2FSWA

Crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
b'RKISDEECPVRKSMQIFAGKWTLLIIFQINRRIIRYGELKRAIPGISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFGMENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG_0823 protein
publication title Transcriptional Regualator, MarR family from Porphyromonas gingivalis W83
rcsb
source organism Porphyromonas gingivalis
molecule tags Transcription
total genus 26
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fswA00
5BMZA 1I5ZA 2IA0A 3BY6A 1R00A 3EDPA 1FBUA 1FLIA 2EJRA 2YR2A 1F1ZA 4HF2A 3SHFA 3BOQA 1Q1HA 2QBYA 2CWEA 1XD7A 2WC2A 3ECOA 3T5XA 5ED4A 3E3VA 2VXZA 5HS7A 4P9FA 4HOBA 1YTYA 2P7CB 4M6XA 2M30A 1Z1DA 5H20A 1FYMA 3IWFA 4MQVA 1BI3A 1U5TA 5FO5A 2C6YA 4YG2F 3I4PA 5HOOA 3ZMVA 2GAUA 3RKWA 2X0LA 3RPQA 3GLXA 3LA7A 1MJAA 1L0OC 4M9SA 5FFZA 3IKTA 2A69F 3FMSA 1B6AA 2XAFA 2XUBA 4WXCA 2NS0A 1U3EM 1J59A 2B0LA 1DP7P 4OIQF 2UXXA 3ZPLA 2Y0MA 3REOA 3KEQA 4HF1A 4AIJA 3RIRA 2DI3A 3BPXA 3JSPA 3GFJA 3RYRA 5HS8A 2O0YA 2R3SA 3VFZA 3MZHA 4BQAA 5DCFA 2BE5F 2XROA 2FMYA 5FLXK 2VODA 5BS6A 4M73A 5LRRA 3GW2A 2NNNA 3LFKA 2K86A 1W5TA 4UVCA 2YX4A 3E6MA 4G8XA 3B02A 1R23A 1BJAA 3K1MA 2A5YB 1SMYF 3T1BA 2MH9A 2QQAA 2CO5A 3KP6A 4CZZA 4IJAA 2VE8A 2XKOA 3WGGA 1ZRCA 3HUGA 4EJWA 3CO6C 6PAXA 5K5RA 3WE2A 3RYPA 1ZARA 2HR3A 3H3ZA 1KQ8A 3ZMDA 3AAFA 2W24A 5ICCA 2ZCWA 4MNUA 2K02A 3T8TA 1RNLA 1P4WA 4ZZLA 4EJOA 2M5WA 3H92A 4HF0A 3F21A 4ZH4F 4QLCU 4ESFA 4A2UA 2PI0A 1R5GA 2A6EF 2OD5A 2L54A 1XGSA 1R22A 4WX9A 5D5VB 2BBYA 1G3SA 3ZMSA 1D8KA 2VBYA 4U7BA 4GXOA 2P6TA 1QNTA 3ZN0A 4KIFA 1W7PD 5DV5A 1O3TA 4S05A 3HRUA 1SFEA 1RI7A 2TDXA 3T0YA 2Z9OA 2DLLA 1A04A 4EM0B 2VT2A 3P9IA 1ZGAA 2A68F 4WWCA 3F72A 5TRDA 3PFIA 1X3UA 3EETA 3MQ0A 3S2WA 3F8FA 3VB2A 2FRHA 4PDKA 1BN5A 2IVMA 2IW5A 4WXDA 5HLHA 1OR7A 4HW0A 4M72A 5H6RA 3RDIA 1ZHFA 3DFGA 1S7OA 1K7AA 3HSFA 3RKYA 1QZZA 3F8NA 3TOBA 1P4XA 5FLXZ 1U78A 1B9MA 3F6OA 1Z6TA 2FA5A 2JPBA 3K69A 3NEUA 3JTGA 3OOPA 4AWXB 2CSOA 4UXNA 4OIPF 3RI4A 5BQTA 4RGSA 2IA2A 3WODF 3HRSA 2O3FA 2AXLA 2R7FA 1KYWA 2H6CA 5F64A 5D6FA 1FZPB 4YFNF 3KFWX 5DUIA 3TGNA 4PCQA 1O7FA 2MC3A 3J80K 4I0BA 2PFBA 3KP5A 2EV6A 2XAHA 3R4KA 5F6FA 3WTXC 4JK1X 4ZYEA 4HLYA 4KN4X 1FBQA 4ENJA 1G6NA 1XGNA 1YLFA 4LFUA 1V3FA 4A0XA 1ON1A 1D3YA 4S04A 3R61A 1W7PB 1AWCA 2ACJA 1RIOH 2JTVA 2MLKA 4GYGA 4HQMA 2Z33A 1DUXC 4Z2YA 2HTSA 3FX3A 4I98B 2OU2A 2P7VB 4OU0A 3N4MA 2EV5A 1B4AA 3QAHA 4U0WA 2JPCA 1T98A 3KP7A 1GVJA 3TO7A 4LG0B 4HQEA 3HYIA 5ILVA 2EV0A 3VEPA 2A07F 2O61A 1LB2A 4LLLA 2IP2A 2P5VA 2EFWA 3BJ6A 4NQWA 4I01A 1WSUA 1BIAA 2DW4A 1D8JA 1B9NA 4KMFA 5CYVA 1ZH5A 5E8IA 1RUOA 1IN7A 2FQ3A 4P5OA 1HQCA 5HDKA 1GXQA 4EMSA 5CVRA 2Q2EA 3BDDA 3N97A 2M8EA 2AS5F 3V7CA 2Q0OA 4KYWA 4O5VA 2ZNYA 1P4AA 2YU3A 1QGPA 1GXPA 4M74A 1SAXA 2ZMEB 2H09A 1ON2A 3GFMA 3WU1B 4R1HA 4G7OF 5FFXA 1PP8F 4G94A 4L0YB 2FXAA 4PZJA 3Q9SA 1SFXA 3E6CC 4EJUA 1MJ9A 3SQNA 3G73A 5E17F 2QENA 2DK5A 3DF8A 5LHHA 1SD6A 4UUVA 4HV6A 4XSXF 3F6VA 5AIQA 3F8MA 3KLNA 3J80Z 3GWZA 1ZRDA 3CUQB 2O8XA 4RGUA 2IPQX 2Q8KA 2EFOA 4Q5SF 3BJAA 1BM9A 2WTEA 1RZ4A 2RV8A 4CHUA 5BPIA 1XGOA 1IN6A 1CF7B 4MGRA 4L0ZB 4HX7A 2STWA 4UNOA 2CYYA 2E1CA 3LQQA 2FE3A 2UXNA 2DT5A 2HYGD 5AONA 3L7WA 1WI9A 3CJNA 1RUNA 3LAJA 2HOEA 1I1SA 5FGMA 3V8LA 3EUHA 5E1ZB 4YIFA 1DPRA 4I7HA 2VC0A 1O57A 4YFXF 2BGCA 2HEOA 2W57A 4ENMA 2GZWA 1XCBA 1XN7A 4BXUA 2QQBA 1BC8C 1K79A 1F5TA 1MGTA 4ZYHA 3F8BA 5L3DA 3KP4A 5E8GA 3C3WA 4ESBA 3TDUC 4WCGA 1V4RA 1QBJA 1J9IA 3OV8A 3DXJF 1EH7A 4D0PA 2QBYB 4M6YA 2UZKA 2WV0A 4PGHA 1LDKB 1XSXA 1ZLJA 4FX4A 4ZZDA 1S29A 1EV7A 2BEOA 4XSZF 3HIFA 1YFHA 4G9YA 3ROUA 3R6SA 1I1GA 3GZ5A 3KP3A 3I5UA 1OYWA 4OIRF 4AIKA 1MZBA 1HSJA 2HKOA 2YPRA 2EK5A 3GX4X 1U5TB 2HTJA 4L9NA 3ELKA 3KLOA 2ETHA 2P6SA 1IW7F 4IF4A 4BAYA 3WE3A 1U2WA 5A2QK 1BI2A 2K27A 2HKXA 4UV8A 1KQ9A 1YW8A 2D45A 2V1XA 1BI0A 1SMTA 3BZ6A 3V4GA 4YIIA 4BHPA 1E2XA 1XSDA 2PN6A 3M7GA 3I59A 4KIGA 1Z9CA 3BP8A 4G6QA 1UB9A 3D5LA 1EH8A 3F3XA 3GYHX 2WWYA 1Z6RA 2ADUA 4HAMA 1REPC 1ZLKA 2F5CA 1SFUA 4Y13A 2PLYA 2LNBA 3M8EA 2GQQA 2V6CA 3O2PE 5K1YA 1IXSB 4CICA 1YW7A 1BI1A 5D8KB 3RKXA 4M71A 1HKTA 3HTSB 2GIVA 4ENKA 3ZMUA 2LDUA 2VE9A 4ZYGA 3T8RA 1KU3A 3WGHA 1H9TA 4GO1A 1W4MA 2O6GE 4XRFA 3IL2A 3EYYA 1LJ9A 1S6LA 1FY7A 3KP2A 5L3GA 2PG4A 3WTZA 4A5NA 4LK1F 4RB2C 4KUMA 4BHCA 3QRFF 1G3YA 1DPUA 3M8FA 3KE2A 3JW4A 2XAJA 1USTA 1J7KA 1T6SA 3RTRA 4U0VA 1IRGA 1WKMA 1T0FA 3R0AA 2IRFG 1USSA 1IF1A 1ZG1A 5LRSA 3QU3A 3SZPA 2ESHA 4ZYDA 5D5XB 1JHHA 1ZRFA 2O03A 2EWNA 4Q47A 5FD5A 3HOSA 3I71A 3IHUA 2GXBA 4IXAA 2QQ9A 4IRIA 4GYIA 4I09A 5D8LB 3KZYA 4IRHA 2W84A 3EYIA 2OZUA 2YSRA 1G3WA 2QLZA 2ISYA 2L4MA 1QPMA 3K9TA 4EJVA 5A2QZ 4M9XA 4EVIA 3K0LA 4P96A 3KETA 2DBBA 2H6BA 1HW5A 5K5OA 2YX7A 1TQIA 3FF5A 3BROA 4Q4ZF 1BBYA 4G6DA 3MCZA 1ZYRF 3RPUA 2BYVE 3TOAA 4CXFA 3WTUC 1R36A 4KIBA 5DEQA 1TNSA 4HLXA 1ZREA 3FXRA 3I0TA 1FT9A 2JZYA 2V9VA 2ZJ2A 1BIBA 4L5IA 2A6HF 3QOPA 1SD5A 2XASA 5HLIA 4EV0A 3L9FA 4HX4A 