2FSUA

Crystal structure of the phnh protein from escherichia coli
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
170
Chain Sequence
b'QDAQHSFRRLLKAMSEPGVIVALHQLKRGWQPLNIATTSVLLTLADNDTPVWLSTPLNNDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEQLNALSGATLILQVASLSGGRMLRLTGEERMIAPQLPECILHELTERPHPFPLGIDLILTCGERLLAIPRTTHVEVC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phnH
publication title Crystal structure of PhnH: an essential component of carbon-phosphorus lyase in Escherichia coli.
pubmed doi rcsb
molecule tags Structural genomics, unknown function
total genus 47
structure length 170
sequence length 183
ec nomenclature ec 2.7.8.37: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase.
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05845 PhnH Bacterial phosphonate metabolism protein (PhnH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11310 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fsuA00
4XB6B 2FSUA
chains in the Genus database with same CATH superfamily
3GLFE 5BSEA 4ZA2A 5K3FA 2H0AA 1G3UA 2DHDA 1KSJA 3WB9A 3LLCA 4EG7A 3HXKA 4G0WA 4ANFA 1COWA 1GP2A 1U1EA 2FQYA 2XODA 2YXLA 5SZJA 3ZHCA 3VPBA 2BGJA 4M9SA 1WPGA 3FDXA 3TLKA 4E46A 1EUQA 1FQJA 2HSDA 2QV0A 1WMAA 5BSVA 3OPYA 3O3OB 3L5OA 3SJCA 2UZ4A 4B46A 2R97A 5HOQA 1RQRA 4MRRA 4F6CA 2QN9A 2Q0HA 1GADO 1O9BA 2AE2A 1SD5A 4E5DA 1AQLA 2ZSHA 1J25A 1FJHA 4INPA 3RHSA 2BLNA 3T5DA 3JWIA 4BLQA 2IBTA 1SC6A 3BTVA 1YJCA 4DKXA 2JAXA 2PUCA 1USWA 2I2BA 2O59A 4AUEA 4C76A 3T3DA 4RCZA 3RABA 3WK8A 1QUEA 3G88A 4EMSA 1DIOB 1YBAA 4QNNA 5EI5A 1IONA 3DOIA 5GOTA 1MAAA 2XYQA 3QUCA 1GAXA 4JH0A 3K5IA 4XJVA 4RA9B 1ZLYA 2WWGA 1FB5A 1HWYA 2PJUA 3INYA 3JQBA 1ZK0A 2A33A 1ORHA 4M4SA 4F6RB 4HAZA 4NCIA 4ADSG 2DOKA 1OIXA 2E18A 4RTQA 5HKOA 1SHJA 5LDDC 1RQLA 3WNVA 4LXIA 5CFNA 2XNHA 1WX1A 5EHXA 4LYHA 3DOHA 1ZU4A 1UP6A 5IC6A 4P2BA 4F9GA 1GUZA 2X0IA 3BSWA 5HIAA 4XFJA 3WAJA 3HHEA 1IVSA 2X22A 5IPFA 2Q4EA 1A4UA 2DPGA 2E4VA 4V0NA 3ZDZB 4CEIB 1E9EA 2FTKE 1KZYC 4OI2A 1NX6A 4PCVA 2B7LA 3K0FA 1Q77A 2WYUA 3JAWB 5EPOA 3KXDA 4WY5A 3T5PA 4QBHA 4ML3A 2DHQA 4LNUB 4LGVA 5JQGA 5A9RA 4F84A 1G6OA 3CV3A 1Y98A 3BBLA 4H3VA 4E5YA 1BWSA 4P34A 4MP8A 4A4DA 3FVVA 4S04A 4ER0A 3I2IA 1Z62A 4ETMA 3PYLA 3OOSA 4DCCA 3ZUGA 1H2AS 4QFMA 3BK7A 2BMDA 3O8NA 3EGWA 1RPNA 4H60A 1W44A 5HE8A 2JIOA 1KJJA 2F2TA 1LKZA 1PJZA 3NNNA 1ZOLA 2R00C 3TFQA 3N2EA 4B7XA 4H7PA 3IOMA 3IV7A 4PZ0A 3V1MA 1EHIA 4ASUA 4DMMA 3KR9A 5LKAA 2FZEA 3P5BA 1HT3A 3GLVA 2PMBA 3R1IA 2CVFA 5D3QA 2JLRA 2Z3ZA 1NVUQ 1YFZA 1NM5A 2PSSA 4D4IA 1PDVA 3RYCA 3GZNA 4LHVA 1OASA 5C4IA 1JTFA 1VPWA 1XX6A 2CDRA 2Q7XA 2ZRJA 4Z99A 3TTXA 3M34A 4INJA 3RASA 1CHNA 6REQB 1NVVQ 4PRYA 2G9VA 5IH3A 3F96A 4C1BA 2RGYA 3GCXA 4NU8X 4LMRA 3C8MA 4F9TA 2PGIA 1FDTA 1WHTB 4B2YA 4KFCA 1T8RA 1U5BB 4CM7A 1JALA 2G17A 3QA9A 2VYNA 4WOBA 3KFLA 4GYKA 1FP4A 1H42A 1Y33E 2ONZA 4TS3A 3V8VA 1OTYA 4CL0A 4CRWB 1G4HA 3BMCB 1KO5A 1D09A 5JARA 2YRWA 3CX8A 1S2OA 4OBWA 3WHKA 2E48A 3GPIA 2ZU0C 3O8QA 4MARA 2ECKA 1XTKA 1HDIA 2X15A 2CMHA 3I09A 3PFNA 4Q48A 4AXXA 1VL2A 2LCFA 1D9XA 2A6PA 4DVGA 2A0UA 4DIBA 1N5KA 2YOFA 1PR5A 2JK0A 1Y7PA 5KNLA 2NSDA 3OF2A 4JEIA 1VPEA 3AYZB 3NDRA 2FN3A 4Y8VA 1RJFA 4F5YA 5F78A 1OXXK 1PZFA 2NO4A 4R83A 3OEWA 1MBZA 3FOZA 1IPHA 2EW8A 3EGVA 2CYCA 3TOCA 4YRCA 4UJ3A 4QIHA 1WVMA 4X1YA 5H4GA 3N6VA 1WUTA 5EKTA 4CCYB 7REQA 1N3LA 4E3ZA 2AHOA 3G9QA 4HZUA 4KV9A 3SEQA 3PLNA 1ZR2A 1Q0QA 3KV3O 3VH3A 2KLBA 2Q9AA 4G0YA 3CM0A 3OCVA 3F5DA 3NC1C 4G01B 1EUCB 1YQDA 1UAGA 1VSBA 3OSUA 4R41A 4RKWA 5HUQA 2C9OA 1LFAA 2C3OA 3I04M 1NI3A 3WQBA 1Z38A 4HNTA 4N18A 1Q21A 1E6WA 2WB4A 3DOEA 4Y9SA 1DLIA 5HZGA 4QDZA 4ZI7B 3AUKA 3WYEA 4B4DA 1L7BA 5T64A 1BWQA 1QCDA 2C3UA 2YWXA 2JHFA 3ESCA 3INTA 5DW3A 2NUTA 2ISQA 2NTEA 3QMPA 3QU7A 4HRYA 4B45A 3OJLA 4F38A 4J1NA 2WILA 3KZOA 3QXGA 3C1UA 5LDGA 1H2ZA 3WB0A 3STVA 4EELA 5MFPA 1Z8NA 1G9XA 3I73A 1J09A 1I9CA 2I2FA 4G6ZA 3HP4A 3PWZA 5C31A 1M73E 1RVV1 4JSTA 3ZWBA 4KGDA 5JS6A 5AOCA 1YTLA 2XJ9A 4J75A 3FGZA 3S1SA 1QS0A 3DJYA 2UZ1A 3ZI4A 2FPKA 4F06A 1P29A 5REQB 1W7AA 4IR7A 1PJ4A 4R8KA 5DHTA 4DKJA 3DLAA 4EYEA 4BLWA 5J4VA 5CT4A 1EE2A 3TE7A 3L4SO 2N47A 5ILQA 2OVBA 4O8CA 4OQFA 2O5VA 3JYHA 3H65A 4FNOA 1CQPA 1GKIA 1P0PA 2FPXA 2FZ5A 2C99A 2N9UA 2P2SA 2XYVA 2XDYA 3E7DA 4IZ6A 1G8YA 1ADCA 4MPTA 4O4JB 3PJEA 3E35A 1PX2A 1ZA2A 2Y1FA 3N3BC 4UD6A 5TGDA 9GPBA 1A4RA 1WUYA 4O4HB 3TIGA 4HNSA 1K88A 2XKJE 2VF4X 4UFNA 4C7OB 4MLPA 2CVZA 2XT9A 2Q27A 5DNEA 3PDIA 4TZ6A 4K6OA 4OX9Y 1I2ZA 1XMJA 4NBSA 5JAUA 3L6RA 3QI7A 3AHEA 3RFUA 1PWHA 4O8ZA 1Y8RB 1QYCA 3ST7A 4I1UA 3EIUA 2XB2A 3S81A 2D0PB 1R0CA 3NXSA 4HPJB 2WAXA 4MUNA 1UBUS 3FNBA 3UT5A 2BGKA 2X1VA 2JLBA 2EYQA 2O3TA 1Y8CA 4MPPA 3UBTA 2VHXA 1TEXA 5TS2A 4YCSA 1N0UA 4WNYA 3RIMA 5F3RA 3HV2A 2OZLB 2QD4A 3T7TA 4LGMA 1X1QA 2NNLD 2ZQ5A 3HP1A 4ZK2A 1KA9H 1PGQA 3K9WA 3KRTA 3P0EA 5AKGA 5KSZA 1T36B 1Z4PX 4C7VA 2AI3A 5ADUS 3C7KA 2BP7A 4X1IB 2QL7A 5IVPA 1EVJA 1T29A 2R5FA 2BKXA 4AJEA 3H5OA 1A72A 3CH5A 3LRXA 4PZUA 1QP7A 5JEEA 2HK9A 3RIYA 5CVUA 2WJAA 5I9TA 2Y2VA 1VL0A 4MVXA 1W94A 2D06A 4CUKA 2RHOA 2C94A 1QTIA 2VBCA 1TE2A 4QYSA 5CBKA 3ROXA 4E22A 3BSFA 