2FSWA

Crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
RKISDEECPVRKSMQIFAGKWTLLIIFQINRRIIRYGELKRAIPGISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFGMENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG_0823 protein
publication title Transcriptional Regualator, MarR family from Porphyromonas gingivalis W83
rcsb
source organism Porphyromonas gingivalis
molecule tags Transcription
total genus 26
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fswA00
1Q1HA 1B9MA 4M73A 4EJOA 3I59A 2BEOA 2GQQA 3MFKA 2A5YB 1YW9A 2KIMA 1OKRA 5J8CA 3WODF 3WG9A 1G3YA 5F1RA 1RUNA 1WSUA 3GUDA 3ABUA 3LA3A 1LDKB 2WV0A 1O3QA 1SD5A 2W25A 5D8LB 1IN8A 1TTYA 2F5FA 3QP6A 1MJBA 3EETA 4PDKA 1XSDA 2Y75A 3V8KA 2XGXA 2K86A 1YS6A 2FNAA 1T2KA 3CUQC 2A6EF 1HQCA 1TQIA 2Z3YA 4HX7A 5TRDA 3OV8A 3IL2A 1QQIA 1GXQA 2L02A 5F64A 2O03A 2M8EA 4M9ZA 1HXDA 2D1HA 3FM3A 2DQRA 2P5KA 4U88A 4Z2YA 3E6CC 4G7ZF 3DFGA 5D8KB 1ZN2A 1LJ9A 1J75A 2V9VA 3V8LA 2V1DA 4UV9A 1OYIA 3WE2A 5CVJA 1FX7A 2GWRA 3HTUA 1XSVA 4GGGA 3W6JB 3Q9SA 3ZPLA 2OZ6A 4EGYA 2VT3A 3GZ6A 5CVUA 3E5QA 4YG2F 5EEHA 3PQKA 2M87A 4WK8F 2G7HA 3VFZA 1G3SA 4O5VA 2NS0A 4A12A 2OQRA 2QQ9A 1Z9CA 2KJBA 4WXCA 2WWYA 1QBJA 3J81Z 2EV0A 4EJVA 4GYGA 1RZ4A 3IKVA 5HS9A 1R5HA 2HQNA 5DDGA 1IN5A 3IWFA 5HLGA 2RN7A 5HLIA 5DD4A 2MLKA 4UVAA 1KU7A 5L3DA 1FYMA 2GXGA 3GWZA 3R61A 4L9VA 3TGNA 3EYIA 3JAMK 2DU9A 4L9NA 2CG4A 1U78A 2P5LC 3V7CA 5FO5A 2QBYB 1ZLKA 3T8RA 4D0PA 1S8NA 2JSCA 1QZZA 1SFEA 5IT9Z 3NQOA 3WGGA 3I4PA 2IA1A 2ZO4A 3H3UA 4RAZA 2GA1A 3ZMDA 2JZYA 3FMSA 5L3EA 5DEQA 2PG4A 2ZMEA 1ZARA 4P9FA 1CF7A 3RI4A 2XIGA 1R5GA 3KEQA 1MZBA 1FBQA 4RAYA 3K1NA 3MQ0A 5LBQA 5FB2A 2P6SA 1LQ1A 3CLOA 1BN5A 4EMSA 1YIOA 2XASA 2J5OA 3F3XA 3V4GA 2YR2A 2RKHA 1Z1DA 1YTYA 2VC0A 5HOOA 2ZKZA 5E8GA 3M1EA 2P7VB 3O3KA 1IF1A 3TDUC 2HOEA 1FYLA 4G9YA 4ESFA 3EQLF 3DEUA 1ZG3A 5KK1A 2JT1A 1P2FA 3DPLC 4UVCA 3KP6A 5E1XA 2MH9A 1O3TA 3H3ZA 4S04A 1U3EM 1BIBA 4XLNF 2RVCA 2YPRA 1F1ZA 3RDIA 2ETHA 1XDUA 4A6EA 4HOBA 3DF8A 2E7XA 3ISPA 4KNYA 2M30A 4ENJA 2M1BA 2P7CB 1TQMA 5ILUA 3FXQA 4MHGA 4CICA 3KP4A 2MD5A 4BHBA 3ZMVA 1I27A 1NHAA 3QPTA 2L4AA 3KFWX 1FPQA 4U7BA 4CDGA 1KGSA 3MEXA 5D5XB 3JTHA 2PQ8A 4ZZDA 2KIUA 2LSOA 5E1ZB 2STTA 2HYGD 2V1XA 3F8MA 3F72A 4XBFA 3IRQA 1UHWA 4I0AA 5CLSA 2HYFA 4KA4A 3BJOA 5BMZA 2Q0OA 1L3LA 5ICFA 5L3CA 1RNLA 1D8JA 1IRFA 4HBLA 1FWZA 4L0ZB 4L5IA 5K5QA 2A61A 2FA5A 2NRAC 5FGMA 4A5NA 4NQWA 1U5TA 4HX8A 2W24A 1J0RA 4OIRF 1R1VA 3IWZA 3K0LA 4HDUA 3H92A 4LLGF 2MA3A 4I0BA 2IT0A 1UB9A 1W7PD 2K4JA 1IN7A 3V7RA 1O3SA 2NYXA 2FXAA 5K5OA 5FD5A 3JW4A 5DCMA 2QVOA 3S2WA 2XKPA 1MD0A 2LF7A 2VBWA 2ESHA 4ZH4F 4OIPF 3F23A 3KP3A 1SMTA 1T6SA 1WRJA 3WTWC 2GXBA 1OMIA 1GVJA 4TV7A 2XAGA 2KJCA 4ZYEA 2EK5A 5ILVA 3IKTA 1XB4A 1HW2A 2QLZA 1BI0A 2GZWA 4G7HF 3PQJA 1DPRA 3BPVA 3ML6A 2RC4A 2IA0A 4HLYA 2HTJA 1Z05A 1SD4A 2F2EA 1FYKA 1REPC 2OD5A 1Y0UA 4I2OA 3WGHA 1JE8A 5IT3A 3QPHA 2OU2A 3K1PA 2HZTA 1DUXC 1ZG5A 1TNTA 1Z6RA 1OR7A 4N9IA 1EH6A 2GIVA 2PFBA 1YW7A 1MDMA 1J9IA 2OAZA 3HOSA 3ZQ7A 4KDPA 2EFPA 5DCFA 1KQ8A 3MCZA 3WU0A 1IN4A 1WQ2A 2FBHA 5J6XA 2CYYA 3L00A 2DFIA 5J8FA 1K78A 5FLXZ 4ENMA 3WTVC 3GF2A 1J7KA 1G3WA 3WTUC 2FBKA 2E1CA 3TO6A 2FBIA 2XV4S 4OIQF 4IXAA 3M8EA 5LLQA 1EH7A 1ON2A 3GFLA 1R22A 4L9TA 1XDSA 4HAMA 4AIHA 5HS7A 4XSXF 5DYMA 4O3MA 2H94A 3QAHA 3GX4X 3B02A 4IHSA 4LG0A 4OOIA 2FF4A 3U2RA 4RGSA 4HF1A 2L4MA 1J59A 2BBYA 2COMA 2KRFA 2ZBKA 3ROUA 3GZ5A 4BNCA 2UXXA 3BJ6A 4A2UA 1HKSA 1CGPA 1P4WA 1O7FA 2OBPA 2DT5A 4MTEA 1F5TA 4HF2A 4RB2C 1XGMA 3ZMTA 2EA4A 2F5EA 4G6DA 5EEGA 4MNUA 2NNYA 3CO6C 1OPCA 2H6CA 5JHUA 3HRUA 1VTNC 4P5OA 5JI6A 3LQRA 1BOAA 4HQMA 2C6YA 5FFZA 5D4SA 5DUKA 5BPIA 1BC8C 2XKOA 2EV5A 2GA2A 3J81K 4YFKF 3KETA 2EFQA 4I01A 1ZGJA 3I54A 1U5TC 5TJJA 3FMQA 2LF8A 5ERIA 2H27A 4NHJA 3CUQB 4EM1A 4ENNA 1O57A 2DAOA 1R00A 2PMUA 3RPQA 3F6OA 4EGZA 1O3RA 4M74A 2DI3A 3V8JA 1I1SA 3G73A 1FNNA 4M6XA 3I0TA 2OZUA 3DP7A 1P4XA 1QNTA 1OYYA 3BPXA 1OYWA 1R1TA 3WTXC 3E3VA 4WF2A 2R7DA 4BHPA 5IT9K 3DPTA 3CUOA 1BI3A 2RDPA 4PZJA 4M9XA 1FSEA 4BH9A 4KN4X 1H9GA 2BYVE 3L9FA 2Z9OA 1A04A 4LLLA 3GVAA 2E7WA 2CFXA 1HSJA 1JGSA 2QENA 2R3SA 4L9JA 1XMKA 1Z6TA 3GW2A 1S3JA 5JFRA 4IRHA 2IVMA 3O2PE 4BQAA 2XAHA 2HWVA 4M72A 2HQRA 1K6OA 3FF5A 1USTA 4BHCA 1TLHB 3KP5A 4KIBA 3RYPA 1I6XA 2IRFG 1UHMA 3E6MA 3WE3A 1ULYA 2AS5F 3I64A 1K7AA 1STZA 5JR3A 1SMYF 1T0FA 4Q4ZF 4KICA 3SHFA 3GFIA 4U0WA 1E2XA 3E6DA 2ZCWA 3K1MA 4RGUA 4A0YA 2EFNA 1KQ0A 2IA2A 3ELKA 2V79A 4UHTA 2A3SA 2JTVA 2XUBA 1JHHA 2B0LA 3N97A 1I5ZA 4PCQA 4XRFA 4LMYA 3E97A 3TKYA 2VE8A 3IRRA 2BGCA 4G7OF 3E5UA 1IW7F 4P96A 2AXLA 1XGNA 5KVRA 1R1UA 4H0EA 1LB2A 3T5XA 2KKOA 2KIFA 3T8TA 2Q8KA 2VBYA 5FFXA 5HLHA 3J80K 1W7PA 3ZN1A 3REOA 2FNPA 1HBXG 1W5TA 2PI0A 3GLXA 3LA2A 2G9WA 4UNOA 1JHFA 2R7FA 3CO7C 1XCBA 3GFMA 5H20A 3HTSB 5CVRA 1IN6A 3JAMZ 2MC3A 1C0WA 2O6GE 3B73A 5HVQC 3I59B 2RGVA 1TQPA 3MWMA 3F8NA 2FEZA 4S05A 2MH2A 3EDPA 5LGNA 3DQVC 4K2EA 4AIKA 1EH8A 2EB7A 1LEBA 4MQVA 2JRTA 3RPUA 1ODDA 1W5SA 4UUVA 3GYHX 3TQNA 4U7DA 3SZTA 2QZ8A 1GHCA 4IPAA 1KYWA 4PGGA 1ONVA 5L3BA 4GCVA 4RGXA 2VE9A 4ASNA 5BOXA 1ZLJA 3ERED 2HFHA 5E1WA 2EFOA 1LNWA 4CYDA 2EJRA 3HRTA 4HQEA 3RKWA 2UWMA 4MQ9F 3W6KB 2M45A 1B9NA 2VC1A 1LEAA 5ICCA 2PMHA 2CWEA 2ADUA 2HDCA 4R8HA 4L18B 4KN7X 1BM9A 3VOEA 3GFJA 1GXPA 1ZYRF 3WTYC 3GXOA 1FOKA 4RB3C 4BAYA 2IP2A 2OQGA 2EFWA 5D5WB 4FX0A 2ISZA 5D6FA 1UCRA 1S7OA 1KU2A 3I5UA 3QU6A 1WKMA 4ETSA 1K79A 2VN2A 3ZN0A 1H9TA 4MEXF 3T1BA 1MJAA 4A5MA 2DQLA 3SFZA 5HDGA 3HRMA 2FMYA 3C7JA 1V4RA 4F7ZA 3KP7A 4ZYGA 2K02A 3N4MA 1QZYA 3BZ6A 5A2QZ 1ZHFA 2XRNA 6PAXA 2QYOA 1XSXA 4IJAA 2BE5F 3DV8A 5LHHA 1BI2A 2O0YA 2P8TA 1KQ9A 1IAWA 2Y0MA 2FU4A 5DUIA 4DNCA 4KIGA 5CJ9A 3U1DA 2VOOA 1P6RA 3I58A 1G6NA 4IVNA 4WCGA 1ZRDA 4AD9A 3E5XA 5BS6A 1SFXA 1FT9A 1HSTA 1BBYA 2F5DA 1SFUA 4XSZF 2CGPA 2ZFWA 3HUGA 3SZPA 2H09A 3LFKA 2ZMEB 3ECHA 1CF7B 4EJTA 2LKPA 3RIRA 1T98A 3P7NA 5HDKA 4FT8A 4U0YA 2HEOA 3T0YA 1FSHA 4OMYA 2UZKA 4EJUA 3CTAA 2P4WA 1G3TA 1FP1D 3WTZA 4HA8A 1AOYA 5D4RA 2QBYA 4LK1F 2VXZA 1XMAA 1RUOA 3HHGA 2ISYA 1HW1A 3NRVA 2X4HA 1ZG1A 1ON1A 2L3DA 4JK1X 1TBXA 2O8XA 2FSWA 4WWCA 4KT5C 1Z91A 3KLOA 4OU0A 1S7AA 1E17A 1SD6A 3E6BA 1FBUA 3BDDA 4B8XA 1AWCA 3C3WA 3BP8A 1USSA 4G94A 1D5VA 4WX9A 4OINF 3FHZA 4Q48A 4YIIA 1LDDA 1ZH5A 2K4BA 5H6RA 1J2XA 1KU9A 2A07F 2CO5A 1B59A 1R7JA 2HGCA 2TDXA 4GO1A 5FD6A 2VBXA 2JPBA 1JXSA 1BIAA 2RQPA 2YX4A 3SQNA 2PN6A 2NNNA 1F4KA 1MKMA 4FHTA 5E18F 4G6QA 3RYRA 1XD7A 2QWWA 3G3ZA 3HSRA 2IJLA 1F9NA 1YYVA 4L0YB 3AAFA 2RNJA 1XGOA 4M71A 3HYIA 4L5JA 3Q9VA 3KE2A 3VB2A 3R6SA 3IHUA 1YFHA 4CHUA 4QLCU 3QP5A 1U5TB 2A6HF 3EUHA 1SD7A 3BOQA 1ZREA 3OOPA 4IHTA 1MJ9A 2VODA 2XAJA 4YFXF 2CW0F 2HKXA 4CXFA 1H0MA 2FMLA 2YU3A 4LLNA 5E20A 1B4AA 1YQAA 2EA2A 2QUFA 3VEPA 2DPUA 5DCMB 2H6BA 5E8IA 3O6BB 2XAFA 5L3FA 3LAJA 4RS8A 3BWGA 4PGHA 2FOKA 1FY7A 2DPDA 4CGZA 4Q5SF 3C18A 2WC2A 4BXUA 4WXDA 3LAPA 4AIJA 5BPDA 2ZXJA 4GYIA 3I71A 1S29A 1LVAA 1J5YA 2O3FA 5LEKA 2J5PA 2GAUA 3LA7A 3C1DA 3JSOA 4ZYHA 1QPMA 1TW3A 5E17F 5D5UB 2P6TA 2DTRA 4RB0A 3WU1B 3TDZC 2P5VA 4N0BA 2A68F 2Y48A 1G4DA 3ZMZA 3ABTA 4Y15A 2K27A 1DP7P 1L0OC 1YLFA 3HSEA 2Z5UA 4OMZA 4WXHA 4JBAA 4LGWA 1HW5A 4M9SA 1MDMB 3GEZA 1RI7A 4JQFA 1IRGA 2ZNZA 3MAJA 1Z7UA 4HW0A 4R79A 5AIPA 4U0VA 4UVBA 2HKOA 2XROA 1ZGAA 3HIFA 3QU3A 1P4AA 3WTSC 3F22A 2X0LA 1YS7A 2D1VA 3HSFA 4HV6A 3P9KA 1K78B 5AONA 3P9IA 3HOTA 2XHKA 1IXCA 4I09A 2YSRA 4P55A 3U9GA 3GO5A 1QO0D 2JPCA 2EV6A 1ZRCA 2QQAA 1PUEE 1X3UA 3KEOA 3ZMSA 1D3YA 3SXYA 3V7SA 2A69F 3D5LA 4LG0B 2ELHA 4Y17A 4O6JA 1IUYA 3M8FA 3RJPA 3WGIA 1FP2A 3P9CA 4MGRA 1BI1A 4CZZA 4ESBA 4HLXA 2MBFA 2Z33A 1R36A 3CJNA 3R60A 2LNBA 3TO7A 3FX3A 5HDNA 2VOPA 4G8XA 1U8RA 3Q5FA 1YO5C 1MGTA 1HKTA 4EVIA 2L54A 4Q47A 1ZAOA 3BJAA 4YIFA 1FLIA 4HX4A 3PFIA 4GXOA 3RKYA 3D0SA 4HZFA 4EV0A 3QRFF 3KCCA 4KFCA 2BV6A 5DD8A 1IZ1A 4QWQA 2FRHA 3EYYA 2XAQA 1EV7A 3DKWA 3I53A 3K2ZA 2D2WA 1FC3A 2L01A 3DXJF 4KUMA 2K7LA 5A2QK 4P9UA 3NEUA 2YX7A 2G7UA 4MTDA 1WWXA 2UXNA 4LK0F 4KIFA 4ENKA 2W85A 4NB5A 1RIOH 3K69A 4AVPA 3MZYA 2HR3A 1O7LA 5ICGA 4EQQA 2ZJ2A 5BQTA 3J80Z 2VBZA 3FWEA 3F6VA 1HKQA 3F8FA 4EM0B 3LSTA 1DDNA 1P92A 5F6FA 3R0JA 4OIOF 5JVTA 2NAZA 1IXRC 2PEXA 2F5CA 3JSPA 3F8CA 3FZVA 2QM3A 3K9TA 2DK8A 2CSOA 4B09A 1IXSB 1U6GA 1YG2A 3HHHA 4DQ2A 2IW5A 3LQQA 4HYEA 3KLNA 2D45A 2XVCA 3CUQA 2QQBA 2STWA 1XGSA 3BROA 3WTTC 2LDUA 4HV5A 1BJAA 1I1GA 2DW4A 5LRRA 3CDHA 3J7AO 3FXUA 4A0ZA 4AWXB 2ESNA 4LD5A 3COAC 1PP8F 2V1UA 1UFMA 3IC7A 1B1BA 4R1HA 4E70A 1U2WA 3F8BA 3TO9A 4KMFA 4KYWA 1BC7C 5LHIA 5H6QA 5FLXK 5CVVA 3R0AA 1S6LA 1DPUA 3FMRA 3KP2A 3KZZA 5L3GA 4LB5A 1QGPA 4ON0A 3LWFA 3BY6A 2MLGA 5HS8A 5D6EA 2CQKA 4RGRA 3ECOA 5AIQA 2FE3A 3QOPA 4ZZLA 4XLPF 1WI9A 3L2CA 2DLLA 4FX4A 2EWNA 4RB1A 2PLYA 1KA8A 1D8KA 4M6YA 2Z99A 1W4MA 5K1YA 2HTSA 3M9AA 4LB6B 1FBSA 5D5VB 3R4KA 5K5RA 3MZHA 1R58A 4CO8A 3FM5A 1V3FA 2PBIA 2PJPA 4YFNF 5LGUA 2IPQX 2VONA 5LHGA 4I02A 4MEYF 3M7GA 5CVIA 4EM2A 1YW8A 2E1NA 4I98B 5ILSA 1SAXA 4HF0A 1TW2A 1W7PB 4KMUX 5DV5A 5ED4A 1XCVA 3ULQB 5ICEA 3KZYA 4UXNA 4LFUA 1PDNC 4I7HA 4HDVA 1XN7A 4A0XA 3HRSA 4Y13A 5CYVA 2WTEA 4EJWA 3ZP5A 3TOAA 1B6AA 3L7WA 2Q2EA 2DK5A 2DO7A 1PP7U 2ZNYA 3JTGA 2M5WA 1ZRFA 2ACJA 1LDJA 4UV8A 1FZPB 1KYZA 4A6DA 4ZYDA 2VT2A 3ZMUA 3RKXA 3FXRA 5LRSA 2V6CA 4IRIA 2W57A 2O61A 3TOBA 1TNSA 3L09A 5LEJA 4LJZF 2FQ3A 2DBBA 1R23A 4IF4A 4N9HA 2HS5A 5LGTA 1T38A 2W84A 3RTRA 1T39A 3F21A 2RV8A 4BYYA 3VODA 2OA4A 1KU3A 4IRGA 4ESJA
chains in the Genus database with same CATH superfamily
1Q1HA 1B9MA 5GTIC 4M73A 4EJOA 3I56I 2EIKH 3I59A 2HDDA 2BEOA 2GQQA 3MFKA 4A3BJ 2A5YB 2LBFA 3OMYA 1YW9A 1DGRM 2KIMA 4YELA 1OKRA 3SJMA 5J8CA 3WODF 4A3CJ 3WG9A 4BJ6C 1G3YA 3OY9A 5F1RA 1RUNA 1POGA 2Y9ZA 1WSUA 2L9RA 3MMYB 3GUDA 3ABUA 3LA3A 2I10A 3AG4H 3S1RJ 4DJAA 1LDKB 2WV0A 1O3QA 3LMMA 4IX7A 1SD5A 2W25A 5D8LB 1ZKGA 3H9GA 2DYRH 3CC4I 2A05A 3S32A 1KZHA 1IN8A 4B3XA 1TTYA 2F5FA 2V26A 1MJBA 3QP6A 5FKLA 1RKTA 3EETA 4BQOA 4HPQA 1X19A 3S15J 4E7SA 4PDKA 1XSDA 2OTJI 2Y75A 3V8KA 4CCJA 2XGXA 2K86A 4LITA 3H35A 1YS6A 3BT9A 2FNAA 1T2KA 3CUQC 2A6EF 1HQCA 1IRXA 3W3CA 5C44J 1TQIA 2Z3YA 2WADA 4HX7A 5TRDA 5H2FC 2DCEA 3RZOJ 4E7HA 3CF5F 3OV8A 4I76A 3IL2A 1QQIA 3KEYA 1GXQA 2L02A 5F64A 2O03A 5CPRB 3U1KA 2M8EA 3CF2A 5E3LA 4M9ZA 5KHDA 4F92B 1IV8A 4W97A 1MNEA 1HXDA 2D1HA 2KMUA 3B6CA 3FM3A 2XPUA 2DQRA 2P5KA 2WAQN 2W1OA 4U88A 2V9KA 4Z2YA 3E6CC 1BOBA 4G7ZF 1OCPA 3DFGA 5D8KB 5HNHA 1ZN2A 2EILH 1LJ9A 1XC5A 1J75A 3CESA 4RLQA 2V9VA 3V8LA 3C2BA 2CU7A 2V1DA 4UV9A 1OYIA 2VKVA 2VJJA 5CVJA 3WE2A 1FX7A 4ZYAA 5HLTA 1IUFA 3DU5A 2GWRA 2Z1DA 3EUAA 3ESWB 2WV1A 5IYBJ 1Y56A 4A3JJ 3HTUA 1XSVA 4IQJA 4NC7A 2LD5A 1Y1WJ 4GGGA 4D1QA 2IS6A 3W6JB 3Q9SA 3BLYA 3ZPLA 2OZ6A 4EGYA 2VT3A 3GZ6A 3DTIA 3PSFA 5CVUA 1Q1VA 3E5QA 3ONQA 4YG2F 4BE1A 2LR8A 5EEHA 3DBHB 2QA4I 1YRNB 2WY7Q 3ASOH 2LK2A 3PQKA 2M87A 1ETVA 4WK8F 3S1MJ 2G7HA 2OJED 3VFZA 3RQ4A 4ZTFA 1HF0A 1ETOA 1G3SA 4O5VA 2W82A 2WAQA 2NS0A 2DMQA 2XGEA 4A12A 1A6QA 3OYHA 5M3MJ 4HNVA 2OQRA 2QQ9A 1Z9CA 5FKNA 1JGGA 1UZCA 2KJBA 4WXCA 2WWYA 3PIOF 2V7FA 2NOGA 3J7ZI 3HUGB 1QBJA 1AKHB 3J81Z 2EV0A 4B4CA 4DZPA 4EJVA 1X2MA 4GYGA 1RZ4A 3A1YA 3IKVA 5HS9A 3AKZA 1R5HA 2F4IA 1ZELA 2HQNA 5DDGA 2VIXA 1YJNI 5J4YA 1IN5A 3IWFA 5HLGA 1MSFC 2RN7A 2HNHA 5HLIA 2DMTA 5CQGA 1ETXA 5DD4A 1I50J 2MLKA 4UVAA 1KU7A 3HXLA 3BG7A 2XSJC 5L3DA 2KL4A 1FYMA 2LREA 2H1KA 2GXGA 1MIJA 3GWZA 3R61A 2PJRA 4L9VA 3TGNA 4AUXA 4KYWA 1RETA 2HPIA 4D5CA 3EYIA 3H3VK 3JAMK 4L9NA 2ME0A 2CG4A 3FXKA 1U78A 2ECCA 3W6VA 1X1BA 2HOSA 2P5LC 3V7CA 4PJ0C 5FO5A 2QBYB 1ZLKA 3CJQB 2FJ1A 3K4KA 3QYFA 2LY1A 5F0FA 2ME6A 3T8RA 2O5RA 3DKYA 3ZXSA 4D0PA 1ETQA 1S8NA 2JSCA 1QZZA 3OIOA 3JRCA 1SFEA 5IT9Z 3NQOA 2DA2A 4IEJA 