3ZJ0A 2Z11A 4KOXA 4XPLA 1S7LA 1PUAA 5HH1A 2B3UA 2I00A 1QSNA 2X7BA 3R9GA 4JWPA 3DR8A 1Q2CA 3R96A 2Q0YA 4UA3A 4KLVA 4CAWA 2P6GA 4YGOA 3T90A 1CJWA 3H4QA 3FB3A 3GY9A 1YX0A 2FIAA 5F47A 2R8VA 5DWNA 1PU9A 1VKCA 4Y49B 2KCWA 3TE4A 3G3SA 3E0KA 1NE9A 2VBQA 2VEZA 4KVXA 3G8WA 4IUSA 3R1KA 4QUSA 4R57A 4KZTA 5JPHA 2PRBA 3PP9A 3W91A 4E2AA 3R95A 4R3LA 3B8GA 1RO5A 2J8RA 2CNTA 3S6GA 3S6FA 4E0AA 1I21A 4KVME 1YVKA 4X5KA 3P2FA 4L8AA 4FD4A 1J4JA 4KVOE 2CY2A 2B5GB 3N7ZA 5HMNA 5I0CA 5C88A 2FIWA 1QSRA 1RXTA 2O28A 2R7HA 2Q4VA 4OADA 1NSLA 1I12A 4NF1A 3FNCA 1KUYA 1CM0A 2P6FA 2FS5A 1YREA 4PV6A 4CRYB 2P0WA 3CXPA 1L0CA 2QECA 2FSRA 4AG7A 3TTHA 2ZW4A 5E96A 2FXFA 4XPDC 5F49A 3VWEA 3DSBA 1K4JA 2H5MA 4IF5A 2DXQA 1KUXA 4CAVA 2CNMA 4NXYA 3EXNA 4KOWA 4Y49C 2D4PA 3FYNA 4LUAA 4R87A 4QBJA 1IYLA 3F8KA 3LODA 4CRZB 2A4NA 1M4IA 5F46A 3BJ8A 3WR7A 3PGPA 1WWZA 2GANA 2VZYA 4RS2A 1YR0A 2Q04A 4J3GA 2ZW6A 2BEIA 1XF8A 3K9UA 4H6ZA 2AE6A 1Z4EA 3F0AA 1M44A 2B5GA 5IV0A 4XPDB 2QMLA 1S7FA 5H86A 1TIQA 2BL1A 1NMTA 2OZUA 4FD6A 3GKRA 4XNHB 3LD2A 4RI1A 1QSMA 4AB7A 2G3TA 4B5OA 1VHSA 2PSWA 1Y7RA 2FE7A 3JUWA 2R98A 4JLYA 4KOSA 1WK4A 1Z9UA 4JJXA 4EVYA 1N71A 2Q7BA 3EO4A 3D8PA 2B58A 2OZGA 4PSXA 2ZW5A 2HV2A 4JXRA 4CAXA 1MJBA 1IYKA 3I3GA 4KUAA 1XE4A 1YLEA 1LRZA 2PR8A 1BO4A 3VWDA 3I9SA 2Y0MA 1B87A 3F5BA 4NEXA 3JVNA 3OWCA 4NCZA 4MJ8A 2VI7A 2CNSA 3TCVA 1S5KA 1XIXA 2VQYA 3R9EA 4HNYB 4KOYA 4KUBA 5F48A
chains in the Genus database with same CATH superfamily
5HVHA 1P0HA 2Q51A 2AFOA 4KSAA 2HQYA 2K5TA 2P6EA 2PE3A 4AVAA 4CYOA 2B4DA 1KUVA 5LRKA 2NMTA 3CXQA 4DYOA 2PJ5A 3DDDA 3SHPA 1Q2YA 1CP6A 1F2OA 3C26A 1HDUA 4JXQA 3FIXA 4Q7AA 5J1QA 2ZEEA 4U5YA 3QNVA 4X8IA 2B4BA 1QMUA 2GIVA 4C2ZA 1X10A 3TC8A 4PXBA 2D4OA 4UF4A 4X3RA 3FX6A 2J8NA 2BUEA 2ZPAA 1M4LA 1YW4A 2J8MA 4KS9A 5IB0A 3JRUA 5JQ4A 3FBUA 4KLWA 2IQ6A 2PVVA 4II9A 1XRYA 4H2KA 3H8FA 4XNHC 3D3SA 1I1DA 2GLFA 4HNXB 1FT7A 3KHXA 1KZFA 2PJAA 5G22A 4DNCA 4K30A 3RBUA 1DTDA 3V8IA 1MJ9A 4H6UA 1LAPA 4KOVA 2JLMA 4EWTA 1KWMA 5JM6A 1ZO0A 4NGSA 2BOAA 4ZY1A 2JDDA 3KQZA 2OB0A 4GS4A 1S7KA 2R1IA 4YRHA 5H84A 3B35A 1M4DA 3IJ3A 3S6HA 3EC4A 1VIXA 1R57A 1ELLP 3D2PA 4ZBGA 4CGLA 3CPAA 2PIYA 3SXNA 2XEFA 1Y9WA 3PFEA 4KSFA 1FY7A 5G1ZA 3CZXA 4JZ0A 1YGHA 4OLLA 4AVBA 3QB8A 5EC4A 2IMOA 1MK4A 4CYPA 3IWEA 3D66A 4HKFA 2HUZA 2PC1A 4OIWA 2Z0ZA 1VGYA 1OZPA 1BPNA 1XMTA 3IO1A 4U9ZA 4XPKA 4MBUA 2ZXVA 2B4DB 3WABA 3BJ7A 3LMSA 1CPXA 2ZENA 4L89A 2ZEDA 1S3ZA 4PPZA 1IB1E 1GHEA 4OC1A 4DUKA 4PSWA 5ELYA 4H89A 2I79A 3LACA 1Y0RA 3CXSA 5KTCA 3D7GA 2ODFA 4EMEA 3BXMA 3NH8A 3IEHA 4IAVA 4Q38A 4KORA 1BAVA 3B7IA 1R43A 1Y9KA 3D7DA 4NGMA 3SXOA 4FD7A 2G9DA 3GYAA 5A27A 3IWGA 3H5ZA 1S7NA 1Z8TA 2FCKA 2WPWA 3S6KA 4F0XA 5K8OA 4R6TA 5C82A 1TKHA 3IC1A 2ZEFA 4NGRA 2PJ0A 4KOUA 3B3CA 4UFXA 4YU9A 4UWIA 4ZGYB 3TO6A 1M1DA 4F6AA 4MY0A 1Z5RA 1LCPA 3CT9A 3KI9A 2EO8A 1TF9A 1Y0YA 4F0YA 1Q2DA 2Q4YA 1P4NA 2QIRA 2DPTA 2FVGA 2IL4A 3WC7A 2C6GA 1S60A 3HLPA 4KOTA 3VARA 4B14A 1OBRA 1IICA 2OU2A 4MI4A 2EVNA 4OAEA 3PBBA 3V7ZA 2EUIA 2GLJA 4TNUA 3W6SA 4MHDA 1CPSA 2FT0A 4M85A 2AJ6A 1LAMA 3NH5A 2PJCA 4E8OA 3DGVA 1HEEA 3KQXA 4R9MA 2V77A 3LWUA 3ISZA 1XFOA 5GCNA 4A32A 5IX3A 3TFYA 3GLJA 3NE8A 3H8GA 4MMOA 2PRQA 3MGDA 1ZLIA 4C7IA 4LX9A 2WYRA 2YNDA 4ZI6A 1CG2A 2YNCA 3UY5A 4CGNA 1QQ9A 1UFHA 2ZW7A 5CBMA 2PR1A 3S9MA 4C7HA 3NE7A 2ARHA 4PK3A 4B5PA 3IFEA 5ISVA 4FWUA 4QC6A 4UWJA 1IIDA 2B3VA 3DNSA 2V8HA 3BLNA 4LQGA 3JTKA 4R8FA 2FL4A 1VHOA 4MY3A 4CS0B 4MFJA 1MJAA 4MFKA 4QB9A 2PVWA 3FRMA 2BSWA 2GE3A 2PJ4A 2RC4A 2PCUA 4MFQA 4BD9A 5DWMA 3D4UA 3TX8A 4B12A 1AYEA 2OH1A 2XEIA 3DR6A 4MCPA 3P2HA 4NGQA 4RUHA 5J8CA 3PZJA 5KTAA 4U9YA 3FXTA 4B10A 2VXKA 2AFZA 2ZOGA 4OKOA 1IY7A 4AG9A 5HVFA 1XEBA 3ZZIA 4PK2A 4QVTA 2ATRA 1Z4RA 2PJ2A 3D68A 4P4IA 3PB6X 4P44A 2G3AA 4MHNA 4KSIA 4WJBA 3RYOA 4OIDA 3TT2A 2GU2A 2PJ7A 2HC9A 