2VHYA 2VP0A 2X3FA 4U9HS 5DSZA 4QDOA 1SPBS 2YXPX 5EWMA 5KVCA 2XGGA 1WF3A 1Z5GA 1NF9A 3D1JA 3DV9A 1BCSB 2HJGA 3PX7A 2FKNA 4BKMA 2JGLA 3NUZA 3EXG1 3TRJA 1JQKA 1G7RA 4G8BA 4BNUA 4QT4A 1EP1B 3DS8A 3DLCA 4CNQA 2CLKB 2ZI7A 1P1BA 2GK3A 4Q39A 4XDYA 4ZJZA 1E1RD 3A1VA 2WVJA 4IDCA 5C52B 1JG2A 2QRUA 3QQ5A 2V8OA 3F0TA 2IDKA 3E4CA 1OT5A 4A8JB 1FFBA 1IG0A 1RYZA 4HAWA 2V0CA 2Q3FA 4U3JB 4C03A 5I5EA 5JVDF 3TQQA 3AUUA 3ZCUA 4WCVA 3AP3A 2F9LA 3W90A 4HP8A 2Z4TA 4MW6A 2SKDA 4ENTA 1G3MA 1WEHA 2ZITA 1CY8A 4RFSA 4ZOBA 2H3HA 3N8KA 3OTQA 4G1FA 1AHHA 2YJZA 2H7VA 3HFGA 1E99A 5IDWA 3WGNA 2WJZB 1IB6A 2WZCA 1XPUA 3KV1A 1H4QA 2CJWB 3UK6A 3ZGOA 1O6FA 4I36A 5DI9A 1DP4A 2WVGA 2YQZA 3AW9A 4HD8A 1L4MA 1NXQA 1OYYA 3OU2A 4BFSA 3UAOA 2IZ6A 5HQTA 1M6HA 1V3TA 3HXQA 2F8SA 1P0IA 3OH8A 4JR2A 2GA8A 4YT2A 4ZC1A 3PKZA 1U8AA 1ONOA 3JVUA 1XK7A 3BDVA 3BG5A 3JU3A 1KO1A 4YAFA 3QITA 3O3MB 1TECE 3PE4A 4I4LA 1UMCB 1F12A 3HFJA 1ECJA 1Y1LA 2BCJQ 4X6UA 1IBKB 1ZL2A 2DYKA 2A57A 1TB4A 3ANLA 2G9ZA 3DPIA 3NKVA 4HVAA 2NMVA 3LI2A 3P71T 2CJXA 4OB6A 3C24A 5U1PA 4NZOA 3OX4A 3R9KA 4YGXB 5HF9A 3TD2A 4OI4A 4DLBA 4UUMA 5LFAA 5E7JA 2ODNA 3V55A 3RTGA 3UAVA 2FP3A 1Z34A 3ICCA 4PSKA 4MJ3A 4JELA 3CVJA 1U1CA 2GD1O 4HNAB 4UE2A 1UBLS 4WX2B 4AJPA 5TMEA 1XD9A 1U0JA 1ZNXA 3SCZA 3B6KA 5JD5A 1V1MB 4RIHA 1B4DA 3QVGB 2ZYDA 4WLVA 3WJ7A 3OQMA 2CHFA 2VNHA 3WLJA 3R5KA 2ZB4A 3KELA 5D1NA 1OGIA 4IJKA 1BS9A 4GOJA 1O89A 4J0JA 2AZTA 3CINA 1WW2A 4KRXA 3COPA 4M1YA 1X7XB 5CT6A 5EVJA 5LA6B 2ODEA 4CV2A 4RZSA 2QUBA 1YKGA 1D6MA 2QUIA 3RAFC 1BOFA 4FVTA 3HSYA 1UJCA 4XDHA 2EOAA 4V1CI 3KR1A 3ZD6A 1B73A 5LBUA 1ZCZA 4QJ3A 4L28A 3OIYA 5KOYA 4NR0A 3FFWA 5JNLA 3DL4A 4TUYF 1CJBA 1K1EA 4G0XA 4RLSA 4P38A 1OVMA 2QVGA 1V11B 4P6VF 3HRHA 1AXGA 2REQA 2VUIB 4DXHA 2HWUA 1DS6A 1YA8A 1F2UB 1L7XA 2BT4A 3JR7A 2WHRA 3OZBA 3RC9A 2BHRA 4IFEA 1RPTA 4IJMA 5J4YA 2AEMA 2WMYA 1SVIA 4V2IA 5TMDA 3L40A 3REGA 3VO8A 2BMAA 3T7EA 1FFAA 2QPAA 3OD1A 1NKSA 1RVDA 2V7VA 1QRSA 3GUVA 5I9BA 1PK9A 1QG0A 2BKEA 1NBME 3UWPA 1KIAA 2WJWA 3ZLBA 5KQSA 3A1UA 4LYYA 4BNDB 2OK7A 1OI4A 2P77A 4M36A 1PD1A 1CB0A 1EFHA 3H87A 2QD1A 3PNVA 1GN8A 1SUIA 4HKTA 3N3AC 5AKYA 3C1OA 5SZIA 3VSDA 3CUUA 3SX0A 2FN9A 3GNQA 4BNIA 2I67A 3H5TA 4ZP1A 5EFZA 3ZVLA 5FWYB 1USGA 2HLPA 3WV5A 1UT5A 3M82A 4B6JA 3KT8A 1BROA 3DAGA 1NW8A 3CLTD 3I9V1 4DLWA 2CEAA 4EY8A 1QC5A 1TRKA 3GZNB 3IL2A 3I4LA 3GROA 3D6UA 3SQMA 3MF4A 5DEIA 3JYLA 1Q7TA 2FW9A 3QYJA 2VL7A 2A84A 1YIAA 3KJXA 1Z5OA 3ZTYA 1Z6YA 1JAXA 2QP9X 2EKBA 3HHPA 3QHPA 2HEIA 2VXYA 4K87A 1DADA 2V4UA 1UEJA 3EYWA 3SZGA 3J7TA 2W2OA 1R9JA 4FT4A 4K6FA 1OLOA 2OZKA 2J9YB 2A78A 3SYLA 5KUTA 1UOPA 4L5AA 4B6OA 4NBUA 4ND1A 1HDEA 2JEYA 2JBHA 3DMDA 3MBIA 3R3UA 4G37A 4I4IA 3X1YA 2UXCB 3L6CA 1ODJA 4G5HA 4HL6A 2P2LA 1XRSB 3KFXA 1JXAA 2XV1A 2PUEA 4CIBA 1T5DX 3PGKA 4RD1A 3JRXA 5FOUA 4A0QA 4BU0A 1UPTA 5CDFE 4TV9A 3SPXA 1CUIA 3ECCA 4QBKA 5K6AA 3WLQA 1CHDA 1XVAA 2VSXA 3VR3A 2PMDA 4ZDWA 3KR0A 3JASA 3ZHSA 4TLMB 5K6AC 1SBTA 2O0JA 3ROKA 4YJ3F 5EZYA 1ZJ5A 2GBPA 2HV9A 3U56A 2W0MA 1JDZA 2I3ZA 1S4QA 3E9DA 1MOPA 4QUGA 5AT1A 1ZP6A 3W3ZB 1X15A 3KQLA 3BIXA 2OPBA 3LQ1A 4RM2A 3MWKA 4MRAA 2XTAA 4Q6BA 3VTZA 5HNKA 3WMRA 1MGOA 5D3MA 1GTJ1 4B09A 4EX7A 1CV2A 5TT0A 5B2FA 3IB3A 3E23A 3K09A 3KL4A 3HL4A 4GGPA 3E70C 4NFYA 2OQVA 1OPRA 3HPQA 3K09C 1PFKA 3OAAD 1BX0A 1PWZA 5JD4A 3MB8A 1ORVA 4AM8A 2XJ4A 4DLNA 5IFLA 3PA8A 4XWGA 4PQGA 5LIRA 4H16A 4MR9A 1Y1SA 1KEKA 2Q46A 4A15A 4CF5A 5CM9C 3QGMA 2EBFX 2IUEA 2JLUA 4HWGA 4QQNA 5AVQA 2DFKB 2QPOA 2L0XA 1JLKA 2XNJA 3KJHA 4XQGA 4KRGA 4DV0B 1GPUA 1J5EB 1NPYA 3BA1A 4L74A 1RJEA 2Z57A 3BK2A 3KYIB 5H59A 1X3LA 2KMLA 4OMFG 1E3DA 2UZ1B 3O6VA 3A1SA 2EC5A 2FRXA 1FYFA 3AUYA 3LXXA 1KDVA 3KEMA 5CP8A 2DE0X 4BEWA 4XFDA 2DX7A 1BDMA 4BCCA 4HWPA 2I91A 3EGXB 3HI4A 4LC1A 2HMUA 1PQWA 1RWWA 2PWZA 2ZSBA 3KK0A 3QEOA 3TM4A 4DA8A 4E1BA 4WV3A 3WZLA 5A62A 1UXJA 3GG9A 5ITVA 1IDOA 4KYTA 2FP4B 2A86A 5HFAA 1PKEA 2Q5QA 1NT4A 1KMIY 3U1TA 2JLSA 3CUKA 4DLSA 5AFSA 3I6IA 2FEKA 3IQHX 5FV7A 2D2EA 3S2SA 4F7DA 4URVR 3VYTB 1PS0A 5AVRA 1HZJA 4H1VA 1KAQA 1Z36A 4Q3AA 1DQRA 4HMOA 4QELA 4RKRA 2PS0A 4ZO8A 1NBHA 1T8WA 4OH1A 2EDAA 5CB8A 4W8OA 4MYSA 5KSYA 2Q7OE 4Z0TA 1J0CA 3SZMA 5BUZA 1R66A 4EPTA 1VL1A 5FWNA 1V8OA 2GN4A 4BYGA 4P58A 5J1TB 2E5LB 5F7ZA 3G8CA 4D9IA 3DAYA 2ERCA 1HYGA 1ZXLA 2D5AA 4KIFA 3UMGA 5AW0A 1UH5A 1XKTA 4L6IA 1XALA 2DC1A 2PL9A 3L06A 4FDMA 5FOWA 2L42A 3TIIA 1QKKA 3AM4A 3UJ9A 5CA1A 1NMSA 4CKXA 3O7MA 1P8AA 4LY0A 4FC6A 3ZHYA 2ZSUA 4BRZA 4UFPA 5KZMB 4UMDA 2R66A 2MINB 4MV1A 4XWTA 1I4DD 2CB0A 2CLEB 2D1FA 4RAOA 1UMDA 1N2JA 1UZUA 4IMRA 4W63A 4BUCA 4OX9B 3BT7A 2H1CA 5I4CA 1OKKD 1Z6XA 2IS1A 3QX9A 2C2MA 4C05A 1GHTA 2JBWA 2ZYGA 3D6NB 3LWDA 3MZ0A 2DWQA 3IESA 3UV3A 2RHDA 1PL0A 1UXHA 5BUSA 4IMIB 2F43A 5EJ4A 3QEMB 3KYJB 3MSXA 1ADGA 5SZKB 2WIGA 3RROA 5DTQA 3U81A 2PRIA 3C3MA 4OUDB 4WL0A 1KDZA 1HE2A 5D6NA 2R0QC 4C2UA 1Y3HA 2G67A 2R8OA 4JJKA 3VHXA 3PQ7A 4BDTA 2VA8A 5JMWA 1I80A 4POAA 3WGYA 3NVMB 1UMKA 4RK4A 4FMDF 4EKNB 5IJXA 1ETHA 1JDUA 4GOKA 4NSNA 3IV9A 1WDWB 4WOPA 3TI9A 5IDQA 2J67A 2ZAIA 3RYHB 1EXNA 2FWBA 3I2FA 3KLNA 4PFQA 5DHRA 1OH5A 5I7AA 1VXRA 1DTEA 2HRQA 3A9RA 4RFSB 1X9IA 1EGHA 4JJEA 