1IUYA 1YIOA 2RN7A 2F5EA 3WTSC 4LMYA 3FM5A 3J81K 1UFMA 3WTVC 4GCVA 2FMLA 1J5YA 2MBFA 2HFHA 2EFNA 1R1VA 3DKWA 2STTA 5LHIA 1HW2A 2XIGA 5L3FA 2MA3A 1HKSA 3ZMZA 4UVAA 3MFKA 3HSEA 2PMHA 3QPHA 5HLGA 4HBLA 2JSCA 3TO9A 4B09A 2XAQA 5IT3A 3U9GA 3K2ZA 3P9CA 4IHSA 2J5OA 4KMUX 3DV8A 2HWVA 1G3TA 2DQRA 2GA1A 3LQRA 1P92A 2M45A 3LA3A 4L9TA 1O3RA 1S8NA 4ON0A 3VOEA 2XVCA 3DEUA 3WTYC 4I02A 4G7ZF 1QO0D 2RDPA 4N9IA 3CUQC 2ESNA 1KQ0A 5LGUA 3HHGA 2RKHA 2EFPA 3PQJA 3E6DA 5E18F 3DPTA 2VOPA 4G7HF 4KNYA 4LB6B 3TKYA 4OIOF 2FOKA 1B1BA 3RJPA 2RGVA 4AIHA 3FXUA 1KU9A 1Y0UA 3IRQA 1TQMA 2F5FA 1MDMA 4OMZA 2W85A 1ZN2A 4NB5A 2GA2A 3F8CA 3WTWC 1FP1D 4N9HA 2E7XA 2GXGA 4RAZA 2DQLA 2G7HA 5D6EA 2W25A 5IT9K 1XGMA 4LLNA 3E5QA 3R60A 2RC4A 2Y75A 3L2CA 1FBSA 1XDSA 1WQ2A 4IRGA 4LG0A 3F22A 3ISPA 1XDUA 1UHMA 5D4RA 2FBKA 5J8FA 4MHGA 4R79A 3LSTA 3W6JB 3K1PA 1S3JA 1YS6A 2F2EA 4IVNA 2K7LA 3HRTA 5CVVA 1D5VA 2PQ8A 3J81Z 2VN2A 5E1WA 3ULQB 4TV7A 1OMIA 2FU4A 1S7AA 1ZG5A 3BPVA 3MZYA 4RGRA 3HRMA 2EB7A 3FZVA 4HV5A 4U0YA 3I53A 2DTRA 1T39A 5FD6A 3E97A 1U5TC 5EEGA 1ZG3A 5DCMA 1OYIA 3QU6A 4QWQA 1W5SA 2HS5A 1HW1A 3WG9A 1JE8A 5KVRA 4EGYA 1FNNA 1KYZA 4L5JA 4FX0A 1O3SA 4LJZF 1K78A 2VT3A 4AVPA 1J0RA 3GZ6A 5CJ9A 3L00A 5E1XA 2VBWA 2HZTA 3JAMK 2QWWA 1H0MA 2FF4A 4KDPA 2FSWA 2JRTA 1IXRC 5JHUA 2OZ6A 1U6GA 3FMRA 4I2OA 2NRAC 3ABTA 4P55A 1I27A 5HDGA 5CVIA 4HX8A 4HZFA 2XGXA 4R8HA 3IRRA 3L09A 2E1NA 2XRNA 1R1UA 4UVBA 2H94A 3SZTA 4JQFA 3E5UA 2P5KA 2FBHA 1H9GA 3ERED 1T38A 3D0SA 1STZA 5JVTA 4HYEA 3QP5A 5LLQA 2K4JA 3MEXA 4YFKF 5IT9Z 2DPDA 1HXDA 4ASNA 1FX7A 2DO7A 3E6BA 4LGWA 3G3ZA 1JXSA 3O3KA 1OPCA 3C7JA 2K4BA 3FXQA 2FNPA 1TTYA 2OAZA 2ZXJA 4KICA 2CQKA 4OOIA 4LLGF 4RAYA 3P7NA 3HSRA 4Y15A 4P9UA 3DQVC 1QZYA 1JHFA 3B73A 1FPQA 3TO6A 2DAOA 4WXHA 4A0YA 4B8XA 3WGIA 1LVAA 1B59A 4KFCA 3CUOA 1LDJA 1LNWA 2P5LC 2CFXA 2PEXA 3TDZC 1KU2A 3ML6A 2FBIA 5D5WB 4A6EA 5DDGA 3I59B 1J75A 1MKMA 4LD5A 5CLSA 2FNAA 1OYYA 3NQOA 4KN7X 3BWGA 4BNCA 1TLHB 3K1NA 5F1RA 3C1DA 3VODA 4XBFA 4HDVA 3MAJA 5KK1A 4E70A 3FMQA 4EM2A 3V8KA 3SXYA 1UHWA 3I64A 2EFQA 2VC1A 4K2EA 2LSOA 3JAMZ 2COMA 2HQRA 2L4AA 3TQNA 3QP6A 3GVAA 3HTUA 5AIPA 2IT0A 2D1VA 1LEAA 4LB5A 1ODDA 2KRFA 1XSVA 3CTAA 3E5XA 1SD7A 1J2XA 1TW2A 4M9ZA 1AOYA 2D1HA 1LEBA 4RS8A 1PP7U 2L3DA 1KA8A 1IN8A 2ZKZA 2VBZA 4A5MA 2XHKA 1YYVA 1TNTA 3M1EA 1DDNA 2IJLA 2HQNA 3CDHA 1R5HA 5HS9A 1MJBA 2KIFA 3JSOA 2PJPA 3M9AA 5ICGA 4U88A 2OA4A 3GXOA 3FM3A 4AD9A 1YG2A 2OBPA 1UCRA 3HOTA 3CLOA 1C0WA 2X4HA 1FYKA 2EA2A 2XV4S 3I58A 2R7DA 1CGPA 1GHCA 2XKPA 3GO5A 5CVJA 2BV6A 1FSHA 2L02A 1XMAA 3PQKA 3COAC 4OINF 1TBXA 2QVOA 1MD0A 4KT5C 5ILUA 3IWZA 5L3CA 2KIMA 3DP7A 4KA4A 1U8RA 2E7WA 2HDCA 1XB4A 2HGCA 1BOAA 1ULYA 1FC3A 5EEHA 3I54A 5ICFA 2Z3YA 5DD4A 4CGZA 1IAWA 5LGNA 2NAZA 2LKPA 3IC7A 2LF7A 2UWMA 3GF2A 3KEOA 2DU9A 1ONVA 4IHTA 2PBIA 3J7AO 4L9VA 3V8JA 3U1DA 2RQPA 1IZ1A 3H3UA 5BOXA 4FT8A 2V79A 4A6DA 2CGPA 3ZP5A 3V7RA 2GWRA 2ZNZA 2Z5UA 2EA4A 3ZQ7A 3GUDA 2M1BA 2MLGA 2VBXA 3GFIA 3Q9VA 4H0EA 1XCVA 4BHBA 4HDUA 3W6KB 2P8TA 5JI6A 4EM1A 2CW0F 3ZMTA 4N0BA 3WTTC 1WRJA 3HHHA 5LEJA 4XLNF 4DQ2A 2ELHA 4MQ9F 5FB2A 2DFIA 5JFRA 2QM3A 3FHZA 1ZGJA 5ILSA 1EH6A 1PDNC 4MEXF 4Y17A 5K5QA 2NNYA 1R7JA 4RB0A 2G9WA 3NRVA 4A12A 1FSEA 1IN5A 1QQIA 5JR3A 2Z99A 1Z91A 1BC7C 1KGSA 4MTEA 5LGTA 4LK0F 1MDMB 1R1TA 5BPDA 4OMYA 3ECHA 5H6QA 2DPUA 1O3QA 3DPLC 5TJJA 4L18B 1VTNC 4I0AA 1F9NA 4EGZA 1LQ1A 4GGGA 5E20A 2JT1A 5D4SA 4CYDA 1G4DA 2MD5A 3GFLA 1T2KA 1W7PA 2HYFA 3JTHA 2ISZA 1WWXA 5ICEA 2D2WA 4WF2A 1HKQA 3LWFA 4ETSA 3P9KA 4XLPF 2H27A 1NHAA 3LA2A 3LAPA 3QPTA 1FOKA 5J6XA 4RGXA 2M87A 1K6OA 2RNJA 5HVQC 2ZO4A 1HBXG 3BJOA 3KZZA 5DD8A 5LBQA 1IN4A 2QYOA 4FHTA 4IPAA 5LHGA 4Q48A 4ENNA 1YS7A 5DYMA 1F4KA 4ESJA 5DUKA 2NYXA 2PMUA 1Z05A 2VONA 1XMKA 5HDNA 3CO7C 2J5PA 2V1UA 1JGSA 2QUFA 2A61A 1R58A 1TW3A 1P6RA 1SD4A 2KIUA 2OQRA 3V7SA 4CDGA 2P4WA 5DCMB 1L3LA 2ZFWA 5LEKA 5ERIA 2IA1A 3WU0A 3IKVA 3U2RA 3FWEA 4PGGA 3EQLF 4WK8F 1PUEE 4MEYF 2F5DA 2ZMEA 1KU7A 1Z7UA 1K78B 4F7ZA 1E17A 4UHTA 4BH9A 2MH2A 4UV9A 4DNCA 1I6XA 4BYYA 1YW9A 1ZAOA 4JBAA 3GEZA 3KCCA 4EJTA 3R0JA 4O6JA 2KJCA 3O6BB 1YQAA 1FYLA 4RB1A 5L3EA 2Y48A 4CO8A 4RB3C 1O7LA 2LF8A 4U7DA 4O3MA 3CUQA 1IXCA 1TQPA 3ABUA 3C18A 1OKRA 2QZ8A 1LDDA 2OQGA 1FP2A 2KKOA 2L01A 1IRFA 1CF7A 1HSTA 2V1DA 4L9JA 5J8CA 2A3SA 2DK8A 2XAGA 4HA8A 2VOOA 3MWMA 4NHJA 1YO5C 4EQQA 2RVCA 3Q5FA 3ZN1A 2KJBA 5D5UB 1FWZA 2CG4A 1P2FA 5CVUA 3SFZA 4MTDA 2FEZA 2G7UA 4A0ZA 2ZBKA 3F23A 5L3BA
chains in the Genus database with same CATH superfamily