2POKA 4Q36A 3ZJ0A 4UEZA 3T9YA 3W6XA 1AUGA 2JEVA 3TOAA 2F7VA 4UBRA 1IOFA 4YFJA 2GREA 1H8LA 4UIBA 4R3KA 2EK8A 8CPAA 3A9LA 1XMBA 4JD6A 1EE3P 3IGRA 4MCRA 5FVJA 4BMHA 3DLJA 4HNWB 2WPXA 2Z10A 1U6MA 5AGEA 3TOBA 1XBUA 2G0BA 4M6HA 4PXDA 4UEEA 1M4GA 5KTDA 4B5PB 2C27A 3D2MA 3EY5A 3S9LA 1QSOA 1JQGA 4ORFA 3QAHA 3V38A 2JBKA 3R9FA 4UIAA 3SJXA 2Q4ZA 5EBVA 1YK3A 5BWAB 4M3SA 2VZZA 1ON0A 4Z65A 4ONUA 2Q7SA 2JDCA 3GUXA 2REEA 3PBEA 4NJRA 4P4JA 1SQHA 1BLLE 3N5FA 2Q44A 3PFOA 2CF4A 4P4BA 5LYIA 2JEWA 4DJLA 4HPSA 1B6BA 4AVCA 3TO7A 1Q7LA 1DE4C 3PEIA 2F5IA 2AFXA 1BOBA 2Z3OA 4P4DA 3SJEA 4C2YA 5AG7A 2OZHA 1TKFA 3TO9A 2EBJA 1QSTA 4OC0A 4OMEA 2PQ8A 1YVOA 4I49A 1ARMA 4P45A 1TF8A 2Q43A 4FD5A 3B3VA 2DF5A 2BCOA 4OP4A 5K8MA 3KKWA 4NSQA 3NH4A 2PDOA 1LANA 5CNPA 2REFA 3EFAA 5J8FA 3QAYA 4NGPA 2QVPA 5LYDA 2DEAA 2CTCA 2Z11A 3D67A 2QJ8A 3FVLA 3NFZA 3KR4A 4KOXA 2EWBA 4XPLA 1S7LA 1PUAA 1UWYA 2B3UA 1GYTA 2I00A 1QSNA 2V8VA 2X7BA 4PXEA 5HH1A 3BI0A 3FJUA 4JWPA 3R9GA 2XEJA 3DR8A 5LRJA 1Q2CA 4A38A 3PB8X 3R96A 4AXVA 2Q0YA 3FECA 4M6IA 4MFZA 4UA3A 4CPAA 4UCPA 4KLVA 4CAFA 3SJFA 2Z3NA 4CAWA 2C6CA 1F2PA 2P6GA 4YGOA 2DPSA 1CJWA 3FEDA 3T90A 4A30A 3H4QA 2RB7A 3FB3A 5AG6A 2JBJA 4A94A 3GY9A 3IIBA 4OC2A 4IK2A 3PRTA 4P4EA 1YX0A 4PQAA 2FIAA 5F47A 2O53A 2R8VA 7CPAA 2Z3LA 1YW6A 3K2KA 1JWQA 4CGMA 5DWNA 3H8EA 1PU9A 1VKCA 4Y49B 4BINA 2KCWA 3WC6A 3G3SA 4ZX8A 3TE4A 3E0KA 3KL9A 1NE9A 3IU2A 2CIJA 5K8PA 4C2XA 2VBQA 3RNZA 2VEZA 4NJQA 4EFDA 5D8NA 4KUBA 4OC4A 4G1PA 4KVXA 3G8WA 4ZY2A 4IUSA 3R1KA 4QUSA 4R57A 4A2ZA 3BI1A 4KZTA 5JPHA 2YNCC 5HXDA 2PRBA 3PB7X 3PP9A 3W91A 4E2AA 3R95A 4NGTA 4R3LA 3SJGA 3B8GA 5EMIA 3FH4A 1RO5A 5DS0A 2F8HA 2J8RA 2ZEOA 5AG4A 5LYLA 2CNTA 1VHEA 4TWEA 4CYQA 4ZX9A 2ZEGA 1X12A 3S6FA 3S6GA 3WC5A 5JH9A 4CGOA 2J9AA 4A33A 4E0AA 2PJBA 3GIUA 2C6PA 3T8WA 1I21A 4KVME 1YVKA 4X5KA 3P2FA 4L8AA 4FD4A 4CGPA 1J4JA 4KVOE 1HDQA 2CY2A 2B5GB 3N7ZA 4B13A 5HMNA 5I0CA 5C88A 4OC5A 4GM5A 2AFUA 2FIWA 4MXUA 4R76A 3IWWA 1QSRA 1RXTA 2O28A 2R7HA 2Q4VA 2HB6A 3KHZA 4OADA 4W9YA 1NSLA 2ZEHA 4P4FA 1I12A 4NF1A 4A37A 1CP7A 4F9UA 2AFWA 2AFSA 1CBXA 3FNCA 1XOVA 1XJOA 3D7FA 1KUYA 1CM0A 2P6FA 2FS5A 4FAIA 1YREA 2C1CA 3RO0A 3PB4X 3KZWA 4MHYA 4PV6A 4CRYB 2P0WA 3CXPA 1L0CA 2QECA 5HVGA 2FSRA 4AG7A 2AFMA 1ZG8A 3FF3A 3TTHA 4X2TA 4MFLA 2PJ9A 4R7MA 2OR4A 2QYVA 2ZW4A 5E96A 3KASA 2FXFA 4ZY0A 1ZG7A 4XPDC 2O4HA 2WUUA 5F49A 3VWEA 2V8GA 2Z3MA 3DSBA 3K9TA 1K4JA 5A28A 2H5MA 4CYNA 4IF5A 1Z8LA 4RN7A 3VATA 2DXQA 1KUXA 5K8NA 4MHPA 1Z8XA 1YMEA 4MCQA 4CAVA 3ISXA 2CNMA 4NXYA 3EXNA 5IB9A 4KOWA 4Y49C 2PJ3A 1CX8A 2ZEMA 2D4PA 3FYNA 2XEGA 4LUAA 4UFVA 4R87A 6CPAA 4QBJA 1LFWA 4C68A 1IYLA 4B6ZA 3F8KA 3LODA 4CRZB 4JYWA 2A4NA 3KR5A 4FBEA 1YLOA 2Z3KA 1M4IA 5F46A 1ZG9A 3BJ8A 3HUVA 3WR7A 4B11A 3PGPA 1WWZA 4LQ6A 2GANA 2VZYA 3KGQA 4RS2A 1YR0A 2PIZA 4M6GA 2Q04A 4MFPA 4UEFA 2CXAA 2V8DA 2PJ6A 3NA6A 1AMPA 4J3GA 2ZW6A 2BEIA 1XF8A 4WWVA 1PCAA 2OOTA 3K9UA 4H6ZA 2AE6A 1Z4EA 2IJZA 4ZYQA 1ELMP 3F0AA 4OC3A 1M44A 1LOKA 2B5GA 4IHMA 4P10A 4YWYA 1Z2LA 3RAMA 5IV0A 2ANPA 4XPDB 2QMLA 2NSMA 1S7FA 3PB9X 4FUUA 5H86A 3L2NA 3SI2A 2WSAA 1TIQA 2BL1A 2BO9A 4UCNA 1IGBA 1ARLA 1NMTA 4GXHA 2CTBA 4MHZA 2OZUA 5G21A 4FD6A 3GKRA 2WZNA 4XNHB 3B3WA 1BPMA 3LD2A 4O23A 4RI1A 3MRUA 4P6YA 2NYQA 1QSMA 2GFQA 4AB7A 2VL1A 2G3TA 1A2ZA 2PJ1A 4K3NA 3SI0A 3CDXA 4B5OA 1F57A 5G20A 1VHSA 2ABZA 2PSWA 4NGNA 2PJ8A 1Y7RA 1ZLHA 4ONWA 2FE7A 3FEEA 1IOIA 5AG5A 1Y7EA 3JUWA 3B3SA 2R98A 2YNEA 5I4MA 3VH9A 4JLYA 4UCMA 4KOSA 1WK4A 4PXCA 1Z9UA 4JJXA 4EVYA 1FNOA 1PYTB 1N71A 1TXRA 2Q7BA 3EO4A 3D8PA 3CPXA 2ZELA 2B58A 1NSAA 3IU1A 2OZGA 4PSXA 2ZW5A 5JGFA 2HV2A 3S9NA 2ZOFA 4A95A 3BHXA 3MN8A 4JXRA 1YQEA 5CPAA 5D29A 4CAXA 1MJBA 1IYKA 3I3GA 4KUAA 4MRIA 1R3NA 3D7HA 1XE4A 4F9VA 4MCSA 2EK9A 2I3CA 1YSJA 4F8ZA 3WT4A 4A31A 3GB0A 4A39A 1YLEA 2RFHA 1LRZA 1Z8WA 2PR8A 2YGWA 1BO4A 3B3TA 4NFRA 3I9SA 1IU8A 2Y0MA 3VWDA 5F09A 1B87A 3F5BA 4NEXA 2ZEPA 3JVNA 3OWCA 4NCZA 4MJ8A 2VI7A 4BBHA 2CNSA 5LRGA 3SI1A 3TCVA 4CAEA 1RTQA 1S5KA 1XIXA 2VQYA 4UFWA 3R9EA 5LYFA 4HNYB 1TKJA 3I1UA 5THWA 3B2YA 4KOYA 1V0CA 3FMCA 5F48A 3RZAA 2Z3PA