1PI3A 3UWMA 1V43A 1R64A 3C3XA 4HR7A 3PFCA 1ZG3A 1ECCA 1TJNA 4FR0A 3AM5A 5FBWB 4C88A 1W36D 3A37A 3DDUA 3FCSB 3LBIA 3WWPA 3TFOA 2GEFA 1G5TA 3OM1A 1KQOA 1J1IA 1N2CE 1EYZA 3O1HB 3I6BA 3MTJA 5IYZA 2P9FA 1NQOA 3MBOA 3Q7TA 5FDFA 5ALHA 3T5MA 3M4NA 2I7TA 3ABSB 2OSBA 3AY7A 4IVQA 4J7XA 4UVEA 1Z7YA 1PZXA 3SM3A 3PITA 3FPHA 1E2JA 1AGNA 4C08A 4C7BA 3PQCA 1PEAA 1YRQA 4CKWA 1M66A 1PEYA 3ITNA 3F9IA 1P81A 3MT8A 1ZICA 4Z4EA 3L0SA 2YUTA 3RJ9A 1T9KA 1E1NA 1RPZA 2A8YA 3HZRA 1V7PC 1HM5A 3ABOB 5ELMA 1UWKA 2FJPA 5LQKA 1MGPA 3E8MA 2FW6A 3R9XA 3T3OA 2XCIA 2H11A 2WG0A 5ECWA 5FUWA 2HU7A 4HI0E 4UCXA 5IKOA 5FV4A 2OE2A 3MOGA 3WGZA 4Q1VA 2P9YA 4KPFC 3Q6MA 1DCMA 1V8PA 1V25A 1C7ZA 3HADA 4TPKA 4DQLA 4KE9A 4RD4A 3BC1A 4FZ5A 3BGVA 1RCUA 1DRKA 4FEYA 5E6RB 3C6QA 3OP1A 2GN2A 4IAOA 5B1DA 4YV0A 4X6YA 4D8XA 4JROA 1XZLA 1F0KA 1CS0A 3H13A 3ZY2A 4X93A 2B2NA 1CUVA 2C29D 2P4EA 1J8QA 2MYNA 2VDWA 3A26A 3FYTA 1EU1A 1SUPA 2AFIA 3K0CA 4ARBA 1Q84A 3JWPA 2ORWA 4ISBA 3WQRA 4R1OA 4YRZA 2VWQA 3K0CC 5BOSB 3DMFA 1PSZA 2IFTA 5CEJA 5A5DA 1T0BA 4TWIA 1ST3A 1WXFA 1BE1A 3JQAA 3PFWO 3MGBA 3GUUA 3O4FA 1BHQ1 2V6JA 3GDOA 1J1ZA 1W8IA 4DV1B 4P5EA 3T0FA 1NUTA 1AUOA 2X0RA 3G9UA 3OFJA 3OX1A 3OBIA 2J3DA 3KKEA 1N78A 3GN2A 1CQJA 1A1SA 2I5PO 1XA3A 2VPWA 3IDFA 3M6WA 2IODA 3ONFA 2HGZA 2GBIA 4Y6OA 3RAEC 1VGVA 2FEMA 3NV9A 5F77A 3LUAA 1IZ7A 2J5QA 3PFKA 1YB7A 2HPAA 2O23A 5HKKA 2NVWA 3A2KA 5HE9A 3H4VA 1T8SA 4UATA 1UKBA 4EZIA 4F9FA 3H7IA 3A4TA 2QVZX 2IEYA 621PA 1OLUA 4I4NA 3CNLA 4FP9A 5G0SA 2W6ID 4HDRB 1I1HA 1WCIA 4PN3A 5ENDA 3QWIA 4BO4A 4UAUA 4XYLA 4IWYA 2B4YA 3N2IA 4AICA 5BW8A 3WNZA 3JZMA 5E8JA 1RACA 1JKJB 4X20B 3FCAA 3ZBQA 3BHJA 4KQ9A 2KBFA 3DXYA 4QTZA 4KU4A 1VBFA 3AVYA 4AL4A 2PUTA 2AYYA 3KB8A 1VPVA 1JWAB 1ZUHA 4X1KA 2IHBA 1ZI8A 3DQQA 3GAZA 3B82A 3AERB 4L8FA 3K9HA 2TYSB 3RNLA 3ZK9A 4D5GA 1NHWA 4KWEA 3GDWA 3NHJA 4MV9A 5AW9A 4D0RA 5C35A 2UUAB 4LFAB 1KOFA 3B9BA 1YAJA 2SCUA 4BO2A 1JEOA 1MOZA 5BWMA 1HE4A 1M1YE 3H1GA 4ZRDA 2EBWA 3GO4A 2CZCA 3VPHA 2C4HA 4JLVA 4WY2A 3LP6A 5TQ2A 3G8BA 3IAAA 4QARA 3TNDA 1S2DA 3LG2A 1T4DA 1GQSA 3ZGVA 1W36B 1JNXX 4KKXB 4JU9A 1QTRA 1RRKA 1UJ2A 5EHGA 2ZAYA 4IIYA 5D5QA 5FUMA 1E59A 2CW5A 1V5GA 3CF4A 3KJZA 1ATIA 4JC5A 3VC3A 4GBMA 1M2OB 1YDFA 3BQMB 1KU6A 3IXLA 5BORA 3C4VA 2ZIUB 3SJUA 1XLWA 1GPJA 3CYFA 4NESA 3R7WB 3V2UA 2IITA 5E1DA 2XCRB 1YOBA 3UBMA 1GUYA 4BV8A 5IKEA 3HY6A 3ONEA 2Y0DA 4IL5A 1SVKA 3L4BA 4NZPA 1ZU5A 2E6UX 1WUKS 3FW1A 4FYKA 3SEAA 4ZGGA 4FCTA 3AEUA 3BRQA 4GVPA 1X8KA 3L4BC 3HU5A 2FWRA 4Z5XA 3T3GA 1E2QA 1T91A 4FKZA 4DGSA 3E84A 4F2PA 2XSZD 4A26A 2NO7A 4A7PA 3WLIA 1HKHA 1C1YA 3UW1A 2VK8A 5DNDA 3NDBB 1QO0A 2VAWA 1Z3CA 2RB4A 4EHNA 2VWGA 4HPXB 4N03A 2A7QA 2DTXA 4AECA 4C0BA 2VLIA 1I7DA 2C2XA 3RUIA 1U9IA 4OF4A 4E94A 3Q2OA 3VO1A 1ZMOA 2K4MA 5B3LA 1ZM4A 1U9IC 2ZULA 1DIBA 3CCCA 1XQ6A 3VI3B 3CURA 1TMOA 3VUEA 3KYCA 1QF7A 4F2HA 1NXOA 2VI5A 4PWYA 2XVYA 3LT1A 3ZWNA 4F5ZA 2PT7A 5CXQA 3MCTA 3OU7A 1U2ZA 5G4KA 5AD1A 5CH3A 2B1JA 4L02A 3WC4A 3GUCA 2BH2A 1MQSA 5GPBA 4F93B 3E9ZA 4BE4A 4Q3BA 2H4HA 1DTSA 3KB6A 3IUQA 3WFIA 4PZYA 4YAKA 5DP1A 1XPOA 2FEWB 4FOPA 4GSYA 4WQMA 4Z7NB 3USZA 2HNBA 3WZ2A 3IPYA 4P92A 5JNVA 2D2FA 4LXYA 4LWOA 4X3CA 4B3RB 3A4NA 2HMYB 3ONNA 3EZXA 3RS7A 1FMFA 1XZQA 1PLKA 1FBNA 4NEHB 1BC5A 3R3HA 3STHA 5CRIA 4ZOQI 5JDCA 4RZQA 1O5IA 2D0IA 2YHSA 2XIQA 5TC4A 2O3RA 1M2GA 3DBRA 4F3YA 5JDCC 2CK3D 1WXIA 2I1LA 3RAPR 1XRQA 4A0SA 3ZD7A 3RS0A 2O5EA 3CA8A 2JBAB 3DOOA 1VOTA 4TTQA 4TSRA 3R6TA 2W6JD 1TAQA 3RRJA 2VK4A 3F2VA 1ZCFA 2EKLA 2ACKA 4JL5A 3DMHA 3OO1A 4IBOA 4MUMA 1J39A 5IUNC 1E3MA 3BRWD 5CG1A 4JC4A 2O3QA 3F6YA 2AG6A 2LCQA 4BHTA 2HCRA 2INGX 3BF8A 3EXHB 4CDMA 4JI0B 1IMJA 2IEGA 2MMGA 3NOOA 3OIFA 2IPAB 5CT8A 5FO0A 3WB1A 5HQ3A 4YFYA 1WDKA 5L9AA 1KJQA 5KTKA 4QFDA 1YZKA 3ZLUA 1VG0B 2V5VA 3NU1A 4LI3X 1ZRHA 1INLA 3N59A 3WNDA 1BFDA 4UCWA 3GA0A 4RJTA 4IIUA 3B9QA 3C87A 4KPUA 3ZDQA 1X87A 1ZO8A 2GT1A 2DKFA 3ONWA 5H3LA 5HJ7A 3AV0B 3OE7A 1FE8A 1NVVR 1UODA 4CEHB 2AJBA 1QU3A 3W1VA 3HM9A 4V03A 1YR8A 1Z73A 3EVZA 2FMKA 3N6XA 4F60A 1XEFA 3MXOA 1PBTA 5CLLA 2QW8A 4LK2A 4MQMA 3TSYA 1XOIA 1JEDA 1P2TA 4NNJA 2R9VA 5EPEA 1LX6A 1ACJA 2F43B 1RPJA 4MWZA 3WQHA 2WJPA 3GT3A 2J8ZA 5IZCC 4Q66C 1Z0JA 1EFCA 3COSA 4DLZA 3Q2IA 2GNPA 3H3XA 1LRKA 4OHBA 4DXDA 1KDRA 2O06A 4AUNA 2QRZA 2Q6LA 3FAKA 2GPNA 5LLSA 4DQXA 1XXLA 4JJAA 5AIBA 1A9RA 3HEAA 1NC1A 2PKEA 3OQJA 1XP8A 3G2HA 4CLHA 1I1NA 5CHEA 1YGPA 1RT9A 2CD9A 2ACWA 3OJEA 4UDOA 3UM9A 4XI9A 5KYVA 2XUFA 1GU1A 2W00A 3AV3A 4GXTA 3SHOA 3I05A 4BNKA 3F3MA 3ICVA 1LPAB 2RGRA 3CHYA 3JD4A 3HCNA 3LBAA 4LRWA 2VZLA 3RODA 5HVNA 3NXKA 4P7FA 3FWPA 4FBGA 1D1TA 2HJWA 1EK2A 4E30A 4LVNA 3KKQA 4LECA 2WKPA 3P94A 4JWKA 1L4YA 4GZMA 2QZ4A 1SC1A 3AG5A 4Q9KA 5FUVA 5ESWA 1BE6A 5AR1A 4RESA 2OV8A 1Y1PA 3PT9A 4IILA 4AN4A 1HZZC 3GP8A 1I5OA 2BM8A 1CT9A 1WNTA 1YR9A 2OLEA 3BXZA 1WKVA 3E9YA 4K26A 2TMKA 4KE6A 2IWHA 2QIOA 2RHBA 1XVLA 4M22A 3UUFA 5EAIA 3LFTA 3ZQUA 3SY8A 3EASA 3DR3A 1KNXA 2B4KA 4M37A 3H5AA 1ODSA 4MW4A 1Y6JA 1U0TA 1GNSA 3CX4A 2YVQA 1TTHA 5TXGA 1HFKA 4WXYB 3GFTA 4LXHA 3DE5X 3U7QB 2NZ8A 2VSFA 2AXNA 2V4MA 3NTLA 1G2PA 2W8ZA 4XARA 2XCUA 5EKDA 3OSZA 3R9XB 3JQQA 4O3FA 1OLSA 4W5JA 2V0NA 