2CUZA 5BMZA 1I5ZA 4Y52J 4DZJA 2IA0A 3BY6A 1R00A 2OCEA 3S14J 2LMDA 3EDPA 1FBUA 1FLIA 2EJRA 3CF5F 2WB1A 2KQRA 3D5SC 3W2VA 3IV5A 2YR2A 1FIPA 3FKJA 4V2GA 5M5WJ 3LSRA 1F1ZA 3MKLA 4HF2A 3SHFA 4CA0A 3BOQA 5GAEJ 1Q1HA 2QBYA 2CWEA 1WJFA 1XD7A 4FQGA 4F52A 2WC2A 1D1AA 3ECOA 1A31A 1G8XA 3J7ZI 1VFCA 2L7FP 3T5XA 5ED4A 1OCCH 3MKYB 3E3VA 2VXZA 2W1OA 2EQRA 1VQLI 3N05A 5HS7A 5IYCJ 4B1RA 4P9FA 3JRCA 4HOBA 3EUAA 1YTYA 4C9YA 1B72B 2P7CB 4PFOA 4M6XA 2M30A 1SFKA 2DA3A 3CJRB 1Z1DA 5H20A 1FYMA 3IWFA 4E7SA 4MQVA 1BI3A 4RAFA 1U5TA 5FO5A 3VYUB 1ZR4A 2C6YA 3DCFA 4YG2F 5J1RA 5EDNA 3I4PA 5HOOA 3ZMVA 2GAUA 4BEHA 1JUMA 2FOWA 1FOYA 3RKWA 5KHDA 2X0LA 3W3CA 3RPQA 3GLXA 3LA7A 1MJAA 3OYBA 1L0OC 4M9SA 4IHYA 3ZQHA 2BY1A 5FFZA 1YIJI 3HJEA 1WI3A 4RDUA 4BJ5C 3S16J 3IKTA 2LH9A 2XC7A 2VUMJ 2QCOA 1VI0A 2A69F 3FMSA 1B6AA 1OJLA 2XAFA 2XUBA 3DBRB 4WXCA 1ACIA 1MBJA 2NS0A 3H5AA 2KP6A 3A02A 5IP7J 5C4XJ 3D5RC 4C30A 1U3EM 1J59A 2B0LA 2JSPA 1A6IA 1DP7P 4OIQF 5EF6A 1E3HA 2UXXA 4PFPA 2HI3A 3ZPLA 2Y0MA 5DTDA 3REOA 5FRMA 1QHGA 3KEQA 4HF1A 4AIJA 1Z67A 2RREA 3RIRA 2DI3A 3BPXA 4LIUA 1JGGA 3S32A 3KIOA 3JSPA 3GFJA 4KITB 3RYRA 2ID6A 4BACA 2R5YA 4XL9A 5HS8A 1SVMA 1YE9A 2O0YA 2R3SA 3VFZA 3MZHA 2DA6A 4BQAA 3K7AJ 5DCFA 4E7ZA 2BOLA 2BY3A 2BE5F 1X58A 3M4OJ 1FIAA 2XROA 2CJJA 2FMYA 5FLXK 2VODA 1UG2A 5BS6A 4JX6A 4NUBA 4M73A 2VQLA 5LRRA 3GW2A 2NNNA 3LFKA 2K86A 2TRTA 5EJCA 2KIQA 2MC4A 1W5TA 4UVCA 4BU2A 3WHBA 1FMVA 2ZJPF 2YX4A 3E6MA 4G8XA 2E5ZA 4N4OB 3B02A 1R23A 1JKRC 2JJ7A 2HVRA 4BY1J 5C4JJ 4XORA 1BJAA 3K1MA 2A5YB 2H8WA 3GTLJ 2WA0A 2E1MB 1SMYF 3T1BA 2MH9A 2QQAA 1VF9A 2GOXB 1AA7A 3VDXA 2V26A 2CO5A 2IS1A 2L7MP 2BW3B 1D0XA 3KP6A 4CZZA 4IJAA 2CU7A 3JRBA 1Y8RB 2VE8A 2XKOA 4DOZA 1IO2A 3S2HJ 1RPWA 2VL8A 3WGGA 1VQPI 1ZRCA 3HUGA 2AXTC 4EJWA 4D7NA 5HNFA 1TZLA 3CO6C 6PAXA 5K5RA 3AKZA 2OTLI 3WE2A 2GLOA 3RYPA 1ZARA 2HR3A 3H3ZA 1KQ8A 5K7HA 5EYRA 3ZMDA 3AAFA 2N8GA 3ZQCA 3ABKH 2K85A 2JK3A 2W24A 1IV8A 5ICCA 2ZCWA 1TWHJ 2BY2A 2K02A 4MNUA 3T8TA 2H1LA 1RNLA 1P4WA 1S5LC 2CQ7A 3CP2A 4ZZLA 4BDZA 2LY1A 1YRNB 4EJOA 2K3FA 2OV7A 1Z3XA 2M5WA 3H92A 4HF0A 2MD0A 3F21A 3CESA 4ZH4F 2DA2A 4HPQA 1D1BA 4QLCU 4BDYA 4ESFA 4A2UA 2PI0A 1R5GA 2A6EF 2OD5A 4BXFA 2RNGA 2L54A 1XGSA 1R22A 3VYSB 5J47A 4WX9A 5D5VB 2BBYA 1MBHA 1G3SA 3ZMSA 1D8KA 2VBYA 4U7BA 1LVKA 4GXOA 4C3IJ 1GV5A 2P6TA 3RQIA 4V19K 3BC8A 4M6VA 1QNTA 3HL2A 3ZN0A 2E35A 4XLEA 3L1PA 4KIFA 1HF0A 1W7PD 5DV5A 1O3TA 4S05A 3HRUA 2KMUA 4QPQA 1MMDA 1SFEA 2JMWA 2OPTA 1RI7A 2TDXA 1Y39A 4LG3A 1PYVA 3T0YA 5FKKA 2Z9OA 2DLLA 1A04A 2O7OA 4EM0B 1WCMJ 2VT2A 3P9IA 1ZGAA 2A68F 4WWCA 3F72A 5TRDA 4ZDPA 3PFIA 1K6YA 1X3UA 3LSIA 1Y56A 3EETA 3MQ0A 4MIMA 3S2WA 3F8FA 3GZNB 2Y2ZA 3QPLA 3AG4H 2DMPA 2WB1N 3VB2A 4BKXA 2FRHA 4PDKA 1AHDP 3WHCA 2K9SA 1BN5A 2M2EA 2IVMA 2IW5A 3SZGA 3MKWB 2KLOA 3LSJA 4WXDA 5HLHA 1EJ9A 1K83J 1OR7A 4HW0A 4M72A 5H6RA 1V54H 2KDOA 3RDIA 4A3CJ 1ZHFA 3K4NA 3DFGA 1S7OA 2AO9A 3OY9A 4S0HB 3JRDA 1K7AA 3HSFA 5J4VA 4XKBA 3RKYA 1QZZA 3F8NA 3FHNA 3TOBA 1P4XA 3OOUA 5FLXZ 1U78A 1B9MA 3F6OA 4UUSA 2HOTA 1Z6TA 2FA5A 2AHQA 2W48A 2JPBA 3H5RA 3K69A 3NEUA 2TCTA 3JTGA 2JQ7A 1UHSA 4BBRJ 4JOMA 3OOPA 4AWXB 2W4SA 3PSIA 2CSOA 3BR6A 4UXNA 5FJ8J 1NTCA 5EG0B 3I4MJ 2BHZA 1AU7A 1E3OC 2XSDC 4OIPF 3RI4A 3KEYA 5BQTA 4RGSA 2LREA 2IA2A 3K6GA 3WODF 3G6EI 1POGA 3HRSA 2O3FA 3BG6A 2H1KA 2AXLA 2JA6J 2EZKA 4XLCA 1OQYA 2R7FA 3CJTB 1KYWA 2E34A 2H6CA 5F64A 5D6FA 1FZPB 3FXJA 2VPRA 1H89C 2BY0A 4YFNF 3KFWX 5DUIA 3TGNA 3VSLA 4PCQA 4RLQA 1O7FA 2MC3A 3LSGA 4F3QA 3BR1A 3J80K 4I0BA 2IS2A 2PFBA 3KP5A 1QPIA 1MBKA 1RKTA 1ZK8A 2EV6A 2XAHA 4FASD 1J9IA 2FUG2 4CCJA 3R4KA 2V9KA 5F6FA 5GTIC 3WTXC 4JK1X 5TISC 2E36A 4ZYEA 1JUPA 4KN4X 4EATA 1FBQA 4HLYA 2K40A 4ENJA 1V5GA 1G6NA 1XGNA 3ZCOA 4KISA 1YLFA 2X1EA 4LFUA 1V3FA 4A0XA 4F91B 1W1WE 1ON1A 1D3YA 4S04A 4A3GJ 2R5ZB 1OCOH 2XPUA 4I76A 4A3FJ 3R61A 3DU6A 1W7PB 3K70C 1AWCA 4DW6A 2L9NA 3OYNA 1ETXA 4A3MJ 2ACJA 3CZ6A 1RIOH 3FISA 2CQNA 4HRIA 2ECCA 2JTVA 2MLKA 4GYGA 2F5VA 4HQMA 2Z33A 1DUXC 4Z2YA 4DGWB 2HTSA 2Z1DA 3E7LA 3FDYA 1GUUA 2IEKA 2BVMA 3FX3A 4I98B 4PJLA 2Y9YA 1ZELA 2G0EA 2ME6A 5HLTA 2OCCH 1W0UA 4IEJA 2OU2A 2P7VB 2DA1A 1MBEA 3IH2A 4I6ZA 2I10A 2DFFA 2NVYJ 4OU0A 3N4MA 2EV5A 1B4AA 1KONA 2M4KA 3QAHA 4U0WA 3IP4B 3GCMA 2VJ4A 4Z6YA 2JPCA 1T98A 3KP7A 2P0WA 1VQNI 3CCUI 4MFDA 1GVJA 3TO7A 4LG0B 4HQEA 1UG0A 2XPWA 3ZGKA 1Y0NA 2X48A 5JLWA 5CKTA 3HYIA 4D5CA 1VQ7I 1EA3A 5ILVA 4XKWA 4PJJA 2EV0A 3VEPA 2A07F 2O61A 2X9DA 1SAUA 1LB2A 4M3BA 2IP2A 3OIOA 4LLLA 2P5VA 4FISA 2EFWA 3PSFA 3BJ6A 5EGOA 4NQWA 4I01A 1R4MB 1WSUA 1ZTRA 1BIAA 1FOXA 2DW4A 1MNMC 1D8JA 1B9NA 4KMFA 5CYVA 1ZH5A 5E8IA 1RUOA 1IN7A 2FQ3A 2QF7A 4P5OA 3VWBA 3CC2I 2M34A 1HQCA 3Q0WA 3G1MA 5HDKA 1GXQA 4EMSA 5CVRA 2Y0SN 4G12A 2Q2EA 3BDDA 2MW8A 3N97A 4X1EA 1Z3YA 3GTQJ 2M8EA 2AS5F 3TMOA 3V7CA 2Q0OA 5E3MA 4KYWA 2ZNYA 1P4AA 4O5VA 3E1SA 2YU3A 2Z16A 1QGPA 1GXPA 4M74A 4OAZA 3C2GA 4G6TB 1SAXA 2M3AA 2ZMEB 3HB9A 2H09A 4FE7A 5IPAA 4FTHA 1AKHA 1ON2A 3GFMA 4M3DA 3WU1B 4R1HA 4G7OF 4A3JJ 2PMZN 5FFXA 1WH5A 5M5YJ 2XF5A 1PP8F 5FKLA 4G94A 4L0YB 1PVEA 4XLHA 2FXAA 2W00A 4A3LJ 4PZJA 4JYKA 3OYIA 3Q9SA 1SFXA 3E6CC 3MMYB 4EJUA 1MJ9A 1Z21A 2QKMB 3SQNA 3G73A 5E17F 1B8IA 2QENA 4F55A 4W97A 1Z7LA 2DA5A 2DK5A 2PX9A 3DF8A 5LHHA 1SD6A 4UUVA 1MMAA 4HV6A 4XSXF 1F36A 3F6VA 2F48A 5AIQA 3OYCA 2WY8Q 2JN6A 3F8MA 3KLNA 3J80Z 3GWZA 2KRHA 1HLVA 1ZRDA 4NDLA 4UY8I 3CUQB 5B5EC 3RCOA 3F9KA 2O8XA 4RGUA 1WJDA 2IPQX 3CF2A 2Q8KA 4RA2A 2EFOA 4DBQA 2KFDA 4Q5SF 3BJAA 3K4CA 1BM9A 2WTEA 3FXMA 4B43A 1RZ4A 2RV8A 4DYQA 3HPHA 4ZDOA 2X51A 1R6RA 4CHUA 5BPIA 1XGOA 1IN6A 1CF7B 1QZEA 1EKEA 1BA5A 4MGRA 2LBFA 4L0ZB 4HX7A 2LG4A 2STWA 3J7AY 4UNOA 2Q1ZB 1NK2P 2CYYA 2DT7B 2E1CA 3LQQA 2R7RA 2FE3A 2V7FA 2IGKA 2UXNA 1K4TA 3BQZA 3IH4A 2DT5A 1UZCA 2HYGD 5KAFC 1K61A 5AONA 3TW6A 3L7WA 1WI9A 2QA4I 5GTHC 3CJNA 1WJAA 1JTXA 4XK4A 5E79C 2M4GA 3UR3C 3A03A 1WPKA 2BVLA 1RUNA 3LMMA 3ZQLA 3LAJA 2HOEA 2WV1A 2R7ZJ 1I1SA 5FGMA 3PUFA 1VQ8I 3V8LA 1D1CA 2OJED 1RETA 3EUHA 3TEDA 5E1ZB 1H8AC 4YIFA 1X1AA 1DPRA 4I7HA 1HDPA 2VC0A 4BE0A 4IHVA 1DU6A 3BZCA 1O57A 3K4LA 3H36A 4YFXF 2BGCA 2HEOA 2W57A 4ENMA 2GZWA 1XCBA 4FETA 4GDFA 5B1BH 3M8JA 1XN7A 4BXUA 2QQBA 1U9NA 1BC8C 2VQHA 2Y30A 1K79A 4Y4RA 1F5TA 1MGTA 4E4HA 1P9QC 4ZYHA 3F8BA 5L3DA 3HOYJ 3KP4A 5E8GA 3L2QA 3C3WA 3ZQGA 4ESBA 3TDUC 4WCGA 1LFPA 1V4RA 3A0BC 1QBJA 4UUTA 3OV8A 3DXJF 1EH7A 3QQAA 4D0PA 4M6YA 5IP6A 2WV0A 4PGHA 2UZKA 4IZZA 3CCQI 1LDKB 1LE8A 3DPUA 1XSXA 1ZLJA 3K4JA 5JHFA 3MN2A 4FX4A 4ZZDA 1S29A 2E1MC 4PJ0C 1EV7A 2WAFA 4DYRA 2BEOA 4XSZF 4AIDA 3HIFA 2VASA 1YFHA 1N25A 4G9YA 3M3YJ 3ROUA 3MD2A 3R6SA 1I1GA 3OYKA 4C3HJ 3PL8A 4XNFA 3GZ5A 2GIZA 3KP3A 3I5UA 1OYWA 4OIRF 4DZPA 1MZBA 3HEFA 2LYCA 4AIKA 1HSJA 3IUOA 1NG6A 3BTLA 2HKOA 3H35A 2KPMA 3NARA 2EIKH 2EZLA 3HKZA 5FKOA 2YPRA 2EK5A 2L9SA 1U5TB 3GX4X 4XRMA 3L2RA 9ANTA 2HTJA 4L9NA 3ELKA 2NVTJ 3KLOA 2LKSA 2ETHA 2ELJA 4BEHB 2P6SA 1IW7F 1BOBA 5FKNA 5B66C 4FCYA 2ZXWH 4IF4A 1WVRA 1SANA 4BAYA 3TBIA 4M3GA 1RKWA 1TP4A 3WE3A 1U2WA 5EEAA 5A2QK 3DKXA 1BI2A 2K27A 3WU2C 1NG7A 2HKXA 4UV8A 2GBYA 1KQ9A 1X1CA 1YW8A 4GRIA 2D45A 2V1XA 2M8GX 1BI0A 2CW8A 2CV2A 1SMTA 3DTKA 3I4NJ 3BZ6A 3V4GA 1EF4A 2E19A 4YIIA 4BHPA 5IOZA 3SDBA 2VIXA 1E2XA 2ZXHA 1XSDA 2CUFA 3CD6I 3BCBA 2PN6A 2LVSA 2L7KA 3M7GA 3I59A 2HVSA 2BHYA 4KIGA 1Z9CA 3QODA 4J19A 1X2NA 3BP8A 4G6QA 3FXKA 3HGYA 1UB9A 2R5YB 4B4CA 3D5LA 1EH8A 3F3XA 3GYHX 2WWYA 1Z6RA 2ADUA 4HAMA 1D5YA 1R5ID 2JA5J 2BXZA 1REPC 4PUSA 1ZLKA 2F5CA 1SFUA 4Y13A 4ITVA 2L5QA 2HNHA 2PLYA 2LNBA 3M8EA 4RAGA 1U9OA 4XKVA 2GQQA 2V6CA 4DBRA 3O2PE 5K1YA 1IXSB 3DKYA 4V2FA 4CICA 1MIJA 1YW7A 3QWLA 1BI1A 5D8KB 3RKXA 4M71A 4CYCA 2IS6A 1HKTA 3HTSB 2GIVA 4ENKA 2ZB9A 3EPZA 2QGUA 3ZMUA 2LDUA 2VE9A 3KPHA 1JUSA 4ZYGA 3T8RA 1KU3A 3WGHA 1H9TA 4GO1A 1KZHA 1W4MA 2O6GE 4XRFA 2AQFA 3IL2A 3EYYA 1LJ9A 2WY7Q 2DMTA 1S6LA 4II2A 1HC8A 1FY7A 2LK2A 2M0MA 4A3BJ 5GP9A 1S9HA 1J09A 2EIMH 3KP2A 5L3GA 2M7AA 2PG4A 3WTZA 2JA8J 4XMYA 3P5JA 4A5NA 4AYBA 3G71I 3K4BA 4LK1F 4KJZA 2GXAA 5F04A 2ID3A 4RB2C 4KUMA 1WJCA 2M0CA 1OCZH 4BHCA 3QRFF 3JRAA 3X2QH 1G3YA 1DPUA 4PJMA 1UELB 3M8FA 3HOVJ 3KE2A 1YOVB 3JW4A 3S1NJ 2XAJA 1USTA 2DMNA 1J7KA 1UMQA 3HXLA 1T6SA 3RTRA 4U0VA 1IRGA 5HNHA 1WKMA 1T0FA 2DOAA 3M1CA 2ZFUA 3R0AA 2IRFG 1USSA 2VJJA 4AC0A 1IF1A 3DU5A 2ELKA 1X3ZB 4BE2A 1ZG1A 3IH3A 3M07A 2XRLA 4JP0A 1MNDA 1Q1VA 3PO3J 5LRSA 2DCEA 3AG1H 3FXLA 3LOCA 2XGCA 3HOZJ 3QU3A 3SZPA 2ESHA 4ZYDA 5D5XB 1VQMI 1JJ8C 1JHHA 1ZRFA 1JT0A 2O03A 2WADA 2EWNA 1X1BA 4Q47A 4ZTJA 2JVGA 5FD5A 1TWGJ 3HOSA 3I71A 3CCRI 2DXIA 3IHUA 2GXBA 4IXAA 2QQ9A 4IRIA 2VKEA 4GYIA 4I09A 5D8LB 3KZYA 4IRHA 2BZTA 3BQYA 2W84A 3ERMA 5LD2C 3EYIA 2OZUA 2OC6A 3BG5A 4CCOA 2YSRA 3BLYA 4Y33A 4QPOA 1BR2A 3CCLI 1G3WA 2QLZA 2ISYA 2L4MA 1QPMA 3K9TA 3OR1C 4EJVA 1PUFA 4B44A 3C2BA 5A2QZ 5IOYA 4M9XA 4EVIA 4YEJA 3K0LA 4P96A 3KETA 3I56I 3GLLA 3SYTA 2VPLA 2DBBA 2H6BA 1HW5A 1MBFA 3V42A 1T95A 5M5XJ 5K5OA 2K5CA 2YX7A 3AG2H 4LOCA 1TQIA 3FF5A 2HVQA 3BROA 5H2FC 4H4KC 4Q4ZF 3GMEA 1BBYA 4G6DA 3MCZA 1ZYRF 3I9V2 3RPUA 2BYVE 2WAEA 3TOAA 1MSEC 3ASNH 5DM6F 1R36A 4CXFA 4KIBA 4UB8C 5DEQA 3WTUC 1TNSA 4HLXA 1ZREA 3I3LA 2LD5A 3VYRB 3FXRA 2HZDA 3I0TA 2R93J 1FT9A 1V55H 5E3NA 2JZYA 2V9VA 3ZQQA 4UUSB 5M3MJ 1MNEA 2ZJ2A 4NC6A 2JA7J 1N77A 3TL4X 1BIBA 4L5IA 3HOUJ 1ERDA 2A6HF 2RQQA 3LFUA 3BR5A 3QOPA 1SD5A 2XASA 5HLIA 2VKVA 1A36A 3D1NI 4MFEA 1XTAA 4EV0A 2FD5A 3L9FA 2ZJRF 2F6CA 2W82A 4HX4A 3HKZN 1IUYA 3S3OA 2K9NA 1YIOA 2XPVA 2RN7A 4JX4A 2F5EA 3WTSC 3EUKL 1VQOI 4LMYA 3FM5A 3J81K 1UFMA 3GBGA 3WTVC 4GCVA 1NK3P 1BR1A 2FMLA 2LLKA 1J5YA 2JWTA 4PSXA 2MBFA 1VQ9I 2HFHA 2EFNA 4NBQA 4E6KG 2DA4A 2PJRA 1R1VA 4ANJA 4DJAA 3TW7A 3DKWA 2STTA 5LHIA 1HW2A 2XIGA 3O8HA 5L3FA 2MA3A 2LY2A 3DEEA 1HKSA 3DBLB 3ZMZA 1XG1A 4UVAA 3MFKA 2ZMEC 3HSEA 2PMHA 3NWSA 2WAQA 3QPHA 4BUPA 3HOWJ 4ZYAA 5HLGA 4HBLA 2JSCA 3TO9A 1W0TA 4B09A 2XAQA 2LC2A 3G2BA 5IT3A 2HU9A 2DFEA 3U9GA 4BE1A 3K2ZA 3P9CA 4IL6C 4IHSA 2J5OA 4Y7NJ 1TL8A 4KMUX 3DV8A 2RAEA 2HWVA 1G3TA 2DQRA 2GA1A 3LQRA 2EIJH 3KZIC 5EG0A 1P92A 2M45A 3LA3A 4L9TA 1O3RA 1S8NA 4ON0A 3OYJA 5DS9A 3VOEA 2XVCA 2R7OA 4XRSG 3DEUA 1OFCX 3WTYC 4I02A 4G7ZF 1VNDA 3LSHA 1R9TJ 1QO0D 2RDPA 3OMYA 4N9IA 1YI2I 3CUQC 2ESNA 1KQ0A 3RKQA 5LGUA 3HHGA 2XSJC 2DFHA 3OWTA 3OYMA 4Y3OA 1TC3C 2KRCA 2RKHA 2EFPA 4JX5A 3PQJA 2CW7A 3E6DA 3A0HC 3K10A 1ETYA 2I5UA 1BW5A 2VJIA 2M7BA 5E18F 