chains in the Genus database with same CATH topology
1P0HA 4KSAA 4AVAA 2HQYA 2K5TA 2P6EA 4CYOA 2B4DA 1KUVA 2NMTA 3CXQA 3DDDA 3SHPA 1Q2YA 3C26A 4JXQA 3FIXA 4U5YA 2B4BA 2GIVA 4C2ZA 2D4OA 2J8NA 2BUEA 2ZPAA 4KS9A 2J8MA 5IB0A 5JQ4A 3FBUA 4KLWA 4II9A 4XNHC 3D3SA 1I1DA 4HNXB 5G22A 4DNCA 1KZFA 4K30A 3V8IA 1MJ9A 4H6UA 4KOVA 2JLMA 1ZO0A 2JDDA 2OB0A 4GS4A 1S7KA 2R1IA 4YRHA 5H84A 1M4DA 3S6HA 3EC4A 1R57A 3D2PA 4ZBGA 4CGLA 3SXNA 1Y9WA 4KSFA 1FY7A 5G1ZA 1YGHA 4OLLA 4AVBA 3QB8A 5EC4A 1MK4A 4CYPA 3IWEA 4HKFA 2HUZA 2PC1A 2Z0ZA 1OZPA 1XMTA 4U9ZA 4XPKA 4MBUA 2ZXVA 2B4DB 3BJ7A 4L89A 1S3ZA 1IB1E 1GHEA 4PSWA 4H89A 2I79A 5KTCA 3CXSA 4Q38A 4KORA 1Y9KA 3SXOA 4FD7A 3GYAA 5A27A 3IWGA 3H5ZA 1S7NA 2FCKA 2WPWA 4F0XA 3S6KA 5C82A 4KOUA 4UFXA 4UWIA 4ZGYB 3TO6A 1M1DA 4F6AA 4MY0A 4F0YA 1Q2DA 2Q4YA 1P4NA 2QIRA 2DPTA 2IL4A 4KOTA 1S60A 4B14A 1IICA 2OU2A 4MI4A 2EVNA 4OAEA 2EUIA 3W6SA 4MHDA 2FT0A 4M85A 2AJ6A 4E8OA 4R9MA 5GCNA 4A32A 5IX3A 3TFYA 3MGDA 4C7IA 4LX9A 2YNDA 4CGNA 2YNCA 3UY5A 1UFHA 2ZW7A 2PR1A 4C7HA 3NE7A 2ARHA 4PK3A 4B5PA 5ISVA 4QC6A 4UWJA 1IIDA 2B3VA 3DNSA 3BLNA 3JTKA 2FL4A 4MY3A 4CS0B 4MFJA 1MJAA 4MFKA 4QB9A 3FRMA 2BSWA 2GE3A 2RC4A 4MFQA 5DWMA 4B12A 2OH1A 3DR6A 3P2HA 5J8CA 5KTAA 3PZJA 4U9YA 3FXTA 4B10A 2VXKA 4AG9A 1XEBA 3ZZIA 4PK2A 4QVTA 2ATRA 1Z4RA 2G3AA 3RYOA 3TT2A 4Q36A 3T9YA 3W6XA 2JEVA 3TOAA 4YFJA 4UBRA 4R3KA 3A9LA 4JD6A 3IGRA 5FVJA 4BMHA 4HNWB 2WPXA 2Z10A 1U6MA 5AGEA 3TOBA 2G0BA 1M4GA 5KTDA 4B5PB 2C27A 3D2MA 3EY5A 1QSOA 4ORFA 3QAHA 3R9FA 5EBVA 1YK3A 5BWAB 4M3SA 2VZZA 1ON0A 4ONUA 2JDCA 2REEA 1SQHA 2Q44A 1B6BA 4AVCA 3TO7A 2F5IA 4C2YA 1BOBA 2Z3OA 5AG7A 2OZHA 3TO9A 1QSTA 2PQ8A 1YVOA 4I49A 4FD5A 3KKWA 4NSQA 2PDOA 5CNPA 2REFA 3EFAA 5J8FA 3ZJ0A 2Z11A 4KOXA 4XPLA 1S7LA 1PUAA 5HH1A 2B3UA 2I00A 1QSNA 2X7BA 3R9GA 4JWPA 3DR8A 1Q2CA 3R96A 2Q0YA 4UA3A 4MFZA 4UCPA 4KLVA 4CAFA 2Z3NA 4CAWA 2P6GA 4YGOA 2DPSA 1CJWA 3T90A 4A30A 3H4QA 3FB3A 5AG6A 3GY9A 1YX0A 2FIAA 5F47A 2R8VA 2Z3LA 4CGMA 5DWNA 1PU9A 1VKCA 4Y49B 2KCWA 3TE4A 3G3SA 3E0KA 1NE9A 3IU2A 4C2XA 2VBQA 2VEZA 4KUBA 4KVXA 3G8WA 4IUSA 3R1KA 4QUSA 4R57A 4A2ZA 4KZTA 5JPHA 2YNCC 2PRBA 3PP9A 3W91A 4E2AA 3R95A 4R3LA 3B8GA 1RO5A 2J8RA 5AG4A 2CNTA 4CYQA 3S6GA 3S6FA 4CGOA 4E0AA 4A33A 1I21A 4KVME 1YVKA 4X5KA 3P2FA 4L8AA 4FD4A 4CGPA 1J4JA 4KVOE 2CY2A 2B5GB 3N7ZA 4B13A 5HMNA 5I0CA 5C88A 2FIWA 1QSRA 1RXTA 2O28A 2R7HA 2Q4VA 4OADA 1NSLA 1I12A 4NF1A 3FNCA 1KUYA 1CM0A 2P6FA 2FS5A 1YREA 4PV6A 4CRYB 2P0WA 3CXPA 1L0CA 2QECA 2FSRA 4AG7A 3TTHA 4MFLA 2ZW4A 5E96A 2FXFA 4XPDC 2WUUA 5F49A 3VWEA 2Z3MA 3DSBA 1K4JA 5A28A 2H5MA 4CYNA 4IF5A 2DXQA 1KUXA 4CAVA 2CNMA 4NXYA 3EXNA 4KOWA 4Y49C 2D4PA 3FYNA 4LUAA 4UFVA 4R87A 4QBJA 4C68A 1IYLA 3F8KA 3LODA 4CRZB 2A4NA 2Z3KA 1M4IA 5F46A 3BJ8A 3WR7A 4B11A 3PGPA 1WWZA 2GANA 2VZYA 4RS2A 1YR0A 2Q04A 4MFPA 2CXAA 4J3GA 2ZW6A 2BEIA 1XF8A 3K9UA 4H6ZA 2AE6A 1Z4EA 3F0AA 1M44A 2B5GA 5IV0A 4XPDB 2QMLA 1S7FA 5H86A 2WSAA 1TIQA 2BL1A 4UCNA 1NMTA 2OZUA 5G21A 4FD6A 3GKRA 4XNHB 3LD2A 4RI1A 1QSMA 4AB7A 2G3TA 4B5OA 5G20A 1VHSA 2PSWA 1Y7RA 2FE7A 5AG5A 3JUWA 2R98A 2YNEA 4JLYA 4UCMA 4KOSA 1WK4A 1Z9UA 4JJXA 4EVYA 1N71A 2Q7BA 3EO4A 3D8PA 2B58A 3IU1A 2OZGA 4PSXA 2ZW5A 2HV2A 4A95A 4JXRA 4CAXA 1MJBA 1IYKA 3I3GA 4KUAA 1XE4A 4A31A 1YLEA 1LRZA 2PR8A 2YGWA 1BO4A 3VWDA 3I9SA 2Y0MA 1B87A 3F5BA 4NEXA 3JVNA 3OWCA 4NCZA 4MJ8A 2VI7A 4BBHA 2CNSA 3TCVA 4CAEA 1S5KA 1XIXA 2VQYA 4UFWA 3R9EA 4HNYB 4KOYA 1V0CA 5F48A 2Z3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P0H A;  4AVA A;  2HQY A;  2K5T A;  2P6E A;  2B4D A;  1KUV A;  