4Q7MB 2EFEB 4IDHA 2GFHA 4G25A 4ZV4A 1P5HA 4XTRA 1OB2A 2I4IA 5TPZA 2FRDA 3LPLA 4CW7A 4JYZA 2CMFA 4BQOA 2X4DA 2WM8A 1S2IA 4JOSA 3KU1A 2FRDC 1RYEA 5AHWA 5AW4A 5AVUA 1EG2A 1NP3A 4BKOA 3PQ4A 1FUYB 1JP7A 1WXHA 4YAWA 4MKRA 3NVDA 1JEQB 1N6OA 2NACA 1XTUA 2V7UA 3F7NA 1AV6A 1A7JA 3GLTA 4LZZA 2JHPA 3EWAA 4MB6A 5IAEA 1UDAA 1ISHA 1XCLA 5BMVB 2BD0A 3KUDA 4YRJA 4CIAA 4PR0A 5JH7A 1T0IA 3A7EA 1CUGA 2YJ6A 3M9XA 1D9ZA 2HIMA 1Z9BA 4KQ6A 5BN4B 4WZAE 1VE3A 3O21A 5BV1A 4IIJB 3OC6A 2P2GA 2Z4RA 3SE7A 4L2IA 4BC0A 2AQHA 4BX0A 2CNWA 2ZSIA 3DBIA 2FXIA 1T13A 2Z2YA 1IOVA 2QENA 3OWHA 2P2ZA 3NM4A 3QFTA 4P4LA 4PSUA 5IAKA 4AKIA 1GL3A 2DPMA 3P4UA 1SXPA 1DAKA 3H5WA 4XIYA 1DLJA 3PTAA 3CVXA 3O84A 2P65A 1MT0A 3F3SA 4H17A 2IELA 4CM1A 3AINA 1YQXA 1PYGA 4GM1A 2RHHA 1SG0A 2RGCA 4MZXA 2HLDD 4PNHA 4U9IS 5AM2A 2PL5A 1GPYA 1P7CA 2C5FA 5ALXA 2ZRDA 1SUFA 4M46A 3SEFA 2WVAA 2CUZA 4JI6B 1WMSA 2VS1A 3VR4A 3R7FA 5E2IA 2BFMA 1J97A 1JIVA 3BB4A 2RGGA 3E18A 3CG0A 4QU5A 1J0AA 3T3HA 4C0HA 4DVJA 3ZQKA 1YASA 1TM1E 4UHFA 3N28A 5CNMA 3MCVA 3IC5A 2G6BA 2LP4Y 4G0NA 1A95A 3O94A 3I8SA 1YQWA 1MD9A 3K5PA 5EPUA 2ZIXA 4EKIA 5JYEA 3FKJA 1AGRA 4K9QA 3J80A 4FWBA 4JLBA 4MS4B 1F0YA 1ICEA 1I2MA 3LYLA 1OCEA 2O48X 4RVUA 4H4EA 2HBZA 5ESDA 5ALKA 5EIWA 4KJZA 5ILOA 2FCAA 3AU9A 3E22B 3EWSA 3HWWA 3OQOA 1Q57A 1TMYA 1X0XA 3ZWPA 1LNZA 5AUOB 4IDGA 2OFWA 1EP9A 3O8LA 3GJQA 5EINA 2LE0A 1JUDA 3N8DA 3WK4A 1KETA 5ETJA 4IDBA 4QBFA 1TU4A 1G8MA 3I76A 3A6GA 2N3ZA 3BWDD 1F2DA 1XJ0A 5TQ2B 4WBNF 2BTEA 2C3MA 3KEFA 3T7JA 1ZNWA 5LMZA 1YTUA 1YS2X 5AJTA 3H1AA 4CFYA 4EPRA 2FSFA 2WD8A 3ZK7A 1T4MA 1ANKA 1ENPA 1I2AA 1LVGA 2WFLB 2OG2A 2ZT8A 5T4EA 3FWZA 5M7EA 2QM7A 5A4IS 2AJDA 4OLJA 4DABA 1XG5A 4DS3A 4U8HA 5AK5A 3K0AA 2VSYA 1UQRA 5CBPA 4QU8A 4FDVA 4BJ6A 2PWPA 3C3AA 3TGWA 3HJUA 3PPWA 2IHZA 3K70C 1E3WA 3CC8A 3TD6A 3IHWA 1YVEI 1E32A 3AEZA 3IUPA 4K9SA 1TOAA 3EJ6A 2XQIA 4MAFA 3ADCA 1E2BA 4JC0A 3G2IA 4BFTA 1O9HA 2JCGA 4IIFA 2HRDA 2ZJYA 2PXAA 1QQBA 3IDQA 2FFBA 3GJZA 1D8AA 3QENA 1HE8B 2G7ZA 5ALDA 5ICMA 1P62B 1OX4B 2GDJA 3D7RA 3IVCA 2AI2A 1AQ6A 1K9VF 3K5WA 4Q7JB 5DU2A 3ZCSA 3LVRE 4DB2A 2JGDA 4DNOA 2HCBA 1NZFA 2QTRA 4FOTA 1I2CA 1RWVA 4PPGA 2W70A 3QBVA 4MJ7A 2ISSD 2QRGA 1L1FA 3UOGA 4JOCA 4II2A 4PQEA 1PK7A 5IABA 1FK8A 3PPXA 2ICAA 5G0TA 1XV5A 2JI7A 2QE7A 2CBZA 3CZ5A 4N0PA 1E0DA 1Y3FE 5JS7A 1MJGM 4G5RA 4MH0R 4LOHA 4RXTA 3TL3A 1CLEA 3WWYA 4DYDA 1S02A 1JEYB 2QP4A 1LJ8A 3PIRA 5CH8A 3H0CA 3LX6A 1SK9A 4I19A 2PH1A 3IIEA 1DMRA 3QYAA 2R8YA 4FQ5A 3STXA 1FNNA 3WICA 1GNPA 1SCUB 3I53A 3VZPA 2O2SA 1CZRA 3RGWS 4IVPA 4PZCA 1RC1A 2Z2ZA 4PRZA 2OBYA 1PF7E 1PFUA 1QHNA 1B74A 2A14A 3AJDA 4L5IA 5IM4F 1PNRA 4GWLA 4D46A 3FCCA 2VHCA 2C9ZA 2CMDA 3AEYA 4HB3A 3ACBA 2O6HA 3I4FA 2ZT7A 5E6SA 1O5OA 4EYGA 5JSQA 2YY7A 2WYOA 4ZAZA 3NUQA 1FLVA 3BTSA 2VZ0A 3SQXA 4Z7JA 5B30A 5BSKA 2PMFA 1SZJG 5CVVA 5SY9A 3V7WA 1ECLA 2PKCA 1Z82A 4H4DA 2PEYA 2PTGA 3NATA 4AJIA 2H92A 4OYRA 4LV6A 1TC2A 1PKXA 3D8TA 3IVAA 2GJ4A 1L8AA 4DZTA 1B16A 5DN6D 3X1XA 1V16A 4LOLA 2F9FA 5H81A 4MVJF 2QMQA 3AHHA 1NVGA 1U0GA 3HUEA 1ORTA 2V9PA 3MJDA 4GI3A 3VZRA 4GX0A 4D4GA 3Q8WA 3WLEA 4HUQA 4BZXA 3O4VA 3WRVA 2YVLA 1M0TA 2BONA 2I99A 5I45A 3EN0A 4MWCA 1ND5A 2HMVA 3F7OA 4GDFA 3W78A 2O2EA 1M2KA 3VU1A 3V8PA 1HDOA 1G1AA 1HLDA 3QLEA 4F1JA 1GQOA 4GXNA 2IZ0A 1IXKA 4GD3Q 4MUAA 3RRFA 4YCCA 4KHZA 5F64A 3IFSA 3GN1A 2H0RA 2J45A 4B3BA 5LZ5A 4WSOA 5IBQA 1F8FA 4HDSB 3N75A 1LPMA 2XVXA 4ZOLA 5AH0A 4E6EA 4J1TA 3SXUA 3C7TA 1VJTA 5BYJA 1QIKA 1VM6A 3OY2A 3C0KA 3ZH9B 3ZTWA 1AJEA 4F72A 3UV7A 4YI3A 1JHOA 3D6JA 5J59A 4D6YA 2ATCA 1DFHA 2QYTA 2Q2NA 3B6EA 1OUMA 1V48A 5KKCA 3VKHA 1N0WA 3WP1B 1GZDA 1D4ZA 2ZJ1A 2XCQA 4ND5A 5DTJA 2O7RA 4UNSA 1RLIA 3RTBA 1VDZA 2FSIA 3TPZA 1GTRA 3EOBI 4KWHA 3CUEF 3HBJA 4MAMA 4OQXA 5FNVF 1YQTA 5FI1B 4WRRA 3GJ4A 3PZRA 3AR6A 1WMDA 3LQRA 5LBIA 3ILVA 3W2EA 5KYNA 1TK2A 5K6RA 1GTVA 4IQ4A 4DADA 1EFPB 1FL9A 5FD8A 4ECEA 1JQDA 2YKGA 4P98A 4LWZA 1RP1A 3UANA 3FFBA 4OBBA 2C31A 4P3YA 1V1JA 1QB8A 3ZHUA 1WCV1 1E0KA 2QG9A 3PXUA 1NLZA 2PA0A 2G63A 5T4HA 4N6GA 2I80A 5LQNA 1GLGA 1P31A 3CUTA 3RREA 1JBKA 1K89A 2Z4SA 2H57A 3UCXA 4CR7A 4ZIRB 5DGCA 4R1PA 1VLHA 3I0NA 4F71A 4KHPB 4OK5A 2FN4A 1RMTA 2RSLA 3MWJA 3RS9A 4PRKA 1HTWA 4ZOEA 2R47A 1RYYA 2ZIEA 4ALMA 4HLCA 1WY5A 4XLZA 3DYBA 1X7ZA 3MD0A 4K86A 3LO5A 5ALWA 1B6RA 4Q5IA 3T7AA 4COOA 4D25A 1SB9A 2RBEA 3QJ5A 4WNIA 1IUKA 4JFAA 2E49A 2WSIA 1T35A 3LMKA 4CWAA 5DX0A 2DUJA 1P1FA 2AGVA 2J1LA 2UVQA 3GIWA 5DM2A 1R50A 3RUFA 2CSUA 2VOJA 4QATA 5FYQA 4IJ6A 3I8XA 1MX1A 4EI9A 4KAJA 1RI5A 2JGAA 4UQPA 1YXMA 4ZVSA 4XPIA 2I54A 4A2QA 5HRCA 3U3DA 2Y0PA 2R8RA 3H97A 5CLQA 4MVJI 3W0LB 3BKXA 1QFMA 1TM2A 4N5DA 1NF8A 4RENA 2AWOA 1MLDA 5COQA 3VDRA 2LPMA 3BD8A 2FHPA 1BAPA 3FG9A 5KYUB 5G4LA 2JLQA 3K4QA 1UP7A 4HAXA 3QOYA 4RXUA 5KREA 4JA0A 2R5WA 3OX2A 4F3TA 1C2TA 3RJTA 2Q1WA 1OV6A 2QHXA 3KSRA 3I64A 1CUHA 5JQGF 3JQRA 5DNWA 3FBWA 2B35A 1KK0A 3Q5GA 1HEYA 2QW0X 1II8B 3JQ7A 4Q4DA 1FFSA 4RWEA 2HQRA 2WM3A 5CW1A 5DB4A 3EULA 2FJ0A 5C8ZA 5LP1A 1KJZA 4NOJA 1IJFA 1C3OA 4R5MA 4B47A 4LQCA 2BFFA 4M88A 5C7YA 3V97A 3ORHA 1UANA 3SG0A 2NPIA 2ZG6A 4UEQA 5BR7A 1DZ3A 2H17A 3PIDA 1EGVB 2HB6A 3AEQA 1UUFA 2ZYAA 3OT5A 4F5DA 