3DPTA 2VOPA 1GT0C 4G7HF 4XR6A 4KNYA 2DA7A 4LB6B 3TKYA 3OSFA 4OIOF 1TT0A 2FOKA 2DTZA 1B1BA 1VQ4I 4ABZA 3RJPA 2ME0A 2NS8A 2RGVA 4AIHA 3FXUA 1KU9A 1Y0UA 4M3FA 2ZXIA 4AYBN 3MKZA 3DLLF 5EGOB 4NQWB 1QHHD 3IRQA 1TQMA 5B3SH 2HOAA 2X6OA 5B1AH 2F5FA 4XLAA 1MDMA 4OMZA 2W85A 2DDBA 3GTPJ 1ZN2A 4CH7A 4J01A 3ASOH 4NB5A 2GA2A 3OYAA 3F8CA 1OCRH 3WTWC 1FP1D 4M3EA 4N9HA 1N75A 2E7XA 2GXGA 4RAZA 2KDZA 3PNYA 3H0GJ 3L2VA 2DQLA 3JRHA 1Z0XA 2AQEA 2G7HA 4IX7A 3BZKA 5D6EA 3ZQIA 3ZQFA 2IGOA 3CCVI 2W25A 5CQGA 5IT9K 1XGMA 4ZTFA 1GV2A 2KZGA 4LLNA 1YJ9I 3E5QA 3R60A 3A4CA 3CMEI 2COBA 1MW7A 1ETWA 4E7IA 3DTIA 1JT6A 2RC4A 1AKHB 2Y75A 3L2CA 3A01A 1FBSA 1XDSA 1WQ2A 3KYDB 4IRGA 4LG0A 1Y8QB 1IV6A 4B48A 3F22A 3ISPA 1LFBA 2CUJA 2LY9A 1DQUA 1UHMA 1UJ8A 1XDUA 5F0FA 5D4RA 2FBKA 3SJMA 1JKPC 5J8FA 4MHGA 4R79A 3LSTA 2NVQJ 3W6JB 2QSFX 1MMNA 3K1PA 2CV1A 4UB6C 1RESA 1S3JA 1YS6A 2F2EA 3PUBA 3SDGA 4IVNA 3BG9A 2K7LA 3HRTA 5CVVA 3K2AA 1D5VA 2FJ1A 3HG9A 4EEFG 2PQ8A 1B8IB 3J81Z 1I3AA 3S3NA 4P1WA 2VN2A 5E1WA 2LOOA 3ULQB 4C2TA 1FMWA 4IQJA 4TV7A 1OMIA 2FU4A 5JLXA 1S7AA 1ZG5A 2R0QC 3E0JB 3A1YA 2EPFA 3BPVA 3MZYA 2P81A 4RGRA 3HRMA 2EB7A 3FZVA 1TWCJ 4HV5A 1LFUP 2H8RA 2IXSA 4U0YA 3FBNB 3CP8A 2YUSA 3I53A 1A35A 1T33A 2DTRA 1ENHA 1T39A 1P7IA 4A3DJ 5FD6A 1G2HA 4AM3A 3E97A 1U5TC 3BR3A 3L2UA 4N4NB 2K9LA 2GM4A 5EEGA 4IKFA 1XX5A 2EILH 1ZG3A 4FE4A 3JRIA 5DCMA 1UAAA 4XIDA 4CZCA 1OYIA 3QU6A 1A6QA 4QWQA 1W5SA 3OYGA 1LKXA 1IDYA 1OLTA 1MH4A 2HS5A 3JCUC 1HW1A 3IAM2 3WG9A 1JE8A 5KVRA 4C2UA 4EGYA 1FTTA 2VQCA 1FNNA 1KYZA 2K9QA 1FOWA 4B3AA 2E71A 4L5JA 2YS9A 2DDAA 4FX0A 1O3SA 4LJZF 2CRGA 4C2MJ 2VT3A 1K78A 4AVPA 2ICWG 3JRGA 1J0RA 2NVXJ 3GZ6A 1F43A 3GTKJ 5CJ9A 3L00A 5E1XA 2VBWA 1SFOJ 4W1UA 2HZTA 2MYSA 3JAMK 2QWWA 1H0MA 2FF4A 4KDPA 2FSWA 2EZHA 2JRTA 4PJNA 1IXRC 3PNTA 1S72I 2FX0A 5JHUA 2OZ6A 1U6GA 1HDDC 5GPAA 3FMRA 5BNGA 1RR8C 2CS3A 4I2OA 2NS7A 3HGGA 2NRAC 3ABTA 4P55A 1I27A 5GPCA 5HDGA 5CVIA 4HX8A 3KYLA 3FKIJ 3ZRGA 1R71A 4HZFA 2XGXA 2HOSA 3OYDA 2V4JC 4R8HA 2LR8A 3IRRA 2IGMA 1FEXA 2WBMA 3L09A 1IC8A 2E1NA 1ETKA 4XKCA 2XRNA 1R1UA 3BT9A 3ABMH 4UVBA 2H94A 3SZTA 4JQFA 3O8GA 2WAQN 3E5UA 2P5KA 2DYSH 2FBHA 1HOMA 1RR7A 1H9GA 3ERED 1LE8B 1W36D 4BQNA 2BXYA 4IQ4A 1T38A 3D0SA 1STZA 5JVTA 1WJ5A 3OYLA 3KYCB 4HYEA 1XC5A 3QP5A 1HA8A 5LLQA 2EINH 2K4JA 5FLVA 3MEXA 4YFKF 2OF7A 1QRYA 5IT9Z 2DPDA 1HXDA 3RZOJ 4ASNA 1FX7A 2DO7A 3E6BA 4LGWA 3G3ZA 3U1KA 4CCMA 2HXOA 1JXSA 1I6HJ 2CV0A 3O3KA 2CUEA 1D0ZA 3PIOF 4OAYA 1OPCA 4QSHA 1XMXA 2HPIA 5LFAA 3C7JA 2K4BA 3Q0UA 2R4GA 4XN3A 2E2IJ 3CC7I 2CQQA 3FXQA 2FNPA 1TTYA 3AL0B 2OAZA 1QVUA 2XB0X 2NOJB 2ZXJA 5DM7F 3LL7A 2X1CA 3VSKA 3HPGA 4KICA 2CQKA 4OOIA 4LLGF 4RAYA 2CH0A 4NC7A 2QEXI 3ABLH 3P7NA 3JRFA 1VQ5I 3HSRA 3H9JA 4E7LA 3GTMJ 4Y15A 4P9UA 3DQVC 1QZYA 2KL4A 1JHFA 3QYEA 3B73A 1M1EB 3OS0A 3G1OA 1WZ2A 1FPQA 3TO6A 2DAOA 3QPSA 4WXHA 4A0YA 4B8XA 3WGIA 1LVAA 1B59A 4KFCA 3SFIA 3CUOA 5IYDJ 2R7UA 1LDJA 4PSWA 1LNWA 3KX2A 2P5LC 2CFXA 2PEXA 3ONQA 1KU2A 1DGWY 3ML6A 3TDZC 2FBIA 5D5WB 1VQKI 2IAIA 2O8KA 3GTJJ 4A6EA 5DDGA 3G1LA 3I59B 1J75A 3QOEA 1MKMA 4HEA2 1WFXA 3W6VA 1X3WB 4LD5A 1WJBA 3SEQA 1Y6IA 4A3IJ 5J1YA 5CLSA 2F4OB 2FNAA 3BG7A 4X0GA 3A2KA 1OYYA 2O9LA 3NQOA 2IGNA 4KN7X 2MG4A 3BWGA 1IJWC 4BNCA 2KHMA 3ESWB 3S1RJ 1TLHB 1YX5A 4BXXJ 2ZSIB 1B72A 3K1NA 5F1RA 1A5JA 2XGDA 3C1DA 3VODA 4CYCB 4XBFA 3CDIA 4HDVA 5K7FA 3RPUD 4XQFA 1W5CC 3MAJA 5KK1A 4E70A 3FMQA 3RQ4A 4EM2A 1FTZA 3V8KA 3SXYA 1UHWA 3I64A 2EFQA 2VC1A 1OISA 4BY7J 4K2EA 2LSOA 3JAMZ 2COMA 2I8DA 3FK7A 2HQRA 3OIPA 2L4AA 3TQNA 1OR7C 1U8BA 3QP6A 4IOAF 3GVAA 3HTUA 5AIPA 2IT0A 2D1VA 1LEAA 2R7WA 4LB5A 1ODDA 2KRFA 3CDLA 3PNVA 4RBOA 1XSVA 3CTAA 3E5XA 4RM3A 2R7VA 1SD7A 1J2XA 1I50J 1TW2A 4B47A 1BJZA 4LIVA 4M9ZA 2O5RA 2MABA 1ETVA 1AOYA 2D1HA 3OR2C 2R7XA 1LEBA 4RS8A 4XOTA 1PP7U 2L3DA 4MLOA 1KA8A 3CMYA 1IN8A 2LP0A 2ZKZA 3CQZJ 2VJ5A 2VBZA 4IHXA 4A5MA 2UUZA 2XHKA 1YYVA 2F4MB 3Q3SA 3HUGB 4IO9F 1TNTA 3M1EA 1BL0A 5K7ZA 1YJNI 5F0CA 4LITA 4F93B 1DDNA 2IJLA 3FK6A 2V9PA 5C44J 3CJQB 2HQNA 1QVTA 3ZXSA 5GAHJ 3OS2A 3CDHA 4A69C 1R5HA 5HS9A 1IRZA 2DOEA 2VQGA 5IP9J 3MZ8A 1TT5B 4BQOA 3DLAA 3GTGJ 3H3VK 1MJBA 5KNLA 1V5EA 2K9MA 2KIFA 3JSOA 2PJPA 3M9AA 2KISA 5ICGA 4U88A 2OA4A 4RLFA 3NWTA 3GXOA 4ZDLA 3DBHB 2XF6A 3FM3A 3CMMA 4AD9A 1YG2A 5F27A 2OBPA 1UCRA 3HOTA 2NVUB 3CLOA 1JKOC 5EZHA 1C0WA 3PJRA 2X4HA 2Y31A 1FYKA 1YX3A 2A05A 2EA2A 1MMGA 3ZOBA 2QSHX 2XV4S 3I58A 3CCMI 2R7DA 3PM1A 3F0CA 1PUFB 2BW3A 2DMQA 3BR2A 1CGPA 1MBGA 1GHCA 5EZGA 1X1DA 1OCPA 2XKPA 3S15J 3GO5A 5CVJA 5KCMA 3U21A 2BV6A 2B9SA 1FSHA 2L02A 1WJEA 1XMAA 2Y0SA 3W2AA 3PQKA 2JA2A 4HNVA 4BJTA 4A3KJ 3COAC 4OINF 1TBXA 4IHWA 4RM2A 4XN0A 2QVOA 1MD0A 4KT5C 5ILUA 3IWZA 4NNJA 5L3CA 4KT6A 2KIMA 3DP7A 4KA4A 1U8RA 3CCEI 4CUGA 1PJRA 2E7WA 3HOXJ 2HDCA 5J3LA 1XB4A 2HGCA 1BOAA 3SEZA 5JVGF 2L9RA 1ULYA 1FC3A 4XRSA 3LSPA 5EEHA 2PMZA 3I54A 1YRNA 1ZR2A 2X6XA 5ICFA 2X1DA 3QYBA 2Z3YA 5DD4A 4CGZA 3G4SI 1IAWA 4XICA 5LGNA 4ZJZA 