2NMT A;  3CXQ A;  3DDD A;  3SHP A;  1Q2Y A;  3C26 A;  4JXQ A;  3FIX A;  4U5Y A;  2B4B A;  2GIV A;  2D4O A;  2J8N A;  2BUE A;  2ZPA A;  5IB0 A;  2J8M A;  5JQ4 A;  3FBU A;  4KLW A;  4II9 A;  4XNH C;  3D3S A;  1I1D A;  4HNX B;  4DNC A;  1KZF A;  4K30 A;  3V8I A;  1MJ9 A;  4H6U A;  4KOV A;  2JLM A;  2JDD A;  2OB0 A;  4GS4 A;  1S7K A;  2R1I A;  4YRH A;  5H84 A;  1M4D A;  3S6H A;  3EC4 A;  1R57 A;  3D2P A;  4ZBG A;  3SXN A;  1Y9W A;  1FY7 A;  1YGH A;  4OLL A;  4AVB A;  3QB8 A;  5EC4 A;  1MK4 A;  4HKF A;  2HUZ A;  2PC1 A;  2Z0Z A;  1OZP A;  1XMT A;  4U9Z A;  4XPK A;  4MBU A;  2ZXV A;  1V0C A;  2B4D B;  3BJ7 A;  4L89 A;  1S3Z A;  1IB1 E;  1GHE A;  4PSW A;  4H89 A;  2I79 A;  5KTC A;  3CXS A;  4KOR A;  1Y9K A;  3SXO A;  4FD7 A;  3GYA A;  3IWG A;  1S7N A;  2FCK A;  2WPW A;  3S6K A;  5C82 A;  4KOU A;  4UWI A;  3TO6 A;  1M1D A;  4F6A A;  4MY0 A;  4F0Y A;  1Q2D A;  2Q4Y A;  1P4N A;  2QIR A;  2IL4 A;  4KOT A;  1S60 A;  1IIC A;  2OU2 A;  4MI4 A;  2EVN A;  4OAE A;  2EUI A;  3W6S A;  4MHD A;  2FT0 A;  4M85 A;  2AJ6 A;  4E8O A;  4R9M A;  5GCN A;  5IX3 A;  3TFY A;  3MGD A;  4LX9 A;  3UY5 A;  1UFH A;  2ZW7 A;  2PR1 A;  3NE7 A;  2ARH A;  4PK3 A;  4B5P A;  5ISV A;  4QC6 A;  4UWJ A;  1IID A;  2B3V A;  3DNS A;  3BLN A;  2FL4 A;  4MY3 A;  4CS0 B;  1MJA A;  4QB9 A;  3FRM A;  2BSW A;  2GE3 A;  2RC4 A;  5DWM A;  2OH1 A;  3DR6 A;  3P2H A;  5J8C A;  5KTA A;  3PZJ A;  4U9Y A;  3FXT A;  2VXK A;  4AG9 A;  1XEB A;  3ZZI A;  4PK2 A;  4QVT A;  2ATR A;  1Z4R A;  2G3A A;  3RYO A;  3TT2 A;  3T9Y A;  3W6X A;  2JEV A;  3TOA A;  4YFJ A;  4UBR A;  4R3K A;  4JD6 A;  3IGR A;  5FVJ A;  4BMH A;  4HNW B;  2WPX A;  2Z10 A;  1U6M A;  3TOB A;  2G0B A;  1M4G A;  5KTD A;  4B5P B;  2C27 A;  3D2M A;  3EY5 A;  1QSO A;  4ORF A;  3QAH A;  3R9F A;  5EBV A;  1YK3 A;  4M3S A;  2VZZ A;  1ON0 A;  4ONU A;  2JDC A;  2REE A;  1SQH A;  2Q44 A;  1B6B A;  4AVC A;  3TO7 A;  2F5I A;  1BOB A;  2OZH A;  3TO9 A;  1QST A;  2PQ8 A;  1YVO A;  4I49 A;  4FD5 A;  3KKW A;  4NSQ A;  2PDO A;  5CNP A;  2REF A;  3EFA A;  5J8F A;  3ZJ0 A;  2Z11 A;  4KOX A;  4XPL A;  1S7L A;  1PUA A;  5HH1 A;  2B3U A;  2I00 A;  1QSN A;  2X7B A;  3R9G A;  4JWP A;  3DR8 A;  1Q2C A;  3R96 A;  2Q0Y A;  4UA3 A;  4KLV A;  4CAW A;  2P6G A;  4YGO A;  3T90 A;  1CJW A;  3H4Q A;  3FB3 A;  3GY9 A;  1YX0 A;  2FIA A;  5F47 A;  2R8V A;  5DWN A;  1PU9 A;  1VKC A;  4Y49 B;  2KCW A;  3TE4 A;  3G3S A;  3E0K A;  1NE9 A;  2VBQ A;  2VEZ A;  4KVX A;  3G8W A;  4IUS A;  3R1K A;  4QUS A;  4R57 A;  4KZT A;  5JPH A;  2PRB A;  3PP9 A;  3W91 A;  4E2A A;  3R95 A;  4R3L A;  3B8G A;  1RO5 A;  2J8R A;  2CNT A;  3S6G A;  3S6F A;  4E0A A;  1I21 A;  4KVM E;  1YVK A;  4X5K A;  3P2F A;  4L8A A;  4FD4 A;  1J4J A;  4KVO E;  2CY2 A;  2B5G B;  3N7Z A;  5HMN A;  5I0C A;  5C88 A;  2FIW A;  1QSR A;  1RXT A;  2O28 A;  2R7H A;  2Q4V A;  4OAD A;  1NSL A;  1I12 A;  4NF1 A;  3FNC A;  1KUY A;  1CM0 A;  2P6F A;  2FS5 A;  1YRE A;  4PV6 A;  4CRY B;  2P0W A;  3CXP A;  1L0C A;  2QEC A;  2FSR A;  4AG7 A;  3TTH A;  2ZW4 A;  5E96 A;  2FXF A;  4XPD C;  5F49 A;  3VWE A;  3DSB A;  1K4J A;  2H5M A;  4IF5 A;  2DXQ A;  1KUX A;  4CAV A;  2CNM A;  4NXY A;  3EXN A;  4KOW A;  4Y49 C;  2D4P A;  3FYN A;  4LUA A;  4R87 A;  4QBJ A;  1IYL A;  3F8K A;  3LOD A;  4CRZ B;  2A4N A;  1M4I A;  5F46 A;  3BJ8 A;  3WR7 A;  3PGP A;  1WWZ A;  2GAN A;  2VZY A;  4RS2 A;  1YR0 A;  2Q04 A;  4J3G A;  2ZW6 A;  2BEI A;  1XF8 A;  3K9U A;  4H6Z A;  2AE6 A;  1Z4E A;  3F0A A;  1M44 A;  2B5G A;  5IV0 A;  4XPD B;  2QML A;  1S7F A;  5H86 A;  1TIQ A;  2BL1 A;  1NMT A;  2OZU A;  4FD6 A;  3GKR A;  4XNH B;  3LD2 A;  4RI1 A;  1QSM A;  4AB7 A;  2G3T A;  4B5O A;  1VHS A;  2PSW A;  1Y7R A;  2FE7 A;  3JUW A;  2R98 A;  4JLY A;  4KOS A;  1WK4 A;  1Z9U A;  4JJX A;  4EVY A;  1N71 A;  2Q7B A;  3EO4 A;  3D8P A;  2B58 A;  2OZG A;  4PSX A;  2ZW5 A;  2HV2 A;  4JXR A;  4CAX A;  1MJB A;  1IYK A;  3I3G A;  4KUA A;  1XE4 A;  1YLE A;  1LRZ A;  2PR8 A;  1BO4 A;  3VWD A;  3I9S A;  2Y0M A;  1B87 A;  3F5B A;  4NEX A;  3JVN A;  3OWC A;  4NCZ A;  4MJ8 A;  2VI7 A;  2CNS A;  3TCV A;  1S5K A;  1XIX A;  2VQY A;  3R9E A;  4HNY B;  4KOY A;  4KUB A;  5F48 A; 