3WGGA 4A3IJ 1DU6A 2HQ5A 1EA3A 3I4PA 1VQNI 2IA1A 2ZO4A 3H3UA 4RAZA 2GA1A 4N4NB 3ZMDA 3CMAI 1ERDA 2JZYA 3FMSA 2M0MA 5L3EA 5DEQA 2PG4A 2ZMEA 1ZARA 1LVKA 4P9FA 2DOAA 2BY3A 1CF7A 1JI8A 3RI4A 2MD0A 1R5GA 2XIGA 3KEQA 3OYAA 4GFBA 2K3FA 2BW3B 1MZBA 1FBQA 4RAYA 4A3FJ 2AQEA 3BR1A 3K1NA 3JCUC 3MQ0A 5LBQA 1B8IA 2IS2A 1ZR2A 3W2VA 2B7EA 1W36D 3PIPF 5FB2A 2P6SA 1LQ1A 2R7UA 5FRMA 3OYCA 3CLOA 1BN5A 5LD2C 4EMSA 3ZQFA 3LSMA 1YIOA 1RR8C 2XASA 2LG4A 2J5OA 3F3XA 2KISA 3V4GA 3HOYJ 2YR2A 2RKHA 3CMEI 1Z1DA 2R7SA 1YTYA 2VC0A 5HOOA 4QPQA 4A3EJ 2ZKZA 5E8GA 2W00A 2E5ZA 3M1EA 2P7VB 1X4OA 4XKVA 3AG2H 3O3KA 1IF1A 2EQRA 3FISA 3TDUC 1V5FA 2HOEA 1FYLA 4G9YA 4ESFA 3EQLF 3DEUA 3MKLA 1ZG3A 2R7QA 5KK1A 1VFCA 2JT1A 3HOVJ 2OCCH 2E5NA 1P2FA 2E36A 3DPLC 5LFAA 1UAAA 1MNMC 4UVCA 3GTGJ 2ZXIA 2DT7B 3K4NA 3KP6A 5E1XA 4RM3A 2MH9A 1MBGA 2HVQA 1O3TA 3H3ZA 4S04A 3TP3A 1U3EM 1VQ7I 1BIBA 1D0ZA 2I5UA 4PK4A 2BZTA 3BCAA 4XLNF 2RVCA 2YPRA 1F1ZA 2DJNA 3OS0A 5M5WJ 1LFUP 3RDIA 1X1DA 2LKSA 2ETHA 1XDUA 4A6EA 4HOBA 4MIMA 1OCOH 1RC9A 3BG9A 1RESA 3DF8A 2E7XA 3ISPA 4RMNA 4KNYA 2M30A 4ENJA 2M1BA 2HI3A 3FHNA 1TQMA 2E60A 2P7CB 2HXOA 1NTCA 5ILUA 9ANTA 3FXQA 4MHGA 4CICA 3PFYA 4DBQA 3KP4A 2MD5A 2DTZA 4BHBA 3OS2A 3ZMVA 1I27A 1NHAA 3JREA 3QPTA 2KFDA 3G4SI 2L4AA 2HPMA 1OCRH 3KFWX 3CCSI 3PO3J 1FPQA 1Z67A 4U7BA 2ZJRF 3GLLA 4CDGA 1KGSA 4M3BA 3MEXA 1JTXA 3CJRB 5D5XB 3LOCA 4XRMA 1G2HA 1E3OC 3JTHA 3DBLB 1X1PA 4QTRA 2PQ8A 4ZZDA 2KIUA 2LSOA 3GTQJ 5E1ZB 3LSRA 1FJLA 2STTA 2HYGD 2V1XA 4BQNA 3F8MA 4B1RA 3F72A 1TWGJ 4XBFA 1FTZA 4IQ4A 3IRQA 3BTIA 2ZB9A 3J7YJ 5HODA 1R49A 1E3PA 1UHWA 4I0AA 5CLSA 2HYFA 4KA4A 3BJOA 3HB9A 5BMZA 2Q0OA 1L3LA 4BEHA 5ICFA 5L3CA 5DTDA 4KISA 4HSTA 1RNLA 1A35A 2QQ8A 1D8JA 1IRFA 4HBLA 4XLEA 3ZRGA 1TWAJ 1JTYA 4PFOA 1FWZA 4L0ZB 4L5IA 3OYEA 4Y3OA 3VDXA 5K5QA 1A36A 2A61A 4C30A 3ZQQA 2E19A 2FA5A 3HGGA 2NRAC 5FGMA 5CQEA 2TRTA 2ZSHB 3S1QJ 3S17J 3SYTA 4A5NA 2CJJA 1PUFB 4NQWA 3PO2J 2OUMA 1U5TA 5TISC 1V5GA 4HX8A 2H8RA 1V55H 2W24A 1J0RA 4OIRF 3AG3H 1R1VA 3IWZA 2ZFUA 3K0LA 4HDUA 2E1MB 3H92A 1D1AA 4LLGF 5B5EC 3SDGA 2MA3A 4I0BA 3MKWB 1UB9A 3L2QA 4IOCF 1W7PD 2IT0A 2MYSA 2K4JA 3K4JA 3OYDA 3LL7A 1IN7A 3V7RA 3M1CA 1O3SA 1HOMA 4KJZA 2NYXA 5B66C 2LY9A 2BXZA 2FXAA 2KZVA 2IGMA 3NWSA 3RCOA 3NAUA 5K5OA 5M5XJ 5FD5A 2QSGX 2XF7A 3JW4A 5DCMA 5FKMA 1E3HA 2QVOA 3S2WA 5J3LA 2XKPA 2JJ7A 1AU7A 2LLKA 1MD0A 2LF7A 2VBWA 2ESHA 4ZH4F 4OIPF 3F23A 3KP3A 2PJRB 1SMTA 1T6SA 1TL8A 1K4TA 1WRJA 3CCUI 2EZLA 2L7FP 3WTWC 4LG3A 2GXBA 1MBHA 3VSKA 3JR9A 2O9LA 1OMIA 1GVJA 3IP4B 4TV7A 2XAGA 2KJCA 4ZYEA 2EK5A 2L5QA 5ILVA 1X3WB 2VQLA 1BW5A 3RPUD 4BY1J 3IKTA 1XB4A 2O8KA 5GAEJ 1HW2A 2QLZA 4NC8A 5FROA 2NS8A 1BI0A 2X9DA 4D9JA 2GZWA 2JUCA 4G7HF 2ZMEC 1Y6IA 3PQJA 1RRJA 1DPRA 3BPVA 3ML6A 2RC4A 3FDYA 2IA0A 4HLYA 4XKWA 4XLHA 2HTJA 1VZ0A 4J19A 3MKYB 1Z05A 1ETWA 2LVSA 1OCCH 4F52A 4XLFA 1SD4A 2F2EA 1FYKA 1REPC 3QYBA 2OD5A 1Y0UA 4I2OA 3GZNB 3WGHA 2RAEA 1JE8A 1FTTA 1HA8A 5IT3A 3QPHA 2OU2A 1BR1A 1N75A 2ZXWH 4F55A 3K1PA 2HZTA 3S3NA 1DUXC 1ZG5A 1B8IB 2DOEA 1AA7A 1TNTA 2JK3A 3JRGA 4BE0A 2L0KA 1Z6RA 1OR7A 2WY8Q 4N9IA 2R5ZA 4NDLA 1EH6A 2GIVA 2L7ZA 2PFBA 1YW7A 1MDMA 4UY8I 3CD6I 3H0GJ 2XC7A 3MN2A 1J9IA 2MSYA 2OAZA 4P1WA 1HCRA 3HOSA 4UB6C 1GV5A 3VSLA 3G1MA 3ZQ7A 2M7AA 4KDPA 2EFPA 5DCFA 1KQ8A 3S1NJ 3L2VA 3MCZA 3WU0A 1WJBA 1R4MB 1IN4A 1WQ2A 1K4SA 2FBHA 5J6XA 4I99C 2CYYA 3BTCA 3L00A 2DFIA 5J8FA 3M4OJ 1U0JA 1K78A 5FLXZ 4ENMA 3KZIC 3WTVC 3GF2A 1J7KA 1G3WA 3WTUC 3HZJA 1JT6A 2XB5A 2FBKA 2E1CA 2JA5J 2Y9YA 3TO6A 1O4XA 2OC6A 3OYKA 2FBIA 2XV4S 4OIQF 1G59A 4X6AJ 4IXAA 3M8EA 5LLQA 1EH7A 2X6OA 3S2DJ 1HDDC 1ON2A 2QSFX 2BOLA 3GFLA 4HG2A 5DS9A 4V19K 2LRDA 1R22A 4L9TA 1XDSA 4HAMA 4AIHA 2KDZA 2H8WA 1GLNA 5HS7A 4XSXF 5DYMA 4O3MA 2H94A 2L9SA 3QAHA 3GX4X 1DP3A 3B02A 2R5YB 4IHSA 2F48A 4LG0A 2M34A 3DWLE 4FE4A 4OOIA 4XONA 2FF4A 3U2RA 4UUTA 4RGSA 4HF1A 2L4MA 2DODA 1J59A 5JVGF 5EGOB 5JLXA 2LP0A 3BQYA 2H1LA 2BBYA 2ZSIB 2COMA 2BVMA 4II2A 3M3YJ 2KRFA 1LUJB 2ZBKA 3ROUA 4E7LA 2DDAA 3GZ5A 1QHHD 1YOVB 3BR3A 4BNCA 1YJ9I 3PUBA 2UXXA 3BJ6A 4A2UA 1HKSA 4QPOA 1CGPA 2KLOA 1P4WA 3ABLH 2R7RA 5IOYA 1WJFA 2X6YA 1O7FA 4A3LJ 2OBPA 2DT5A 4MTEA 3DCFA 1F5TA 2X1EA 3LNQA 2K85A 4HF2A 4RB2C 5KCMA 1XGMA 4XN3A 3ZMTA 2EA4A 5F27A 3JRFA 1TWFJ 2F5EA 3HPHA 2E1OA 4G6DA 5EEGA 4JX6A 4MNUA 2NNYA 3CO6C 4BQQA 3VYUB 2UUZA 1OPCA 4RM2A 3HOZJ 2H6CA 5JHUA 3HRUA 1XS9A 1VTNC 4P5OA 5JI6A 5IYDJ 3LQRA 1BOAA 4HQMA 2C6YA 5FFZA 1CQTA 5D4SA 5DUKA 5BPIA 1H88C 2WAEA 3K7AJ 1BC8C 1VQ9I 4XLAA 2XKOA 1PYVA 3HBLA 4Y33A 2EV5A 2GA2A 3J81K 4YFKF 3KETA 1FOWA 3BG6A 4KITB 2IS1A 3D1NI 1OFCX 2EFQA 4I01A 2QSHX 5KNLA 1ZGJA 3I54A 1NG7A 3CC7I 1U5TC 2FQ4A 5TJJA 3FMQA 2LF8A 4XOTA 4CYCA 5ERIA 3FBNB 3WHBA 5GPCA 2H27A 4NHJA 1S9HA 3CUQB 4EM1A 2KRCA 4ENNA 3CC2I 1O57A 2DAOA 2EZHA 3DLAA 1R00A 4RAGA 1YIJI 2JWTA 2PMUA 4NQWB 3RPQA 3BZCA 4EEFG 3F6OA 4EGZA 2ID3A 2L9VA 2CUJA 3FBIB 3JRIA 4M74A 1O3RA 2XDVA 2DI3A 3CQZJ 3V8JA 2WBMA 1I1SA 2G0EA 1FNNA 4M6XA 3G73A 4H4KC 2F4MB 5EG0B 1Z0XA 3G6EI 3I0TA 2OZUA 2ZJQF 5EJCA 3DP7A 1VQMI 1P4XA 1QNTA 1OYYA 3BPXA 1OYWA 1R1TA 3WTXC 4RAFA 1W5CC 4GDFA 3E3VA 5DM6F 2D5VA 3TBIA 4WF2A 2R7DA 3PNTA 1V54H 3WG7H 2R7XA 4BHPA 5IT9K 3DPTA 5IP9J 3S93A 1ZGWA 3CUOA 1BI3A 2RDPA 3OYGA 4PZJA 3VYSB 1IG7A 1UG2A 2NVYJ 2E71A 3CCRI 5F0HA 3E0JB 3H5NA 3OS1A 1YE9A 4M9XA 1FSEA 4C3JJ 3PSIA 1YJWI 5F0CA 2IGNA 4BH9A 4KN4X 4UB8C 1H9GA 3DEEA 2BYVE 3L9FA 4XR6A 1WJ5A 5JHFA 2Z9OA 1A04A 4LLLA 3GTLJ 4QSHA 3GVAA 1OCTC 2E7WA 2O7OA 5EDNA 3PM1A 1LE8A 4ZTJA 3CCEI 2CFXA 1HSJA 4IOAF 4XOPA 3GTMJ 2VJ5A 1JGSA 2QENA 2R3SA 3TP0A 5JLWA 4CZCA 2VKHA 1MBFA 4G12A 4L9JA 3H5RA 1XMKA 1Z6TA 2CW7A 2EIMH 2X1DA 3GW2A 1S3JA 3IH4A 5JFRA 2VB6A 4XRSA 4IRHA 2IVMA 3O2PE 4BQAA 2XAHA 5M5YJ 2VI6A 3AL0C 1SVMA 2HWVA 4CSWA 4M72A 2HQRA 1K6OA 3CLQA 3FF5A 1USTA 1OR7C 4XNFA 4BHCA 3ASNH 2HVRA 2HVSA 1TLHB 3WU2C 3QPLA 3GTKJ 3KP5A 4NC6A 1Y39A 4KIBA 3RYPA 2IBDA 1I6XA 4ZJZA 1T8IA 2IRFG 1UHMA 3E6MA 3WE3A 2XGCA 1ULYA 2AS5F 5GP9A 3I64A 1Y8RB 1K7AA 1P9QC 2JSPA 2ELKA 1STZA 3OR1C 2COBA 2CQNA 3J7AY 5JR3A 1SMYF 3ZCOA 3BR0A 4U87A 1T0FA 4Q4ZF 2W48A 5FLMJ 2K5CA 3MD2A 1R5ID 4KICA 1SANA 3SHFA 5E3MA 3GFIA 1IV6A 4U0WA 3E7LA 1E2XA 3E6DA 4A3DJ 2CUEA 2JVGA 2OPTA 2ZCWA 3K1MA 3BQZA 1PJRA 4RGUA 1IRZA 4A0YA 2EFNA 1JKPC 2XRLA 1KQ0A 2IA2A 3ELKA 2V79A 4UHTA 2A3SA 1SAUA 2JTVA 2XUBA 3I4NJ 1JHHA 2B0LA 3DBRB 4N4OB 2Q2EB 2Z16A 3QYEA 3N97A 1K6YA 5J47A 1I5ZA 1XPXA 1B72A 3S14J 2L9NA 2RREA 1QRYA 4Y4RA 4PCQA 4XRFA 1WJDA 2LH9A 4LMYA 3E97A 3TKYA 4PFPA 1DGWY 2VE8A 2QEXI 2M4KA 3IRRA 2BGCA 4G7OF 3E5UA 1IW7F 4P96A 4W1UA 2AXLA 1XGNA 1LFBA 4GRIA 5KVRA 1R1UA 4H0EA 3OYMA 1LB2A 3T5XA 2KKOA 1TT5B 3HGYA 2KIFA 3T8TA 4PJMA 2Q8KA 2ZXHA 2VXDA 3PJRA 2VBYA 5FFXA 3TW6A 5HLHA 2QKMB 2F5VA 2EH3A 3LFUA 3J80K 4CH7A 1W7PA 2ECBA 3FK7A 1LPQA 1WZ2A 3ZN1A 1Z7LA 3REOA 1BR2A 1X2NA 2FNPA 1HBXG 1W5TA 2PI0A 3GLXA 4RLFA 3AG1H 4XLCA 3LA2A 1VQ4I 2G9WA 4UNOA 1JHFA 4PSXA 1UMQA 2R7FA 3ABKH 1D5YA 2R93J 1S7EA 1ENHA 3CO7C 2BY0A 1XCBA 3GFMA 5H20A 2DFHA 3HJEA 3HTSB 5CVRA 1IN6A 4IL6C 3JAMZ 2MC3A 2LYCA 2E2HJ 2MABA 4RDUA 1C0WA 2O6GE 3B73A 5HVQC 3I59B 5J4VA 2RGVA 1TQPA 3MWMA 4UUSA 2CH0A 3F8NA 2LBFB 4Y7NJ 2FEZA 2HZDA 4RA2A 1D0YA 3CJTB 4S05A 2R7TA 2MH2A 2DMUA 3EDPA 3UNGC 5LGNA 1Z77A 5DM7F 3DQVC 3OL4A 4K2EA 4AIKA 4KT6A 4BDYA 1EH8A 1ITYA 1U8BA 1YX5A 3H1CA 2EB7A 1LEBA 2BY2A 4MQVA 1IGNA 1W0UA 4D7MA 2X85A 2JRTA 3RPUA 4ESJA 3OL3A 1ODDA 4JX4A 3OYFA 5CKTA 1W5SA 4UUVA 3GYHX 4ITVA 3A03A 3TQNA 4U7DA 3SZTA 4M3DA 4AYBN 2QZ8A 4BXXJ 1MMNA 2DJIA 3SDBA 3K4LA 1GHCA 4IPAA 1JUPA 4PJLA 1KYWA 4PGGA 1ONVA 2JA2A 3W2WA 5L3BA 2K9QA 3HEFA 4GCVA 4RGXA 5GAGJ 4ASNA 4XQFA 2VE9A 3GTJJ 4S0HB 5BOXA 2CV1A 1ZLJA 3ERED 1MH3A 2HFHA 5FLVA 1W36C 3CZ6A 1I3AA 1VQOI 5E1WA 4V2GA 3DTEA 2EFOA 2KP6A 1JJ6C 1FMVA 4C2UA 1LNWA 2HU9A 1VQPI 4CYDA 4HEA2 5FJ8J 3S3OA 1P7JA 2EJRA 3K10A 2XAUA 3KYCB 3HRTA 1U9NA 2JA6J 4HQEA 3RKWA 2UWMA 4MQ9F 3W6KB 3CCMI 4C9YA 2K9SA 2M45A 1B9NA 4AYBA 4CCLA 2VC1A 4A69C 1LEAA 5ICCA 2PMHA 3MKZA 1SFOJ 2CWEA 1N77A 3L2UA 4BJ5C 2ADUA 2HDCA 2B63J 2NVUB 4B44A 3FKJA 3O8GA 4D5FA 4DGWB 4R8HA 4L18B 4KN7X 1BM9A 1Z21A 1I39A 3TMOA 4B43A 3VOEA 2V6EA 3GFJA 1GXPA 1ZYRF 3WTYC 3GXOA 2JUGA 1SC7A 1FOKA 3K6GA 4RB3C 2OTLI 4BAYA 1D0XA 1IO2A 3AFHA 2IP2A 3EPZA 4E7IA 2OQGA 3OYJA 2EFWA 1A5JA 5D5WB 4FX0A 2CW8A 2ISZA 5D6FA 5J1UA 4FISA 3H36A 2AO9A 1UCRA 4V2FA 1S7OA 3IAM2 1ZTRA 1KU2A 2K9MA 3I5UA 3QU6A 1WKMA 4ETSA 1EJ9A 1K79A 2BHYA 2VN2A 2BY1A 2XSDC 3C2HA 4AVZA 3ZN0A 5J1YA 2LC2A 1H9TA 3C2GA 3CP2A 4MEXF 3N05A 3T1BA 1MJAA 3IAS2 4NUBA 5K7HA 4A5MA 2DQLA 3SFZA 2FX0A 5HDGA 5M3FJ 3HRMA 2M2EA 2CFOA 2YUSA 2FMYA 3C7JA 1V4RA 1FMWA 2MC4A 4F7ZA 4XIDA 3VPRA 3KP7A 4JYKA 3UKGA 4ZYGA 3DLLF 2K02A 3G2BA 2VKEA 3K70D 4FTHA 3N4MA 1QZYA 3BZ6A 5A2QZ 4MFEA 1ZHFA 2XRNA 4BACA 6PAXA 1WFXA 2V4JC 1MSEC 2Q1ZB 2L7MP 2QYOA 1XSXA 2K9LA 1OCZH 4IJAA 2BE5F 3DV8A 5LHHA 5KAFC 1BI2A 2O0YA 2P8TA 1N78A 3LSKA 2KQRA 5IY5H 1KQ9A 1IAWA 2Y31A 2DA3A 1Z3YA 1IDZA 2Y0MA 3HC7A 2FU4A 5DUIA 4DNCA 2XPVA 1YRNA 4IO9F 2KT0A 4KIGA 5CJ9A 5F08A 1T0FC 2PMZN 3U1DA 2VOOA 4IHXA 1P6RA 3I9V2 3I58A 1G6NA 2EZKA 4IVNA 4WCGA 3VWBA 1JUSA 4QIWN 1ZRDA 2OV7A 4AD9A 3E5XA 3RSNA 5BS6A 3IH3A 3LSGA 1SFXA 1G8XA 1FT9A 2E2IJ 1HSTA 1BBYA 2F5DA 1SFUA 1E0EA 3OYBA 5F1JA 4XSZF 2JA7J 2CGPA 2GIZA 2VUMJ 2ZFWA 3HUGA 2TCTA 3SZPA 2H09A 3LFKA 1AKHA 2ZMEB 3H9JA 3ECHA 1CF7B 3ZOBA 4EJTA 1XMXA 2LKPA 1IJWC 3RIRA 1MBEA 1T98A 2EBIA 3P7NA 5HDKA 1RR7A 4FT8A 3F0CA 2VQCA 4U0YA 2HEOA 4PUSA 5KAIC 3T0YA 1FSHA 4OMYA 1B72B 1TC3C 5GTHC 2BXYA 2UZKA 4EJUA 3CTAA 2P4WA 2WA0A 2IXSA 2AXTC 3DEWA 2HDWA 1FOYA 1G3TA 4DW6A 2PMZA 1JJ8C 1IC8A 1FP1D 3WTZA 4HA8A 1WI3A 4A93J 2HYJA 4E4HA 2XGDA 1GVDA 2LMDA 1XTAA 2P81A 1ZQ3P 1P7IA 1AOYA 5D4RA 3K4CA 4OWRB 1YHQI 2QBYA 4LK1F 2VXZA 2HOTA 1XMAA 5E79C 1RUOA 2DA4A 3HHGA 4F93B 3FXLA 1VF9A 3Q0VA 5IPAA 2ISYA 1HW1A 3NRVA 2X4HA 2XPWA 3BR5A 3ZR8X 1ZG1A 1ON1A 2L3DA 4JK1X 4M3EA 3PNVA 1TBXA 2M3AA 2O8XA 2UV1A 1GDTA 5C4XJ 2FSWA 4WWCA 4A3GJ 4KT5C 1VQ6I 1Z91A 3KLOA 4OU0A 1S7AA 3WHCA 2MGQA 1E17A 3FXMA 1SD6A 1UELB 4FCYA 3BR2A 3E6BA 1FBUA 3CDLA 3BDDA 4B8XA 1AWCA 3C3WA 2BW3A 3BP8A 1NK2P 2PX9A 3I4MJ 1USSA 5B1BH 4BXFA 4G94A 1D5VA 4WX9A 4OINF 3FHZA 3LSPA 4Q48A 3CCVI 4YIIA 1LDDA 2DA5A 1A31A 4ANJA 4XKBA 3HOXJ 3Q0UA 1H89C 1ZH5A 2AHQA 2K4BA 5H6RA 5EZHA 1J2XA 1ZR4A 4LIVA 2F4OB 1T95A 1KU9A 3SEQA 2A07F 2KZGA 2CO5A 1B59A 2RQQA 1R7JA 1UHSA 2HGCA 1XG1A 2TDXA 4DYCA 5K7ZA 3M8JA 3KIOA 4GO1A 4XORA 3CMMA 3ABMH 5FD6A 2LFBA 2VBXA 1T08B 2JPBA 1JXSA 2X6XA 1BIAA 2M7BA 4M3GA 2RQPA 4C3IJ 3K2AA 3RZDJ 2GBYA 2YX4A 3SQNA 4JP0A 1ACIA 3EUKL 2W4SA 2PN6A 2NNNA 1F4KA 3Q0WA 2L7KA 1MKMA 4FHTA 4LIUA 5E18F 3PUFA 4G6QA 2DMPA 3RYRA 1WH5A 2GXAA 5TGTA 1XD7A 2DXIA 3I55I 2N8GA 4FETA 1SVOA 2QWWA 2HQAA 3G3ZA 3HSRA 2XF6A 4JX5A 2IJLA 1BA5A 1F9NA 4Z6YA 2YU9J 1WHUA 1YYVA 4L0YB 2DA7A 4BEHB 3AAFA 2RNJA 1XGOA 4PSWA 1H8AC 2JVHA 4M71A 3HYIA 5J40A 3VYRB 2GOMA 2WB1N 3Q9VA 3KE2A 4L5JA 1N25A 3VB2A 3R6SA 2IGOA 1F36A 3IHUA 4BBSJ 1YFHA 4CHUA 2R7WA 4QLCU 3OIPA 3QP5A 4RBOA 1U5TB 4BS9A 2A6HF 3QPSA 1QVTA 3EUHA 2VJIA 3OIQA 1SD7A 3BOQA 2V1NA 3HPGA 1IDYA 2NXNB 1ZREA 3OOPA 4XKCA 4IHTA 1MJ9A 2VODA 4ZDOA 5E3OA 2XAJA 4YFXF 2CW0F 1TWCJ 2HKXA 2M8GX 1WJCA 4CXFA 1H0MA 2VL8A 2FMLA 2VLAA 2YU3A 4MFDA 4CUGA 3QQAA 2R92J 1T33A 4LLNA 1SFKA 1UJ8A 2DFEA 5E20A 4CCNA 2NVXJ 1B4AA 1YQAA 2EA2A 2QUFA 3VEPA 2DPUA 1TT0A 4PJJA 1U9OA 5DCMB 3FKIJ 2H6BA 3CP8A 5E8IA 3O6BB 2XAFA 2R7ZJ 1BL0A 2QKLB 2WB1A 5C4JJ 5L3FA 3LAJA 4RS8A 3HM5A 3BWGA 3NWTA 2X51A 4PGHA 2FOKA 3OYNA 5IYCJ 1FY7A 2DPDA 4CGZA 4Y52J 1WVRA 4Q5SF 2MG4A 3C18A 1WGXA 2WC2A 1ZK8A 3O8HA 4BXUA 1ETYA 4FASD 4WXDA 3LAPA 3JRBA 3RQIA 4AIJA 5BPDA 1R71A 2ZXJA 2E34A 4GYIA 2R7VA 2KIQA 4MO7A 