2NAZA 2LKPA 3IC7A 2LF7A 1JI8A 2UWMA 3GF2A 1SVOA 4DYCA 1IUFA 3KEOA 2DU9A 2E5NA 1ONVA 1XS9A 4E7HA 4IHTA 1RC9A 2PBIA 3J7AO 4BL0B 5TGTA 2VKDA 3OSGA 4L9VA 3V8JA 3U1DA 2Y69H 1GVDA 2RQPA 2XF7A 1SEUA 1IZ1A 3H3UA 5BOXA 4HSTA 3RZDJ 4FT8A 2V79A 4A6DA 4BS9A 2PJRB 5J40A 4L5EA 2CGPA 2M9HA 3HZJA 3BTCA 1OCTC 3S1MJ 3OS1A 2B7EA 3ZP5A 3PO2J 3V7RA 4B3XA 1K4SA 2GWRA 2ZNZA 2Z5UA 2EA4A 3ZQ7A 3GUDA 4AVZA 1IG7A 2M1BA 1JTYA 2MLGA 3K4MA 3MVPA 2B63J 1CQTA 2VBXA 4D1QA 3GFIA 4CCNA 2YU9J 3Q9VA 1D0YA 2DJNA 4H0EA 1X4OA 1XCVA 4BHBA 2LTPA 5F1JA 4A3EJ 5J1UA 1TWFJ 4HDUA 3W6KB 2LRDA 2P8TA 5JI6A 4EM1A 3HBLA 2CW0F 2L2OA 3ZMTA 4N0BA 3WTTC 1WRJA 1T56A 3HHHA 5LEJA 3OL3A 2DJIA 4XLNF 5IY5H 3HDDA 1MSFC 4A93J 3DTEA 4DQ2A 2R7SA 3B6CA 2ELHA 5FRNA 4MQ9F 5FB2A 2HXIA 1YITI 2EZIA 1Y1VJ 2DFIA 5JFRA 3OYFA 2QM3A 2A5WA 3FHZA 2CMPA 3PFYA 1ZGJA 5ILSA 1EH6A 1PDNC 4XM3A 4MEXF 4Y17A 5K5QA 3GTOJ 2NNYA 3IAS2 4E7KA 2LKXA 1R7JA 4RB0A 2KZVA 3K4KA 4CSWA 2G9WA 3NRVA 4A12A 4E7JA 1FSEA 1IN5A 1QQIA 5JR3A 3AG3H 2Z99A 2E60A 2MGQA 3VPRA 1Z91A 2HYJA 3AFHA 1FJLA 1BC7C 3CCJI 4X6AJ 1V5FA 1KGSA 2HPMA 2JVHA 1ITYA 4IOCF 2JUGA 4MTEA 3CLQA 2CQXA 5LGTA 4C3JJ 2NOGA 1SVLA 3H9GA 2IBDA 4QTRA 4LK0F 1MDMB 1R1TA 2W7NA 5BPDA 4OMYA 3ECHA 5H6QA 3TP0A 2DPUA 1S7EA 5M3FJ 1O3QA 3DPLC 5TJJA 4L18B 1VTNC 2MSYA 1F9NA 4I0AA 2XAUA 4EGZA 3S17J 1LQ1A 1RRJA 1IDZA 4GGGA 3H9QA 5E20A 2VKHA 3K70D 1X19A 2JT1A 2DYRH 4II3A 2LFBA 5D4SA 4CYDA 3EUHC 4F92B 3L2WA 1G4DA 3H0DA 4HSRA 2R5ZA 2MD5A 3GFLA 3LSKA 1T2KA 1T8IA 1ZKGA 1W7PA 2HYFA 3JTHA 2ISZA 2F4IA 1WWXA 2L9VA 3LSMA 5F08A 3BR0A 2KT0A 1X1PA 4CCKA 5ICEA 3HC7A 2D2WA 4WF2A 4MO7A 1VQ6I 1HKQA 2Q2EB 3LWFA 3A01B 4ETSA 3OYEA 2HQ5A 3P9KA 4XLPF 2Y9ZA 3BTJA 2H27A 1NHAA 1O4XA 1X2MA 3LA2A 3LAPA 2V1NA 4D9JA 1I3QJ 3QPTA 1FOKA 4BJ6C 2ZJQF 5J6XA 4RGXA 3H5NA 3J7YJ 2M87A 1K6OA 2RNJA 5HVQC 1WH7A 4YELA 2ZO4A 1HBXG 3BJOA 3Q0VA 2FQ4A 3KZZA 5DD8A 5LBQA 2R92J 5HODA 2DT6A 3S2DJ 1IN4A 2HDDA 5CPRB 1DGRM 2QYOA 4FHTA 4IPAA 5LHGA 4YRVA 4Q48A 4ENNA 5GAGJ 1YS7A 5FROA 5DYMA 1F4KA 1WHUA 2XB5A 5DUKA 4ESJA 1HCRA 1BW6A 2QBYB 2NYXA 1R49A 2PMUA 1Z05A 2VONA 1XMKA 5HDNA 3CO7C 2J5PA 2E2HJ 3OYHA 2V1UA 2E1OA 2A6TA 1JGSA 5GADJ 2QUFA 4QIWN 2A61A 5F0HA 1R58A 4J00A 1TW3A 1P6RA 2L7ZA 1SD4A 3WG7H 2ZC2A 2KIUA 3W2WA 2OQRA 2K3PA 2GOMA 3FXOA 3S8PA 2UV1A 1JJ6C 3AL0C 4I99C 1SC7A 3V7SA 5E3OA 4CDGA 2P4WA 2R7QA 3DWLE 5DCMB 3S3MA 1L3LA 2ZFWA 4XLFA 2CFOA 5LEKA 5ERIA 1IRXA 2EH3A 4D7MA 4NC8A 1QA6A 2OTJI 2IA1A 3WU0A 2D5VA 3CC4I 2V6EA 3OL4A 1MH3A 1XPXA 3IKVA 3U2RA 3LNQA 2QKLB 3FWEA 4PGGA 1LUJB 3EQLF 3TP3A 4WK8F 5KAIC 1PUEE 3ZR8X 1Y1WJ 2L0KA 3OIQA 2DMUA 2F5DA 4MEYF 2ZMEA 3JR9A 1KU7A 1Z7UA 1K78B 2VI6A 2LBFB 4F7ZA 1E17A 4UHTA 3RSNA 4BH9A 2DOFA 1E0EA 5E3LA 2MH2A 4UV9A 4DNCA 1ORKA 1NH3A 4OWRB 1BR4A 4BBSJ 1IGNA 1I6XA 1YJWI 4BYYA 2XGEA 2IS4A 1YW9A 1ZAOA 4JBAA 3CCSI 3GEZA 4RMNA 1H88C 2E2JJ 2VXDA 3KCCA 2HDWA 2X85A 4EJTA 3R0JA 1E3PA 4O6JA 2KJCA 3FIWA 1GLNA 3CCYA 3O6BB 4U87A 5FKMA 2JUCA 1APLC 3HM5A 1YQAA 1FYLA 1X4PA 2R7TA 4RB1A 5L3EA 4HNTA 2Y48A 4CO8A 2JRMA 4RB3C 1O7LA 1Z77A 1GDTA 4HNUA 4YIRX 2ECBA 2LF8A 3QYFA 4U7DA 4O3MA 2ZSHB 3CUQA 1ZGWA 2DODA 1U0JA 1IXCA 1TQPA 3UNGC 3ABUA 1TWAJ 3C18A 1OKRA 1WGXA 2QZ8A 4XOPA 3S1QJ 2MFZA 3CMAI 1LDDA 3BCAA 2XDVA 3H1CA 1YHQI 2OQGA 1FP2A 2VB6A 3B6AA 3BTIA 2KKOA 2L01A 1ZQ3P 1ETQA 1IRFA 1N78A 2X6WA 1CF7A 1HSTA 2DN0A 5FLMJ 2OUMA 2Z2SB 4BGDA 1DP3A 2V1DA 4L9JA 5J8CA 3I55I 1W36C 5J4YA 2A3SA 2DK8A 1T08B 2XAGA 4ZC3A 4HA8A 2VOOA 3MWMA 2X6YA 4NHJA 1YO5C 4GFBA 3PIPF 3UKGA 4D5FA 3FBIB 4EQQA 4AUXA 2RVCA 5IYBJ 1R4NB 2VLAA 3DEWA 2QQ8A 3Q5FA 3ZN1A 1VZ0A 2EBIA 3C2HA 1LPQA 1QU3A 2KJBA 5C3EJ 4DIQA 5D5UB 4XONA 1I39A 3VYTB 1FWZA 1T0FC 4PK4A 2CG4A 2QSGX 2NXNB 2HQAA 1P7JA 3JREA 4AU7A 1MMSA 1P2FA 1G59A 5CVUA 1JKQC 3S93A 3BG3A 3SFZA 4MTDA 2FEZA 4BQQA 2G7UA 4A0ZA 2ZBKA 3F23A 5L3BA 3NAUA 4HG2A 1ETOA 1DU0A 4CCLA 5CQEA
chains in the Genus database with same CATH topology
5BMZA 1I5ZA 2IA0A 3BY6A 1R00A 3EDPA 1FBUA 1FLIA 2EJRA 2YR2A 1F1ZA 4HF2A 3SHFA 3BOQA 1Q1HA 2QBYA 2CWEA 1XD7A 2WC2A 3ECOA 3T5XA 5ED4A 3E3VA 2VXZA 5HS7A 4P9FA 4HOBA 1YTYA 2P7CB 4M6XA 2M30A 1Z1DA 5H20A 1FYMA 3IWFA 4MQVA 1BI3A 1U5TA 5FO5A 2C6YA 4YG2F 3I4PA 5HOOA 3ZMVA 2GAUA 3RKWA 2X0LA 3RPQA 3GLXA 3LA7A 1MJAA 1L0OC 4M9SA 5FFZA 3IKTA 2A69F 3FMSA 1B6AA 2XAFA 2XUBA 4WXCA 2NS0A 1U3EM 1J59A 2B0LA 1DP7P 4OIQF 2UXXA 3ZPLA 2Y0MA 3REOA 3KEQA 4HF1A 4AIJA 3RIRA 2DI3A 3BPXA 3JSPA 3GFJA 3RYRA 5HS8A 2O0YA 2R3SA 3VFZA 3MZHA 4BQAA 5DCFA 2BE5F 2XROA 2FMYA 5FLXK 2VODA 5BS6A 4M73A 5LRRA 3GW2A 2NNNA 3LFKA 2K86A 1W5TA 4UVCA 2YX4A 3E6MA 4G8XA 3B02A 1R23A 1BJAA 3K1MA 2A5YB 1SMYF 3T1BA 2MH9A 2QQAA 2CO5A 3KP6A 4CZZA 4IJAA 2VE8A 2XKOA 3WGGA 1ZRCA 3HUGA 4EJWA 3CO6C 6PAXA 5K5RA 3WE2A 3RYPA 1ZARA 2HR3A 3H3ZA 1KQ8A 3ZMDA 3AAFA 2W24A 5ICCA 2ZCWA 4MNUA 2K02A 3T8TA 1RNLA 1P4WA 4ZZLA 4EJOA 2M5WA 3H92A 4HF0A 3F21A 4ZH4F 4QLCU 4ESFA 4A2UA 2PI0A 1R5GA 2A6EF 2OD5A 2L54A 1XGSA 1R22A 4WX9A 5D5VB 