#chains in the Genus database with same CATH topology
 5HVH A;  1P0H A;  2Q51 A;  2AFO A;  4KSA A;  2HQY A;  2K5T A;  2P6E A;  2PE3 A;  4AVA A;  4CYO A;  2B4D A;  1KUV A;  5LRK A;  2NMT A;  3CXQ A;  4DYO A;  2PJ5 A;  3DDD A;  3SHP A;  1Q2Y A;  1CP6 A;  1F2O A;  3C26 A;  1HDU A;  4JXQ A;  3FIX A;  4Q7A A;  5J1Q A;  2ZEE A;  4U5Y A;  3QNV A;  4X8I A;  2B4B A;  1QMU A;  2GIV A;  4C2Z A;  1X10 A;  3TC8 A;  4PXB A;  2D4O A;  4UF4 A;  4X3R A;  3FX6 A;  2J8N A;  2BUE A;  2ZPA A;  1M4L A;  1YW4 A;  2J8M A;  4KS9 A;  5IB0 A;  3JRU A;  5JQ4 A;  3FBU A;  4KLW A;  2IQ6 A;  2PVV A;  4II9 A;  1XRY A;  4H2K A;  3H8F A;  4XNH C;  3D3S A;  1I1D A;  2GLF A;  4HNX B;  1FT7 A;  3KHX A;  1KZF A;  2PJA A;  5G22 A;  4DNC A;  4K30 A;  3RBU A;  1DTD A;  3V8I A;  1MJ9 A;  4H6U A;  1LAP A;  4KOV A;  2JLM A;  4EWT A;  1KWM A;  5JM6 A;  1ZO0 A;  4NGS A;  2BOA A;  4ZY1 A;  2JDD A;  3KQZ A;  2OB0 A;  4GS4 A;  1S7K A;  2R1I A;  4YRH A;  5H84 A;  3B35 A;  1M4D A;  3IJ3 A;  3S6H A;  3EC4 A;  1VIX A;  1R57 A;  1ELL P;  3D2P A;  4ZBG A;  4CGL A;  3CPA A;  2PIY A;  3SXN A;  2XEF A;  1Y9W A;  3PFE A;  4KSF A;  1FY7 A;  5G1Z A;  3CZX A;  4JZ0 A;  1YGH A;  4OLL A;  4AVB A;  3QB8 A;  5EC4 A;  2IMO A;  1MK4 A;  4CYP A;  3IWE A;  3D66 A;  4HKF A;  2HUZ A;  2PC1 A;  4OIW A;  2Z0Z A;  1VGY A;  1OZP A;  1BPN A;  1XMT A;  3IO1 A;  4U9Z A;  4XPK A;  4MBU A;  2ZXV A;  2B4D B;  3WAB A;  3BJ7 A;  3LMS A;  1CPX A;  2ZEN A;  4L89 A;  2ZED A;  1S3Z A;  4PPZ A;  1IB1 E;  1GHE A;  4OC1 A;  4DUK A;  4PSW A;  5ELY A;  4H89 A;  2I79 A;  3LAC A;  1Y0R A;  3CXS A;  5KTC A;  3D7G A;  2ODF A;  4EME A;  3BXM A;  3NH8 A;  3IEH A;  4IAV A;  4Q38 A;  4KOR A;  1BAV A;  3B7I A;  1R43 A;  1Y9K A;  3D7D A;  4NGM A;  3SXO A;  4FD7 A;  2G9D A;  3GYA A;  5A27 A;  3IWG A;  3H5Z A;  1S7N A;  1Z8T A;  2FCK A;  2WPW A;  3S6K A;  4F0X A;  5K8O A;  4R6T A;  5C82 A;  1TKH A;  3IC1 A;  2ZEF A;  4NGR A;  2PJ0 A;  4KOU A;  3B3C A;  4UFX A;  4YU9 A;  4UWI A;  4ZGY B;  3TO6 A;  1M1D A;  4F6A A;  4MY0 A;  1Z5R A;  1LCP A;  3CT9 A;  3KI9 A;  2EO8 A;  1TF9 A;  1Y0Y A;  4F0Y A;  1Q2D A;  2Q4Y A;  1P4N A;  2QIR A;  2DPT A;  2FVG A;  2IL4 A;  3WC7 A;  2C6G A;  1S60 A;  3HLP A;  4KOT A;  3VAR A;  4B14 A;  1OBR A;  1IIC A;  2OU2 A;  4MI4 A;  2EVN A;  4OAE A;  3PBB A;  3V7Z A;  2EUI A;  2GLJ A;  4TNU A;  3W6S A;  4MHD A;  1CPS A;  2FT0 A;  4M85 A;  2AJ6 A;  1LAM A;  3NH5 A;  2PJC A;  4E8O A;  3DGV A;  1HEE A;  3KQX A;  4R9M A;  2V77 A;  3LWU A;  3ISZ A;  1XFO A;  5GCN A;  4A32 A;  5IX3 A;  3TFY A;  3GLJ A;  3NE8 A;  3H8G A;  4MMO A;  2PRQ A;  3MGD A;  1ZLI A;  4C7I A;  4LX9 A;  2WYR A;  2YND A;  4ZI6 A;  1CG2 A;  2YNC A;  3UY5 A;  4CGN A;  1QQ9 A;  1UFH A;  2ZW7 A;  5CBM A;  2PR1 A;  3S9M A;  4C7H A;  3NE7 A;  2ARH A;  4PK3 A;  4B5P A;  3IFE A;  5ISV A;  4FWU A;  4QC6 A;  4UWJ A;  1IID A;  2B3V A;  3DNS A;  2V8H A;  3BLN A;  4LQG A;  3JTK A;  4R8F A;  2FL4 A;  1VHO A;  4MY3 A;  4CS0 B;  4MFJ A;  1MJA A;  4MFK A;  4QB9 A;  2PVW A;  3FRM A;  2BSW A;  2GE3 A;  2PJ4 A;  2RC4 A;  2PCU A;  4MFQ A;  4BD9 A;  5DWM A;  3D4U A;  3TX8 A;  4B12 A;  1AYE A;  2OH1 A;  2XEI A;  3DR6 A;  4MCP A;  3P2H A;  4NGQ A;  4RUH A;  5J8C A;  3PZJ A;  5KTA A;  4U9Y A;  3FXT A;  4B10 A;  2VXK A;  2AFZ A;  2ZOG A;  4OKO A;  1IY7 A;  4AG9 A;  5HVF A;  1XEB A;  3ZZI A;  4PK2 A;  4QVT A;  2ATR A;  1Z4R