3A01A 1FEXA 2DFFA 3I71A 1S29A 1LVAA 1MBKA 2E35A 1J5YA 5FKKA 2O3FA 4YEJA 5LEKA 3S2HJ 1TWHJ 1WPKA 2J5PA 2GAUA 1PUFA 3LA7A 2DT6A 1V5EA 3C1DA 2CV0A 3JSOA 4ZYHA 2ELJA 2EIJH 2NVQJ 2ICWG 1JKRC 2VKDA 1XX5A 4OAYA 1QPMA 4E7JA 3K4BA 1TW3A 5E17F 1FIAA 2P6TA 2GOXB 2Y0SN 2DTRA 4RB0A 5D5UB 3WU1B 2Y30A 2DOFA 3TDZC 3ZGKA 3CDIA 2EINH 4ABZA 3BC8A 2P5VA 1GUUA 2A68F 2Y48A 4N0BA 1G4DA 1HLVA 3ZMZA 2Y2ZA 5GPAA 3ABTA 3B6AA 2GLOA 4Y15A 3BG3A 1K83J 2K27A 3OSFA 3AL0B 1X3ZB 4XL9A 3LSHA 1DP7P 3GTOJ 1L0OC 1YLFA 3HSEA 4M3FA 5EZGA 3ZQIA 4YRVA 2Z5UA 3X2QH 3CMYA 2VASA 4OMZA 4WXHA 2R5ZB 4JBAA 2KDOA 4C2MJ 3H0DA 4LGWA 1HW5A 2CQQA 2LKXA 4M9SA 3BTJA 5FRNA 5C3EJ 4OAZA 1RKWA 1MDMB 3GEZA 1RI7A 3A02A 3S3MA 3IH2A 5GADJ 3S16J 1RPWA 4JQFA 4HRIA 1MMSA 2Y0SA 4XRSG 1MW7A 1IRGA 2ZNZA 4BY7J 4AM3A 1WJEA 2NVTJ 2L2OA 3MAJA 3SZGA 1Z7UA 3KYLA 4HW0A 4R79A 5AIPA 1WJAA 2KRHA 4U0VA 4C2TA 2CS3A 4UVBA 2HKOA 2XROA 3BZKA 1R9TJ 1ZGAA 3HIFA 3QU3A 1P4AA 1OJLA 1TZLA 4G6TB 2X0LA 4ZC3A 4DYRA 1OLTA 3WTSC 1YS7A 3F22A 3GTPJ 2D1VA 3HSFA 4HV6A 3P9KA 3S8PA 1K78B 5AONA 4BDZA 2CV2A 2IEKA 3KPHA 1ORKA 3P9IA 3HOTA 2MFZA 2XHKA 4CA0A 1IXCA 4I09A 2YSRA 4P55A 2JQ7A 3U9GA 3GO5A 1QO0D 4DIQA 2JPCA 2EV6A 2W7NA 1BR4A 1X4PA 1ZRCA 4E7KA 2QQAA 5EF6A 1PUEE 1X3UA 3KEOA 3KX2A 1QU3A 3ZMSA 3ZQGA 1FOXA 1D3YA 3SXYA 3V7SA 2A69F 3OOUA 4BGDA 4HNTA 3D5LA 3DPUA 4LG0B 3OYIA 1QA6A 2ELHA 1QPIA 4Y17A 4O6JA 3L2RA 2JRMA 1EKEA 1IUYA 3M8FA 3RJPA 4BBRJ 3ERMA 3TEDA 3K4MA 1LKXA 3WGIA 3L1PA 1FP2A 2EZIA 3P9CA 4MGRA 1BI1A 2DDBA 4CZZA 4ESBA 1F43A 3BTLA 1X1AA 1NG6A 3HG9A 4A3KJ 4IHWA 1Z3XA 4HLXA 1OISA 2MBFA 2Z33A 2XF5A 1R36A 1I3QJ 2K3PA 3CJNA 3R60A 5BNGA 2LNBA 2JA8J 2CQXA 3TO7A 3FXJA 3FX3A 5HDNA 2Z2SB 2VOPA 2VJ4A 4X1EA 1KONA 3H5AA 4G8XA 1U8RA 3Q5FA 1YO5C 2QF7A 1MGTA 1HKTA 3BG5A 3OWTA 3TL4X 4EVIA 2DA6A 2L54A 4Q47A 1ZAOA 3BJAA 1NH3A 2CMPA 2JMWA 4DBRA 3D5SC 4YIFA 2E2JJ 3DU6A 1FLIA 4HX4A 3PFIA 4GXOA 3RKYA 3D0SA 4HZFA 4EV0A 3IV5A 5EEAA 3QRFF 3KCCA 1HDPA 2BV6A 5DD8A 4E6KG 4KFCA 4DOZA 1IZ1A 2X1CA 4QWQA 2FRHA 2R5YA 2M4GA 3EYYA 4AC0A 4D7NA 2XAQA 2V9PA 1EV7A 5GAHJ 1YI2I 2EPFA 3DKWA 2I8DA 3I53A 1K61A 3RKQA 3K2ZA 4XK4A 5EGOA 2D2WA 1FC3A 1MH4A 1QZEA 2L01A 1SEUA 3EUHC 4CYCB 1HC8A 3DXJF 1W0TA 4BE2A 5EYRA 2DA1A 3IUOA 4KUMA 2K7LA 5A2QK 4P9UA 3H9QA 3NEUA 4IHVA 2YX7A 2G7UA 4MTDA 1WWXA 2UXNA 4LK0F 1YX3A 4KIFA 4ENKA 2W85A 4NB5A 3JRAA 1RIOH 4NNJA 3K69A 4AVPA 4FQGA 3MZYA 2HR3A 1O7LA 4CCKA 5ICGA 4NBQA 2ZJ2A 4EQQA 5BQTA 3J80Z 2VBZA 3FWEA 3HOWJ 3F6VA 2KPMA 1HKQA 3F8FA 4EM0B 2FD5A 1VNDA 3LSTA 2YS9A 1JT0A 1DDNA 3ZQHA 4EATA 1P92A 5F6FA 3R0JA 4OIOF 4II3A 2K9NA 5JVTA 1YITI 2NAZA 1IXRC 3MZ8A 1J09A 2PEXA 2F5CA 3JSPA 3F8CA 5E3NA 5J1RA 3FZVA 2QM3A 1S5LC 2BVLA 2VQGA 3K9TA 2DK8A 3KYDB 2CSOA 3E1SA 1IXSB 1U6GA 3GCMA 1YG2A 1X58A 2DMNA 3HHHA 4B09A 4A3MJ 1M1EB 4DQ2A 1APLC 2IW5A 3LQQA 3A01B 2MW8A 2P0WA 3JRHA 2FOWA 2E1MC 3KLNA 2XVCA 4HYEA 3JRDA 3CUQA 2QQBA 4J01A 2D45A 1LE8B 1JKOC 2STWA 1XGSA 1LFPA 3BROA 1JUMA 3WTTC 2LDUA 3QWLA 2ID6A 2LTPA 4HV5A 1BJAA 2WAFA 3DKXA 1I1GA 2DW4A 5F04A 5LRRA 2LOOA 3CDHA 3J7AO 4F91B 3VYTB 3FXUA 4A0ZA 4AWXB 1FIPA 2A6TA 2ESNA 4LD5A 3COAC 3DTKA 5EG0A 1WH7A 2NOJB 2F6CA 3ZQLA 1ETKA 2QCOA 1R6RA 2IAIA 1PP8F 2V1UA 3F9KA 3HDDA 1UFMA 2OCEA 5B1AH 3IC7A 1B1BA 4R1HA 4E70A 1U2WA 2CQ7A 5B3SH 3CCJI 3BR6A 3F8BA 2M9HA 3TO9A 4B3AA 4KMFA 3G71I 3M07A 1QHGA 1Y1VJ 1BC7C 1VQLI 1EF4A 5LHIA 5H6QA 3GMEA 5FLXK 5CVVA 3R0AA 4E7ZA 1S6LA 4XICA 1MMDA 3FMRA 3ZQCA 1DPUA 1JKQC 3OYLA 3KP2A 3FIWA 3GBGA 3QOEA 3G1OA 3MVPA 4HSRA 3KZZA 1PVEA 5L3GA 4LB5A 1QGPA 2QGUA 4F3QA 2CRGA 4X0GA 4ON0A 1UG0A 3LWFA 3BY6A 2MLGA 4PJNA 3OR2C 5D6EA 4C3HJ 5HS8A 2CQKA 4DZJA 4RGRA 3ECOA 2GM4A 3Q3SA 5AIQA 4IHYA 2AQFA 2FE3A 3QOPA 4ZZLA 3A0HC 4XLPF 1WI9A 3L2CA 3P5JA 4AU7A 2DLLA 1GV2A 4FX4A 2RNGA 2EWNA 4RB1A 1D1CA 2PLYA 4ZDLA 1QVUA 1KA8A 2LY2A 1D8KA 3NARA 4M6YA 2X48A 2ZJPF 1I6HJ 5FKOA 2Z99A 1W4MA 5K1YA 3LSJA 2X6WA 1Y0NA 2HTSA 4IZZA 3M9AA 2R4GA 4LB6B 1FBSA 4CCMA 3HKZN 5D5VB 1SVLA 3FK6A 3R4KA 5IP7J 5K5RA 1BW6A 3MZHA 1R58A 1Y8QB 4ZDPA 4CO8A 2VQHA 3A0BC 2K40A 1V3FA 3FM5A 4BL0B 2PBIA 1VI0A 2PJPA 4XM3A 4YFNF 5LGUA 4JOMA 4MLOA 2IPQX 4BKXA 3U21A 3PNYA 2VONA 4L5EA 5LHGA 5K7FA 1AHDP 4I02A 1X1CA 4MEYF 3M7GA 5CVIA 3UR3C 3V42A 4EM2A 4FE7A 3LSIA 1YW8A 2E1NA 4XMYA 4B48A 4I98B 2CUZA 4BUPA 5ILSA 1SAXA 4HF0A 1BJZA 1GT0C 3HOUJ 1TW2A 1A6IA 2VPRA 1W7PB 2BHZA 4KMUX 3A2KA 3A4CA 5DV5A 5ED4A 1NK3P 1D1BA 1XCVA 4BJTA 2JN6A 3ULQB 2R0QC 4B47A 2IS4A 5HNFA 2B9SA 5ICEA 3KZYA 4UXNA 4LFUA 5IOZA 3HKZA 1PDNC 2FUG2 4I7HA 1W1WE 3K70C 2DN0A 4HDVA 4M6VA 3SEZA 3G1LA 1MNDA 1XN7A 4A0XA 2XB0X 3HRSA 3HL2A 2OF7A 3FXOA 4Y13A 5CYVA 2WTEA 4BU2A 3TOAA 4EJWA 3ZP5A 1MMGA 1B6AA 1MBJA 3L7WA 4HNUA 1VQ5I 2Q2EA 4UUSB 2DK5A 2DO7A 1PP7U 2ZNYA 3JTGA 1MMAA 3I3LA 2M5WA 4LOCA 2VPLA 2NS7A 1ZRFA 3QODA 2ACJA 3CCYA 1LDJA 4UV8A 1FZPB 1T56A 1KYZA 3PL8A 3CCQI 1DU0A 4A6DA 4ZYDA 3BCBA 3L2WA 2VT2A 2A5WA 1TP4A 3ZMUA 3RKXA 2Y69H 3FXRA 1R4NB 1S72I 3CCLI 2ZC2A 1WCMJ 4I6ZA 5LRSA 1VQKI 3D5RC 2V6CA 3SFIA 4DYQA 4IRIA 2HOAA 1VQ8I 2DYSH 2W57A 2O61A 3TOBA 1TNSA 4AIDA 3L09A 5IP6A 1OQYA 1DQUA 5LEJA 4LJZF 2FQ3A 2DBBA 1R23A 4J00A 4IF4A 3TW7A 2R7OA 4N9HA 2HS5A 5LGTA 4YIRX 1T38A 3OSGA 3W2AA 2W84A 2KHMA 3RTRA 2CUFA 2IGKA 1T39A 4IKFA 3F21A 2HXIA 2RV8A 4BYYA 3VODA 4CCOA 2OA4A 1KU3A 4XN0A 2M0CA 4IRGA 2DU9A
chains in the Genus database with same CATH topology
1Q1HA 1B9MA 4M73A 4EJOA 3I59A 2BEOA 2GQQA 3MFKA 2A5YB 1YW9A 2KIMA 1OKRA 5J8CA 3WODF 3WG9A 1G3YA 5F1RA 1RUNA 1WSUA 3GUDA 3ABUA 3LA3A 1LDKB 2WV0A 1O3QA 1SD5A 2W25A 5D8LB 1IN8A 1TTYA 2F5FA 3QP6A 1MJBA 3EETA 4PDKA 1XSDA 2Y75A 3V8KA 2XGXA 2K86A 1YS6A 2FNAA 1T2KA 3CUQC 2A6EF 1HQCA 1TQIA 2Z3YA 4HX7A 5TRDA 3OV8A 3IL2A 1QQIA 1GXQA 2L02A 5F64A 2O03A 2M8EA 4M9ZA 1HXDA 2D1HA 3FM3A 2DQRA 2P5KA 4U88A 4Z2YA 3E6CC 4G7ZF 3DFGA 5D8KB 1ZN2A 1LJ9A 1J75A 2V9VA 3V8LA 2V1DA 4UV9A 1OYIA 3WE2A 5CVJA 1FX7A 2GWRA 3HTUA 1XSVA 4GGGA 3W6JB 3Q9SA 3ZPLA 2OZ6A 4EGYA 2VT3A 3GZ6A 5CVUA 3E5QA 4YG2F 5EEHA 3PQKA 2M87A 4WK8F 2G7HA 3VFZA 1G3SA 4O5VA 2NS0A 4A12A 2OQRA 2QQ9A 1Z9CA 2KJBA 4WXCA 2WWYA 1QBJA 3J81Z 2EV0A 4EJVA 4GYGA 1RZ4A 3IKVA 5HS9A 1R5HA 2HQNA 5DDGA 1IN5A 3IWFA 5HLGA 2RN7A 5HLIA 5DD4A 2MLKA 4UVAA 1KU7A 5L3DA 1FYMA 2GXGA 3GWZA 3R61A 4L9VA 3TGNA 3EYIA 3JAMK 2DU9A 4L9NA 2CG4A 1U78A 2P5LC 3V7CA 5FO5A 2QBYB 1ZLKA 3T8RA 4D0PA 1S8NA 2JSCA 1QZZA 1SFEA 5IT9Z 3NQOA 3WGGA 3I4PA 2IA1A 2ZO4A 3H3UA 4RAZA 2GA1A 3ZMDA 2JZYA 3FMSA 5L3EA 5DEQA 2PG4A 2ZMEA 1ZARA 4P9FA 1CF7A 3RI4A 2XIGA 1R5GA 3KEQA 1MZBA 1FBQA 4RAYA 3K1NA 3MQ0A 5LBQA 5FB2A 2P6SA 1LQ1A 3CLOA 1BN5A 4EMSA 1YIOA 2XASA 2J5OA 3F3XA 3V4GA 2YR2A 2RKHA 1Z1DA 1YTYA 2VC0A 5HOOA 2ZKZA 5E8GA 3M1EA 2P7VB 3O3KA 1IF1A 3TDUC 2HOEA 1FYLA 4G9YA 4ESFA 3EQLF 3DEUA 1ZG3A 5KK1A 2JT1A 1P2FA 3DPLC 4UVCA 3KP6A 5E1XA 2MH9A 1O3TA 3H3ZA 4S04A 1U3EM 1BIBA 4XLNF 2RVCA 2YPRA 1F1ZA 3RDIA 2ETHA 1XDUA 4A6EA 4HOBA 3DF8A 2E7XA 3ISPA 4KNYA 2M30A 4ENJA 2M1BA 2P7CB 1TQMA 5ILUA 3FXQA 4MHGA 4CICA 3KP4A 2MD5A 4BHBA 3ZMVA 1I27A 1NHAA 3QPTA 2L4AA 3KFWX 1FPQA 4U7BA 4CDGA 1KGSA 3MEXA 5D5XB 3JTHA 2PQ8A 4ZZDA 2KIUA 2LSOA 5E1ZB 2STTA 2HYGD 2V1XA 3F8MA 3F72A 4XBFA 3IRQA 1UHWA 4I0AA 5CLSA 2HYFA 4KA4A 3BJOA 5BMZA 2Q0OA 1L3LA 5ICFA 5L3CA 1RNLA 1D8JA 1IRFA 4HBLA 1FWZA 4L0ZB 4L5IA 5K5QA 2A61A 2FA5A 2NRAC 5FGMA 4A5NA 4NQWA 1U5TA 4HX8A 2W24A 1J0RA 4OIRF 1R1VA 3IWZA 3K0LA 4HDUA 3H92A 4LLGF 2MA3A 4I0BA 2IT0A 1UB9A 1W7PD 2K4JA 1IN7A 3V7RA 1O3SA 2NYXA 2FXAA 5K5OA 5FD5A 3JW4A 5DCMA 2QVOA 3S2WA 2XKPA 1MD0A 2LF7A 2VBWA 2ESHA 4ZH4F 4OIPF 3F23A 3KP3A 1SMTA 1T6SA 1WRJA 3WTWC 2GXBA 1OMIA 1GVJA 4TV7A 2XAGA 2KJCA 4ZYEA 2EK5A 5ILVA 3IKTA 1XB4A 1HW2A 2QLZA 1BI0A 2GZWA 4G7HF 3PQJA 1DPRA 3BPVA 3ML6A 2RC4A 2IA0A 4HLYA 2HTJA 1Z05A 1SD4A 2F2EA 1FYKA 1REPC 2OD5A 1Y0UA 4I2OA 3WGHA 1JE8A 5IT3A 3QPHA 2OU2A 3K1PA 2HZTA 1DUXC 1ZG5A 1TNTA 1Z6RA 1OR7A 4N9IA 1EH6A 2GIVA 2PFBA 1YW7A 1MDMA 1J9IA 2OAZA 3HOSA 3ZQ7A 4KDPA 2EFPA 5DCFA 1KQ8A 3MCZA 3WU0A 1IN4A 1WQ2A 2FBHA 5J6XA 2CYYA 3L00A 2DFIA 5J8FA 1K78A 5FLXZ 4ENMA 3WTVC 3GF2A 1J7KA 1G3WA 3WTUC 2FBKA 2E1CA 3TO6A 2FBIA 2XV4S 4OIQF 4IXAA 3M8EA 5LLQA 1EH7A 1ON2A 3GFLA 1R22A 4L9TA 1XDSA 4HAMA 4AIHA 5HS7A 4XSXF 5DYMA 4O3MA 2H94A 3QAHA 3GX4X 3B02A 4IHSA 4LG0A 4OOIA 2FF4A 3U2RA 4RGSA 4HF1A 2L4MA 1J59A 2BBYA 2COMA 2KRFA 2ZBKA 3ROUA 3GZ5A 4BNCA 2UXXA 3BJ6A 4A2UA 1HKSA 1CGPA 1P4WA 1O7FA 2OBPA 2DT5A 4MTEA 1F5TA 4HF2A 4RB2C 1XGMA 3ZMTA 2EA4A 2F5EA 4G6DA 5EEGA 4MNUA 2NNYA 3CO6C 1OPCA 2H6CA 5JHUA 3HRUA 1VTNC 4P5OA 5JI6A 3LQRA 1BOAA 4HQMA 2C6YA 5FFZA 5D4SA 5DUKA 5BPIA 1BC8C 2XKOA 2EV5A 2GA2A 3J81K 4YFKF 3KETA 2EFQA 4I01A 1ZGJA 3I54A 1U5TC 5TJJA 3FMQA 2LF8A 5ERIA 2H27A 4NHJA 3CUQB 4EM1A 4ENNA 1O57A 2DAOA 1R00A 2PMUA 3RPQA 3F6OA 4EGZA 1O3RA 4M74A 2DI3A 3V8JA 1I1SA 3G73A 1FNNA 4M6XA 3I0TA 2OZUA 3DP7A 1P4XA 1QNTA 1OYYA 3BPXA 1OYWA 1R1TA 3WTXC 3E3VA 4WF2A 2R7DA 4BHPA 5IT9K 3DPTA 3CUOA 1BI3A 2RDPA 4PZJA 4M9XA 1FSEA 4BH9A 4KN4X 1H9GA 2BYVE 3L9FA 2Z9OA 1A04A 4LLLA 3GVAA 2E7WA 2CFXA 1HSJA 1JGSA 2QENA 2R3SA 4L9JA 1XMKA 1Z6TA 3GW2A 1S3JA 5JFRA 4IRHA 2IVMA 3O2PE 4BQAA 2XAHA 2HWVA 4M72A 2HQRA 1K6OA 3FF5A 1USTA 4BHCA 1TLHB 3KP5A 4KIBA 3RYPA 1I6XA 2IRFG 1UHMA 3E6MA 3WE3A 1ULYA 2AS5F 3I64A 1K7AA 1STZA 5JR3A 1SMYF 1T0FA 4Q4ZF 4KICA 3SHFA 3GFIA 4U0WA 1E2XA 3E6DA 2ZCWA 3K1MA 4RGUA 4A0YA 2EFNA 1KQ0A 2IA2A 3ELKA 2V79A 4UHTA 2A3SA 2JTVA 2XUBA 1JHHA 2B0LA 3N97A 1I5ZA 4PCQA 4XRFA 4LMYA 3E97A 3TKYA 2VE8A 3IRRA 2BGCA 4G7OF 3E5UA 1IW7F 4P96A 2AXLA 1XGNA 5KVRA 1R1UA 4H0EA 1LB2A 3T5XA 2KKOA 2KIFA 3T8TA 2Q8KA 2VBYA 5FFXA 5HLHA 3J80K 1W7PA 3ZN1A 3REOA 2FNPA 1HBXG 1W5TA 2PI0A 3GLXA 3LA2A 2G9WA 4UNOA 1JHFA 2R7FA 3CO7C 1XCBA 3GFMA 5H20A 3HTSB 5CVRA 1IN6A 3JAMZ 2MC3A 1C0WA 2O6GE 3B73A 5HVQC 3I59B 2RGVA 1TQPA 3MWMA 3F8NA 2FEZA 4S05A 2MH2A 3EDPA 5LGNA 3DQVC 4K2EA 4AIKA 1EH8A 2EB7A 1LEBA 4MQVA 2JRTA 3RPUA 1ODDA 1W5SA 4UUVA 3GYHX 3TQNA 4U7DA 3SZTA 2QZ8A 1GHCA 4IPAA 1KYWA 4PGGA 1ONVA 5L3BA 4GCVA 4RGXA 2VE9A 4ASNA 5BOXA 1ZLJA 3ERED 2HFHA 5E1WA 2EFOA 1LNWA 4CYDA 2EJRA 3HRTA 4HQEA 3RKWA 2UWMA 4MQ9F 3W6KB 2M45A 1B9NA 2VC1A 1LEAA 5ICCA 2PMHA 2CWEA 2ADUA 2HDCA 4R8HA 4L18B 4KN7X 1BM9A 3VOEA 3GFJA 1GXPA 1ZYRF 3WTYC 3GXOA 1FOKA 4RB3C 4BAYA 2IP2A 2OQGA 2EFWA 5D5WB 4FX0A 2ISZA 5D6FA 1UCRA 1S7OA 1KU2A 3I5UA 3QU6A 1WKMA 4ETSA 1K79A 2VN2A 3ZN0A 1H9TA 4MEXF 3T1BA 1MJAA 4A5MA 2DQLA 3SFZA 5HDGA 3HRMA 2FMYA 3C7JA 1V4RA 4F7ZA 3KP7A 4ZYGA 2K02A 3N4MA 1QZYA 3BZ6A 5A2QZ 1ZHFA 2XRNA 6PAXA 2QYOA 1XSXA 4IJAA 2BE5F 3DV8A 5LHHA 1BI2A 2O0YA 2P8TA 1KQ9A 1IAWA 2Y0MA 2FU4A 5DUIA 4DNCA 4KIGA 5CJ9A 3U1DA 2VOOA 1P6RA 3I58A 1G6NA 4IVNA 4WCGA 1ZRDA 4AD9A 3E5XA 5BS6A 1SFXA 1FT9A 1HSTA 1BBYA 2F5DA 1SFUA 4XSZF 2CGPA 2ZFWA 3HUGA 3SZPA 2H09A 3LFKA 2ZMEB 3ECHA 1CF7B 4EJTA 2LKPA 3RIRA 1T98A 3P7NA 5HDKA 4FT8A 4U0YA 2HEOA 3T0YA 1FSHA 4OMYA 2UZKA 4EJUA 3CTAA 2P4WA 1G3TA 1FP1D 3WTZA 4HA8A 1AOYA 5D4RA 2QBYA 4LK1F 2VXZA 1XMAA 1RUOA 3HHGA 2ISYA 1HW1A 3NRVA 2X4HA 1ZG1A 1ON1A 2L3DA 4JK1X 1TBXA 2O8XA 2FSWA 4WWCA 4KT5C 1Z91A 3KLOA 4OU0A 1S7AA 1E17A 1SD6A 3E6BA 1FBUA 3BDDA 4B8XA 1AWCA 3C3WA 3BP8A 1USSA 4G94A 1D5VA 4WX9A 4OINF 3FHZA 4Q48A 4YIIA 1LDDA 1ZH5A 2K4BA 5H6RA 1J2XA 1KU9A 2A07F 2CO5A 1B59A 1R7JA 2HGCA 2TDXA 4GO1A 5FD6A 2VBXA 2JPBA 1JXSA 1BIAA 2RQPA 2YX4A 3SQNA 2PN6A 2NNNA 1F4KA 1MKMA 4FHTA 5E18F 4G6QA 3RYRA 1XD7A 2QWWA 3G3ZA 3HSRA 2IJLA 1F9NA 1YYVA 4L0YB 3AAFA 2RNJA 1XGOA 4M71A 3HYIA 4L5JA 3Q9VA 3KE2A 3VB2A 3R6SA 3IHUA 1YFHA 4CHUA 4QLCU 3QP5A 1U5TB 2A6HF 3EUHA 1SD7A 3BOQA 1ZREA 3OOPA 4IHTA 1MJ9A 2VODA 2XAJA 4YFXF 2CW0F 2HKXA 4CXFA 1H0MA 2FMLA 2YU3A 4LLNA 5E20A 1B4AA 1YQAA 2EA2A 2QUFA 3VEPA 2DPUA 5DCMB 2H6BA 5E8IA 3O6BB 2XAFA 5L3FA 3LAJA 