2IYQA 2O2ZA 5FOSA 5J4HA 1FVHA 2VN8A 3QFSA 4ZT6A 5KNBH 3W5CA 3S29A 3K8YA 1L5WA 4XCXA 4TWRA 4BXOB 1EJ2A 4D9BA 3F71A 3VVMA 5AHRA 1IUNA 4EG4A 2FSVA 2R7AA 1E2PA 2FMHA 4BQNA 4D4HA 5JJLA 5CEFA 3WSWA 3I3OA 5IT5A 2VQFB 4C6TB 4XUDA 2IS6A 1E9BA 2V7EA 4YVFA 5BWOA 1ZK4A 4ZRMA 4L0DA 1G64A 1PGOA 3TECE 2W6CX 4DWVA 1AO3A 1Z16A 4MWBA 3LA8A 4QNRA 1L5NA 4D6XA 5KYWB 1MXFA 5LMNB 4P7GA 4YQEA 3GARA 4HFRA 4HFMA 5ARCA 4LMBA 1O8CA 2YNMD 5LDHA 4KIUA 1HGXA 3AX6A 3DV0A 2FFAA 2ES4A 2O1SA 3DCJA 4ID9A 4E7PA 2JIZA 4XGKA 4QJ4A 2AF3C 2YDYA 1SVNA 1P2DA 4K9NA 4FB4A 4N39A 1HUQA 4BNWA 3DZIA 3HBAA 1JQJC 4FJ2A 2QJRA 2XGMA 3I8OA 2DSNA 4CKBA 1QVAA 4ENWA 5DYWA 4ZCPA 4GRDA 3CBQA 1U4SA 4GSLA 4DDTA 4LXTA 3GLSA 1IM5A 4DIMA 1KFCB 1DOAA 1BXRA 2JGNA 3A6DA 3FHJA 4KQJA 1IMOA 2OD9A 2AMVA 1JHPA 5B36A 2PZGA 4LVCA 1OA0A 1E4EB 1NUPA 3TZCA 1N5JA 1W5AA 2B3DA 4DB4A 1QWSA 4KXQA 3C6ZA 4FFLA 4QPDA 3VU9A 1TFRA 4OVKA 2WSLA 2D7CA 3B9RA 1IBSA 3K31A 2OLKA 4EKYA 4YT8A 4DV7B 3H17A 3MTAA 4ONEA 1Y7TA 3S2FA 2A0FA 2DFTA 3IAFA 3RBXA 3N0XA 3GCGA 1KI6A 3BHIA 4QJBA 4UVGA 2JFBA 3UHOA 3WIOA 2DFDA 3GRUA 1SB8A 4EHAA 2VBFA 5BUQA 1AN9A 5KINB 2WIJA 4FHGA 2RB5A 3L0YA 1GGNA 3K2IA 3D64A 4EATA 2RH5A 4EVIA 2XADA 2SICE 3OJCA 3TTVA 3U19A 2Z6VA 3RRYA 3H75A 3OKFA 4MGEA 3FYCA 4GX1A 3K70B 3LPCA 5B57C 3W3AD 4E0BA 5I4IA 1E8DA 5LU9A 1U3CA 1YULA 2DQ4A 4IKPA 1K5DA 2X8WA 3BCRA 2Z8YA 4JB2A 4EB0A 4Y6PA 1W30A 1UFKA 1GV1A 3WK7A 1Y9AA 3IHTA 1I3MA 2AKEA 3RUEA 3GMDA 2Y0BA 4L72A 1PJ2A 3GFQA 3ZLVA 4JP1A 4QHTA 4KIWA 4J91A 3BA6A 3WLNA 3IP1A 4EIWA 4K3UA 5I51A 2WU8A 4CQMD 2PNJA 2WFAA 5LQSA 2WU1A 4MWSA 4RHYA 5K0EA 3WZMA 5K8TA 1D6JA 3MCZA 3G1TA 4LKOA 4AS3A 3R8XA 4UUAA 3L4JA 3UMYA 3BMQA 2ZZNA 4CIWA 2CJYA 4FGJA 2F8TA 1FPQA 1D1QA 3MJ4A 2UUPA 4PCAA 1FYDA 4MVJH 4J0DA 4XX0A 2O8VA 2ZOSA 3U1VA 3WKBA 3MS4A 3ICQB 3CEHA 4E31A 1XAIA 4EB3A 4EOGA 3AR4A 3A8TA 4O2AA 4K9DA 1H8HD 1E0AA 1OQAA 1SVMA 4RS3A 3ZI7A 3A0RB 4EYSA 2B0CA 2ZJ3A 2BKLA 4LDJA 4TN5A 3RAJA 5AM4A 2B1QA 4G5GA 1FEZA 2ZBPA 5JZ9A 3B8HA 4KUEA 1AQIA 1KVUA 3VKFA 2BGUA 4ZV7A 1A2KC 1JI3A 1PYOA 1RWPA 4G3XA 2CDNA 1SY7A 1P6UA 2GM9A 2RCNA 4ZTBA 1XRPA 4ZAYA 4NDNE 3AHDA 1ONNA 1L1RA 1YSCA 2IP1A 3BXGA 3EZYA 3ISJA 4LRYA 2RIPA 4UPEA 2QG4A 5F23A 3LDHA 4NICA 4S3MA 4W5QA 1RQGA 4M7PA 4WD3A 3HVIA 5FWAA 4YDQA 5KTMA 1P72A 2PLAA 4TROA 5K3SA 5JTTA 1UJ6A 4QRIA 4M1SA 2JEOA 1EK1A 1FFEA 1PTKA 4EVSA 4Z3KA 4C4TA 1PEDA 4PBRA 2K5UA 2JLWA 2F1OA 4OCZA 4X8OA 4N54A 1KE2A 1XWWA 1USIA 4IM7A 3HK2A 2H1SA 1L5FA 1NVEA 1QIFA 2MSDB 4IY1A 1A8PA 3BH7A 3RG2A 3B3JA 1NJ1A 1JIKA 3L0IB 5CAEB 3RH0A 2GN9A 4QHYA 5JNRA 1EP3B 1NF2A 4HLDA 3EVEA 3AEKA 1E64A 3E05A 4KUGA 2ASVA 2EWVA 1U65A 2XWBF 5GTDA 4N5HX 1EGAA 3HXOA 4U63A 2EJBA 1C0EA 1AURA 1M2EA 3A3KA 4E1VA 5AVZA 4RTKA 1LZKA 1EFTA 1M5TA 1IY2A 2XDQA 2FFHA 1ESDA 4QOSA 1NJ2A 3CF6R 2VXOA 3GVHA 4RX1A 1SEPA 1KZ7B 5A4DA 1NU8A 1F2TB 1TXGA 4F85A 4JVOA 1AM4D 4DC1A 4F4CA 1GG8A 2B30A 5L51A 5FIUA 2DTEA 3R7DA 4BCBA 3AR2A 3QE2A 2ET6A 4WH0A 3VMMA 2V98A 4MKXA 2CNLA 3ZNOA 3CWZA 6CHYA 2R4UA 1ISRA 2Q3LA 5A71A 1G17A 4YDSA 2IGBA 3Q1LA 1L5HB 1KYZA 4EY4A 3IPLA 4P4SA 1DG3A 4YCJA 5MFZA 4EGAA 2B2XA 4OQ4A 4EFNA 1K8RA 3U3OA 3QV1A 3DVSX 4YXWD 1Z6ZA 3R4CA 1QNLA 1TU3A 3ND5A 2YWJA 3I45A 4UZEA 3W5JA 5C7IO 1ZJ6A 2OYSA 4R1NA 2MSKA 3H19A 3NIBA 3V4LA 3LGSA 1EXVA 3KXIA 4NMLA 2PS1A 1NMQA 3IHLA 2CC2A 2FYTA 4CEJA 1DJQA 2VNKA 2X23A 1QP8A 2RHMA 2XAAA 3VPSA 2WJ4A 4QPCA 1K7EB 2A35A 3C45A 1OYWA 3L9XA 2ETXA 1YD7A 5L45A 5KQGA 3ETJA 5I9LA 3BN3A 1I10A 2P4HX 2ZCUA 3HSKA 4XSGA 5JNWA 4Q7KA 2Q2VA 1KEWA 1P2SA 2ZT5A 4UUPA 4AAYA 3CB4A 3QMMA 4I1OA 3H5IA 1C4KA 5FTNA 4CCAA 1NGSA 2J3MA 1GPLA 2LIPA 2EFJA 1G8HA 4XCVA 5GJVC 2FE1A 4K9KA 4QDJA 3FCUB 2PV0A 1YH3A 1T4CA 3ENWA 3LFHA 3OZXA 1A77A 3LY7A 3IUBA 2RI1A 1XCOA 2AOVA 1ADYA 3MT9A 3ZNQA 3D7NA 1IIRA 4LXXA 3QPCA 5AW2A 1XDSA 2E1RA 3HQ4O 2JCBA 4IXTA 3ZWKA 1YBFA 3R24A 5EQDA 1S1MA 2WNSA 4Y1RB 4ZHQB 3UO8B 1Z12A 4R3WA 1N1MA 5CYFA 5GVSA 4BL5A 2OBLA 1KIFA 1PFWA 1U63A 2IYNA 4AO6A 4CFZA 1E5TA 2GZRA 1W4BA 3P0JA 1BN6A 1OTHA 2Q8NA 1GCAA 4I08A 5BN3B 3S55A 4PM4A 4NCAA 5J4KA 4Q1CA 3S7ZA 1DJOA 3KYDA 1V5EA 2UVDA 2JKVA 2ZJBA 1Z2DA 2ZRHA 1OX5A 4G85A 4B3JA 1VQ1A 3FVWA 4L27A 4H7KA 3QKRA 1E1MA 3O4IA 4O0LA 2AH5A 3FCXA 1RLMA 3H2KA 1R2QA 4LYDA 3LKDA 1TT5B 4KBFA 4Q4JB 4Z1MA 1GO2A 3ECSA 1E89A 2XOKD 4RJIA 4DJDC 3ELUA 4YMVA 1E6CA 5FHRA 2IBMA 2C2HA 4IQFA 3KSBC 1IHYA 2XRMA 4HDNB 4KQKA 2NZXA 3N8HA 4YPVA 3GRPA 2D5CA 2ZRLA 4ZGWA 1GFSA 3N58A 4BFZA 4DLAA 4U9UA 5LQMA 3O2SB 1V8BA 3FDFA 2WFMA 5EUBA 1B6GA 2OC4A 2PX8A 3RK4A 4ERNA 1FJ2A 3FPKA 2HFKA 4I5GA 1Y42X 2WZDA 3B6MA 3MJCA 4CV3A 3G79A 3TN7A 2PZJA 5LCXA 4JEMA 4Z9XA 3ZQJA 4Z3OA 1XTRA 4GGOA 4P3PA 1G5IA 4B2LA 4RTNA 4HV4A 1WMFA 3EDQA 2GYVA 3D31A 3LUCA 3R20A 1L7EA 2PFGA 4MS3B 4LHSA 4OQPA 1LBHA 1TYZA 3R6DA 1ZONA 2X5KO 4NPHA 4KAXA 1Z06A 1JVSA 1T2VA 1XEWY 4BB0A 3HACA 4BO3A 3PQ2A 2D0DA 1F8UA 4AX4A 2O8DA 3M33A 2A67A 3OLZA 4Q05A 1Q14A 1XNGA 2VNJA 1H3NA 1PG2A 5HJ2A 4C7MA 4S1NA 2GKOA 3VBCA 1ECBA 3T1HB 3CSDA 2R8EA 3EXEA 3DV0B 4EY6A 2HMWA 4NONA 4EITA 1ZN7A 1H5NA 4KXXA 4DPLA 1U8FO 4AMZA 4D80A 3VC2A 5JC1A 3FROA 3Q0TA 1WZCA 1Y3BE 3LWBA 3VKUA 1I3OA 2Q3DA 4MI3A 4X92A 4MDYA 2G9NA 3G2NA 