A;  2PJ2 A;  3D68 A;  4P4I A;  3PB6 X;  4P44 A;  2G3A A;  4MHN A;  4KSI A;  4WJB A;  3RYO A;  4OID A;  3TT2 A;  2GU2 A;  2PJ7 A;  2HC9 A;  2POK A;  4Q36 A;  3ZJ0 A;  4UEZ A;  3T9Y A;  3W6X A;  1AUG A;  2JEV A;  3TOA A;  2F7V A;  4UBR A;  1IOF A;  4YFJ A;  2GRE A;  1H8L A;  4UIB A;  4R3K A;  2EK8 A;  8CPA A;  3A9L A;  1XMB A;  4JD6 A;  1EE3 P;  3IGR A;  4MCR A;  5FVJ A;  4BMH A;  3DLJ A;  4HNW B;  2WPX A;  2Z10 A;  1U6M A;  5AGE A;  3TOB A;  1XBU A;  2G0B A;  4M6H A;  4PXD A;  4UEE A;  1M4G A;  5KTD A;  4B5P B;  2C27 A;  3D2M A;  3EY5 A;  3S9L A;  1QSO A;  1JQG A;  4ORF A;  3QAH A;  3V38 A;  2JBK A;  3R9F A;  4UIA A;  3SJX A;  2Q4Z A;  5EBV A;  1YK3 A;  5BWA B;  4M3S A;  2VZZ A;  1ON0 A;  4Z65 A;  4ONU A;  2Q7S A;  2JDC A;  3GUX A;  2REE A;  3PBE A;  4NJR A;  4P4J A;  1SQH A;  1BLL E;  3N5F A;  2Q44 A;  3PFO A;  2CF4 A;  4P4B A;  5LYI A;  2JEW A;  4DJL A;  4HPS A;  1B6B A;  4AVC A;  3TO7 A;  1Q7L A;  1DE4 C;  3PEI A;  2F5I A;  2AFX A;  1BOB A;  2Z3O A;  4P4D A;  3SJE A;  4C2Y A;  5AG7 A;  2OZH A;  1TKF A;  3TO9 A;  2EBJ A;  1QST A;  4OC0 A;  4OME A;  2PQ8 A;  1YVO A;  4I49 A;  1ARM A;  4P45 A;  1TF8 A;  2Q43 A;  4FD5 A;  3B3V A;  2DF5 A;  2BCO A;  4OP4 A;  5K8M A;  3KKW A;  4NSQ A;  3NH4 A;  2PDO A;  1LAN A;  5CNP A;  2REF A;  3EFA A;  5J8F A;  3QAY A;  4NGP A;  2QVP A;  5LYD A;  2DEA A;  2CTC A;  2Z11 A;  3D67 A;  2QJ8 A;  3FVL A;  3NFZ A;  3KR4 A;  4KOX A;  2EWB A;  4XPL A;  1S7L A;  1PUA A;  1UWY A;  2B3U A;  1GYT A;  2I00 A;  1QSN A;  2V8V A;  2X7B A;  4PXE A;  5HH1 A;  3BI0 A;  3FJU A;  4JWP A;  3R9G A;  2XEJ A;  3DR8 A;  5LRJ A;  1Q2C A;  4A38 A;  3PB8 X;  3R96 A;  4AXV A;  2Q0Y A;  3FEC A;  4M6I A;  4MFZ A;  4UA3 A;  4CPA A;  4UCP A;  4KLV A;  4CAF A;  3SJF A;  2Z3N A;  4CAW A;  2C6C A;  1F2P A;  2P6G A;  4YGO A;  2DPS A;  1CJW A;  3FED A;  3T90 A;  4A30 A;  3H4Q A;  2RB7 A;  3FB3 A;  5AG6 A;  2JBJ A;  4A94 A;  3GY9 A;  3IIB A;  4OC2 A;  4IK2 A;  3PRT A;  4P4E A;  1YX0 A;  4PQA A;  2FIA A;  5F47 A;  2O53 A;  2R8V A;  7CPA A;  2Z3L A;  1YW6 A;  3K2K A;  1JWQ A;  4CGM A;  5DWN A;  3H8E A;  1PU9 A;  1VKC A;  4Y49 B;  4BIN A;  2KCW A;  3WC6 A;  3G3S A;  4ZX8 A;  3TE4 A;  3E0K A;  3KL9 A;  1NE9 A;  3IU2 A;  2CIJ A;  5K8P A;  4C2X A;  2VBQ A;  3RNZ A;  2VEZ A;  4NJQ A;  4EFD A;  5D8N A;  4KUB A;  4OC4 A;  4G1P A;  4KVX A;  3G8W A;  4ZY2 A;  4IUS A;  3R1K A;  4QUS A;  4R57 A;  4A2Z A;  3BI1 A;  4KZT A;  5JPH A;  2YNC C;  5HXD A;  2PRB A;  3PB7 X;  3PP9 A;  3W91 A;  4E2A A;  3R95 A;  4NGT A;  4R3L A;  3SJG A;  3B8G A;  5EMI A;  3FH4 A;  1RO5 A;  5DS0 A;  2F8H A;  2J8R A;  2ZEO A;  5AG4 A;  5LYL A;  2CNT A;  1VHE A;  4TWE A;  4CYQ A;  4ZX9 A;  2ZEG A;  1X12 A;  3S6F A;  3S6G A;  3WC5 A;  5JH9 A;  4CGO A;  2J9A A;  4A33 A;  4E0A A;  2PJB A;  3GIU A;  2C6P A;  3T8W A;  1I21 A;  4KVM E;  1YVK A;  4X5K A;  3P2F A;  4L8A A;  4FD4 A;  4CGP A;  1J4J A;  4KVO E;  1HDQ A;  2CY2 A;  2B5G B;  3N7Z A;  4B13 A;  5HMN A;  5I0C A;  5C88 A;  4OC5 A;  4GM5 A;  2AFU A;  2FIW A;  4MXU A;  4R76 A;  3IWW A;  1QSR A;  1RXT A;  2O28 A;  2R7H A;  2Q4V A;  2HB6 A;  3KHZ A;  4OAD A;  4W9Y A;  1NSL A;  2ZEH A;  4P4F A;  1I12 A;  4NF1 A;  4A37 A;  1CP7 A;  4F9U A;  2AFW A;  2AFS A;  1CBX A;  3FNC A;  1XOV A;  1XJO A;  3D7F A;  1KUY A;  1CM0 A;  2P6F A;  2FS5 A;  4FAI A;  1YRE A;  2C1C A;  3RO0 A;  3PB4 X;  3KZW A;  4MHY A;  4PV6 A;  4CRY B;  2P0W A;  3CXP A;  1L0C A;  2QEC A;  5HVG A;  2FSR A;  4AG7 A;  2AFM A;  1ZG8 A;  3FF3 A;  3TTH A;  4X2T A;  4MFL A;  2PJ9 A;  4R7M A;  2OR4 A;  2QYV A;  2ZW4 A;  5E96 A;  3KAS A;  2FXF A;  4ZY0 A;  1ZG7 A;  4XPD C;  2O4H A;  2WUU A;  5F49 A;  3VWE A;  2V8G A;  2Z3M A;  3DSB A;  3K9T A;  1K4J A;  5A28 A;  2H5M A;  4CYN A;  4IF5 A;  1Z8L A;  