4RS8A 3BWGA 4PGHA 2FOKA 1FY7A 2DPDA 4CGZA 4Q5SF 3C18A 2WC2A 4BXUA 4WXDA 3LAPA 4AIJA 5BPDA 2ZXJA 4GYIA 3I71A 1S29A 1LVAA 1J5YA 2O3FA 5LEKA 2J5PA 2GAUA 3LA7A 3C1DA 3JSOA 4ZYHA 1QPMA 1TW3A 5E17F 5D5UB 2P6TA 2DTRA 4RB0A 3WU1B 3TDZC 2P5VA 4N0BA 2A68F 2Y48A 1G4DA 3ZMZA 3ABTA 4Y15A 2K27A 1DP7P 1L0OC 1YLFA 3HSEA 2Z5UA 4OMZA 4WXHA 4JBAA 4LGWA 1HW5A 4M9SA 1MDMB 3GEZA 1RI7A 4JQFA 1IRGA 2ZNZA 3MAJA 1Z7UA 4HW0A 4R79A 5AIPA 4U0VA 4UVBA 2HKOA 2XROA 1ZGAA 3HIFA 3QU3A 1P4AA 3WTSC 3F22A 2X0LA 1YS7A 2D1VA 3HSFA 4HV6A 3P9KA 1K78B 5AONA 3P9IA 3HOTA 2XHKA 1IXCA 4I09A 2YSRA 4P55A 3U9GA 3GO5A 1QO0D 2JPCA 2EV6A 1ZRCA 2QQAA 1PUEE 1X3UA 3KEOA 3ZMSA 1D3YA 3SXYA 3V7SA 2A69F 3D5LA 4LG0B 2ELHA 4Y17A 4O6JA 1IUYA 3M8FA 3RJPA 3WGIA 1FP2A 3P9CA 4MGRA 1BI1A 4CZZA 4ESBA 4HLXA 2MBFA 2Z33A 1R36A 3CJNA 3R60A 2LNBA 3TO7A 3FX3A 5HDNA 2VOPA 4G8XA 1U8RA 3Q5FA 1YO5C 1MGTA 1HKTA 4EVIA 2L54A 4Q47A 1ZAOA 3BJAA 4YIFA 1FLIA 4HX4A 3PFIA 4GXOA 3RKYA 3D0SA 4HZFA 4EV0A 3QRFF 3KCCA 4KFCA 2BV6A 5DD8A 1IZ1A 4QWQA 2FRHA 3EYYA 2XAQA 1EV7A 3DKWA 3I53A 3K2ZA 2D2WA 1FC3A 2L01A 3DXJF 4KUMA 2K7LA 5A2QK 4P9UA 3NEUA 2YX7A 2G7UA 4MTDA 1WWXA 2UXNA 4LK0F 4KIFA 4ENKA 2W85A 4NB5A 1RIOH 3K69A 4AVPA 3MZYA 2HR3A 1O7LA 5ICGA 4EQQA 2ZJ2A 5BQTA 3J80Z 2VBZA 3FWEA 3F6VA 1HKQA 3F8FA 4EM0B 3LSTA 1DDNA 1P92A 5F6FA 3R0JA 4OIOF 5JVTA 2NAZA 1IXRC 2PEXA 2F5CA 3JSPA 3F8CA 3FZVA 2QM3A 3K9TA 2DK8A 2CSOA 4B09A 1IXSB 1U6GA 1YG2A 3HHHA 4DQ2A 2IW5A 3LQQA 4HYEA 3KLNA 2D45A 2XVCA 3CUQA 2QQBA 2STWA 1XGSA 3BROA 3WTTC 2LDUA 4HV5A 1BJAA 1I1GA 2DW4A 5LRRA 3CDHA 3J7AO 3FXUA 4A0ZA 4AWXB 2ESNA 4LD5A 3COAC 1PP8F 2V1UA 1UFMA 3IC7A 1B1BA 4R1HA 4E70A 1U2WA 3F8BA 3TO9A 4KMFA 4KYWA 1BC7C 5LHIA 5H6QA 5FLXK 5CVVA 3R0AA 1S6LA 1DPUA 3FMRA 3KP2A 3KZZA 5L3GA 4LB5A 1QGPA 4ON0A 3LWFA 3BY6A 2MLGA 5HS8A 5D6EA 2CQKA 4RGRA 3ECOA 5AIQA 2FE3A 3QOPA 4ZZLA 4XLPF 1WI9A 3L2CA 2DLLA 4FX4A 2EWNA 4RB1A 2PLYA 1KA8A 1D8KA 4M6YA 2Z99A 1W4MA 5K1YA 2HTSA 3M9AA 4LB6B 1FBSA 5D5VB 3R4KA 5K5RA 3MZHA 1R58A 4CO8A 3FM5A 1V3FA 2PBIA 2PJPA 4YFNF 5LGUA 2IPQX 2VONA 5LHGA 4I02A 4MEYF 3M7GA 5CVIA 4EM2A 1YW8A 2E1NA 4I98B 5ILSA 1SAXA 4HF0A 1TW2A 1W7PB 4KMUX 5DV5A 5ED4A 1XCVA 3ULQB 5ICEA 3KZYA 4UXNA 4LFUA 1PDNC 4I7HA 4HDVA 1XN7A 4A0XA 3HRSA 4Y13A 5CYVA 2WTEA 4EJWA 3ZP5A 3TOAA 1B6AA 3L7WA 2Q2EA 2DK5A 2DO7A 1PP7U 2ZNYA 3JTGA 2M5WA 1ZRFA 2ACJA 1LDJA 4UV8A 1FZPB 1KYZA 4A6DA 4ZYDA 2VT2A 3ZMUA 3RKXA 3FXRA 5LRSA 2V6CA 4IRIA 2W57A 2O61A 3TOBA 1TNSA 3L09A 5LEJA 4LJZF 2FQ3A 2DBBA 1R23A 4IF4A 4N9HA 2HS5A 5LGTA 1T38A 2W84A 3RTRA 1T39A 3F21A 2RV8A 4BYYA 3VODA 2OA4A 1KU3A 4IRGA 4ESJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1H A;  1B9M A;  4M73 A;  4EJO A;  3I59 A;  2BEO A;  2GQQ A;  3MFK A;  2A5Y B;  1YW9 A;  2KIM A;  1OKR A;  5J8C A;  3WOD F;  3WG9 A;  1G3Y A;  5F1R A;  1RUN A;  1WSU A;  3GUD A;  3ABU A;  3LA3 A;  1LDK B;  2WV0 A;  1O3Q A;  1SD5 A;  2W25 A;  5D8L B;  1IN8 A;  1TTY A;  2F5F A;  3QP6 A;  1MJB A;  3EET A;  4PDK A;  1XSD A;  2Y75 A;  3V8K A;  2XGX A;  2K86 A;  1YS6 A;  2FNA A;  1T2K A;  3CUQ C;  2A6E F;  1HQC A;  1TQI A;  2Z3Y A;  4HX7 A;  5TRD A;  3OV8 A;  3IL2 A;  1QQI A;  1GXQ A;  2L02 A;  5F64 A;  2O03 A;  2M8E A;  4M9Z A;  1HXD A;  2D1H A;  3FM3 A;  2DQR A;  2P5K A;  4U88 A;  4Z2Y A;  3E6C C;  4G7Z F;  3DFG A;  5D8K B;  1ZN2 A;  1LJ9 A;  1J75 A;  2V9V A;  3V8L A;  2V1D A;  4UV9 A;  1OYI A;  3WE2 A;  5CVJ A;  1FX7 A;  2GWR A;  3HTU A;  1XSV A;  4GGG A;  3W6J B;  3Q9S A;  3ZPL A;  2OZ6 A;  4EGY A;  2VT3 A;  3GZ6 A;  5CVU A;  3E5Q A;  4YG2 F;  5EEH A;  3PQK A;  2M87 A;  4WK8 F;  2G7H A;  3VFZ A;  1G3S A;  4O5V A;  2NS0 A;  4A12 A;  2OQR A;  2QQ9 A;  1Z9C A;  2KJB A;  4WXC A;  2WWY A;  1QBJ A;  3J81 Z;  2EV0 A;  4EJV A;  4GYG A;  1RZ4 A;  3IKV A;  5HS9 A;  1R5H A;  2HQN A;  5DDG A;  1IN5 A;  3IWF A;  5HLG A;  2RN7 A;  5HLI A;  5DD4 A;  2MLK A;  4UVA A;  1KU7 A;  5L3D A;  1FYM A;  2GXG A;  3GWZ A;  3R61 A;  4L9V A;  3TGN A;  3EYI A;  3JAM K;  2DU9 A;  4L9N A;  2CG4 A;  1U78 A;  2P5L C;  3V7C A;  5FO5 A;  2QBY B;  1ZLK A;  3T8R A;  4D0P A;  1S8N A;  2JSC A;  1QZZ A;  1SFE A;  5IT9 Z;  3NQO A;  3WGG A;  3I4P A;  2IA1 A;  2ZO4 A;  3H3U A;  4RAZ A;  2GA1 A;  3ZMD A;  2JZY A;  3FMS A;  5L3E A;  5DEQ A;  2PG4 A;  2ZME A;  1ZAR A;  4P9F A;  1CF7 A;  3RI4 A;  2XIG A;  1R5G A;  3KEQ A;  1MZB A;  1FBQ A;  4RAY A;  3K1N A;  3MQ0 A;  5LBQ A;  5FB2 A;  2P6S A;  1LQ1 A;  3CLO A;  1BN5 A;  4EMS A;  1YIO A;  2XAS A;  2J5O A;  3F3X A;  3V4G A;  2YR2 A;  2RKH A;  1Z1D A;  1YTY A;  2VC0 A;  5HOO A;  2ZKZ A;  5E8G A;  3M1E A;  2P7V B;  3O3K A;  1IF1 A;  3TDU C;  2HOE A;  1FYL A;  4G9Y A;  4ESF A;  3EQL F;  3DEU A;  1ZG3 A;  5KK1 A;  2JT1 A;  1P2F A;  3DPL C;  4UVC A;  3KP6 A;  5E1X A;  2MH9 A;  1O3T A;  3H3Z A;  4S04 A;  1U3E M;  1BIB A;  4XLN F;  2RVC A;  2YPR A;  1F1Z A;  3RDI A;  2ETH A;  1XDU A;  4A6E A;  4HOB A;  3DF8 A;  2E7X A;  3ISP A;  4KNY A;  2M30 A;  4ENJ A;  2M1B A;  2P7C B;  1TQM A;  5ILU A;  3FXQ A;  4MHG A;  4CIC A;  3KP4 A;  2MD5 A;  4BHB A;  3ZMV A;  1I27 A;  1NHA A;  3QPT A;  2L4A A;  3KFW X;  1FPQ A;  4U7B A;  4CDG A;  1KGS A;  3MEX A;  5D5X B;  3JTH A;  2PQ8 A;  4ZZD A;  2KIU A;  2LSO A;  5E1Z B;  2STT A;  2HYG D;  2V1X A;  3F8M A;  3F72 A;  4XBF A;  3IRQ A;  1UHW A;  4I0A A;  5CLS A;  2HYF A;  4KA4 A;  3BJO A;  5BMZ A;  2Q0O A;  1L3L A;  5ICF A;  5L3C A;  1RNL A;  1D8J A;  1IRF A;  4HBL A;  1FWZ A;  4L0Z B;  4L5I A;  5K5Q A;  2A61 A;  2FA5 A;  2NRA C;  5FGM A;  4A5N A;  4NQW A;  1U5T A;  4HX8 A;  2W24 A;  1J0R A;  4OIR F;  1R1V A;  3IWZ A;  3K0L A;  4HDU A;  3H92 A;  4LLG F;  2MA3 A;  4I0B A;  2IT0 A;  1UB9 A;  1W7P D;  2K4J A;  1IN7 A;  3V7R A;  1O3S A;  2NYX A;  2FXA A;  5K5O A;  5FD5 A;  3JW4 A;  5DCM A;  2QVO A;  3S2W A;  2XKP A;  1MD0 A;  2LF7 A;  2VBW A;  2ESH A;  4ZH4 F;  4OIP F;  3F23 A;  3KP3 A;  1SMT A;  1T6S A;  1WRJ A;  3WTW C;  2GXB A;  1OMI A;  1GVJ A;  4TV7 A;  2XAG A;  2KJC A;  4ZYE A;  2EK5 A;  5ILV A;  3IKT A;  1XB4 A;  1HW2 A;  2QLZ A;  1BI0 A;  2GZW A;  4G7H F;  3PQJ A;  1DPR A;  3BPV A;  3ML6 A;  2RC4 A;  2IA0 A;  4HLY A;  2HTJ A;  1Z05 A;  1SD4 A;  2F2E A;  1FYK A;  1REP C;  2OD5 A;  1Y0U A;  4I2O A;  3WGH A;  1JE8 A;  5IT3 A;  3QPH A;  2OU2 A;  3K1P A;  2HZT A;  1DUX C;  1ZG5 A;  1TNT A;  1Z6R A;  1OR7 A;  4N9I A;  1EH6 A;  2GIV A;  2PFB A;  1YW7 A;  1MDM A;  1J9I A;  2OAZ A;  3HOS A;  3ZQ7 A;  4KDP A;  2EFP A;  5DCF A;  1KQ8 A;  3MCZ A;  3WU0 A;  1IN4 A;  1WQ2 A;  2FBH A;  5J6X A;  2CYY A;  3L00 A;  2DFI A;  5J8F A;  1K78 A;  5FLX Z;  4ENM A;  3WTV C;  3GF2 A;  1J7K A;  1G3W A;  3WTU C;  2FBK A;  2E1C A;  3TO6 A;  2FBI A;  2XV4 S;  4OIQ F;  4IXA A;  3M8E A;  5LLQ A;  1EH7 A;  1ON2 A;  3GFL A;  1R22 A;  4L9T A;  1XDS A;  4HAM A;  4AIH A;  5HS7 A;  4XSX F;  5DYM A;  4O3M A;  2H94 A;  3QAH A;  3GX4 X;  3B02 A;  4IHS A;  4LG0 A;  4OOI A;  2FF4 A;  3U2R A;  4RGS A;  4HF1 A;  2L4M A;  1J59 A;  2BBY A;  2COM A;  2KRF A;  2ZBK A;  3ROU A;  3GZ5 A;  4BNC A;  2UXX A;  3BJ6 A;  4A2U A;  1HKS A;  1CGP A;  1P4W A;  1O7F A;  2OBP A;  2DT5 A;  4MTE A;  1F5T A;  4HF2 A;  4RB2 C;  1XGM A;  3ZMT A;  2EA4 A;  2F5E A;  4G6D A;  5EEG A;  4MNU A;  2NNY A;  3CO6 C;  1OPC A;  2H6C A;  5JHU A;  3HRU A;  1VTN C;  4P5O A;  5JI6 A;  3LQR A;  1BOA A;  4HQM A;  2C6Y A;  5FFZ A;  5D4S A;  5DUK A;  5BPI A;  1BC8 C;  2XKO A;  2EV5 A;  2GA2 A;  3J81 K;  4YFK F;  3KET A;  2EFQ A;  4I01 A;  1ZGJ A;  3I54 A;  1U5T C;  5TJJ A;  3FMQ A;  2LF8 A;  5ERI A;  2H27 A;  4NHJ A;  3CUQ B;  4EM1 A;  4ENN A;  1O57 A;  2DAO A;  1R00 A;  2PMU A;  3RPQ A;  3F6O A;  4EGZ A;  1O3R A;  4M74 A;  2DI3 A;  3V8J A;  1I1S A;  3G73 A;  1FNN A;  4M6X A;  3I0T A;  2OZU A;  3DP7 A;  1P4X A;  1QNT A;  1OYY A;  3BPX A;  1OYW A;  1R1T A;  3WTX C;  3E3V A;  4WF2 A;  2R7D A;  4BHP A;  5IT9 K;  3DPT A;  3CUO A;  1BI3 A;  2RDP A;  4PZJ A;  4M9X A;  1FSE A;  4BH9 A;  4KN4 X;  1H9G A;  2BYV E;  3L9F A;  2Z9O A;  1A04 A;  4LLL A;  3GVA A;  2E7W A;  2CFX A;  1HSJ A;  1JGS A;  2QEN A;  2R3S A;  4L9J A;  1XMK A;  1Z6T A;  3GW2 A;  1S3J A;  5JFR A;  4IRH A;  2IVM A;  3O2P E;  4BQA A;  2XAH A;  2HWV A;  4M72 A;  2HQR A;  1K6O A;  3FF5 A;  1UST A;  4BHC A;  1TLH B;  3KP5 A;  4KIB A;  3RYP A;  1I6X A;  2IRF G;  1UHM A;  3E6M A;  3WE3 A;  1ULY A;  2AS5 F;  3I64 A;  1K7A A;  1STZ A;  5JR3 A;  1SMY F;  1T0F A;  4Q4Z F;  4KIC A;  3SHF A;  3GFI A;  4U0W A;  1E2X A;  3E6D A;  2ZCW A;  3K1M A;  4RGU A;  4A0Y A;  2EFN A;  1KQ0 A;  2IA2 A;  3ELK A;  2V79 A;  4UHT A;  2A3S A;  2JTV A;  2XUB A;  1JHH A;  2B0L A;  3N97 A;  1I5Z A;  4PCQ A;  4XRF A;  4LMY A;  3E97 A;  3TKY A;  2VE8 A;  3IRR A;  2BGC A;  4G7O F;  3E5U A;  1IW7 F;  4P96 A;  2AXL A;  1XGN A;  5KVR A;  1R1U A;  4H0E A;  1LB2 A;  3T5X A;  2KKO A;  2KIF A;  3T8T A;  2Q8K A;  2VBY A;  5FFX A;  5HLH A;  3J80 K;  1W7P A;  3ZN1 A;  3REO A;  2FNP A;  1HBX G;  1W5T A;  2PI0 A;  3GLX A;  3LA2 A;  2G9W A;  4UNO A;  1JHF A;  2R7F A;  3CO7 C;  1XCB A;  3GFM A;  5H20 A;  3HTS B;  5CVR A;  1IN6 A;  3JAM Z;  2MC3 A;  1C0W A;  2O6G E;  3B73 A;  5HVQ C;  3I59 B;  2RGV A;  1TQP A;  3MWM A;  3F8N A;  2FEZ A;  4S05 A;  2MH2 A;  3EDP A;  5LGN A;  3DQV C;  4K2E A;  4AIK A;  1EH8 A;  2EB7 A;  1LEB A;  4MQV A;  2JRT A;  3RPU A;  1ODD A;  1W5S A;  4UUV A;  3GYH X;  3TQN A;  4U7D A;  3SZT A;  2QZ8 A;  1GHC A;  4IPA A;  1KYW A;  4PGG A;  1ONV A;  5L3B A;  4GCV A;  4RGX A;  2VE9 A;  4ASN A;  5BOX A;  1ZLJ A;  3ERE D;  2HFH A;  5E1W A;  2EFO A;  1LNW A;  4CYD A;  2EJR A;  3HRT A;  4HQE A;  3RKW A;  2UWM A;  4MQ9 F;  3W6K B;  2M45 A;  1B9N A;  2VC1 A;  1LEA A;  5ICC A;  2PMH A;  2CWE A;  2ADU A;  2HDC A;  4R8H A;  4L18 B;  4KN7 X;  1BM9 A;  3VOE A;  3GFJ A;  1GXP A;  1ZYR F;  3WTY C;  3GXO A;  1FOK A;  4RB3 C;  4BAY A;  2IP2 A;  2OQG A;  2EFW A;  5D5W B;  4FX0 A;  2ISZ A;  5D6F A;  1UCR A;  1S7O A;  1KU2 A;  3I5U A;  3QU6 A;  1WKM A;  4ETS A;  1K79 A;  2VN2 A;  3ZN0 A;  1H9T A;  4MEX F;  3T1B A;  1MJA A;  4A5M A;  2DQL A;  3SFZ A;  5HDG A;  3HRM A;  2FMY A;  3C7J A;  1V4R A;  4F7Z A;  3KP7 A;  4ZYG A;  2K02 A;  3N4M A;  1QZY A;  3BZ6 A;  5A2Q Z;  1ZHF A;  2XRN A;  6PAX A;  2QYO A;  1XSX A;  4IJA A;  2BE5 F;  3DV8 A;  5LHH A;  1BI2 A;  2O0Y A;  2P8T A;  1KQ9 A;  1IAW A;  2Y0M A;  2FU4 A;  5DUI A;  4DNC A;  4KIG A;  5CJ9 A;  3U1D A;  2VOO A;  1P6R A;  3I58 A;  1G6N A;  4IVN A;  4WCG A;  1ZRD A;  4AD9 A;  3E5X A;  5BS6 A;  1SFX A;  1FT9 A;  1HST A;  1BBY A;  2F5D A;  1SFU A;  4XSZ F;  2CGP A;  2ZFW A;  3HUG A;  3SZP A;  2H09 A;  3LFK A;  2ZME B;  3ECH A;  1CF7 B;  4EJT A;  2LKP A;  3RIR A;  1T98 A;  3P7N A;  5HDK A;  4FT8 A;  4U0Y A;  2HEO A;  3T0Y A;  1FSH A;  4OMY A;  2UZK A;  4EJU A;  3CTA A;  2P4W A;  1G3T A;  1FP1 D;  3WTZ A;  4HA8 A;  1AOY A;  5D4R A;  2QBY A;  4LK1 F;  2VXZ A;  1XMA A;  1RUO A;  3HHG A;  2ISY A;  1HW1 A;  3NRV A;  2X4H A;  1ZG1 A;  1ON1 A;  2L3D A;  4JK1 X;  1TBX A;  2O8X A;  2FSW A;  4WWC A;  4KT5 C;  1Z91 A;  3KLO A;  4OU0 A;  1S7A A;  1E17 A;  1SD6 A;  3E6B A;  1FBU A;  3BDD A;  4B8X A;  1AWC A;  3C3W A;  3BP8 A;  1USS A;  4G94 A;  1D5V A;  4WX9 A;  4OIN F;  3FHZ A;  4Q48 A;  4YII A;  1LDD A;  1ZH5 A;  2K4B A;  5H6R A;  1J2X A;  1KU9 A;  2A07 F;  2CO5 A;  1B59 A;  1R7J A;  2HGC A;  2TDX A;  4GO1 A;  5FD6 A;  2VBX A;  2JPB A;  1JXS A;  1BIA A;  2RQP A;  2YX4 A;  3SQN A;  2PN6 A;  2NNN A;  1F4K A;  1MKM A;  4FHT A;  5E18 F;  4G6Q A;  3RYR A;  1XD7 A;  2QWW A;  3G3Z A;  3HSR A;  2IJL A;  1F9N A;  1YYV A;  4L0Y B;  3AAF A;  2RNJ A;  1XGO A;  4M71 A;  3HYI A;  4L5J A;  3Q9V A;  3KE2 A;  3VB2 A;  3R6S A;  3IHU A;  1YFH A;  4CHU A;  4QLC U;  3QP5 A;  1U5T B;  2A6H F;  3EUH A;  1SD7 A;  3BOQ A;  1ZRE A;  3OOP A;  4IHT A;  1MJ9 A;  2VOD A;  2XAJ A;  4YFX F;  2CW0 F;  2HKX A;  4CXF A;  1H0M A;  2FML A;  2YU3 A;  4LLN A;  5E20 A;  1B4A A;  1YQA A;  2EA2 A;  2QUF A;  3VEP A;  2DPU A;  5DCM B;  2H6B A;  5E8I A;  3O6B B;  2XAF A;  5L3F A;  3LAJ A;  4RS8 A;  3BWG A;  4PGH A;  2FOK A;  1FY7 A;  2DPD A;  4CGZ A;  4Q5S F;  3C18 A;  2WC2 A;  4BXU A;  4WXD A;  3LAP A;  4AIJ A;  5BPD A;  2ZXJ A;  4GYI A;  3I71 A;  1S29 A;  1LVA A;  1J5Y A;  2O3F A;  5LEK A;  2J5P A;  2GAU A;  3LA7 A;  3C1D A;  3JSO A;  4ZYH A;  1QPM A;  1TW3 A;  5E17 F;  5D5U B;  2P6T A;  2DTR A;  4RB0 A;  3WU1 B;  3TDZ C;  2P5V A;  4N0B A;  2A68 F;  2Y48 A;  1G4D A;  3ZMZ A;  3ABT A;  4Y15 A;  2K27 A;  1DP7 P;  1L0O C;  1YLF A;  3HSE A;  2Z5U A;  4OMZ A;  4WXH A;  4JBA A;  4LGW A;  1HW5 A;  4M9S A;  1MDM B;  3GEZ A;  1RI7 A;  4JQF A;  1IRG A;  2ZNZ A;  3MAJ A;  1Z7U A;  4HW0 A;  4R79 A;  5AIP A;  4U0V A;  4UVB A;  2HKO A;  2XRO A;  1ZGA A;  3HIF A;  3QU3 A;  1P4A A;  3WTS C;  3F22 A;  2X0L A;  1YS7 A;  2D1V A;  3HSF A;  4HV6 A;  3P9K A;  1K78 B;  5AON A;  3P9I A;  3HOT A;  2XHK A;  1IXC A;  4I09 A;  2YSR A;  4P55 A;  3U9G A;  3GO5 A;  1QO0 D;  2JPC A;  2EV6 A;  1ZRC A;  2QQA A;  1PUE E;  1X3U A;  3KEO A;  3ZMS A;  1D3Y A;  3SXY A;  3V7S A;  2A69 F;  3D5L A;  4LG0 B;  2ELH A;  4Y17 A;  4O6J A;  1IUY A;  3M8F A;  3RJP A;  3WGI A;  1FP2 A;  3P9C A;  4MGR A;  1BI1 A;  4CZZ A;  4ESB A;  4HLX A;  2MBF A;  2Z33 A;  1R36 A;  3CJN A;  3R60 A;  2LNB A;  3TO7 A;  3FX3 A;  5HDN A;  2VOP A;  4G8X A;  1U8R A;  3Q5F A;  1YO5 C;  1MGT A;  1HKT A;  4EVI A;  2L54 A;  4Q47 A;  1ZAO A;  3BJA A;  4YIF A;  1FLI A;  4HX4 A;  3PFI A;  4GXO A;  3RKY A;  3D0S A;  4HZF A;  4EV0 A;  3QRF F;  3KCC A;  4KFC A;  2BV6 A;  5DD8 A;  1IZ1 A;  4QWQ A;  2FRH A;  3EYY A;  2XAQ A;  1EV7 A;  3DKW A;  3I53 A;  3K2Z A;  2D2W A;  1FC3 A;  2L01 A;  3DXJ F;  4KUM A;  2K7L A;  5A2Q K;  4P9U A;  3NEU A;  2YX7 A;  2G7U A;  4MTD A;  1WWX A;  2UXN A;  4LK0 F;  4KIF A;  4ENK A;  2W85 A;  4NB5 A;  1RIO H;  3K69 A;  4AVP A;  3MZY A;  2HR3 A;  1O7L A;  5ICG A;  4EQQ A;  2ZJ2 A;  5BQT A;  3J80 Z;  2VBZ A;  3FWE A;  3F6V A;  1HKQ A;  3F8F A;  4EM0 B;  3LST A;  1DDN A;  1P92 A;  5F6F A;  3R0J A;  4OIO F;  5JVT A;  2NAZ A;  1IXR C;  2PEX A;  2F5C A;  3JSP A;  3F8C A;  3FZV A;  2QM3 A;  3K9T A;  2DK8 A;  2CSO A;  4B09 A;  1IXS B;  1U6G A;  1YG2 A;  3HHH A;  4DQ2 A;  2IW5 A;  3LQQ A;  4HYE A;  3KLN A;  2D45 A;  2XVC A;  3CUQ A;  2QQB A;  2STW A;  1XGS A;  3BRO A;  3WTT C;  2LDU A;  4HV5 A;  1BJA A;  1I1G A;  2DW4 A;  5LRR A;  3CDH A;  3J7A O;  3FXU A;  4A0Z A;  4AWX B;  2ESN A;  4LD5 A;  3COA C;  1PP8 F;  2V1U A;  1UFM A;  3IC7 A;  1B1B A;  4R1H A;  4E70 A;  1U2W A;  3F8B A;  3TO9 A;  4KMF A;  4KYW A;  1BC7 C;  5LHI A;  5H6Q A;  5FLX K;  5CVV A;  3R0A A;  1S6L A;  1DPU A;  3FMR A;  3KP2 A;  3KZZ A;  5L3G A;  4LB5 A;  1QGP A;  4ON0 A;  3LWF A;  3BY6 A;  2MLG A;  5HS8 A;  5D6E A;  2CQK A;  4RGR A;  3ECO A;  5AIQ A;  2FE3 A;  3QOP A;  4ZZL A;  4XLP F;  1WI9 A;  3L2C A;  2DLL A;  4FX4 A;  2EWN A;  4RB1 A;  2PLY A;  1KA8 A;  1D8K A;  4M6Y A;  2Z99 A;  1W4M A;  5K1Y A;  2HTS A;  3M9A A;  4LB6 B;  1FBS A;  5D5V B;  3R4K A;  5K5R A;  3MZH A;  1R58 A;  4CO8 A;  3FM5 A;  1V3F A;  2PBI A;  2PJP A;  4YFN F;  5LGU A;  2IPQ X;  2VON A;  5LHG A;  4I02 A;  4MEY F;  3M7G A;  5CVI A;  4EM2 A;  1YW8 A;  2E1N A;  4I98 B;  5ILS A;  1SAX A;  4HF0 A;  1TW2 A;  1W7P B;  4KMU X;  5DV5 A;  5ED4 A;  1XCV A;  3ULQ B;  5ICE A;  3KZY A;  4UXN A;  4LFU A;  1PDN C;  4I7H A;  4HDV A;  1XN7 A;  4A0X A;  3HRS A;  4Y13 A;  5CYV A;  2WTE A;  4EJW A;  3ZP5 A;  3TOA A;  1B6A A;  3L7W A;  2Q2E A;  2DK5 A;  2DO7 A;  1PP7 U;  2ZNY A;  3JTG A;  2M5W A;  1ZRF A;  2ACJ A;  1LDJ A;  4UV8 A;  1FZP B;  1KYZ A;  4A6D A;  4ZYD A;  2VT2 A;  3ZMU A;  3RKX A;  3FXR A;  5LRS A;  2V6C A;  4IRI A;  2W57 A;  2O61 A;  3TOB A;  1TNS A;  3L09 A;  5LEJ A;  4LJZ F;  2FQ3 A;  2DBB A;  1R23 A;  4IF4 A;  4N9H A;  2HS5 A;  5LGT A;  1T38 A;  2W84 A;  3RTR A;  1T39 A;  3F21 A;  2RV8 A;  4BYY A;  3VOD A;  2OA4 A;  1KU3 A;  4IRG A;  4ESJ A; 
#chains in the Genus database with same CATH topology
 1Q1H A;  1B9M A;  5GTI C;  4M73 A;  4EJO A;  3I56 I;  2EIK H;  3I59 A;  2HDD A;  2BEO A;  2GQQ A;  3MFK A;  4A3B J;  2A5Y B;  2LBF A;  3OMY A;  1YW9 A;  1DGR M;  2KIM A;  4YEL A;  1OKR A;  3SJM A;  5J8C A;  3WOD F;  4A3C J;  3WG9 A;  4BJ6 C;  1G3Y A;  3OY9 A;  5F1R A;  1RUN A;  1POG A;  2Y9Z A;  1WSU A;  2L9R A;  3MMY B;  3GUD A;  3ABU A;  3LA3 A;  2I10 A;  3AG4 H;  3S1R J;  4DJA A;  1LDK B;  2WV0 A;  1O3Q A;  3LMM A;  4IX7 A;  1SD5 A;  2W25 A;  5D8L B;  1ZKG A;  3H9G A;  2DYR H;  3CC4 I;  2A05 A;  3S32 A;  1KZH A;  1IN8 A;  4B3X A;  1TTY A;  2F5F A;  2V26 A;  1MJB A;  3QP6 A;  5FKL A;  1RKT A;  3EET A;  4BQO A;  4HPQ A;  1X19 A;  3S15 J;  4E7S A;  4PDK A;  1XSD A;  2OTJ I;  2Y75 A;  3V8K A;  4CCJ A;  2XGX A;  2K86 A;  4LIT A;  3H35 A;  1YS6 A;  3BT9 A;  2FNA A;  1T2K A;  3CUQ C;  2A6E F;  1HQC A;  1IRX A;  3W3C A;  5C44 J;  1TQI A;  2Z3Y A;  2WAD A;  4HX7 A;  5TRD A;  5H2F C;  2DCE A;  3RZO J;  4E7H A;  3CF5 F;  3OV8 A;  4I76 A;  3IL2 A;  1QQI A;  3KEY A;  1GXQ A;  2L02 A;  5F64 A;  2O03 A;  5CPR B;  3U1K A;  2M8E A;  3CF2 A;  5E3L A;  4M9Z A;  5KHD A;  4F92 B;  1IV8 A;  4W97 A;  1MNE A;  1HXD A;  2D1H A;  2KMU A;  3B6C A;  3FM3 A;  2XPU A;  2DQR A;  2P5K A;  2WAQ N;  2W1O A;  4U88 A;  2V9K A;  4Z2Y A;  3E6C C;  1BOB A;  4G7Z F;  1OCP A;  3DFG A;  5D8K B;  5HNH A;  1ZN2 A;  2EIL H;  1LJ9 A;  1XC5 A;  1J75 A;  3CES A;  4RLQ A;  2V9V A;  3V8L A;  3C2B A;  2CU7 A;  2V1D A;  4UV9 A;  1OYI A;  2VKV A;  2VJJ A;  5CVJ A;  3WE2 A;  1FX7 A;  4ZYA A;  5HLT A;  1IUF A;  3DU5 A;  2GWR A;  2Z1D A;  3EUA A;  3ESW B;  2WV1 A;  5IYB J;  1Y56 A;  4A3J J;  3HTU A;  1XSV A;  4IQJ A;  4NC7 A;  2LD5 A;  1Y1W J;  4GGG A;  4D1Q A;  2IS6 A;  3W6J B;  3Q9S A;  3BLY A;  3ZPL A;  2OZ6 A;  4EGY A;  2VT3 A;  3GZ6 A;  3DTI A;  3PSF A;  5CVU A;  1Q1V A;  3E5Q A;  3ONQ A;  4YG2 F;  4BE1 A;  2LR8 A;  5EEH A;  3DBH B;  2QA4 I;  1YRN B;  2WY7 Q;  3ASO H;  2LK2 A;  3PQK A;  2M87 A;  1ETV A;  4WK8 F;  3S1M J;  2G7H A;  2OJE D;  3VFZ A;  3RQ4 A;  4ZTF A;  1HF0 A;  1ETO A;  1G3S A;  4O5V A;  2W82 A;  2WAQ A;  2NS0 A;  2DMQ A;  2XGE A;  4A12 A;  1A6Q A;  3OYH A;  5M3M J;  4HNV A;  2OQR A;  2QQ9 A;  1Z9C A;  5FKN A;  1JGG A;  1UZC A;  2KJB A;  4WXC A;  2WWY A;  3PIO F;  2V7F A;  2NOG A;  3J7Z I;  3HUG B;  1QBJ A;  1AKH B;  3J81 Z;  2EV0 A;  4B4C A;  4DZP A;  4EJV A;  1X2M A;  4GYG A;  1RZ4 A;  3A1Y A;  3IKV A;  5HS9 A;  3AKZ A;  1R5H A;  2F4I A;  1ZEL A;  2HQN A;  5DDG A;  2VIX A;  1YJN I;  5J4Y A;  1IN5 A;  3IWF A;  5HLG A;  1MSF C;  2RN7 A;  2HNH A;  5HLI A;  2DMT A;  5CQG A;  1ETX A;  5DD4 A;  1I50 J;  2MLK A;  4UVA A;  1KU7 A;  3HXL A;  3BG7 A;  2XSJ C;  5L3D A;  2KL4 A;  1FYM A;  2LRE A;  2H1K A;  2GXG A;  1MIJ A;  3GWZ A;  3R61 A;  2PJR A;  4L9V A;  3TGN A;  4AUX A;  4KYW A;  1RET A;  2HPI A;  4D5C A;  3EYI A;  3H3V K;  3JAM K;  4L9N A;  2ME0 A;  2CG4 A;  3FXK A;  1U78 A;  2ECC A;  3W6V A;  1X1B A;  2HOS A;  2P5L C;  3V7C A;  4PJ0 C;  5FO5 A;  2QBY B;  1ZLK A;  3CJQ B;  2FJ1 A;  3K4K A;  3QYF A;  2LY1 A;  5F0F A;  2ME6 A;  3T8R A;  2O5R A;  3DKY A;  3ZXS A;  4D0P A;  1ETQ A;  1S8N A;  2JSC A;  1QZZ A;  3OIO A;  3JRC A;  1SFE A;  5IT9 Z;  3NQO A;  2DA2 A;  4IEJ A;  3WGG A;  4A3I J;  1DU6 A;  2HQ5 A;  1EA3 A;  3I4P A;  1VQN I;  2IA1 A;  2ZO4 A;  3H3U A;  4RAZ A;  2GA1 A;  4N4N B;  3ZMD A;  3CMA I;  1ERD A;  2JZY A;  3FMS A;  2M0M A;  5L3E A;  5DEQ A;  2PG4 A;  2ZME A;  1ZAR A;  1LVK A;  4P9F A;  2DOA A;  2BY3 A;  1CF7 A;  1JI8 A;  3RI4 A;  2MD0 A;  1R5G A;  2XIG A;  3KEQ A;  3OYA A;  4GFB A;  2K3F A;  2BW3 B;  1MZB A;  1FBQ A;  4RAY A;  4A3F J;  2AQE A;  3BR1 A;  3K1N A;  3JCU C;  3MQ0 A;  5LBQ A;  1B8I A;  2IS2 A;  1ZR2 A;  3W2V A;  2B7E A;  1W36 D;  3PIP F;  5FB2 A;  2P6S A;  1LQ1 A;  2R7U A;  5FRM A;  3OYC A;  3CLO A;  1BN5 A;  5LD2 C;  4EMS A;  3ZQF A;  3LSM A;  1YIO A;  1RR8 C;  2XAS A;  2LG4 A;  2J5O A;  3F3X A;  2KIS A;  3V4G A;  3HOY J;  2YR2 A;  2RKH A;  3CME I;  1Z1D A;  2R7S A;  1YTY A;  2VC0 A;  5HOO A;  4QPQ A;  4A3E J;  2ZKZ A;  5E8G A;  2W00 A;  2E5Z A;  3M1E A;  2P7V B;  1X4O A;  4XKV A;  3AG2 H;  3O3K A;  1IF1 A;  2EQR A;  3FIS A;  3TDU C;  1V5F A;  2HOE A;  1FYL A;  4G9Y A;  4ESF A;  3EQL F;  3DEU A;  3MKL A;  1ZG3 A;  2R7Q A;  5KK1 A;  1VFC A;  2JT1 A;  3HOV J;  2OCC H;  2E5N A;  1P2F A;  2E36 A;  3DPL C;  5LFA A;  1UAA A;  1MNM C;  4UVC A;  3GTG J;  2ZXI A;  2DT7 B;  3K4N A;  3KP6 A;  5E1X A;  4RM3 A;  2MH9 A;  1MBG A;  2HVQ A;  1O3T A;  3H3Z A;  4S04 A;  3TP3 A;  1U3E M;  1VQ7 I;  1BIB A;  1D0Z A;  2I5U A;  4PK4 A;  2BZT A;  3BCA A;  4XLN F;  2RVC A;  2YPR A;  1F1Z A;  2DJN A;  3OS0 A;  5M5W J;  1LFU P;  3RDI A;  1X1D A;  2LKS A;  2ETH A;  1XDU A;  4A6E A;  4HOB A;  4MIM A;  1OCO H;  1RC9 A;  3BG9 A;  1RES A;  3DF8 A;  2E7X A;  3ISP A;  4RMN A;  4KNY A;  2M30 A;  4ENJ A;  2M1B A;  2HI3 A;  3FHN A;  1TQM A;  2E60 A;  2P7C B;  2HXO A;  1NTC A;  5ILU A;  9ANT A;  3FXQ A;  4MHG A;  4CIC A;  3PFY A;  4DBQ A;  3KP4 A;  2MD5 A;  2DTZ A;  4BHB A;  3OS2 A;  3ZMV A;  1I27 A;  1NHA A;  3JRE A;  3QPT A;  2KFD A;  3G4S I;  2L4A A;  2HPM A;  1OCR H;  3KFW X;  3CCS I;  3PO3 J;  1FPQ A;  1Z67 A;  4U7B A;  2ZJR F;  3GLL A;  4CDG A;  1KGS A;  4M3B A;  3MEX A;  1JTX A;  3CJR B;  5D5X B;  3LOC A;  4XRM A;  1G2H A;  1E3O C;  3JTH A;  3DBL B;  1X1P A;  4QTR A;  2PQ8 A;  4ZZD A;  2KIU A;  2LSO A;  3GTQ J;  5E1Z B;  3LSR A;  1FJL A;  2STT A;  2HYG D;  2V1X A;  4BQN A;  3F8M A;  4B1R A;  3F72 A;  1TWG J;  4XBF A;  1FTZ A;  4IQ4 A;  3IRQ A;  3BTI A;  2ZB9 A;  3J7Y J;  5HOD A;  1R49 A;  1E3P A;  1UHW A;  4I0A A;  5CLS A;  2HYF A;  4KA4 A;  3BJO A;  3HB9 A;  5BMZ A;  2Q0O A;  1L3L A;  4BEH A;  5ICF A;  5L3C A;  5DTD A;  4KIS A;  4HST A;  1RNL A;  1A35 A;  2QQ8 A;  1D8J A;  1IRF A;  4HBL A;  4XLE A;  3ZRG A;  1TWA J;  1JTY A;  4PFO A;  1FWZ A;  4L0Z B;  4L5I A;  3OYE A;  4Y3O A;  3VDX A;  5K5Q A;  1A36 A;  2A61 A;  4C30 A;  3ZQQ A;  2E19 A;  2FA5 A;  3HGG A;  2NRA C;  5FGM A;  5CQE A;  2TRT A;  2ZSH B;  3S1Q J;  3S17 J;  3SYT A;  4A5N A;  2CJJ A;  1PUF B;  4NQW A;  3PO2 J;  2OUM A;  1U5T A;  5TIS C;  1V5G A;  4HX8 A;  2H8R A;  1V55 H;  2W24 A;  1J0R A;  4OIR F;  3AG3 H;  1R1V A;  3IWZ A;  2ZFU A;  3K0L A;  4HDU A;  2E1M B;  3H92 A;  1D1A A;  4LLG F;  5B5E C;  3SDG A;  2MA3 A;  4I0B A;  3MKW B;  1UB9 A;  3L2Q A;  4IOC F;  1W7P D;  2IT0 A;  2MYS A;  2K4J A;  3K4J A;  3OYD A;  3LL7 A;  1IN7 A;  3V7R A;  3M1C A;  1O3S A;  1HOM A;  4KJZ A;  2NYX A;  5B66 C;  2LY9 A;  2BXZ A;  2FXA A;  2KZV A;  2IGM A;  3NWS A;  3RCO A;  3NAU A;  5K5O A;  5M5X J;  5FD5 A;  2QSG X;  2XF7 A;  3JW4 A;  5DCM A;  5FKM A;  1E3H A;  2QVO A;  3S2W A;  5J3L A;  2XKP A;  2JJ7 A;  1AU7 A;  2LLK A;  1MD0 A;  2LF7 A;  2VBW A;  2ESH A;  4ZH4 F;  4OIP F;  3F23 A;  3KP3 A;  2PJR B;  1SMT A;  1T6S A;  1TL8 A;  1K4T A;  1WRJ A;  3CCU I;  2EZL A;  2L7F P;  3WTW C;  4LG3 A;  2GXB A;  1MBH A;  3VSK A;  3JR9 A;  2O9L A;  1OMI A;  1GVJ A;  3IP4 B;  4TV7 A;  2XAG A;  2KJC A;  4ZYE A;  2EK5 A;  2L5Q A;  5ILV A;  1X3W B;  2VQL A;  1BW5 A;  3RPU D;  4BY1 J;  3IKT A;  1XB4 A;  