3JAKA 3NBKA 1E18A 4RF5A 5EWLB 4EA8A 4TV9F 2YX1A 2GAFA 4LTNA 1M6VB 3PQ3A 2CXPA 4KQWA 2GHIA 4LG1A 4UE6A 3IIKA 5B7QA 1JBEA 2Q3BA 3A27A 4O5AA 1WP9A 4FBMA 4LW8A 4X24A 3KQNA 4FFBA 4YBRA 5EZYF 4NE2A 1RXSA 4DT1A 2OL4A 4NBWA 4RJLA 4FMCF 4HYYA 1W5EA 4X7RA 5F2KA 2O52A 1U8UA 1K63A 4CMEA 3SKYA 1G20B 2FR8C 3OJWA 1G7TA 5EL0A 3H9BA 1GLNA 5KKNB 2H4ZA 3H83A 4CMEC 3PFBA 3NHRA 2PQ2A 5K8UA 5CDUA 4NE7A 1OFUA 3LECA 4PGMA 4UHEA 5FXMA 2OD7A 2N0SA 2BGRA 3GMSA 4D26A 2P6UA 4RM3A 4E07A 1T3LA 2EFHB 2H1VA 4FZRA 2YOHA 2W6OA 2P5TB 2ZS7A 1R6AA 1KRWA 3LQ2A 1U2DA 2WTUA 4Z86A 1ODIA 1NBMD 5JCJD 3HCWA 3R0JA 1A2BA 3I1IA 5AESA 3TUJC 3VU0A 5IVKA 3UMMA 1U2DC 2EIHA 2DQYA 4PYOA 1C3XA 5TX7A 2R7MA 4PNZA 2IC5A 3HNRA 1BKSB 3DVQX 1G21E 3JWJA 4UAVA 1VC2A 4ZCLA 2Z30A 2H5EA 4FKMA 4KQMA 1ISMA 3JYPA 3IA7A 4PZPA 2WJ6A 3DVLA 4D41A 1Z17A 3GWGA 1BD4A 1VGQA 4FNMA 1EZZA 2GPBA 3M6FA 4IYJA 2R4QA 2H54A 1VLZA 4CIDA 2DVMA 2RG1A 3D1VA 5PGMA 5CDHA 2BUCA 5BNIA 3IKTA 1TLLA 2H06A 3B6IA 1FTWA 3LOQA 4XYMA 5CCDA 4BFYA 1Z22A 1SQ6A 4MCJA 5H9WA 4I1PA 2VEOA 1EWQA 2F1JA 3HCPA 4ARSA 4EY3A 3T3IA 1NIJA 2HNKA 3BMQB 1G41A 3EDYA 4G09A 2R7LA 3IOEA 2GJKA 2QP3A 1GA6A 4XX0B 5H4HA 3CEMA 5A0FA 2AC2A 4AKSA 4I99A 3C16C 2X0JA 5CB0A 3ZZUA 2PO7A 1LDBA 2BFWA 5AUPB 3AW8A 3IT1A 4REQA 2XNSA 3STUA 1VE1A 3BFVA 3UKDA 5L6LB 1FDWA 3WWCA 4NZ9A 2IKSA 3GUHA 1WUHS 4R8SA 3U1BA 4YS6A 2GZ3A 4YK7A 5ESXA 1NJFA 3PP8A 3WVNA 4BRSA 5J2UF 1B23P 4B40A 2NO5A 2C7BA 3L7KA 3KOMA 1TQ2A 2HCFA 1YZHA 1CIVA 3IX7A 2PUBA 1UDCA 3KB2A 4HH0A 3BWXA 1WSBA 3KQSA 4J3FA 2J3EA 1NW9B 4GKKB 1ILWA 2J3KA 3OZIA 1CFJA 3I23A 4V0SA 2Z56A 5F76A 3KHSA 4DARA 1EXWA 3EIEA 2LR0A 3JR3A 5MGBA 1RDFA 2V96A 1CU1A 1USUA 4O1HA 4UM9B 4TKVA 1UZNA 1C7JA 1YMQA 2QTHA 4BVAA 5CA1F 1F8XA 4J2HA 1SXJA 1HDXA 4V3BA 4I3HA 1TQHA 3O82A 2HSZA 4KAAA 3NDIA 3P1JA 4IIEA 3GRZA 4P54A 1DKQA 1FJXA 3MMXA 1WMEA 4WBXC 4KB5A 4V0MA 3J81A 1T0UA 2PRZA 2B5VA 1H6AA 1H1DA 1DQYA 4US0R 3H4TA 5ALUA 1T2CA 3HVUA 2ERYA 2QXYA 4RF3A 3HCEA 2V3CC 3MPOA 3K6SA 3DBLB 3TEJA 2AZXA 3KKNA 2RHRA 3OM9A 3DB2A 2EQAA 3OC0A 3ZJYA 3HU3A 1YONA 2G72A 3VH2A 1R6UA 4AUMA 1E1KA 1NOJA 2VDVE 5LQJA 2DBVO 3LHIA 3TRKA 2FPIA 2ZTSA 1PCXA 2Z04A 3MFQA 2QLLA 1PIWA 3Q88A 1EIWA 3ED1A 3IXQA 4K40A 3T1YB 1JDPA 2RARA 4HQFA 5A4MS 4U00A 3F7TA 1FW8A 2C9DA 2IYOA 3TAUA 3WL8A 2EFYA 3HBMA 3BEOA 4JIGA 5HGJA 1APBA 4MYHA 3ZBUA 4N0DA 1TEVA 3GJ6A 4JK3A 2OCGA 4Z8XA 1MCZA 3EIHA 1CY1A 4TSKA 2JJ1A 1CJVC 5ALMA 3I6QA 2VFAA 1XEXB 3UZUA 2GXAA 2WTXA 1MVNA 1TM4E 3Q3IA 4ILEA 3V8QA 3I9MA 3Q8XB 4P4UA 5FBKA 1K2WA 4M38A 4MIEA 2XI4A 2YHAA 4CR6A 1F06A 2PKWA 4ITRC 1EA5A 1U7OA 2HJVA 1SHKA 3P32A 4KXUA 2V7PA 4Y0NA 3VR5D 3PXCX 3E3OA 5D86A 4LK3A 4AX8A 1KI2A 1LPBB 4NI5A 2X9VA 3H16A 4ZVRA 3NZEA 1D1PA 1QYIA 4MQEA 4FZJA 1J6UA 3QXJA 3JVIA 4MRSA 4XQ0A 5IYZF 4HEA1 1N5MA 1W88A 2A1TS 3GLHE 4JBYA 2YN0A 4JUDX 4AD8A 4L07A 4BB5A 1COZA 1TD1A 4Y2XA 1RQNA 1PR2A 1VG8A 2J4CA 4UDYX 4BGVA 3HFRA 3ZVNA 4ZMBA 1EUDA 1DC6A 1I9GA 1PU2A 3OE4A 4NRDA 3P97A 3NGXA 5EXEA 4F3NA 1U6IA 4MCIA 2CNOA 2PN1A 1X7GA 3U3XA 4HTFB 3DUWA 1F7VA 4IRXA 3UJDA 2ADMA 2NUBA 2LZ0A 2QJFA 4O02B 3QWHA 1MX3A 4TXLA 5CU7A 3TW8A 1WP4A 1YL5A 3M7IA 2YWEA 5JXJA 2O3JA 1SH7A 1V6CA 2IPLA 4XAQA 5GJBA 2XNDA 3CZPA 3GNSA 4AMGA 2BFNA 4IUYA 2NPOA 3KYBA 3AZOA 5LVAA 3SR4A 3KQUA 3THYA 3D7LA 4FOSA 2XF2A 3Q72A 2J9FA 3K9NA 2NWQA 3NYWA 5LB2A 4GLLA 4CF4A 1TNDA 3R44A 1KDPA 2BELA 4FOLA 1OBFO 1R8QA 1SUSA 2O2YA 1TW2A 3G5AA 3NAGA 5DBHX 5FWDA 1ILEA 4WOCA 3S1AB 3CO0S 4RK7A 3AL0C 2BC9A 3DWGA 1CB7A 1ULZA 2NGRA 3E7FA 1Z4NA 3NKLA 4LQDA 3GCZA 3FIJA 1Q3HA 1JKIA 5AVOA 2AFHE 3I5MA 5LJIA 4JP5A 2ZPAA 3FF4A 1XRNA 4C2BA 2WRZA 4NG5A 4ABYA 2BBTA 3AFGA 2XUJA 5P8WA 2FEXA 5I8PA 1OAAA 1MR3F 1JIIA 4ZD6A 2OUKA 1H5QA 2VQSA 2PLRA 2V58A 2FWAA 4X3OA 4Y67A 4ZVLA 3NTVA 3VPFA 1ZMRA 4RANA 5IK2D 1JXMA 3CKMA 1LXCA 2AB0A 2OT3B 4PHGA 4E14A 4EEZA 4MR8B 2J0VA 3ET4A 2KHZA 1JLMA 2O19A 2QM8A 1CJSA 1EIZA 1H0SA 2K6GA 1KOLA 1AUQA 4UEJA 3BE6A 1LA2A 1KTIA 2QVXX 5K20A 1Z8HA 1AQJA 1H23A 4Y7CA 5KX5A 1HTTA 3EVGA 3PYMA 1W5FA 3NH6A 4GU5A 4PAMA 3ZK8A 4F4HA 4YR9A 4WESB 1UBMS 2HSWA 2JI6A 2NUPB 1MRZA 2XE7A 3KFVA 1RXYA 3QU4A 1KVQA 1YOVA 2XLBA 4DHWA 1FU4A 4QM7A 1TAHA 1C1DB 4N5LA 2DJ5A 2BGLA 4HLQB 3I3SR 5KOHB 3EUEA 2IX3A 2I7XA 1A2QA 3OCWA 1MDFA 3FUCA 2JHCA 1F51E 2OWEA 4P3NA 4WERA 2J59A 2P0AA 3T7DA 3U4GA 3QKUA 4EL0A 4TZ0A 1U2GC 3I5AA 5JAOA 2Z08A 4HAVA 3R5JA 4ODIA 5AW5A 4EMBA 1NFQA 2WHQA 2IYSA 3LBFA 1D0VA 5DM0A 4OP2A 1BDHA 4YO7A 3VFDA 3NWBA 4GWGA 2NUAA 1VLLA 4UUNA 3TIXB 1N8KA 2HM7A 4MHOA 4QQFA 4RSMA 2IUSA 1FQWA 2FWIA 3P2EA 5HMMA 3UH0A 1FFDA 1UT8A 1Y4AE 2XZDA 2G1PA 4X91A 4XW2A 4P1ZA 2IP2A 3RSSA 4Q4LA 2QTBA 4EWLA 1YRLA 1OA1A 3IVMA 3OLXA 3P9CA 2EWMA 2JH9A 4BX9A 4AQYB 1I0LA 2DETA 5IJ0B 5DX1A 3WYDA 1PV1A 1XZKA 2ECQA 5HBGA 2C8VA 1PX0A 4G81A 4TSFD 1KI9A 2ODTX 2XKKA 4JLKA 4MMXB 3ETNA 1U3FA 4PYJA 1IEWA 5ICCA 3NHMA 4RY2A 5EOVA 4P31A 2G88A 2BISA 4EGQA 4E88A 3FYHA 1ZY2A 1VECA 4YLEA 1QH1A 5LSAA 1T6XA 3T4PA 3USES 2UYHA 3OZTA 4NWIA 2C88A 4ZU1X 3TSCA 4AYWA 1RM5A 2ZE8A 4CDGA 4LOIA 4OKNA 1J90A 1LPNA 2C9BA 3A9WA 3OLWA 3ZEIA 3B89A 1Z7WA 1PUJA 3TH5A 2FZCA 1PLJA 3QVWA 1EBFA 2P78A 1TD9A 2I6QA 3ENKA 1SFRA 4HEJA 