4RN7 A;  3VAT A;  2DXQ A;  1KUX A;  5K8N A;  4MHP A;  1Z8X A;  1YME A;  4MCQ A;  4CAV A;  3ISX A;  2CNM A;  4NXY A;  3EXN A;  5IB9 A;  4KOW A;  4Y49 C;  2PJ3 A;  1CX8 A;  2ZEM A;  2D4P A;  3FYN A;  2XEG A;  4LUA A;  4UFV A;  4R87 A;  6CPA A;  4QBJ A;  1LFW A;  4C68 A;  1IYL A;  4B6Z A;  3F8K A;  3LOD A;  4CRZ B;  4JYW A;  2A4N A;  3KR5 A;  4FBE A;  1YLO A;  2Z3K A;  1M4I A;  5F46 A;  1ZG9 A;  3BJ8 A;  3HUV A;  3WR7 A;  4B11 A;  3PGP A;  1WWZ A;  4LQ6 A;  2GAN A;  2VZY A;  3KGQ A;  4RS2 A;  1YR0 A;  2PIZ A;  4M6G A;  2Q04 A;  4MFP A;  4UEF A;  2CXA A;  2V8D A;  2PJ6 A;  3NA6 A;  1AMP A;  4J3G A;  2ZW6 A;  2BEI A;  1XF8 A;  4WWV A;  1PCA A;  2OOT A;  3K9U A;  4H6Z A;  2AE6 A;  1Z4E A;  2IJZ A;  4ZYQ A;  1ELM P;  3F0A A;  4OC3 A;  1M44 A;  1LOK A;  2B5G A;  4IHM A;  4P10 A;  4YWY A;  1Z2L A;  3RAM A;  5IV0 A;  2ANP A;  4XPD B;  2QML A;  2NSM A;  1S7F A;  3PB9 X;  4FUU A;  5H86 A;  3L2N A;  3SI2 A;  2WSA A;  1TIQ A;  2BL1 A;  2BO9 A;  4UCN A;  1IGB A;  1ARL A;  1NMT A;  4GXH A;  2CTB A;  4MHZ A;  2OZU A;  5G21 A;  4FD6 A;  3GKR A;  2WZN A;  4XNH B;  3B3W A;  1BPM A;  3LD2 A;  4O23 A;  4RI1 A;  3MRU A;  4P6Y A;  2NYQ A;  1QSM A;  2GFQ A;  4AB7 A;  2VL1 A;  2G3T A;  1A2Z A;  2PJ1 A;  4K3N A;  3SI0 A;  3CDX A;  4B5O A;  1F57 A;  5G20 A;  1VHS A;  2ABZ A;  2PSW A;  4NGN A;  2PJ8 A;  1Y7R A;  1ZLH A;  4ONW A;  2FE7 A;  3FEE A;  1IOI A;  5AG5 A;  1Y7E A;  3JUW A;  3B3S A;  2R98 A;  2YNE A;  5I4M A;  3VH9 A;  4JLY A;  4UCM A;  4KOS A;  1WK4 A;  4PXC A;  1Z9U A;  4JJX A;  4EVY A;  1FNO A;  1PYT B;  1N71 A;  1TXR A;  2Q7B A;  3EO4 A;  3D8P A;  3CPX A;  2ZEL A;  2B58 A;  1NSA A;  3IU1 A;  2OZG A;  4PSX A;  2ZW5 A;  5JGF A;  2HV2 A;  3S9N A;  2ZOF A;  4A95 A;  3BHX A;  3MN8 A;  4JXR A;  1YQE A;  5CPA A;  5D29 A;  4CAX A;  1MJB A;  1IYK A;  3I3G A;  4KUA A;  4MRI A;  1R3N A;  3D7H A;  1XE4 A;  4F9V A;  4MCS A;  2EK9 A;  2I3C A;  1YSJ A;  4F8Z A;  3WT4 A;  4A31 A;  3GB0 A;  4A39 A;  1YLE A;  2RFH A;  1LRZ A;  1Z8W A;  2PR8 A;  2YGW A;  1BO4 A;  3B3T A;  4NFR A;  3I9S A;  1IU8 A;  2Y0M A;  3VWD A;  5F09 A;  1B87 A;  3F5B A;  4NEX A;  2ZEP A;  3JVN A;  3OWC A;  4NCZ A;  4MJ8 A;  2VI7 A;  4BBH A;  2CNS A;  5LRG A;  3SI1 A;  3TCV A;  4CAE A;  1RTQ A;  1S5K A;  1XIX A;  2VQY A;  4UFW A;  3R9E A;  5LYF A;  4HNY B;  1TKJ A;  3I1U A;  5THW A;  3B2Y A;  4KOY A;  1V0C A;  3FMC A;  5F48 A;  3RZA A;  2Z3P A; 
#chains in the Genus database with same CATH homology
 1P0H A;  4KSA A;  4AVA A;  2HQY A;  2K5T A;  2P6E A;  4CYO A;  2B4D A;  1KUV A;  2NMT A;  3CXQ A;  3DDD A;  3SHP A;  1Q2Y A;  3C26 A;  4JXQ A;  3FIX A;  4U5Y A;  2B4B A;  2GIV A;  4C2Z A;  2D4O A;  2J8N A;  2BUE A;  2ZPA A;  4KS9 A;  2J8M A;  5IB0 A;  5JQ4 A;  3FBU A;  4KLW A;  4II9 A;  4XNH C;  3D3S A;  1I1D A;  4HNX B;  5G22 A;  4DNC A;  1KZF A;  4K30 A;  3V8I A;  1MJ9 A;  4H6U A;  4KOV A;  2JLM A;  1ZO0 A;  2JDD A;  2OB0 A;  4GS4 A;  1S7K A;  2R1I A;  4YRH A;  5H84 A;  1M4D A;  3S6H A;  3EC4 A;  1R57 A;  3D2P A;  4ZBG A;  4CGL A;  3SXN A;  1Y9W A;  4KSF A;  1FY7 A;  5G1Z A;  1YGH A;  4OLL A;  4AVB A;  3QB8 A;  5EC4 A;  1MK4 A;  4CYP A;  3IWE A;  4HKF A;  2HUZ A;  2PC1 A;  2Z0Z A;  1OZP A;  1XMT A;  4U9Z A;  4XPK A;  4MBU A;  2ZXV A;  2B4D B;  3BJ7 A;  4L89 A;  1S3Z A;  1IB1 E;  1GHE A;  4PSW A;  4H89 A;  2I79 A;  5KTC A;  3CXS A;  4Q38 A;  4KOR A;  1Y9K A;  3SXO A;  4FD7 A;  3GYA A;  5A27 A;  3IWG A;  3H5Z A;  1S7N A;  2FCK A;  2WPW A;  4F0X A;  3S6K A;  5C82 A;  4KOU A;  4UFX A;  4UWI A;  4ZGY B;  3TO6 A;  1M1D A;  4F6A A;  4MY0 A;  4F0Y A;  1Q2D A;  2Q4Y A;  1P4N A;  2QIR A;  2DPT A;  2IL4 A;  4KOT A;  1S60 A;  4B14 A;  1IIC A;  2OU2 A;  4MI4 A;  2EVN A;  4OAE A;  2EUI A;  3W6S A;  4MHD A;  2FT0 A;  4M85 A;  2AJ6 A;  