2O8K A;  5GAE J;  1HW2 A;  2QLZ A;  4NC8 A;  5FRO A;  2NS8 A;  1BI0 A;  2X9D A;  4D9J A;  2GZW A;  2JUC A;  4G7H F;  2ZME C;  1Y6I A;  3PQJ A;  1RRJ A;  1DPR A;  3BPV A;  3ML6 A;  2RC4 A;  3FDY A;  2IA0 A;  4HLY A;  4XKW A;  4XLH A;  2HTJ A;  1VZ0 A;  4J19 A;  3MKY B;  1Z05 A;  1ETW A;  2LVS A;  1OCC H;  4F52 A;  4XLF A;  1SD4 A;  2F2E A;  1FYK A;  1REP C;  3QYB A;  2OD5 A;  1Y0U A;  4I2O A;  3GZN B;  3WGH A;  2RAE A;  1JE8 A;  1FTT A;  1HA8 A;  5IT3 A;  3QPH A;  2OU2 A;  1BR1 A;  1N75 A;  2ZXW H;  4F55 A;  3K1P A;  2HZT A;  3S3N A;  1DUX C;  1ZG5 A;  1B8I B;  2DOE A;  1AA7 A;  1TNT A;  2JK3 A;  3JRG A;  4BE0 A;  2L0K A;  1Z6R A;  1OR7 A;  2WY8 Q;  4N9I A;  2R5Z A;  4NDL A;  1EH6 A;  2GIV A;  2L7Z A;  2PFB A;  1YW7 A;  1MDM A;  4UY8 I;  3CD6 I;  3H0G J;  2XC7 A;  3MN2 A;  1J9I A;  2MSY A;  2OAZ A;  4P1W A;  1HCR A;  3HOS A;  4UB6 C;  1GV5 A;  3VSL A;  3G1M A;  3ZQ7 A;  2M7A A;  4KDP A;  2EFP A;  5DCF A;  1KQ8 A;  3S1N J;  3L2V A;  3MCZ A;  3WU0 A;  1WJB A;  1R4M B;  1IN4 A;  1WQ2 A;  1K4S A;  2FBH A;  5J6X A;  4I99 C;  2CYY A;  3BTC A;  3L00 A;  2DFI A;  5J8F A;  3M4O J;  1U0J A;  1K78 A;  5FLX Z;  4ENM A;  3KZI C;  3WTV C;  3GF2 A;  1J7K A;  1G3W A;  3WTU C;  3HZJ A;  1JT6 A;  2XB5 A;  2FBK A;  2E1C A;  2JA5 J;  2Y9Y A;  3TO6 A;  1O4X A;  2OC6 A;  3OYK A;  2FBI A;  2XV4 S;  4OIQ F;  1G59 A;  4X6A J;  4IXA A;  3M8E A;  5LLQ A;  1EH7 A;  2X6O A;  3S2D J;  1HDD C;  1ON2 A;  2QSF X;  2BOL A;  3GFL A;  4HG2 A;  5DS9 A;  4V19 K;  2LRD A;  1R22 A;  4L9T A;  1XDS A;  4HAM A;  4AIH A;  2KDZ A;  2H8W A;  1GLN A;  5HS7 A;  4XSX F;  5DYM A;  4O3M A;  2H94 A;  2L9S A;  3QAH A;  3GX4 X;  1DP3 A;  3B02 A;  2R5Y B;  4IHS A;  2F48 A;  4LG0 A;  2M34 A;  3DWL E;  4FE4 A;  4OOI A;  4XON A;  2FF4 A;  3U2R A;  4UUT A;  4RGS A;  4HF1 A;  2L4M A;  2DOD A;  1J59 A;  5JVG F;  5EGO B;  5JLX A;  2LP0 A;  3BQY A;  2H1L A;  2BBY A;  2ZSI B;  2COM A;  2BVM A;  4II2 A;  3M3Y J;  2KRF A;  1LUJ B;  2ZBK A;  3ROU A;  4E7L A;  2DDA A;  3GZ5 A;  1QHH D;  1YOV B;  3BR3 A;  4BNC A;  1YJ9 I;  3PUB A;  2UXX A;  3BJ6 A;  4A2U A;  1HKS A;  4QPO A;  1CGP A;  2KLO A;  1P4W A;  3ABL H;  2R7R A;  5IOY A;  1WJF A;  2X6Y A;  1O7F A;  4A3L J;  2OBP A;  2DT5 A;  4MTE A;  3DCF A;  1F5T A;  2X1E A;  3LNQ A;  2K85 A;  4HF2 A;  4RB2 C;  5KCM A;  1XGM A;  4XN3 A;  3ZMT A;  2EA4 A;  5F27 A;  3JRF A;  1TWF J;  2F5E A;  3HPH A;  2E1O A;  4G6D A;  5EEG A;  4JX6 A;  4MNU A;  2NNY A;  3CO6 C;  4BQQ A;  3VYU B;  2UUZ A;  1OPC A;  4RM2 A;  3HOZ J;  2H6C A;  5JHU A;  3HRU A;  1XS9 A;  1VTN C;  4P5O A;  5JI6 A;  5IYD J;  3LQR A;  1BOA A;  4HQM A;  2C6Y A;  5FFZ A;  1CQT A;  5D4S A;  5DUK A;  5BPI A;  1H88 C;  2WAE A;  3K7A J;  1BC8 C;  1VQ9 I;  4XLA A;  2XKO A;  1PYV A;  3HBL A;  4Y33 A;  2EV5 A;  2GA2 A;  3J81 K;  4YFK F;  3KET A;  1FOW A;  3BG6 A;  4KIT B;  2IS1 A;  3D1N I;  1OFC X;  2EFQ A;  4I01 A;  2QSH X;  5KNL A;  1ZGJ A;  3I54 A;  1NG7 A;  3CC7 I;  1U5T C;  2FQ4 A;  5TJJ A;  3FMQ A;  2LF8 A;  4XOT A;  4CYC A;  5ERI A;  3FBN B;  3WHB A;  5GPC A;  2H27 A;  4NHJ A;  1S9H A;  3CUQ B;  4EM1 A;  2KRC A;  4ENN A;  3CC2 I;  1O57 A;  2DAO A;  2EZH A;  3DLA A;  1R00 A;  4RAG A;  1YIJ I;  2JWT A;  2PMU A;  4NQW B;  3RPQ A;  3BZC A;  4EEF G;  3F6O A;  4EGZ A;  2ID3 A;  2L9V A;  2CUJ A;  3FBI B;  3JRI A;  4M74 A;  1O3R A;  2XDV A;  2DI3 A;  3CQZ J;  3V8J A;  2WBM A;  1I1S A;  2G0E A;  1FNN A;  4M6X A;  3G73 A;  4H4K C;  2F4M B;  5EG0 B;  1Z0X A;  3G6E I;  3I0T A;  2OZU A;  2ZJQ F;  5EJC A;  3DP7 A;  1VQM I;  1P4X A;  1QNT A;  1OYY A;  3BPX A;  1OYW A;  1R1T A;  3WTX C;  4RAF A;  1W5C C;  4GDF A;  3E3V A;  5DM6 F;  2D5V A;  3TBI A;  4WF2 A;  2R7D A;  3PNT A;  1V54 H;  3WG7 H;  2R7X A;  4BHP A;  5IT9 K;  3DPT A;  5IP9 J;  3S93 A;  1ZGW A;  3CUO A;  1BI3 A;  2RDP A;  3OYG A;  4PZJ A;  3VYS B;  1IG7 A;  1UG2 A;  2NVY J;  2E71 A;  3CCR I;  5F0H A;  3E0J B;  3H5N A;  3OS1 A;  1YE9 A;  4M9X A;  1FSE A;  4C3J J;  3PSI A;  1YJW I;  5F0C A;  2IGN A;  4BH9 A;  4KN4 X;  4UB8 C;  1H9G A;  3DEE A;  2BYV E;  3L9F A;  4XR6 A;  1WJ5 A;  5JHF A;  2Z9O A;  1A04 A;  4LLL A;  3GTL J;  4QSH A;  3GVA A;  1OCT C;  2E7W A;  2O7O A;  5EDN A;  3PM1 A;  1LE8 A;  4ZTJ A;  3CCE I;  2CFX A;  1HSJ A;  4IOA F;  4XOP A;  3GTM J;  2VJ5 A;  1JGS A;  2QEN A;  2R3S A;  3TP0 A;  5JLW A;  4CZC A;  2VKH A;  1MBF A;  4G12 A;  4L9J A;  3H5R A;  1XMK A;  1Z6T A;  2CW7 A;  2EIM H;  2X1D A;  3GW2 A;  1S3J A;  3IH4 A;  5JFR A;  2VB6 A;  4XRS A;  4IRH A;  2IVM A;  3O2P E;  4BQA A;  2XAH A;  5M5Y J;  2VI6 A;  3AL0 C;  1SVM A;  2HWV A;  4CSW A;  4M72 A;  2HQR A;  1K6O A;  3CLQ A;  3FF5 A;  1UST A;  1OR7 C;  4XNF A;  4BHC A;  3ASN H;  2HVR A;  2HVS A;  1TLH B;  3WU2 C;  3QPL A;  3GTK J;  3KP5 A;  4NC6 A;  1Y39 A;  4KIB A;  3RYP A;  2IBD A;  1I6X A;  4ZJZ A;  1T8I A;  2IRF G;  1UHM A;  3E6M A;  3WE3 A;  2XGC A;  1ULY A;  2AS5 F;  5GP9 A;  3I64 A;  1Y8R B;  1K7A A;  1P9Q C;  2JSP A;  2ELK A;  1STZ A;  3OR1 C;  2COB A;  2CQN A;  3J7A Y;  5JR3 A;  1SMY F;  3ZCO A;  3BR0 A;  4U87 A;  1T0F A;  4Q4Z F;  2W48 A;  5FLM J;  2K5C A;  3MD2 A;  1R5I D;  4KIC A;  1SAN A;  3SHF A;  5E3M A;  3GFI A;  1IV6 A;  4U0W A;  3E7L A;  1E2X A;  3E6D A;  4A3D J;  2CUE A;  2JVG A;  2OPT A;  2ZCW A;  3K1M A;  3BQZ A;  1PJR A;  4RGU A;  1IRZ A;  4A0Y A;  2EFN A;  1JKP C;  2XRL A;  1KQ0 A;  2IA2 A;  3ELK A;  2V79 A;  4UHT A;  2A3S A;  1SAU A;  2JTV A;  2XUB A;  3I4N J;  1JHH A;  2B0L A;  3DBR B;  4N4O B;  2Q2E B;  2Z16 A;  3QYE A;  3N97 A;  1K6Y A;  5J47 A;  1I5Z A;  1XPX A;  1B72 A;  3S14 J;  2L9N A;  2RRE A;  1QRY A;  4Y4R A;  4PCQ A;  4XRF A;  1WJD A;  2LH9 A;  4LMY A;  3E97 A;  3TKY A;  4PFP A;  1DGW Y;  2VE8 A;  2QEX I;  2M4K A;  3IRR A;  2BGC A;  4G7O F;  3E5U A;  1IW7 F;  4P96 A;  4W1U A;  2AXL A;  1XGN A;  1LFB A;  4GRI A;  5KVR A;  1R1U A;  4H0E A;  3OYM A;  1LB2 A;  3T5X A;  2KKO A;  1TT5 B;  3HGY A;  2KIF A;  3T8T A;  4PJM A;  2Q8K A;  2ZXH A;  2VXD A;  3PJR A;  2VBY A;  5FFX A;  3TW6 A;  5HLH A;  2QKM B;  2F5V A;  2EH3 A;  3LFU A;  3J80 K;  4CH7 A;  1W7P A;  2ECB A;  3FK7 A;  1LPQ A;  1WZ2 A;  3ZN1 A;  1Z7L A;  3REO A;  1BR2 A;  1X2N A;  2FNP A;  1HBX G;  1W5T A;  2PI0 A;  3GLX A;  4RLF A;  3AG1 H;  4XLC A;  3LA2 A;  1VQ4 I;  2G9W A;  4UNO A;  1JHF A;  4PSX A;  1UMQ A;  2R7F A;  3ABK H;  1D5Y A;  2R93 J;  1S7E A;  1ENH A;  3CO7 C;  2BY0 A;  1XCB A;  3GFM A;  5H20 A;  2DFH A;  3HJE A;  3HTS B;  5CVR A;  1IN6 A;  4IL6 C;  3JAM Z;  2MC3 A;  2LYC A;  2E2H J;  2MAB A;  4RDU A;  1C0W A;  2O6G E;  3B73 A;  5HVQ C;  3I59 B;  5J4V A;  2RGV A;  1TQP A;  3MWM A;  4UUS A;  2CH0 A;  3F8N A;  2LBF B;  4Y7N J;  2FEZ A;  2HZD A;  4RA2 A;  1D0Y A;  3CJT B;  4S05 A;  2R7T A;  2MH2 A;  2DMU A;  3EDP A;  3UNG C;  5LGN A;  1Z77 A;  5DM7 F;  3DQV C;  3OL4 A;  4K2E A;  4AIK A;  4KT6 A;  4BDY A;  1EH8 A;  1ITY A;  1U8B A;  1YX5 A;  3H1C A;  2EB7 A;  1LEB A;  2BY2 A;  4MQV A;  1IGN A;  1W0U A;  4D7M A;  2X85 A;  2JRT A;  3RPU A;  4ESJ A;  3OL3 A;  1ODD A;  4JX4 A;  3OYF A;  5CKT A;  1W5S A;  4UUV A;  3GYH X;  4ITV A;  3A03 A;  3TQN A;  4U7D A;  3SZT A;  4M3D A;  4AYB N;  2QZ8 A;  4BXX J;  1MMN A;  2DJI A;  3SDB A;  3K4L A;  1GHC A;  4IPA A;  1JUP A;  4PJL A;  1KYW A;  4PGG A;  1ONV A;  2JA2 A;  3W2W A;  5L3B A;  2K9Q A;  3HEF A;  4GCV A;  4RGX A;  5GAG J;  4ASN A;  4XQF A;  2VE9 A;  3GTJ J;  4S0H B;  5BOX A;  2CV1 A;  1ZLJ A;  3ERE D;  1MH3 A;  2HFH A;  5FLV A;  1W36 C;  3CZ6 A;  1I3A A;  1VQO I;  5E1W A;  4V2G A;  3DTE A;  2EFO A;  2KP6 A;  1JJ6 C;  1FMV A;  4C2U A;  1LNW A;  2HU9 A;  1VQP I;  4CYD A;  4HEA 2;  5FJ8 J;  3S3O A;  1P7J A;  2EJR A;  3K10 A;  2XAU A;  3KYC B;  3HRT A;  1U9N A;  2JA6 J;  4HQE A;  3RKW A;  2UWM A;  4MQ9 F;  3W6K B;  3CCM I;  4C9Y A;  2K9S A;  2M45 A;  1B9N A;  4AYB A;  4CCL A;  2VC1 A;  4A69 C;  1LEA A;  5ICC A;  2PMH A;  3MKZ A;  1SFO J;  2CWE A;  1N77 A;  3L2U A;  4BJ5 C;  2ADU A;  2HDC A;  2B63 J;  2NVU B;  4B44 A;  3FKJ A;  3O8G A;  4D5F A;  4DGW B;  4R8H A;  4L18 B;  4KN7 X;  1BM9 A;  1Z21 A;  1I39 A;  3TMO A;  4B43 A;  3VOE A;  2V6E A;  3GFJ A;  1GXP A;  1ZYR F;  3WTY C;  3GXO A;  2JUG A;  1SC7 A;  1FOK A;  3K6G A;  4RB3 C;  2OTL I;  4BAY A;  1D0X A;  1IO2 A;  3AFH A;  2IP2 A;  3EPZ A;  4E7I A;  2OQG A;  3OYJ A;  2EFW A;  1A5J A;  5D5W B;  4FX0 A;  2CW8 A;  2ISZ A;  5D6F A;  5J1U A;  4FIS A;  3H36 A;  2AO9 A;  1UCR A;  4V2F A;  1S7O A;  3IAM 2;  1ZTR A;  1KU2 A;  2K9M A;  3I5U A;  3QU6 A;  1WKM A;  4ETS A;  1EJ9 A;  1K79 A;  2BHY A;  2VN2 A;  2BY1 A;  2XSD C;  3C2H A;  4AVZ A;  3ZN0 A;  5J1Y A;  2LC2 A;  1H9T A;  3C2G A;  3CP2 A;  4MEX F;  3N05 A;  3T1B A;  1MJA A;  3IAS 2;  4NUB A;  5K7H A;  4A5M A;  2DQL A;  3SFZ A;  2FX0 A;  5HDG A;  5M3F J;  3HRM A;  2M2E A;  2CFO A;  2YUS A;  2FMY A;  3C7J A;  1V4R A;  1FMW A;  2MC4 A;  4F7Z A;  4XID A;  3VPR A;  3KP7 A;  4JYK A;  3UKG A;  4ZYG A;  3DLL F;  2K02 A;  3G2B A;  2VKE A;  3K70 D;  4FTH A;  3N4M A;  1QZY A;  3BZ6 A;  5A2Q Z;  4MFE A;  1ZHF A;  2XRN A;  4BAC A;  6PAX A;  1WFX A;  2V4J C;  1MSE C;  2Q1Z B;  2L7M P;  2QYO A;  1XSX A;  2K9L A;  1OCZ H;  4IJA A;  2BE5 F;  3DV8 A;  5LHH A;  5KAF C;  1BI2 A;  2O0Y A;  2P8T A;  1N78 A;  3LSK A;  2KQR A;  5IY5 H;  1KQ9 A;  1IAW A;  2Y31 A;  2DA3 A;  1Z3Y A;  1IDZ A;  2Y0M A;  3HC7 A;  2FU4 A;  5DUI A;  4DNC A;  2XPV A;  1YRN A;  4IO9 F;  2KT0 A;  4KIG A;  5CJ9 A;  5F08 A;  1T0F C;  2PMZ N;  3U1D A;  2VOO A;  4IHX A;  1P6R A;  3I9V 2;  3I58 A;  1G6N A;  2EZK A;  4IVN A;  4WCG A;  3VWB A;  1JUS A;  4QIW N;  1ZRD A;  2OV7 A;  4AD9 A;  3E5X A;  3RSN A;  5BS6 A;  3IH3 A;  3LSG A;  1SFX A;  1G8X A;  1FT9 A;  2E2I J;  1HST A;  1BBY A;  2F5D A;  1SFU A;  1E0E A;  3OYB A;  5F1J A;  4XSZ F;  2JA7 J;  2CGP A;  2GIZ A;  2VUM J;  2ZFW A;  3HUG A;  2TCT A;  3SZP A;  2H09 A;  3LFK A;  1AKH A;  2ZME B;  3H9J A;  3ECH A;  1CF7 B;  3ZOB A;  4EJT A;  1XMX A;  2LKP A;  1IJW C;  3RIR A;  1MBE A;  1T98 A;  2EBI A;  3P7N A;  5HDK A;  1RR7 A;  4FT8 A;  3F0C A;  2VQC A;  4U0Y A;  2HEO A;  4PUS A;  5KAI C;  3T0Y A;  1FSH A;  4OMY A;  1B72 B;  1TC3 C;  5GTH C;  2BXY A;  2UZK A;  4EJU A;  3CTA A;  2P4W A;  2WA0 A;  2IXS A;  2AXT C;  3DEW A;  2HDW A;  1FOY A;  1G3T A;  4DW6 A;  2PMZ A;  1JJ8 C;  1IC8 A;  1FP1 D;  3WTZ A;  4HA8 A;  1WI3 A;  4A93 J;  2HYJ A;  4E4H A;  2XGD A;  1GVD A;  2LMD A;  1XTA A;  2P81 A;  1ZQ3 P;  1P7I A;  1AOY A;  5D4R A;  3K4C A;  4OWR B;  1YHQ I;  2QBY A;  4LK1 F;  2VXZ A;  2HOT A;  1XMA A;  5E79 C;  1RUO A;  2DA4 A;  3HHG A;  4F93 B;  3FXL A;  1VF9 A;  3Q0V A;  5IPA A;  2ISY A;  1HW1 A;  3NRV A;  2X4H A;  2XPW A;  3BR5 A;  3ZR8 X;  1ZG1 A;  1ON1 A;  2L3D A;  4JK1 X;  4M3E A;  3PNV A;  1TBX A;  2M3A A;  2O8X A;  2UV1 A;  1GDT A;  5C4X J;  2FSW A;  4WWC A;  4A3G J;  4KT5 C;  1VQ6 I;  1Z91 A;  3KLO A;  4OU0 A;  1S7A A;  3WHC A;  2MGQ A;  1E17 A;  3FXM A;  1SD6 A;  1UEL B;  4FCY A;  3BR2 A;  3E6B A;  1FBU A;  3CDL A;  3BDD A;  4B8X A;  1AWC A;  3C3W A;  2BW3 A;  3BP8 A;  1NK2 P;  2PX9 A;  3I4M J;  1USS A;  5B1B H;  4BXF A;  4G94 A;  1D5V A;  4WX9 A;  4OIN F;  3FHZ A;  3LSP A;  4Q48 A;  3CCV I;  4YII A;  1LDD A;  2DA5 A;  1A31 A;  4ANJ A;  4XKB A;  3HOX J;  3Q0U A;  1H89 C;  1ZH5 A;  2AHQ A;  2K4B A;  5H6R A;  5EZH A;  1J2X A;  1ZR4 A;  4LIV A;  2F4O B;  1T95 A;  1KU9 A;  3SEQ A;  2A07 F;  2KZG A;  2CO5 A;  1B59 A;  2RQQ A;  1R7J A;  1UHS A;  2HGC A;  1XG1 A;  2TDX A;  4DYC A;  5K7Z A;  3M8J A;  3KIO A;  4GO1 A;  4XOR A;  