2BBYA 1G3SA 3ZMSA 1D8KA 2VBYA 4U7BA 4GXOA 2P6TA 1QNTA 3ZN0A 4KIFA 1W7PD 5DV5A 1O3TA 4S05A 3HRUA 1SFEA 1RI7A 2TDXA 3T0YA 2Z9OA 2DLLA 1A04A 4EM0B 2VT2A 3P9IA 1ZGAA 2A68F 4WWCA 3F72A 5TRDA 3PFIA 1X3UA 3EETA 3MQ0A 3S2WA 3F8FA 3VB2A 2FRHA 4PDKA 1BN5A 2IVMA 2IW5A 4WXDA 5HLHA 1OR7A 4HW0A 4M72A 5H6RA 3RDIA 1ZHFA 3DFGA 1S7OA 1K7AA 3HSFA 3RKYA 1QZZA 3F8NA 3TOBA 1P4XA 5FLXZ 1U78A 1B9MA 3F6OA 1Z6TA 2FA5A 2JPBA 3K69A 3NEUA 3JTGA 3OOPA 4AWXB 2CSOA 4UXNA 4OIPF 3RI4A 5BQTA 4RGSA 2IA2A 3WODF 3HRSA 2O3FA 2AXLA 2R7FA 1KYWA 2H6CA 5F64A 5D6FA 1FZPB 4YFNF 3KFWX 5DUIA 3TGNA 4PCQA 1O7FA 2MC3A 3J80K 4I0BA 2PFBA 3KP5A 2EV6A 2XAHA 3R4KA 5F6FA 3WTXC 4JK1X 4ZYEA 4HLYA 4KN4X 1FBQA 4ENJA 1G6NA 1XGNA 1YLFA 4LFUA 1V3FA 4A0XA 1ON1A 1D3YA 4S04A 3R61A 1W7PB 1AWCA 2ACJA 1RIOH 2JTVA 2MLKA 4GYGA 4HQMA 2Z33A 1DUXC 4Z2YA 2HTSA 3FX3A 4I98B 2OU2A 2P7VB 4OU0A 3N4MA 2EV5A 1B4AA 3QAHA 4U0WA 2JPCA 1T98A 3KP7A 1GVJA 3TO7A 4LG0B 4HQEA 3HYIA 5ILVA 2EV0A 3VEPA 2A07F 2O61A 1LB2A 4LLLA 2IP2A 2P5VA 2EFWA 3BJ6A 4NQWA 4I01A 1WSUA 1BIAA 2DW4A 1D8JA 1B9NA 4KMFA 5CYVA 1ZH5A 5E8IA 1RUOA 1IN7A 2FQ3A 4P5OA 1HQCA 5HDKA 1GXQA 4EMSA 5CVRA 2Q2EA 3BDDA 3N97A 2M8EA 2AS5F 3V7CA 2Q0OA 4KYWA 4O5VA 2ZNYA 1P4AA 2YU3A 1QGPA 1GXPA 4M74A 1SAXA 2ZMEB 2H09A 1ON2A 3GFMA 3WU1B 4R1HA 4G7OF 5FFXA 1PP8F 4G94A 4L0YB 2FXAA 4PZJA 3Q9SA 1SFXA 3E6CC 4EJUA 1MJ9A 3SQNA 3G73A 5E17F 2QENA 2DK5A 3DF8A 5LHHA 1SD6A 4UUVA 4HV6A 4XSXF 3F6VA 5AIQA 3F8MA 3KLNA 3J80Z 3GWZA 1ZRDA 3CUQB 2O8XA 4RGUA 2IPQX 2Q8KA 2EFOA 4Q5SF 3BJAA 1BM9A 2WTEA 1RZ4A 2RV8A 4CHUA 5BPIA 1XGOA 1IN6A 1CF7B 4MGRA 4L0ZB 4HX7A 2STWA 4UNOA 2CYYA 2E1CA 3LQQA 2FE3A 2UXNA 2DT5A 2HYGD 5AONA 3L7WA 1WI9A 3CJNA 1RUNA 3LAJA 2HOEA 1I1SA 5FGMA 3V8LA 3EUHA 5E1ZB 4YIFA 1DPRA 4I7HA 2VC0A 1O57A 4YFXF 2BGCA 2HEOA 2W57A 4ENMA 2GZWA 1XCBA 1XN7A 4BXUA 2QQBA 1BC8C 1K79A 1F5TA 1MGTA 4ZYHA 3F8BA 5L3DA 3KP4A 5E8GA 3C3WA 4ESBA 3TDUC 4WCGA 1V4RA 1QBJA 1J9IA 3OV8A 3DXJF 1EH7A 4D0PA 2QBYB 4M6YA 2UZKA 2WV0A 4PGHA 1LDKB 1XSXA 1ZLJA 4FX4A 4ZZDA 1S29A 1EV7A 2BEOA 4XSZF 3HIFA 1YFHA 4G9YA 3ROUA 3R6SA 1I1GA 3GZ5A 3KP3A 3I5UA 1OYWA 4OIRF 4AIKA 1MZBA 1HSJA 2HKOA 2YPRA 2EK5A 3GX4X 1U5TB 2HTJA 4L9NA 3ELKA 3KLOA 2ETHA 2P6SA 1IW7F 4IF4A 4BAYA 3WE3A 1U2WA 5A2QK 1BI2A 2K27A 2HKXA 4UV8A 1KQ9A 1YW8A 2D45A 2V1XA 1BI0A 1SMTA 3BZ6A 3V4GA 4YIIA 4BHPA 1E2XA 1XSDA 2PN6A 3M7GA 3I59A 4KIGA 1Z9CA 3BP8A 4G6QA 1UB9A 3D5LA 1EH8A 3F3XA 3GYHX 2WWYA 1Z6RA 2ADUA 4HAMA 1REPC 1ZLKA 2F5CA 1SFUA 4Y13A 2PLYA 2LNBA 3M8EA 2GQQA 2V6CA 3O2PE 5K1YA 1IXSB 4CICA 1YW7A 1BI1A 5D8KB 3RKXA 4M71A 1HKTA 3HTSB 2GIVA 4ENKA 3ZMUA 2LDUA 2VE9A 4ZYGA 3T8RA 1KU3A 3WGHA 1H9TA 4GO1A 1W4MA 2O6GE 4XRFA 3IL2A 3EYYA 1LJ9A 1S6LA 1FY7A 3KP2A 5L3GA 2PG4A 3WTZA 4A5NA 4LK1F 4RB2C 4KUMA 4BHCA 3QRFF 1G3YA 1DPUA 3M8FA 3KE2A 3JW4A 2XAJA 1USTA 1J7KA 1T6SA 3RTRA 4U0VA 1IRGA 1WKMA 1T0FA 3R0AA 2IRFG 1USSA 1IF1A 1ZG1A 5LRSA 3QU3A 3SZPA 2ESHA 4ZYDA 5D5XB 1JHHA 1ZRFA 2O03A 2EWNA 4Q47A 5FD5A 3HOSA 3I71A 3IHUA 2GXBA 4IXAA 2QQ9A 4IRIA 4GYIA 4I09A 5D8LB 3KZYA 4IRHA 2W84A 3EYIA 2OZUA 2YSRA 1G3WA 2QLZA 2ISYA 2L4MA 1QPMA 3K9TA 4EJVA 5A2QZ 4M9XA 4EVIA 3K0LA 4P96A 3KETA 2DBBA 2H6BA 1HW5A 5K5OA 2YX7A 1TQIA 3FF5A 3BROA 4Q4ZF 1BBYA 4G6DA 3MCZA 1ZYRF 3RPUA 2BYVE 3TOAA 4CXFA 3WTUC 1R36A 4KIBA 5DEQA 1TNSA 4HLXA 1ZREA 3FXRA 3I0TA 1FT9A 2JZYA 2V9VA 2ZJ2A 1BIBA 4L5IA 2A6HF 3QOPA 1SD5A 2XASA 5HLIA 4EV0A 3L9FA 4HX4A 1IUYA 1YIOA 2RN7A 2F5EA 3WTSC 4LMYA 3FM5A 3J81K 1UFMA 3WTVC 4GCVA 2FMLA 1J5YA 2MBFA 2HFHA 2EFNA 1R1VA 3DKWA 2STTA 5LHIA 1HW2A 2XIGA 5L3FA 2MA3A 1HKSA 3ZMZA 4UVAA 3MFKA 3HSEA 2PMHA 3QPHA 5HLGA 4HBLA 2JSCA 3TO9A 4B09A 2XAQA 5IT3A 3U9GA 3K2ZA 3P9CA 4IHSA 2J5OA 4KMUX 3DV8A 2HWVA 1G3TA 2DQRA 2GA1A 3LQRA 1P92A 2M45A 3LA3A 4L9TA 1O3RA 1S8NA 4ON0A 3VOEA 2XVCA 3DEUA 3WTYC 4I02A 4G7ZF 1QO0D 2RDPA 4N9IA 3CUQC 2ESNA 1KQ0A 5LGUA 3HHGA 2RKHA 2EFPA 3PQJA 3E6DA 5E18F 3DPTA 2VOPA 4G7HF 4KNYA 4LB6B 3TKYA 4OIOF 2FOKA 1B1BA 3RJPA 2RGVA 4AIHA 3FXUA 1KU9A 1Y0UA 3IRQA 1TQMA 2F5FA 1MDMA 4OMZA 2W85A 1ZN2A 4NB5A 2GA2A 3F8CA 3WTWC 1FP1D 4N9HA 2E7XA 2GXGA 4RAZA 2DQLA 2G7HA 5D6EA 2W25A 5IT9K 1XGMA 4LLNA 3E5QA 3R60A 2RC4A 2Y75A 3L2CA 1FBSA 1XDSA 1WQ2A 4IRGA 4LG0A 3F22A 3ISPA 1XDUA 1UHMA 5D4RA 2FBKA 5J8FA 4MHGA 4R79A 3LSTA 3W6JB 3K1PA 1S3JA 1YS6A 2F2EA 4IVNA 2K7LA 3HRTA 5CVVA 1D5VA 2PQ8A 3J81Z 2VN2A 5E1WA 3ULQB 4TV7A 1OMIA 2FU4A 1S7AA 1ZG5A 3BPVA 3MZYA 4RGRA 3HRMA 2EB7A 3FZVA 4HV5A 4U0YA 3I53A 2DTRA 1T39A 5FD6A 3E97A 1U5TC 5EEGA 1ZG3A 5DCMA 1OYIA 3QU6A 4QWQA 1W5SA 2HS5A 1HW1A 3WG9A 1JE8A 5KVRA 4EGYA 1FNNA 1KYZA 4L5JA 4FX0A 1O3SA 4LJZF 1K78A 2VT3A 4AVPA 1J0RA 3GZ6A 5CJ9A 3L00A 5E1XA 2VBWA 2HZTA 3JAMK 2QWWA 1H0MA 2FF4A 4KDPA 2FSWA 2JRTA 1IXRC 5JHUA 2OZ6A 1U6GA 3FMRA 4I2OA 2NRAC 3ABTA 4P55A 1I27A 5HDGA 5CVIA 4HX8A 4HZFA 2XGXA 4R8HA 3IRRA 3L09A 2E1NA 2XRNA 1R1UA 4UVBA 2H94A 3SZTA 4JQFA 3E5UA 2P5KA 2FBHA 1H9GA 3ERED 1T38A 3D0SA 1STZA 5JVTA 4HYEA 3QP5A 5LLQA 