4EPWA 3LQFA 2O7VA 3CZ4A 2GO7A 2AG5A 5HFJA 3LLMA 2A1UA 3N7AA 4CXMA 3RW9A 4EJ0A 1QFZA 2EDCA 3OLQA 5CLHA 4U7GA 1NBOA 5DLYA 3G2KA 3OWXA 3COWA 4XD7D 5FPPA 2NSHA 3EA4A 2XUQA 3MTQA 1U04A 3SBXA 3CEJA 4U7FA 3V80A 1G0OA 4F4DA 2W6JA 2JAOA 1J24A 1G7CA 4IG9A 4W7SA 4J0EA 1FOEB 4KXVA 3BIFA 4IF6A 1V8DA 1Q0UA 4CNBA 1PTJA 2O57A 4IINA 2P0YA 4WOJA 2H1OA 2EZUA 2DJIA 1FSFA 2JJ8A 1PTJC 4P08A 4XIIA 1CY0A 3S1LA 2PCJA 3BE8A 4R4JA 3AILA 4EJ6A 2IT1A 1DKOA 1ZUNB 1VKZA 2AG0A 3WGKA 2RFLA 1MV5A 3Q3CA 4I3FA 1JJFA 3P9IA 4AP5A 4ZQHA 1PZEA 2X5JO 3T8YA 3MMPA 4MZDA 5KSPA 1QOPB 3BVPA 5DYIA 3SLGA 3ELWA 2ZYVX 2HLHA 3D6VA 1OT3A 2XB9A 5EYPA 2G76A 3UMSA 3ZXUB 2ASEA 2APJA 3TRIA 2RKBA 1CZUA 1J56A 1R5NA 2VJBA 1WE2A 2ZWVA 4S0ZA 5CFQA 2VA9A 1DAPA 2Z1MA 3ZE2B 3EEIA 4DUGD 2NZVG 2I8CA 3QIVA 4KFTA 5BP7A 2QN2A 4RV5A 3RYIB 3EIQA 4KMSA 2EL9A 2W6QA 4TMFA 4OHFA 5D01A 1FF9A 3DP7A 4UU1A 5SV2A 4IUBS 3BMXA 3REQA 3UPDA 2W9XA 2HT1A 3ZKAA 5C8VA 1R00A 2DGDA 5U9CA 1EXMA 4UBJA 3FDZA 2CLLB 2NVUB 4EARA 4DMCA 3IRUA 4E11A 3NBAA 4UUOA 3IEMA 1W6UA 3KX2A 4TWJA 2OCDA 5EERA 5D8DA 1ENZA 4ETNA 4BN4A 5AVXA 3ZWVA 4B79A 3AVUA 1IJKA 4ED9A 4DUYB 2X42A 2NM0A 5LP6F 3QIAA 2X8BA 1ENOA 3GAMA 2R6ZA 3KJNA 4JT4A 3TBHA 2G07A 3VAAA 1L8XA 3BFKA 3I72A 1QMGA 5KHOC 1J8MF 4ARCA 3IS3A 2OV4A 1P6XA 2EBHX 3P4XA 4QGBA 1V35A 4I4TA 1TO2E 4PAOA 3ZIDA 5KYYB 4CIXA 3ZE7A 1BMFD 1JHDA 1POXA 2QV7A 4DM4A 5IAGA 3UEOA 1DPFA 4FX5A 2ODAA 4BATA 5LYYA 1WOMA 2GUGA 1V37A 4MQ4A 3T7RA 3T6KA 2AJ8A 1UBKS 4G4IA 1YNSA 4F4IA 1KOJA 2QROA 4D56A 2JFHA 5EJ6A 4LRTB 4LJ9A 2BBSA 1EUYA 4ACBA 1VP9A 2EZ9A 5IVIA 3NFYA 1VBNA 3IQXA 3PT5A 4IMJB 2HADA 2GCOA 5A9SB 5EEGA 2FXVA 3TIFA 1GRCA 2WIBA 3PUKA 3H9CA 1T1SA 4DA4A 1ZSVA 2J7PA 3NHBA 5CTAA 5TB5A 3R8FA 2P6MA 2HRCA 1N5RA 2QSYA 3NANA 1PR3A 4FI3C 4XEUA 1P4HA 5DCWA 3ZJTA 1QBGA 4HOYA 5EIOA 4KUHA 2UUOA 4LSZA 3RB8A 4JNKA 1ZGCA 5E0KB 1WO8A 2J3IA 2WM2A 3GBVA 3FM9A 2CNBA 4N8EA 4D82A 4DIFA 3UPUA 4M0EA 1V1RB 5IX8A 2VPIA 3U7FB 1Z4IA 4PX9A 3MVEA 3R0VA 4F12A 4JVSB 3AM1A 1AKNA 2WC1A 4OM8A 1J99A 1KFKB 1IWOA 1HNXB 4X8LA 1ZK3A 4WK6A 4KMOA 1JSZA 1DARA 3HM2A 5L4NA 3TGPA 3ASZA 1ECFA 1FNCA 3AL2A 3UIEA 3A6ZA 4GO1A 2CDBA 4HQ6A 5LP6A 1ZVVA 5D84A 3P4YA 1P17A 4ZCMA 3F9RA 4URZR 4ZREA 3MRSA 4F45A 5LP6C 3KKZA 1F8YA 3RFTA 3MCWA 4LSWA 1SMKA 3DV2A 5EQJB 2RE8A 3GW8A 5BR8B 1RYFA 1KS2A 3C14C 3G6KA 4V2UA 2XMCA 3TDNA 2VAMA 4RL6A 1TEZA 3MELA 1M2VA 3FMPB 3CE6A 2ZRMA 3NRJA 3R5FA 4R9UC 3QSYA 1IL0A 4D6PA 5SY4A 3JQ6A 4TKZA 5CR9A 1X9GA 2CFRA 3QVKA 2IPNA 2VVTA 2I2DA 1E58A 3CPSA 3W7AA 5GV7A 4WI1A 1KZHA 5CCEA 1JR3D 4KO2S 3OOWA 2ZEJA 4RW0A 2NV2B 4N0EA 1QHXA 1USKA 5KJCA 3PA6A 2DM6A 4MDFA 2C4TA 3W1WA 5CVDA 5K0TA 1JFLA 3OLCX 3UGJA 2IRWA 4GLJA 3AQ4A 4RQBA 1AUPA 1EDZA 5D00A 5ALPA 2ZBQA 3UPTA 1G8GA 5D87A 4EAAA 3P0RA 5ECGC 1JW9B 1Q19A 1UL1X 3PC6A 1UFQA 3A4VA 4Z9BA 3W77A 5BWCA 3AOEA 3B1ZA 2Q4OA 1TVEA 2ZFUA 4GR9A 3ZE9A 4LF8B 2FR1A 1YCFA 2FGJA 2JD0A 3AOEC 1T34A 1R1DA 4XFKA 4BFCA 1EPUA 1PT5A 2GQ0A 1O95D 2PZEA 3LY8A 2ROQA 3FZYA 2G4VA 1A9TA 1Z2PX 3F5SA 4DCSA 4XE5A 1RXWA 1J0BA 4L8VA 5FI0B 3B78A 4N4AA 4G2TA 3LT0A 1AUVA 4E5MA 2CV2A 1WDTA 4LJLA 5JH7F 1KARA 1TVKA 3MB5A 3U7JA 3F49S 3F4BA 1XU7A 2FW7A 3GHHA 5BVGB 5EXPA 3FHTA 3K8QA 2B1RA 2ZAGA 2BZ1A 3UCFA 1G19A 3LQYA 3MLAA 2WF6A 1FFXA 1VL6A 1UXKA 2BJHA 1EVIA 4K5QA 5KTRA 3BMOB 4YTEA 3KL2A 4FCCA 2JEZA 3STYA 3L4EA 5JG7A 4EHBA 2X9QA 3AJEA 2XXJA 3ASYA 4PY2A 4WTOA 4F3KA 2NLOA 4WZBB 2G6TA 1ACMA 4HK4A 3FOWA 1R0ZA 2I3GA 4MUYA 4U0KA 3M4ZA 1DDIA 4KO1S 1FJGB 4GW3A 1Z88A 4YLGA 3DFIA 4TTIA 3QE9Y 4JKYA 1M54A 2PH7A 1D4OA 2Y77A 4I46A 4RETA 4ALNA 2TS1A 2O2DA 3A1NA 3DC7A 3U16A 2Y68A 2YZ7A 3A7DA 1GNQA 1YS4A 4O2BA 4CIYA 3E5RA 1DRJA 3H5VA 1X7WA 1WQ3A 2BE7A 4OOEA 1X14A 2PD3A 3M9LA 4KE7A 5TR9A 4BQQA 2QF7A 4NH4A 1J0DA 1Z5NA 3KZCA 4KG7A 4AB1A 1T5BA 2ODPA 4AZ3B 3W6NA 4DM3A 4J49A 2CCJA 4M0PA 2CHQA 1MX9A 2JAWA 2PGXA 3MTBA 4H31A 4WKPA 3WJ2A 3AVQA 1KZ6A 2D8MA 5EN4A 1NYTA 3UJBA 1NVWQ 2VJMA 3UJ7A 3EXIA 4KLZA 1XHLA 3V1UA 3IOYA 5JSHA 4AIRA 5DMXA 2YBEA 2CLIB 1HRKA 3I1JA 2ZSAA 4RL4A 1VBKA 1P75A 3RF7A 2WPNA 2C1ZA 2I3AA 3BTOA 4HFNA 4ZVTA 3OBBA 2AL7A 3ZVKA 2ECFA 1U0BB 4YR7A 2V7TA 4MYTA 3JX9A 1VE9A 3IEVA 4PZ9A 4ZO9A 3RVRA 3Q7PA 1LW6E 4I7EA 2IPXA 1D5CA 4NCHA 4BNXA 2EU8A 2V3WA 1PZHA 2B61A 1RAGA 1PSWA 3IOCA 4X0EA 1YZ3A 3J81k 3FWNA 4KPEC 3Q4GA 1JGTA 1ZD5A 2PJDA 4RYLA 1Q2XA 2YJGA 4E5NA 3LSTA 1A9SA 3NOVA 1FRQA 1G4UR 3H4IA 3NIWA 1D5WA 5JCZA 1B3BA 3AESA 4U2KA 4ZJUA 1LQ2A 1XTBA 1CR6A 4RSHA 1TCAA 5EE9A 2DR3A 8MHTA 3GRFA 2H7XA 3GF4A 3ICWA 1QH1B 4MJXA 4GS5A 1RNLA 1EWTA 1NJ5A 4BP8A 5LN1A 1Q6ZA 2IZOA 1M1UA 4NE9A 1JAZA 1LK5A 3HVKA 3V3KA 4E21A 1SBNE 1ZGHA 3PENA 4R1MA 3M2TA 2QBYB 4BX3A 1GZVA 4FQ7A 1VJ0A 4ZU6X 4PO9A 4YA6A 2Y1CA 1CDOA 1K06A 3QLUA 4JXXA 2BGWA 3AF3A 4HDKA 4OMUA 4NDZA 2CXSA 2WB2A 3QLUC 4KC0A 1VKHA 2DUNA 1GYRA 3GB9A 4A23A 2GH1A 5F2OA 4B3GA 2HTFA 3TYXA 2QQEA 3L8ZA 2J08A 2Y1KA 1ZLXA 3P0HA 1DDOA 3MNFA 1LEHA 1DC3A 3LGXA 4DWWA 3UOWA 3K0HA 4ZEMA 4HN9A 3DR5A 3N70A 4WFJA 5AI4A 1NI4B 3CLUD 4YALA 2BFCA 1E61A 1KK2A 1LF5A 4KTTE 4MMYB 1L2TA 3HJRA 4IQGA 4Q1BA 2R25B 1T2DA 4Y18A 1LPOA 3EVNA 4ZEXA 4RY9A 4OHYA 5L40A 4MHSA 4TZKA 4IWXA 2WKQA 1E7MA 3NX4A 4HBGA 