3CMM A;  3ABM H;  5FD6 A;  2LFB A;  2VBX A;  1T08 B;  2JPB A;  1JXS A;  2X6X A;  1BIA A;  2M7B A;  4M3G A;  2RQP A;  4C3I J;  3K2A A;  3RZD J;  2GBY A;  2YX4 A;  3SQN A;  4JP0 A;  1ACI A;  3EUK L;  2W4S A;  2PN6 A;  2NNN A;  1F4K A;  3Q0W A;  2L7K A;  1MKM A;  4FHT A;  4LIU A;  5E18 F;  3PUF A;  4G6Q A;  2DMP A;  3RYR A;  1WH5 A;  2GXA A;  5TGT A;  1XD7 A;  2DXI A;  3I55 I;  2N8G A;  4FET A;  1SVO A;  2QWW A;  2HQA A;  3G3Z A;  3HSR A;  2XF6 A;  4JX5 A;  2IJL A;  1BA5 A;  1F9N A;  4Z6Y A;  2YU9 J;  1WHU A;  1YYV A;  4L0Y B;  2DA7 A;  4BEH B;  3AAF A;  2RNJ A;  1XGO A;  4PSW A;  1H8A C;  2JVH A;  4M71 A;  3HYI A;  5J40 A;  3VYR B;  2GOM A;  2WB1 N;  3Q9V A;  3KE2 A;  4L5J A;  1N25 A;  3VB2 A;  3R6S A;  2IGO A;  1F36 A;  3IHU A;  4BBS J;  1YFH A;  4CHU A;  2R7W A;  4QLC U;  3OIP A;  3QP5 A;  4RBO A;  1U5T B;  4BS9 A;  2A6H F;  3QPS A;  1QVT A;  3EUH A;  2VJI A;  3OIQ A;  1SD7 A;  3BOQ A;  2V1N A;  3HPG A;  1IDY A;  2NXN B;  1ZRE A;  3OOP A;  4XKC A;  4IHT A;  1MJ9 A;  2VOD A;  4ZDO A;  5E3O A;  2XAJ A;  4YFX F;  2CW0 F;  1TWC J;  2HKX A;  2M8G X;  1WJC A;  4CXF A;  1H0M A;  2VL8 A;  2FML A;  2VLA A;  2YU3 A;  4MFD A;  4CUG A;  3QQA A;  2R92 J;  1T33 A;  4LLN A;  1SFK A;  1UJ8 A;  2DFE A;  5E20 A;  4CCN A;  2NVX J;  1B4A A;  1YQA A;  2EA2 A;  2QUF A;  3VEP A;  2DPU A;  1TT0 A;  4PJJ A;  1U9O A;  5DCM B;  3FKI J;  2H6B A;  3CP8 A;  5E8I A;  3O6B B;  2XAF A;  2R7Z J;  1BL0 A;  2QKL B;  2WB1 A;  5C4J J;  5L3F A;  3LAJ A;  4RS8 A;  3HM5 A;  3BWG A;  3NWT A;  2X51 A;  4PGH A;  2FOK A;  3OYN A;  5IYC J;  1FY7 A;  2DPD A;  4CGZ A;  4Y52 J;  1WVR A;  4Q5S F;  2MG4 A;  3C18 A;  1WGX A;  2WC2 A;  1ZK8 A;  3O8H A;  4BXU A;  1ETY A;  4FAS D;  4WXD A;  3LAP A;  3JRB A;  3RQI A;  4AIJ A;  5BPD A;  1R71 A;  2ZXJ A;  2E34 A;  4GYI A;  2R7V A;  2KIQ A;  4MO7 A;  3A01 A;  1FEX A;  2DFF A;  3I71 A;  1S29 A;  1LVA A;  1MBK A;  2E35 A;  1J5Y A;  5FKK A;  2O3F A;  4YEJ A;  5LEK A;  3S2H J;  1TWH J;  1WPK A;  2J5P A;  2GAU A;  1PUF A;  3LA7 A;  2DT6 A;  1V5E A;  3C1D A;  2CV0 A;  3JSO A;  4ZYH A;  2ELJ A;  2EIJ H;  2NVQ J;  2ICW G;  1JKR C;  2VKD A;  1XX5 A;  4OAY A;  1QPM A;  4E7J A;  3K4B A;  1TW3 A;  5E17 F;  1FIA A;  2P6T A;  2GOX B;  2Y0S N;  2DTR A;  4RB0 A;  5D5U B;  3WU1 B;  2Y30 A;  2DOF A;  3TDZ C;  3ZGK A;  3CDI A;  2EIN H;  4ABZ A;  3BC8 A;  2P5V A;  1GUU A;  2A68 F;  2Y48 A;  4N0B A;  1G4D A;  1HLV A;  3ZMZ A;  2Y2Z A;  5GPA A;  3ABT A;  3B6A A;  2GLO A;  4Y15 A;  3BG3 A;  1K83 J;  2K27 A;  3OSF A;  3AL0 B;  1X3Z B;  4XL9 A;  3LSH A;  1DP7 P;  3GTO J;  1L0O C;  1YLF A;  3HSE A;  4M3F A;  5EZG A;  3ZQI A;  4YRV A;  2Z5U A;  3X2Q H;  3CMY A;  2VAS A;  4OMZ A;  4WXH A;  2R5Z B;  4JBA A;  2KDO A;  4C2M J;  3H0D A;  4LGW A;  1HW5 A;  2CQQ A;  2LKX A;  4M9S A;  3BTJ A;  5FRN A;  5C3E J;  4OAZ A;  1RKW A;  1MDM B;  3GEZ A;  1RI7 A;  3A02 A;  3S3M A;  3IH2 A;  5GAD J;  3S16 J;  1RPW A;  4JQF A;  4HRI A;  1MMS A;  2Y0S A;  4XRS G;  1MW7 A;  1IRG A;  2ZNZ A;  4BY7 J;  4AM3 A;  1WJE A;  2NVT J;  2L2O A;  3MAJ A;  3SZG A;  1Z7U A;  3KYL A;  4HW0 A;  4R79 A;  5AIP A;  1WJA A;  2KRH A;  4U0V A;  4C2T A;  2CS3 A;  4UVB A;  2HKO A;  2XRO A;  3BZK A;  1R9T J;  1ZGA A;  3HIF A;  3QU3 A;  1P4A A;  1OJL A;  1TZL A;  4G6T B;  2X0L A;  4ZC3 A;  4DYR A;  1OLT A;  3WTS C;  1YS7 A;  3F22 A;  3GTP J;  2D1V A;  3HSF A;  4HV6 A;  3P9K A;  3S8P A;  1K78 B;  5AON A;  4BDZ A;  2CV2 A;  2IEK A;  3KPH A;  1ORK A;  3P9I A;  3HOT A;  2MFZ A;  2XHK A;  4CA0 A;  1IXC A;  4I09 A;  2YSR A;  4P55 A;  2JQ7 A;  3U9G A;  3GO5 A;  1QO0 D;  4DIQ A;  2JPC A;  2EV6 A;  2W7N A;  1BR4 A;  1X4P A;  1ZRC A;  4E7K A;  2QQA A;  5EF6 A;  1PUE E;  1X3U A;  3KEO A;  3KX2 A;  1QU3 A;  3ZMS A;  3ZQG A;  1FOX A;  1D3Y A;  3SXY A;  3V7S A;  2A69 F;  3OOU A;  4BGD A;  4HNT A;  3D5L A;  3DPU A;  4LG0 B;  3OYI A;  1QA6 A;  2ELH A;  1QPI A;  4Y17 A;  4O6J A;  3L2R A;  2JRM A;  1EKE A;  1IUY A;  3M8F A;  3RJP A;  4BBR J;  3ERM A;  3TED A;  3K4M A;  1LKX A;  3WGI A;  3L1P A;  1FP2 A;  2EZI A;  3P9C A;  4MGR A;  1BI1 A;  2DDB A;  4CZZ A;  4ESB A;  1F43 A;  3BTL A;  1X1A A;  1NG6 A;  3HG9 A;  4A3K J;  4IHW A;  1Z3X A;  4HLX A;  1OIS A;  2MBF A;  2Z33 A;  2XF5 A;  1R36 A;  1I3Q J;  2K3P A;  3CJN A;  3R60 A;  5BNG A;  2LNB A;  2JA8 J;  2CQX A;  3TO7 A;  3FXJ A;  3FX3 A;  5HDN A;  2Z2S B;  2VOP A;  2VJ4 A;  4X1E A;  1KON A;  3H5A A;  4G8X A;  1U8R A;  3Q5F A;  1YO5 C;  2QF7 A;  1MGT A;  1HKT A;  3BG5 A;  3OWT A;  3TL4 X;  4EVI A;  2DA6 A;  2L54 A;  4Q47 A;  1ZAO A;  3BJA A;  1NH3 A;  2CMP A;  2JMW A;  4DBR A;  3D5S C;  4YIF A;  2E2J J;  3DU6 A;  1FLI A;  4HX4 A;  3PFI A;  4GXO A;  3RKY A;  3D0S A;  4HZF A;  4EV0 A;  3IV5 A;  5EEA A;  3QRF F;  3KCC A;  1HDP A;  2BV6 A;  5DD8 A;  4E6K G;  4KFC A;  4DOZ A;  1IZ1 A;  2X1C A;  4QWQ A;  2FRH A;  2R5Y A;  2M4G A;  3EYY A;  4AC0 A;  4D7N A;  2XAQ A;  2V9P A;  1EV7 A;  5GAH J;  1YI2 I;  2EPF A;  3DKW A;  2I8D A;  3I53 A;  1K61 A;  3RKQ A;  3K2Z A;  4XK4 A;  5EGO A;  2D2W A;  1FC3 A;  1MH4 A;  1QZE A;  2L01 A;  1SEU A;  3EUH C;  4CYC B;  1HC8 A;  3DXJ F;  1W0T A;  4BE2 A;  5EYR A;  2DA1 A;  3IUO A;  4KUM A;  2K7L A;  5A2Q K;  4P9U A;  3H9Q A;  3NEU A;  4IHV A;  2YX7 A;  2G7U A;  4MTD A;  1WWX A;  2UXN A;  4LK0 F;  1YX3 A;  4KIF A;  4ENK A;  2W85 A;  4NB5 A;  3JRA A;  1RIO H;  4NNJ A;  3K69 A;  4AVP A;  4FQG A;  3MZY A;  2HR3 A;  1O7L A;  4CCK A;  5ICG A;  4NBQ A;  2ZJ2 A;  4EQQ A;  5BQT A;  3J80 Z;  2VBZ A;  3FWE A;  3HOW J;  3F6V A;  2KPM A;  1HKQ A;  3F8F A;  4EM0 B;  2FD5 A;  1VND A;  3LST A;  2YS9 A;  1JT0 A;  1DDN A;  3ZQH A;  4EAT A;  1P92 A;  5F6F A;  3R0J A;  4OIO F;  4II3 A;  2K9N A;  5JVT A;  1YIT I;  2NAZ A;  1IXR C;  3MZ8 A;  1J09 A;  2PEX A;  2F5C A;  3JSP A;  3F8C A;  5E3N A;  5J1R A;  3FZV A;  2QM3 A;  1S5L C;  2BVL A;  2VQG A;  3K9T A;  2DK8 A;  3KYD B;  2CSO A;  3E1S A;  1IXS B;  1U6G A;  3GCM A;  1YG2 A;  1X58 A;  2DMN A;  3HHH A;  4B09 A;  4A3M J;  1M1E B;  4DQ2 A;  1APL C;  2IW5 A;  3LQQ A;  3A01 B;  2MW8 A;  2P0W A;  3JRH A;  2FOW A;  2E1M C;  3KLN A;  2XVC A;  4HYE A;  3JRD A;  3CUQ A;  2QQB A;  4J01 A;  2D45 A;  1LE8 B;  1JKO C;  2STW A;  1XGS A;  1LFP A;  3BRO A;  1JUM A;  3WTT C;  2LDU A;  3QWL A;  2ID6 A;  2LTP A;  4HV5 A;  1BJA A;  2WAF A;  3DKX A;  1I1G A;  2DW4 A;  5F04 A;  5LRR A;  2LOO A;  3CDH A;  3J7A O;  4F91 B;  3VYT B;  3FXU A;  4A0Z A;  4AWX B;  1FIP A;  2A6T A;  2ESN A;  4LD5 A;  3COA C;  3DTK A;  5EG0 A;  1WH7 A;  2NOJ B;  2F6C A;  3ZQL A;  1ETK A;  2QCO A;  1R6R A;  2IAI A;  1PP8 F;  2V1U A;  3F9K A;  3HDD A;  1UFM A;  2OCE A;  5B1A H;  3IC7 A;  1B1B A;  4R1H A;  4E70 A;  1U2W A;  2CQ7 A;  5B3S H;  3CCJ I;  3BR6 A;  3F8B A;  2M9H A;  3TO9 A;  4B3A A;  4KMF A;  3G71 I;  3M07 A;  1QHG A;  1Y1V J;  1BC7 C;  1VQL I;  1EF4 A;  5LHI A;  5H6Q A;  3GME A;  5FLX K;  5CVV A;  3R0A A;  4E7Z A;  1S6L A;  4XIC A;  1MMD A;  3FMR A;  3ZQC A;  1DPU A;  1JKQ C;  3OYL A;  3KP2 A;  3FIW A;  3GBG A;  3QOE A;  3G1O A;  3MVP A;  4HSR A;  3KZZ A;  1PVE A;  5L3G A;  4LB5 A;  1QGP A;  2QGU A;  4F3Q A;  2CRG A;  4X0G A;  4ON0 A;  1UG0 A;  3LWF A;  3BY6 A;  2MLG A;  4PJN A;  3OR2 C;  5D6E A;  4C3H J;  5HS8 A;  2CQK A;  4DZJ A;  4RGR A;  3ECO A;  2GM4 A;  3Q3S A;  5AIQ A;  4IHY A;  2AQF A;  2FE3 A;  3QOP A;  4ZZL A;  3A0H C;  4XLP F;  1WI9 A;  3L2C A;  3P5J A;  4AU7 A;  2DLL A;  1GV2 A;  4FX4 A;  2RNG A;  2EWN A;  4RB1 A;  1D1C A;  2PLY A;  4ZDL A;  1QVU A;  1KA8 A;  2LY2 A;  1D8K A;  3NAR A;  4M6Y A;  2X48 A;  2ZJP F;  1I6H J;  5FKO A;  2Z99 A;  1W4M A;  5K1Y A;  3LSJ A;  2X6W A;  1Y0N A;  2HTS A;  4IZZ A;  3M9A A;  2R4G A;  4LB6 B;  1FBS A;  4CCM A;  3HKZ N;  5D5V B;  1SVL A;  3FK6 A;  3R4K A;  5IP7 J;  5K5R A;  1BW6 A;  3MZH A;  1R58 A;  1Y8Q B;  4ZDP A;  4CO8 A;  2VQH A;  3A0B C;  2K40 A;  1V3F A;  3FM5 A;  4BL0 B;  2PBI A;  1VI0 A;  2PJP A;  4XM3 A;  4YFN F;  5LGU A;  4JOM A;  4MLO A;  2IPQ X;  4BKX A;  3U21 A;  3PNY A;  2VON A;  4L5E A;  5LHG A;  5K7F A;  1AHD P;  4I02 A;  1X1C A;  4MEY F;  3M7G A;  5CVI A;  3UR3 C;  3V42 A;  4EM2 A;  4FE7 A;  3LSI A;  1YW8 A;  2E1N A;  4XMY A;  4B48 A;  4I98 B;  2CUZ A;  4BUP A;  5ILS A;  1SAX A;  4HF0 A;  1BJZ A;  1GT0 C;  3HOU J;  1TW2 A;  1A6I A;  2VPR A;  1W7P B;  2BHZ A;  4KMU X;  3A2K A;  3A4C A;  5DV5 A;  5ED4 A;  1NK3 P;  1D1B A;  1XCV A;  4BJT A;  2JN6 A;  3ULQ B;  2R0Q C;  4B47 A;  2IS4 A;  5HNF A;  2B9S A;  5ICE A;  3KZY A;  4UXN A;  4LFU A;  5IOZ A;  3HKZ A;  1PDN C;  2FUG 2;  4I7H A;  1W1W E;  3K70 C;  2DN0 A;  4HDV A;  4M6V A;  3SEZ A;  3G1L A;  1MND A;  1XN7 A;  4A0X A;  2XB0 X;  3HRS A;  3HL2 A;  2OF7 A;  3FXO A;  4Y13 A;  5CYV A;  2WTE A;  4BU2 A;  3TOA A;  4EJW A;  3ZP5 A;  1MMG A;  1B6A A;  1MBJ A;  3L7W A;  4HNU A;  1VQ5 I;  2Q2E A;  4UUS B;  2DK5 A;  2DO7 A;  1PP7 U;  2ZNY A;  3JTG A;  1MMA A;  3I3L A;  2M5W A;  4LOC A;  2VPL A;  2NS7 A;  1ZRF A;  3QOD A;  2ACJ A;  3CCY A;  1LDJ A;  4UV8 A;  1FZP B;  1T56 A;  1KYZ A;  3PL8 A;  3CCQ I;  1DU0 A;  4A6D A;  4ZYD A;  3BCB A;  3L2W A;  2VT2 A;  2A5W A;  1TP4 A;  3ZMU A;  3RKX A;  2Y69 H;  3FXR A;  1R4N B;  1S72 I;  3CCL I;  2ZC2 A;  1WCM J;  4I6Z A;  5LRS A;  1VQK I;  3D5R C;  2V6C A;  3SFI A;  4DYQ A;  4IRI A;  2HOA A;  1VQ8 I;  2DYS H;  2W57 A;  2O61 A;  3TOB A;  1TNS A;  4AID A;  3L09 A;  5IP6 A;  1OQY A;  1DQU A;  5LEJ A;  4LJZ F;  2FQ3 A;  2DBB A;  1R23 A;  4J00 A;  4IF4 A;  3TW7 A;  2R7O A;  4N9H A;  2HS5 A;  5LGT A;  4YIR X;  1T38 A;  3OSG A;  3W2A A;  2W84 A;  2KHM A;  3RTR A;  2CUF A;  2IGK A;  1T39 A;  4IKF A;  3F21 A;  2HXI A;  2RV8 A;  4BYY A;  3VOD A;  4CCO A;  2OA4 A;  1KU3 A;  4XN0 A;  2M0C A;  4IRG A;  2DU9 A; 
#chains in the Genus database with same CATH homology
 1Q1H A;  1B9M A;  4M73 A;  4EJO A;  3I59 A;  2BEO A;  2GQQ A;  3MFK A;  2A5Y B;  1YW9 A;  2KIM A;  1OKR A;  5J8C A;  3WOD F;  3WG9 A;  1G3Y A;  5F1R A;  1RUN A;  1WSU A;  3GUD A;  3ABU A;  3LA3 A;  1LDK B;  2WV0 A;  1O3Q A;  1SD5 A;  2W25 A;  5D8L B;  1IN8 A;  1TTY A;  2F5F A;  3QP6 A;  1MJB A;  3EET A;  4PDK A;  1XSD A;  2Y75 A;  3V8K A;  2XGX A;  2K86 A;  1YS6 A;  2FNA A;  1T2K A;  3CUQ C;  2A6E F;  1HQC A;  1TQI A;  2Z3Y A;  4HX7 A;  5TRD A;  3OV8 A;  3IL2 A;  1QQI A;  1GXQ A;  2L02 A;  5F64 A;  2O03 A;  2M8E A;  4M9Z A;  1HXD A;  2D1H A;  3FM3 A;  2DQR A;  2P5K A;  4U88 A;  4Z2Y A;  3E6C C;  4G7Z F;  3DFG A;  5D8K B;  1ZN2 A;  1LJ9 A;  1J75 A;  2V9V A;  3V8L A;  2V1D A;  4UV9 A;  1OYI A;  3WE2 A;  5CVJ A;  1FX7 A;  2GWR A;  3HTU A;  1XSV A;  4GGG A;  3W6J B;  3Q9S A;  3ZPL A;  2OZ6 A;  4EGY A;  2VT3 A;  3GZ6 A;  5CVU A;  3E5Q A;  4YG2 F;  5EEH A;  3PQK A;  2M87 A;  4WK8 F;  2G7H A;  3VFZ A;  1G3S A;  4O5V A;  2NS0 A;  4A12 A;  2OQR A;  2QQ9 A;  1Z9C A;  2KJB A;  4WXC A;  2WWY A;  1QBJ A;  3J81 Z;  2EV0 A;  4EJV A;  4GYG A;  1RZ4 A;  3IKV A;  5HS9 A;  1R5H A;  2HQN A;  5DDG A;  1IN5 A;  3IWF A;  5HLG A;  2RN7 A;  5HLI A;  5DD4 A;  2MLK A;  4UVA A;  1KU7 A;  5L3D A;  1FYM A;  2GXG A;  3GWZ A;  3R61 A;  4L9V A;  3TGN A;  3EYI A;  3JAM K;  2DU9 A;  4L9N A;  2CG4 A;  1U78 A;  2P5L C;  3V7C A;  5FO5 A;  2QBY B;  1ZLK A;  3T8R A;  4D0P A;  1S8N A;  2JSC A;  1QZZ A;  1SFE A;  5IT9 Z;  3NQO A;  3WGG A;  3I4P A;  2IA1 A;  2ZO4 A;  3H3U A;  4RAZ A;  2GA1 A;  3ZMD A;  2JZY A;  3FMS A;  5L3E A;  5DEQ A;  2PG4 A;  2ZME A;  1ZAR A;  4P9F A;  1CF7 A;  3RI4 A;  2XIG A;  1R5G A;  3KEQ A;  1MZB A;  1FBQ A;  4RAY A;  3K1N A;  3MQ0 A;  5LBQ A;  