4E8O A;  4R9M A;  5GCN A;  4A32 A;  5IX3 A;  3TFY A;  3MGD A;  4C7I A;  4LX9 A;  2YND A;  4CGN A;  2YNC A;  3UY5 A;  1UFH A;  2ZW7 A;  2PR1 A;  4C7H A;  3NE7 A;  2ARH A;  4PK3 A;  4B5P A;  5ISV A;  4QC6 A;  4UWJ A;  1IID A;  2B3V A;  3DNS A;  3BLN A;  3JTK A;  2FL4 A;  4MY3 A;  4CS0 B;  4MFJ A;  1MJA A;  4MFK A;  4QB9 A;  3FRM A;  2BSW A;  2GE3 A;  2RC4 A;  4MFQ A;  5DWM A;  4B12 A;  2OH1 A;  3DR6 A;  3P2H A;  5J8C A;  5KTA A;  3PZJ A;  4U9Y A;  3FXT A;  4B10 A;  2VXK A;  4AG9 A;  1XEB A;  3ZZI A;  4PK2 A;  4QVT A;  2ATR A;  1Z4R A;  2G3A A;  3RYO A;  3TT2 A;  4Q36 A;  3T9Y A;  3W6X A;  2JEV A;  3TOA A;  4YFJ A;  4UBR A;  4R3K A;  3A9L A;  4JD6 A;  3IGR A;  5FVJ A;  4BMH A;  4HNW B;  2WPX A;  2Z10 A;  1U6M A;  5AGE A;  3TOB A;  2G0B A;  1M4G A;  5KTD A;  4B5P B;  2C27 A;  3D2M A;  3EY5 A;  1QSO A;  4ORF A;  3QAH A;  3R9F A;  5EBV A;  1YK3 A;  5BWA B;  4M3S A;  2VZZ A;  1ON0 A;  4ONU A;  2JDC A;  2REE A;  1SQH A;  2Q44 A;  1B6B A;  4AVC A;  3TO7 A;  2F5I A;  4C2Y A;  1BOB A;  2Z3O A;  5AG7 A;  2OZH A;  3TO9 A;  1QST A;  2PQ8 A;  1YVO A;  4I49 A;  4FD5 A;  3KKW A;  4NSQ A;  2PDO A;  5CNP A;  2REF A;  3EFA A;  5J8F A;  3ZJ0 A;  2Z11 A;  4KOX A;  4XPL A;  1S7L A;  1PUA A;  5HH1 A;  2B3U A;  2I00 A;  1QSN A;  2X7B A;  3R9G A;  4JWP A;  3DR8 A;  1Q2C A;  3R96 A;  2Q0Y A;  4UA3 A;  4MFZ A;  4UCP A;  4KLV A;  4CAF A;  2Z3N A;  4CAW A;  2P6G A;  4YGO A;  2DPS A;  1CJW A;  3T90 A;  4A30 A;  3H4Q A;  3FB3 A;  5AG6 A;  3GY9 A;  1YX0 A;  2FIA A;  5F47 A;  2R8V A;  2Z3L A;  4CGM A;  5DWN A;  1PU9 A;  1VKC A;  4Y49 B;  2KCW A;  3TE4 A;  3G3S A;  3E0K A;  1NE9 A;  3IU2 A;  4C2X A;  2VBQ A;  2VEZ A;  4KUB A;  4KVX A;  3G8W A;  4IUS A;  3R1K A;  4QUS A;  4R57 A;  4A2Z A;  4KZT A;  5JPH A;  2YNC C;  2PRB A;  3PP9 A;  3W91 A;  4E2A A;  3R95 A;  4R3L A;  3B8G A;  1RO5 A;  2J8R A;  5AG4 A;  2CNT A;  4CYQ A;  3S6G A;  3S6F A;  4CGO A;  4E0A A;  4A33 A;  1I21 A;  4KVM E;  1YVK A;  4X5K A;  3P2F A;  4L8A A;  4FD4 A;  4CGP A;  1J4J A;  4KVO E;  2CY2 A;  2B5G B;  3N7Z A;  4B13 A;  5HMN A;  5I0C A;  5C88 A;  2FIW A;  1QSR A;  1RXT A;  2O28 A;  2R7H A;  2Q4V A;  4OAD A;  1NSL A;  1I12 A;  4NF1 A;  3FNC A;  1KUY A;  1CM0 A;  2P6F A;  2FS5 A;  1YRE A;  4PV6 A;  4CRY B;  2P0W A;  3CXP A;  1L0C A;  2QEC A;  2FSR A;  4AG7 A;  3TTH A;  4MFL A;  2ZW4 A;  5E96 A;  2FXF A;  4XPD C;  2WUU A;  5F49 A;  3VWE A;  2Z3M A;  3DSB A;  1K4J A;  5A28 A;  2H5M A;  4CYN A;  4IF5 A;  2DXQ A;  1KUX A;  4CAV A;  2CNM A;  4NXY A;  3EXN A;  4KOW A;  4Y49 C;  2D4P A;  3FYN A;  4LUA A;  4UFV A;  4R87 A;  4QBJ A;  4C68 A;  1IYL A;  3F8K A;  3LOD A;  4CRZ B;  2A4N A;  2Z3K A;  1M4I A;  5F46 A;  3BJ8 A;  3WR7 A;  4B11 A;  3PGP A;  1WWZ A;  2GAN A;  2VZY A;  4RS2 A;  1YR0 A;  2Q04 A;  4MFP A;  2CXA A;  4J3G A;  2ZW6 A;  2BEI A;  1XF8 A;  3K9U A;  4H6Z A;  2AE6 A;  1Z4E A;  3F0A A;  1M44 A;  2B5G A;  5IV0 A;  4XPD B;  2QML A;  1S7F A;  5H86 A;  2WSA A;  1TIQ A;  2BL1 A;  4UCN A;  1NMT A;  2OZU A;  5G21 A;  4FD6 A;  3GKR A;  4XNH B;  3LD2 A;  4RI1 A;  1QSM A;  4AB7 A;  2G3T A;  4B5O A;  5G20 A;  1VHS A;  2PSW A;  1Y7R A;  2FE7 A;  5AG5 A;  3JUW A;  2R98 A;  2YNE A;  4JLY A;  4UCM A;  4KOS A;  1WK4 A;  1Z9U A;  4JJX A;  4EVY A;  1N71 A;  2Q7B A;  3EO4 A;  3D8P A;  2B58 A;  3IU1 A;  2OZG A;  4PSX A;  2ZW5 A;  2HV2 A;  4A95 A;  4JXR A;  4CAX A;  1MJB A;  1IYK A;  3I3G A;  4KUA A;  1XE4 A;  4A31 A;  1YLE A;  1LRZ A;  2PR8 A;  2YGW A;  1BO4 A;  3VWD A;  3I9S A;  2Y0M A;  1B87 A;  3F5B A;  4NEX A;  3JVN A;  3OWC A;  4NCZ A;  4MJ8 A;  2VI7 A;  4BBH A;  2CNS A;  3TCV A;  4CAE A;  1S5K A;  1XIX A;  2VQY A;  4UFW A;  3R9E A;  4HNY B;  4KOY A;  1V0C A;  5F48 A;  2Z3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...