2FSPA 3AR3A 3GFRA 1KF0A 2B34A 3IXMA 4FNAA 3UJAA 2YZMA 4PG5A 1QGDA 4RPIA 2P27A 5FBQB 4UU7A 1WULS 4EGJA 4U6NA 5EMJA 2PUDA 4MQLA 4PYNA 1XTZA 2H6EA 3K4PA 3FA2A 2BFBB 3PQ6A 3PUVA 3QVSA 2NU6B 4WGGA 5A4AA 1B6SA 4MWDA 4GBJA 5H3CA 3GJ0A 1WQ4A 1UXOA 3E61A 3DE7X 4ND2A 2YWCA 2UYGA 1N3YA 3OZSA 3REQB 2BMJA 2E37A 1VL8A 3NKFA 2OQ2A 2NQ8A 3MCUA 2HH9A 3OZRA 3VNUA 3PX3A 3TQCA 1YC5A 2LDXA 5ER6A 2A5JA 5E38A 2C42A 4D3XA 4YMLA 2Q29A 2XTNA 1TIBA 3JD1A 2A0WA 2G06A 2IKQA 3C70A 4BP9A 1JJIA 4PR3A 5DH9A 1QK3A 4UMVA 4A6EA 5ADWA 3AETA 2WM9B 3THOA 1W8DA 1GZUA 3BL5A 3DO8A 3PGXA 3SF8B 1JAHA 3D0RA 2ISCA 2XHEA 1ZINA 4KQCA 5DM4A 3ZIAA 1UKVY 4R1QA 4HT3B 5HILA 2NW6A 1MIOB 3DZKA 5K7SA 1QGAA 3N0RA 4CI9A 2JLZA 3K16A 3UENA 1KI4A 4NU5A 5E7MA 4BN5A 4F8EA 2G3YA 3Q9NA 1ARZA 2V9CA 2Z3WA 3D8HA 5EE1A 2SECE 4RIGA 4YONB 1TZCA 1M2JA 4KNWA 3CVYA 1G16A 3CX7A 5FR2A 4L4YA 4AY6A 1XMPA 2C00A 3UYKA 3H2JA 2PS9A 3ZYZA 4BZQA 2F17A 1L5KA 4V0QA 3WRYA 1HURA 3ZI0A 2QTCA 4L6AA 2H5JA 2IIBA 1AMOA 2BKUA 3TOSA 5ALYA 3SI7A 4WJLA 1M6NA 4PQFA 1XVVA 3RU3A 1RSZA 5FF9A 4KXWA 3TZ6A 2B0JA 3UUWA 4ZOLF 4YJ2A 4IHQA 5IC5A 4CUZA 2IQIA 1MORA 4ZPXA 4IHJA 4ZRNA 3PQFA 4YRSA 1GKKA 1SU4A 2H52A 2QB5A 3QNWA 4WVFA 1RD4A 5C8YA 3WQSB 1UF9A 2WT9A 3LWZA 4LF4B 1C2YA 4IP0A 3GLUA 1CE8B 1GVHA 4JDUA 2GZSA 4CM3A 5MN5A 3Q41A 4TT3D 3SC4A 3UK1A 4DCPA 4Q4AA 3NHSA 4L50A 1FS6A 3KT6A 2C5EA 3AI1A 3FSRA 5JRDS 5FQOA 1CIPA 2O54A 1A76A 3EW9A 4P8RA 3WNQA 1UAYA 2J5XA 4TVOA 1NQ5A 1ZIDA 3NV7A 4WOKA 1UOEA 4GOOD 5G3ZA 3ANYB 4G2NA 5A0TA 2BUAA 1U80A 1WV1A 1Q1QA 3NPAA 3UN1A 4NK5A 3HA5A 1KK3A 4I55B 1DCFA 3IH5A 3MWEB 1PRYA 4IDAA 2W2KA 5JWOA 4H7FA 1W2GA 3IUNA 4QZVA 3BWCA 4LX0A 2QZSA 2GD0A 3RO7A 4WXMA 5B6PA 2AC7A 2G36A 3CUYA 1EHCA 1W1WA 5HF8A 3ZDYB 4BQFA 3QK7A 4ARAA 3MJSA 4GZ3A 5K0CA 3LIPA 4AF7A 2FOXA 1IRIA 2Q2OA 4NBLA 4PSCA 5ALRA 1IEVA 3ZG6A 4AJNA 4DY4A 4LJSA 2H2WA 3WLRA 4PNEA 5I3CA 4FFOA 4FSHA 4GXRA 5LLTA 1YCGA 1XUOA 1NW5A 2CHUA 1FQKA 2HXYA 1M2VB 1JF8A 2CFCA 4MQ6A 4MYUA 4RPGA 2ZWAA 3RE1A 1VKOA 3A6JA 1RHRA 1JLLA 4QUHA 3TSAA 4PYIA 1R6XA 1UBCA 1BGXT 1SGWA 1V5IA 3FPAA 3MWFA 2ZYIA 3O8OA 5A6SB 2VAPA 3BAFA 4OQYA 5DYGA 3GLFA 1H9CA 1SN7A 2YW9A 1TQ4A 3VNSA 3WO0A 3ZGLA 3N74A 3WA7A 4LY6A 4IEEA 5ICEA 3UK0A 2VYCA 4AZ0A 3D5EA 2QL9A 1O6GA 2PRSA 2XWSA 5TE9A 1L7OA 1MXHA 4XVHA 2YS6A 5I7UA 4EW2A 3BL8A 1CUBA 3D1LA 4L8WB 4BWVA 5M04A 3V2IA 2FMXA 1FP7A 5I7FA 2QUKA 1L5SA 4JSRA 3H9UA 3JD3A 2X77A 4G8CA 4J0CA 4JI2B 1V47A 4B48A 1Z13A 2ZS8A 3IO5A 5DO9A 3S5JA 3KSMA 3AU8A 3W9YA 2R6HA 3QVTA 3JWGA 1X6VA 5CIQA 2PWBA 5FP0A 1B43A 1EVQA 5L3ZA 1DXHA 221PA 1RXEA 3II6X 4L4XA 4AWBA 4TMVA 3THWA 5CIWA 2ZETA 4KBGA 4JGIA 1CUUA 1L4LA 3EBOA 2ID7A 4Q9IA 3D4IA 2F48A 1EFKA 3L7BA 3PEYA 1HG1A 2VCYA 3WLAA 4E2WA 1DKUA 1PW5A 2QMYA 3MFYA 4UNQA 4BQEA 2QYOA 5BQXA 4GUDA 3MYRA 4C04A 1E3JA 1SQ0A 1NWCA 5LPNA 1G5QA 2QLJA 4GXQA 2NZUG 3MIIA 3DL7A 1KDYA 3Q3JB 4W82A 4XDZA 1LUAA 1FSZA 4EHJA 1SG9A 2BSQA 2CVOA 3PKJA 3EC7A 4IJVA 5A05A 4G1UC 5EZ5A 2YC4C 4CQLA 2VT7A 1HR0B 1W85A 4GZ6A 3SE0A 1HYBA 1LC0A 1QIHA 2J6HA 2ZTMA 3ANXA 3HZZA 4NZYA 3K71B 4JASB 4R51A 3JAMA 1NDHA 5CPFA 3A9CA 3D02A 2JGFA 2V65A 3O83A 2ENWA 5AOVA 2GJAA 5KC9A 3OFNA 2BEWB 4X9XA 3EBPA 4UQOA 1SVLA 3TLEA 3PI6A 2R1VA 4OHZA 1A98A 1VJ5A 3CX3A 1ZVMA 4RK1A 1JEAA 3GRYA 4BGIA 3IMGA 5K03A 1PSDA 2CCKA 3DB1A 2JFWA 2P7HA 3IR6A 3KAJA 3HU2A 4AP9A 5IXSA 3LD9A 2O1XA 2EVWX 2VDJA 4XM0A 3RC1A 3UG6A 2ZRGA 1U5CA 2UZIR 4GR4A 4X60A 4YECA 3EVAA 2NU8B 1K5GA 2ZLBA 2J5BA 2QTFA 2IEIA 4JBLA 5ALNA 1G3IA 1B41A 2BFEA 2HZ7A 2NSYA 3JWEA 3QVJA 1B8VA 4MW1A 3K1AA 3TQSA 1DBVO 3SFVA 5KTYA 5EXTA 4Q4CA 3IAM1 2I4LA 1U0LA 4PCUA 4JLOA 4OJTA 4TTAA 4CQMA 5KNCH 1GSOA 1K27A 4DMKA 3UY4A 2PKQO 1QXSA 2GTIA 1JL3A 5BT8A 5TY0A 1OXKB 2ATEA 4KQ1A 5FTKA 1P7WA 3F9CA 3QUQA 3U2QA 3UNXA 2JC3A 2WPDD 1MB3A 3S8YA 1WG8A 3HB7A 1E2NA 2MWMA 1R8SA 1YT5A 3LUBA 3AT1A 3PIIA 5BSRA 5A5GA 2D2XA 1EQUA 4WXPA 3RWBA 4E32A 3ZHVA 1NI5A 2VJYA 2YWHA 3B7PA 4O1MA 2QUJA 5LQRA 4XQEA 5IBCA 5E9AA 2ATIA 3UFXA 1E2DA 4LFCB 1ENYA 1UC8A 2MSWA 2Z5LA 5EHZA 3LAWA 1ZN8A 2AVNA 1VJDA 4J0HA 4R71A 5G1NA 4TYMA 1U2QA 1UBTS 2I34A 1ZL0A 5IUJC 5CYGA 2GHTA 1XRRA 4ES6A 4RORA 1OI7A 3IUYA 5GONA 4ZQBA 5JE8A 4ARZA 2CEKA 4RVCA 3BMNA 4DIDA 1X7YA 3N1UA 2WUWE 3VDNB 1I3LA 1A9OA 2OP0A 1EM8A 1KZGB 1L7RA 1M1ZA 2XE6A 1U3WA 2VTVA 3GAFA 3INGA 4MWTA 4QUIA 2XIJA 4Y2YA 3ZE0B 3NCTA 5BSTA 4CE6A 4ENQA 1ZW6A 2I62A 3GT4A 4WW0A 5LUAA 1XDWA 1AIPA 3LPNA 5E9WA 1ADJA 3QMWA 1N2IA 2IUYA 1KVTA 2TSYB 3OQHA 3WGOA 4J7UA 2IOHA 4CMAA 4PZZA 5JAMA 2XLCA 5BYBA 2XNCA 1FVXA 5C2JB 3ZBPA 1E9VA 5IJ9B 4RZIA 3EG9A 3FYUA 3GXBA 5HKAA 3D3WB 4XDGA 2WTNA 2HUPA 5TNXA 1R0RE 3AKDA 3U09A 2OHHA 4H15A 4O2AF 1M74A 1P1KA 1JHMA 3EISA 4HPWA 3CT4A 1L6RA 3PNMA 2BDTA 3CF2A 1ZNYA 3RC8A 1BGWA 1FU8A 1CQZA 1L5MA 1V96A 2C4MA 1IHPA 1DOHA 3DEKA 4GL4A 3ZKWB 4DQDA 4A8HA 5IDXA 4ZQCB 4DV6B 1VHDA 1E94E 1M5UA 2PY6A 4KACA 4WLNA 3F90A 4MI6A 1FDOA 1KMCA 2FUCA 4L5BA 3VR6D 5FEUA 3VNBA 3ADOA 3GMIA 4QAJA 1E7RA 5L3QA 2O8CB 1O97C 3SS7X 3WYCA 4UDNA 2HRZA 4FS8A 1GXSA 1N6LA 1G8AA 1YMUA 3AWDA 3D4NA 1KVSA 4XLLA 2D6FA 3GFBA 4YIHA 1ZOPA 1OBOA 5LJLA 5JS8A 4YYZA 4K2AA 4CLRA 2W7TA 5DGXA 1ORIA 2JJQA 1FYXA 3KAQA 3V4OA