5FB2 A;  2P6S A;  1LQ1 A;  3CLO A;  1BN5 A;  4EMS A;  1YIO A;  2XAS A;  2J5O A;  3F3X A;  3V4G A;  2YR2 A;  2RKH A;  1Z1D A;  1YTY A;  2VC0 A;  5HOO A;  2ZKZ A;  5E8G A;  3M1E A;  2P7V B;  3O3K A;  1IF1 A;  3TDU C;  2HOE A;  1FYL A;  4G9Y A;  4ESF A;  3EQL F;  3DEU A;  1ZG3 A;  5KK1 A;  2JT1 A;  1P2F A;  3DPL C;  4UVC A;  3KP6 A;  5E1X A;  2MH9 A;  1O3T A;  3H3Z A;  4S04 A;  1U3E M;  1BIB A;  4XLN F;  2RVC A;  2YPR A;  1F1Z A;  3RDI A;  2ETH A;  1XDU A;  4A6E A;  4HOB A;  3DF8 A;  2E7X A;  3ISP A;  4KNY A;  2M30 A;  4ENJ A;  2M1B A;  2P7C B;  1TQM A;  5ILU A;  3FXQ A;  4MHG A;  4CIC A;  3KP4 A;  2MD5 A;  4BHB A;  3ZMV A;  1I27 A;  1NHA A;  3QPT A;  2L4A A;  3KFW X;  1FPQ A;  4U7B A;  4CDG A;  1KGS A;  3MEX A;  5D5X B;  3JTH A;  2PQ8 A;  4ZZD A;  2KIU A;  2LSO A;  5E1Z B;  2STT A;  2HYG D;  2V1X A;  3F8M A;  3F72 A;  4XBF A;  3IRQ A;  1UHW A;  4I0A A;  5CLS A;  2HYF A;  4KA4 A;  3BJO A;  5BMZ A;  2Q0O A;  1L3L A;  5ICF A;  5L3C A;  1RNL A;  1D8J A;  1IRF A;  4HBL A;  1FWZ A;  4L0Z B;  4L5I A;  5K5Q A;  2A61 A;  2FA5 A;  2NRA C;  5FGM A;  4A5N A;  4NQW A;  1U5T A;  4HX8 A;  2W24 A;  1J0R A;  4OIR F;  1R1V A;  3IWZ A;  3K0L A;  4HDU A;  3H92 A;  4LLG F;  2MA3 A;  4I0B A;  2IT0 A;  1UB9 A;  1W7P D;  2K4J A;  1IN7 A;  3V7R A;  1O3S A;  2NYX A;  2FXA A;  5K5O A;  5FD5 A;  3JW4 A;  5DCM A;  2QVO A;  3S2W A;  2XKP A;  1MD0 A;  2LF7 A;  2VBW A;  2ESH A;  4ZH4 F;  4OIP F;  3F23 A;  3KP3 A;  1SMT A;  1T6S A;  1WRJ A;  3WTW C;  2GXB A;  1OMI A;  1GVJ A;  4TV7 A;  2XAG A;  2KJC A;  4ZYE A;  2EK5 A;  5ILV A;  3IKT A;  1XB4 A;  1HW2 A;  2QLZ A;  1BI0 A;  2GZW A;  4G7H F;  3PQJ A;  1DPR A;  3BPV A;  3ML6 A;  2RC4 A;  2IA0 A;  4HLY A;  2HTJ A;  1Z05 A;  1SD4 A;  2F2E A;  1FYK A;  1REP C;  2OD5 A;  1Y0U A;  4I2O A;  3WGH A;  1JE8 A;  5IT3 A;  3QPH A;  2OU2 A;  3K1P A;  2HZT A;  1DUX C;  1ZG5 A;  1TNT A;  1Z6R A;  1OR7 A;  4N9I A;  1EH6 A;  2GIV A;  2PFB A;  1YW7 A;  1MDM A;  1J9I A;  2OAZ A;  3HOS A;  3ZQ7 A;  4KDP A;  2EFP A;  5DCF A;  1KQ8 A;  3MCZ A;  3WU0 A;  1IN4 A;  1WQ2 A;  2FBH A;  5J6X A;  2CYY A;  3L00 A;  2DFI A;  5J8F A;  1K78 A;  5FLX Z;  4ENM A;  3WTV C;  3GF2 A;  1J7K A;  1G3W A;  3WTU C;  2FBK A;  2E1C A;  3TO6 A;  2FBI A;  2XV4 S;  4OIQ F;  4IXA A;  3M8E A;  5LLQ A;  1EH7 A;  1ON2 A;  3GFL A;  1R22 A;  4L9T A;  1XDS A;  4HAM A;  4AIH A;  5HS7 A;  4XSX F;  5DYM A;  4O3M A;  2H94 A;  3QAH A;  3GX4 X;  3B02 A;  4IHS A;  4LG0 A;  4OOI A;  2FF4 A;  3U2R A;  4RGS A;  4HF1 A;  2L4M A;  1J59 A;  2BBY A;  2COM A;  2KRF A;  2ZBK A;  3ROU A;  3GZ5 A;  4BNC A;  2UXX A;  3BJ6 A;  4A2U A;  1HKS A;  1CGP A;  1P4W A;  1O7F A;  2OBP A;  2DT5 A;  4MTE A;  1F5T A;  4HF2 A;  4RB2 C;  1XGM A;  3ZMT A;  2EA4 A;  2F5E A;  4G6D A;  5EEG A;  4MNU A;  2NNY A;  3CO6 C;  1OPC A;  2H6C A;  5JHU A;  3HRU A;  1VTN C;  4P5O A;  5JI6 A;  3LQR A;  1BOA A;  4HQM A;  2C6Y A;  5FFZ A;  5D4S A;  5DUK A;  5BPI A;  1BC8 C;  2XKO A;  2EV5 A;  2GA2 A;  3J81 K;  4YFK F;  3KET A;  2EFQ A;  4I01 A;  1ZGJ A;  3I54 A;  1U5T C;  5TJJ A;  3FMQ A;  2LF8 A;  5ERI A;  2H27 A;  4NHJ A;  3CUQ B;  4EM1 A;  4ENN A;  1O57 A;  2DAO A;  1R00 A;  2PMU A;  3RPQ A;  3F6O A;  4EGZ A;  1O3R A;  4M74 A;  2DI3 A;  3V8J A;  1I1S A;  3G73 A;  1FNN A;  4M6X A;  3I0T A;  2OZU A;  3DP7 A;  1P4X A;  1QNT A;  1OYY A;  3BPX A;  1OYW A;  1R1T A;  3WTX C;  3E3V A;  4WF2 A;  2R7D A;  4BHP A;  5IT9 K;  3DPT A;  3CUO A;  1BI3 A;  2RDP A;  4PZJ A;  4M9X A;  1FSE A;  4BH9 A;  4KN4 X;  1H9G A;  2BYV E;  3L9F A;  2Z9O A;  1A04 A;  4LLL A;  3GVA A;  2E7W A;  2CFX A;  1HSJ A;  1JGS A;  2QEN A;  2R3S A;  4L9J A;  1XMK A;  1Z6T A;  3GW2 A;  1S3J A;  5JFR A;  4IRH A;  2IVM A;  3O2P E;  4BQA A;  2XAH A;  2HWV A;  4M72 A;  2HQR A;  1K6O A;  3FF5 A;  1UST A;  4BHC A;  1TLH B;  3KP5 A;  4KIB A;  3RYP A;  1I6X A;  2IRF G;  1UHM A;  3E6M A;  3WE3 A;  1ULY A;  2AS5 F;  3I64 A;  1K7A A;  1STZ A;  5JR3 A;  1SMY F;  1T0F A;  4Q4Z F;  4KIC A;  3SHF A;  3GFI A;  4U0W A;  1E2X A;  3E6D A;  2ZCW A;  3K1M A;  4RGU A;  4A0Y A;  2EFN A;  1KQ0 A;  2IA2 A;  3ELK A;  2V79 A;  4UHT A;  2A3S A;  2JTV A;  2XUB A;  1JHH A;  2B0L A;  3N97 A;  1I5Z A;  4PCQ A;  4XRF A;  4LMY A;  3E97 A;  3TKY A;  2VE8 A;  3IRR A;  2BGC A;  4G7O F;  3E5U A;  1IW7 F;  4P96 A;  2AXL A;  1XGN A;  5KVR A;  1R1U A;  4H0E A;  1LB2 A;  3T5X A;  2KKO A;  2KIF A;  3T8T A;  2Q8K A;  2VBY A;  5FFX A;  5HLH A;  3J80 K;  1W7P A;  3ZN1 A;  3REO A;  2FNP A;  1HBX G;  1W5T A;  2PI0 A;  3GLX A;  3LA2 A;  2G9W A;  4UNO A;  1JHF A;  2R7F A;  3CO7 C;  1XCB A;  3GFM A;  5H20 A;  3HTS B;  5CVR A;  1IN6 A;  3JAM Z;  2MC3 A;  1C0W A;  2O6G E;  3B73 A;  5HVQ C;  3I59 B;  2RGV A;  1TQP A;  3MWM A;  3F8N A;  2FEZ A;  4S05 A;  2MH2 A;  3EDP A;  5LGN A;  3DQV C;  4K2E A;  4AIK A;  1EH8 A;  2EB7 A;  1LEB A;  4MQV A;  2JRT A;  3RPU A;  1ODD A;  1W5S A;  4UUV A;  3GYH X;  3TQN A;  4U7D A;  3SZT A;  2QZ8 A;  1GHC A;  4IPA A;  1KYW A;  4PGG A;  1ONV A;  5L3B A;  4GCV A;  4RGX A;  2VE9 A;  4ASN A;  5BOX A;  1ZLJ A;  3ERE D;  2HFH A;  5E1W A;  2EFO A;  1LNW A;  4CYD A;  2EJR A;  3HRT A;  4HQE A;  3RKW A;  2UWM A;  4MQ9 F;  3W6K B;  2M45 A;  1B9N A;  2VC1 A;  1LEA A;  5ICC A;  2PMH A;  2CWE A;  2ADU A;  2HDC A;  4R8H A;  4L18 B;  4KN7 X;  1BM9 A;  3VOE A;  3GFJ A;  1GXP A;  1ZYR F;  3WTY C;  3GXO A;  1FOK A;  4RB3 C;  4BAY A;  2IP2 A;  2OQG A;  2EFW A;  5D5W B;  4FX0 A;  2ISZ A;  5D6F A;  1UCR A;  1S7O A;  1KU2 A;  3I5U A;  3QU6 A;  1WKM A;  4ETS A;  1K79 A;  2VN2 A;  3ZN0 A;  1H9T A;  4MEX F;  3T1B A;  1MJA A;  4A5M A;  2DQL A;  3SFZ A;  5HDG A;  3HRM A;  2FMY A;  3C7J A;  1V4R A;  4F7Z A;  3KP7 A;  4ZYG A;  2K02 A;  3N4M A;  1QZY A;  3BZ6 A;  5A2Q Z;  1ZHF A;  2XRN A;  6PAX A;  2QYO A;  1XSX A;  4IJA A;  2BE5 F;  3DV8 A;  5LHH A;  1BI2 A;  2O0Y A;  2P8T A;  1KQ9 A;  1IAW A;  2Y0M A;  2FU4 A;  5DUI A;  4DNC A;  4KIG A;  5CJ9 A;  3U1D A;  2VOO A;  1P6R A;  3I58 A;  1G6N A;  4IVN A;  4WCG A;  1ZRD A;  4AD9 A;  3E5X A;  5BS6 A;  1SFX A;  1FT9 A;  1HST A;  1BBY A;  2F5D A;  1SFU A;  4XSZ F;  2CGP A;  2ZFW A;  3HUG A;  3SZP A;  2H09 A;  3LFK A;  2ZME B;  3ECH A;  1CF7 B;  4EJT A;  2LKP A;  3RIR A;  1T98 A;  3P7N A;  5HDK A;  4FT8 A;  4U0Y A;  2HEO A;  3T0Y A;  1FSH A;  4OMY A;  2UZK A;  4EJU A;  3CTA A;  2P4W A;  1G3T A;  1FP1 D;  3WTZ A;  4HA8 A;  1AOY A;  5D4R A;  2QBY A;  4LK1 F;  2VXZ A;  1XMA A;  1RUO A;  3HHG A;  2ISY A;  1HW1 A;  3NRV A;  2X4H A;  1ZG1 A;  1ON1 A;  2L3D A;  4JK1 X;  1TBX A;  2O8X A;  2FSW A;  4WWC A;  4KT5 C;  1Z91 A;  3KLO A;  4OU0 A;  1S7A A;  1E17 A;  1SD6 A;  3E6B A;  1FBU A;  3BDD A;  4B8X A;  1AWC A;  3C3W A;  3BP8 A;  1USS A;  4G94 A;  1D5V A;  4WX9 A;  4OIN F;  3FHZ A;  4Q48 A;  4YII A;  1LDD A;  1ZH5 A;  2K4B A;  5H6R A;  1J2X A;  1KU9 A;  2A07 F;  2CO5 A;  1B59 A;  1R7J A;  2HGC A;  2TDX A;  4GO1 A;  5FD6 A;  2VBX A;  2JPB A;  1JXS A;  1BIA A;  2RQP A;  2YX4 A;  3SQN A;  2PN6 A;  2NNN A;  1F4K A;  1MKM A;  4FHT A;  5E18 F;  4G6Q A;  3RYR A;  1XD7 A;  2QWW A;  3G3Z A;  3HSR A;  2IJL A;  1F9N A;  1YYV A;  4L0Y B;  3AAF A;  2RNJ A;  1XGO A;  4M71 A;  3HYI A;  4L5J A;  3Q9V A;  3KE2 A;  3VB2 A;  3R6S A;  3IHU A;  1YFH A;  4CHU A;  4QLC U;  3QP5 A;  1U5T B;  2A6H F;  3EUH A;  1SD7 A;  3BOQ A;  1ZRE A;  3OOP A;  4IHT A;  1MJ9 A;  2VOD A;  2XAJ A;  4YFX F;  2CW0 F;  2HKX A;  4CXF A;  1H0M A;  2FML A;  2YU3 A;  4LLN A;  5E20 A;  1B4A A;  1YQA A;  2EA2 A;  2QUF A;  3VEP A;  2DPU A;  5DCM B;  2H6B A;  5E8I A;  3O6B B;  2XAF A;  5L3F A;  3LAJ A;  4RS8 A;  3BWG A;  4PGH A;  2FOK A;  1FY7 A;  2DPD A;  4CGZ A;  4Q5S F;  3C18 A;  2WC2 A;  4BXU A;  4WXD A;  3LAP A;  4AIJ A;  5BPD A;  2ZXJ A;  4GYI A;  3I71 A;  1S29 A;  1LVA A;  1J5Y A;  2O3F A;  5LEK A;  2J5P A;  2GAU A;  3LA7 A;  3C1D A;  3JSO A;  4ZYH A;  1QPM A;  1TW3 A;  5E17 F;  5D5U B;  2P6T A;  2DTR A;  4RB0 A;  3WU1 B;  3TDZ C;  2P5V A;  4N0B A;  2A68 F;  2Y48 A;  1G4D A;  3ZMZ A;  3ABT A;  4Y15 A;  2K27 A;  1DP7 P;  1L0O C;  1YLF A;  3HSE A;  2Z5U A;  4OMZ A;  4WXH A;  4JBA A;  4LGW A;  1HW5 A;  4M9S A;  1MDM B;  3GEZ A;  1RI7 A;  4JQF A;  1IRG A;  2ZNZ A;  3MAJ A;  1Z7U A;  4HW0 A;  4R79 A;  5AIP A;  4U0V A;  4UVB A;  2HKO A;  2XRO A;  1ZGA A;  3HIF A;  3QU3 A;  1P4A A;  3WTS C;  3F22 A;  2X0L A;  1YS7 A;  2D1V A;  3HSF A;  4HV6 A;  3P9K A;  1K78 B;  5AON A;  3P9I A;  3HOT A;  2XHK A;  1IXC A;  4I09 A;  2YSR A;  4P55 A;  3U9G A;  3GO5 A;  1QO0 D;  2JPC A;  2EV6 A;  1ZRC A;  2QQA A;  1PUE E;  1X3U A;  3KEO A;  3ZMS A;  1D3Y A;  3SXY A;  3V7S A;  2A69 F;  3D5L A;  4LG0 B;  2ELH A;  4Y17 A;  4O6J A;  1IUY A;  3M8F A;  3RJP A;  3WGI A;  1FP2 A;  3P9C A;  4MGR A;  1BI1 A;  4CZZ A;  4ESB A;  4HLX A;  2MBF A;  2Z33 A;  1R36 A;  3CJN A;  3R60 A;  2LNB A;  3TO7 A;  3FX3 A;  5HDN A;  2VOP A;  4G8X A;  1U8R A;  3Q5F A;  1YO5 C;  1MGT A;  1HKT A;  4EVI A;  2L54 A;  4Q47 A;  1ZAO A;  3BJA A;  4YIF A;  1FLI A;  4HX4 A;  3PFI A;  4GXO A;  3RKY A;  3D0S A;  4HZF A;  4EV0 A;  3QRF F;  3KCC A;  4KFC A;  2BV6 A;  5DD8 A;  1IZ1 A;  4QWQ A;  2FRH A;  3EYY A;  2XAQ A;  1EV7 A;  3DKW A;  3I53 A;  3K2Z A;  2D2W A;  1FC3 A;  2L01 A;  3DXJ F;  4KUM A;  2K7L A;  5A2Q K;  4P9U A;  3NEU A;  2YX7 A;  2G7U A;  4MTD A;  1WWX A;  2UXN A;  4LK0 F;  4KIF A;  4ENK A;  2W85 A;  4NB5 A;  1RIO H;  3K69 A;  4AVP A;  3MZY A;  2HR3 A;  1O7L A;  5ICG A;  4EQQ A;  2ZJ2 A;  5BQT A;  3J80 Z;  2VBZ A;  3FWE A;  3F6V A;  1HKQ A;  3F8F A;  4EM0 B;  3LST A;  1DDN A;  1P92 A;  5F6F A;  3R0J A;  4OIO F;  5JVT A;  2NAZ A;  1IXR C;  2PEX A;  2F5C A;  3JSP A;  3F8C A;  3FZV A;  2QM3 A;  3K9T A;  2DK8 A;  2CSO A;  4B09 A;  1IXS B;  1U6G A;  1YG2 A;  3HHH A;  4DQ2 A;  2IW5 A;  3LQQ A;  4HYE A;  3KLN A;  2D45 A;  2XVC A;  3CUQ A;  2QQB A;  2STW A;  1XGS A;  3BRO A;  3WTT C;  2LDU A;  4HV5 A;  1BJA A;  1I1G A;  2DW4 A;  5LRR A;  3CDH A;  3J7A O;  3FXU A;  4A0Z A;  4AWX B;  2ESN A;  4LD5 A;  3COA C;  1PP8 F;  2V1U A;  1UFM A;  3IC7 A;  1B1B A;  4R1H A;  4E70 A;  1U2W A;  3F8B A;  3TO9 A;  4KMF A;  4KYW A;  1BC7 C;  5LHI A;  5H6Q A;  5FLX K;  5CVV A;  3R0A A;  1S6L A;  1DPU A;  3FMR A;  3KP2 A;  3KZZ A;  5L3G A;  4LB5 A;  1QGP A;  4ON0 A;  3LWF A;  3BY6 A;  2MLG A;  5HS8 A;  5D6E A;  2CQK A;  4RGR A;  3ECO A;  5AIQ A;  2FE3 A;  3QOP A;  4ZZL A;  4XLP F;  1WI9 A;  3L2C A;  2DLL A;  4FX4 A;  2EWN A;  4RB1 A;  2PLY A;  1KA8 A;  1D8K A;  4M6Y A;  2Z99 A;  1W4M A;  5K1Y A;  2HTS A;  3M9A A;  4LB6 B;  1FBS A;  5D5V B;  3R4K A;  5K5R A;  3MZH A;  1R58 A;  4CO8 A;  3FM5 A;  1V3F A;  2PBI A;  2PJP A;  4YFN F;  5LGU A;  2IPQ X;  2VON A;  5LHG A;  4I02 A;  4MEY F;  3M7G A;  5CVI A;  4EM2 A;  1YW8 A;  2E1N A;  4I98 B;  5ILS A;  1SAX A;  4HF0 A;  1TW2 A;  1W7P B;  4KMU X;  5DV5 A;  5ED4 A;  1XCV A;  3ULQ B;  5ICE A;  3KZY A;  4UXN A;  4LFU A;  1PDN C;  4I7H A;  4HDV A;  1XN7 A;  4A0X A;  3HRS A;  4Y13 A;  5CYV A;  2WTE A;  4EJW A;  3ZP5 A;  3TOA A;  1B6A A;  3L7W A;  2Q2E A;  2DK5 A;  2DO7 A;  1PP7 U;  2ZNY A;  3JTG A;  2M5W A;  1ZRF A;  2ACJ A;  1LDJ A;  4UV8 A;  1FZP B;  1KYZ A;  4A6D A;  4ZYD A;  2VT2 A;  3ZMU A;  3RKX A;  3FXR A;  5LRS A;  2V6C A;  4IRI A;  2W57 A;  2O61 A;  3TOB A;  1TNS A;  3L09 A;  5LEJ A;  4LJZ F;  2FQ3 A;  2DBB A;  1R23 A;  4IF4 A;  4N9H A;  2HS5 A;  5LGT A;  1T38 A;  2W84 A;  3RTR A;  1T39 A;  3F21 A;  2RV8 A;  4BYY A;  3VOD A;  2OA4 A;  1KU3 A;  4IRG A;  4ESJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...