2K4JA 3MEXA 4YFKF 5IT9Z 2DPDA 1HXDA 4ASNA 1FX7A 2DO7A 3E6BA 4LGWA 3G3ZA 1JXSA 3O3KA 1OPCA 3C7JA 2K4BA 3FXQA 2FNPA 1TTYA 2OAZA 2ZXJA 4KICA 2CQKA 4OOIA 4LLGF 4RAYA 3P7NA 3HSRA 4Y15A 4P9UA 3DQVC 1QZYA 1JHFA 3B73A 1FPQA 3TO6A 2DAOA 4WXHA 4A0YA 4B8XA 3WGIA 1LVAA 1B59A 4KFCA 3CUOA 1LDJA 1LNWA 2P5LC 2CFXA 2PEXA 3TDZC 1KU2A 3ML6A 2FBIA 5D5WB 4A6EA 5DDGA 3I59B 1J75A 1MKMA 4LD5A 5CLSA 2FNAA 1OYYA 3NQOA 4KN7X 3BWGA 4BNCA 1TLHB 3K1NA 5F1RA 3C1DA 3VODA 4XBFA 4HDVA 3MAJA 5KK1A 4E70A 3FMQA 4EM2A 3V8KA 3SXYA 1UHWA 3I64A 2EFQA 2VC1A 4K2EA 2LSOA 3JAMZ 2COMA 2HQRA 2L4AA 3TQNA 3QP6A 3GVAA 3HTUA 5AIPA 2IT0A 2D1VA 1LEAA 4LB5A 1ODDA 2KRFA 1XSVA 3CTAA 3E5XA 1SD7A 1J2XA 1TW2A 4M9ZA 1AOYA 2D1HA 1LEBA 4RS8A 1PP7U 2L3DA 1KA8A 1IN8A 2ZKZA 2VBZA 4A5MA 2XHKA 1YYVA 1TNTA 3M1EA 1DDNA 2IJLA 2HQNA 3CDHA 1R5HA 5HS9A 1MJBA 2KIFA 3JSOA 2PJPA 3M9AA 5ICGA 4U88A 2OA4A 3GXOA 3FM3A 4AD9A 1YG2A 2OBPA 1UCRA 3HOTA 3CLOA 1C0WA 2X4HA 1FYKA 2EA2A 2XV4S 3I58A 2R7DA 1CGPA 1GHCA 2XKPA 3GO5A 5CVJA 2BV6A 1FSHA 2L02A 1XMAA 3PQKA 3COAC 4OINF 1TBXA 2QVOA 1MD0A 4KT5C 5ILUA 3IWZA 5L3CA 2KIMA 3DP7A 4KA4A 1U8RA 2E7WA 2HDCA 1XB4A 2HGCA 1BOAA 1ULYA 1FC3A 5EEHA 3I54A 5ICFA 2Z3YA 5DD4A 4CGZA 1IAWA 5LGNA 2NAZA 2LKPA 3IC7A 2LF7A 2UWMA 3GF2A 3KEOA 2DU9A 1ONVA 4IHTA 2PBIA 3J7AO 4L9VA 3V8JA 3U1DA 2RQPA 1IZ1A 3H3UA 5BOXA 4FT8A 2V79A 4A6DA 2CGPA 3ZP5A 3V7RA 2GWRA 2ZNZA 2Z5UA 2EA4A 3ZQ7A 3GUDA 2M1BA 2MLGA 2VBXA 3GFIA 3Q9VA 4H0EA 1XCVA 4BHBA 4HDUA 3W6KB 2P8TA 5JI6A 4EM1A 2CW0F 3ZMTA 4N0BA 3WTTC 1WRJA 3HHHA 5LEJA 4XLNF 4DQ2A 2ELHA 4MQ9F 5FB2A 2DFIA 5JFRA 2QM3A 3FHZA 1ZGJA 5ILSA 1EH6A 1PDNC 4MEXF 4Y17A 5K5QA 2NNYA 1R7JA 4RB0A 2G9WA 3NRVA 4A12A 1FSEA 1IN5A 1QQIA 5JR3A 2Z99A 1Z91A 1BC7C 1KGSA 4MTEA 5LGTA 4LK0F 1MDMB 1R1TA 5BPDA 4OMYA 3ECHA 5H6QA 2DPUA 1O3QA 3DPLC 5TJJA 4L18B 1VTNC 4I0AA 1F9NA 4EGZA 1LQ1A 4GGGA 5E20A 2JT1A 5D4SA 4CYDA 1G4DA 2MD5A 3GFLA 1T2KA 1W7PA 2HYFA 3JTHA 2ISZA 1WWXA 5ICEA 2D2WA 4WF2A 1HKQA 3LWFA 4ETSA 3P9KA 4XLPF 2H27A 1NHAA 3LA2A 3LAPA 3QPTA 1FOKA 5J6XA 4RGXA 2M87A 1K6OA 2RNJA 5HVQC 2ZO4A 1HBXG 3BJOA 3KZZA 5DD8A 5LBQA 1IN4A 2QYOA 4FHTA 4IPAA 5LHGA 4Q48A 4ENNA 1YS7A 5DYMA 1F4KA 4ESJA 5DUKA 2NYXA 2PMUA 1Z05A 2VONA 1XMKA 5HDNA 3CO7C 2J5PA 2V1UA 1JGSA 2QUFA 2A61A 1R58A 1TW3A 1P6RA 1SD4A 2KIUA 2OQRA 3V7SA 4CDGA 2P4WA 5DCMB 1L3LA 2ZFWA 5LEKA 5ERIA 2IA1A 3WU0A 3IKVA 3U2RA 3FWEA 4PGGA 3EQLF 4WK8F 1PUEE 4MEYF 2F5DA 2ZMEA 1KU7A 1Z7UA 1K78B 4F7ZA 1E17A 4UHTA 4BH9A 2MH2A 4UV9A 4DNCA 1I6XA 4BYYA 1YW9A 1ZAOA 4JBAA 3GEZA 3KCCA 4EJTA 3R0JA 4O6JA 2KJCA 3O6BB 1YQAA 1FYLA 4RB1A 5L3EA 2Y48A 4CO8A 4RB3C 1O7LA 2LF8A 4U7DA 4O3MA 3CUQA 1IXCA 1TQPA 3ABUA 3C18A 1OKRA 2QZ8A 1LDDA 2OQGA 1FP2A 2KKOA 2L01A 1IRFA 1CF7A 1HSTA 2V1DA 4L9JA 5J8CA 2A3SA 2DK8A 2XAGA 4HA8A 2VOOA 3MWMA 4NHJA 1YO5C 4EQQA 2RVCA 3Q5FA 3ZN1A 2KJBA 5D5UB 1FWZA 2CG4A 1P2FA 5CVUA 3SFZA 4MTDA 2FEZA 2G7UA 4A0ZA 2ZBKA 3F23A 5L3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMZ A;  1I5Z A;  2IA0 A;  3BY6 A;  1R00 A;  3EDP A;  1FBU A;  1FLI A;  2EJR A;  2YR2 A;  1F1Z A;  4HF2 A;  3SHF A;  3BOQ A;  1Q1H A;  2QBY A;  2CWE A;  1XD7 A;  2WC2 A;  3ECO A;  3T5X A;  5ED4 A;  3E3V A;  2VXZ A;  5HS7 A;  4P9F A;  4HOB A;  1YTY A;  2P7C B;  4M6X A;  2M30 A;  1Z1D A;  5H20 A;  1FYM A;  3IWF A;  4MQV A;  1BI3 A;  1U5T A;  5FO5 A;  2C6Y A;  4YG2 F;  3I4P A;  5HOO A;  3ZMV A;  2GAU A;  3RKW A;  2X0L A;  3RPQ A;  3GLX A;  3LA7 A;  1MJA A;  1L0O C;  4M9S A;  5FFZ A;  3IKT A;  2A69 F;  3FMS A;  1B6A A;  2XAF A;  2XUB A;  4WXC A;  2NS0 A;  1U3E M;  1J59 A;  2B0L A;  1DP7 P;  4OIQ F;  2UXX A;  3ZPL A;  2Y0M A;  3REO A;  3KEQ A;  4HF1 A;  4AIJ A;  3RIR A;  2DI3 A;  3BPX A;  3JSP A;  3GFJ A;  3RYR A;  5HS8 A;  2O0Y A;  2R3S A;  3VFZ A;  3MZH A;  4BQA A;  5DCF A;  2BE5 F;  2XRO A;  2FMY A;  5FLX K;  2VOD A;  5BS6 A;  4M73 A;  5LRR A;  3GW2 A;  2NNN A;  3LFK A;  2K86 A;  1W5T A;  4UVC A;  2YX4 A;  3E6M A;  4G8X A;  3B02 A;  1R23 A;  1BJA A;  3K1M A;  2A5Y B;  1SMY F;  3T1B A;  2MH9 A;  2QQA A;  2CO5 A;  3KP6 A;  4CZZ A;  4IJA A;  2VE8 A;  2XKO A;  3WGG A;  1ZRC A;  3HUG A;  4EJW A;  3CO6 C;  6PAX A;  5K5R A;  3WE2 A;  3RYP A;  1ZAR A;  2HR3 A;  3H3Z A;  1KQ8 A;  3ZMD A;  3AAF A;  2W24 A;  5ICC A;  2ZCW A;  4MNU A;  2K02 A;  3T8T A;  1RNL A;  1P4W A;  4ZZL A;  4EJO A;  2M5W A;  3H92 A;  4HF0 A;  3F21 A;  4ZH4 F;  4QLC U;  4ESF A;  4A2U A;  2PI0 A;  1R5G A;  2A6E F;  2OD5 A;  2L54 A;  1XGS A;  1R22 A;  4WX9 A;  5D5V B;  2BBY A;  1G3S A;  3ZMS A;  1D8K A;  2VBY A;  4U7B A;  4GXO A;  2P6T A;  1QNT A;  3ZN0 A;  4KIF A;  1W7P D;  5DV5 A;  1O3T A;  4S05 A;  3HRU A;  1SFE A;  1RI7 A;  2TDX A;  3T0Y A;  2Z9O A;  2DLL A;  1A04 A;  4EM0 B;  2VT2 A;  3P9I A;  1ZGA A;  2A68 F;  4WWC A;  3F72 A;  5TRD A;  3PFI A;  1X3U A;  3EET A;  3MQ0 A;  3S2W A;  3F8F A;  3VB2 A;  2FRH A;  4PDK A;  1BN5 A;  2IVM A;  2IW5 A;  4WXD A;  5HLH A;  1OR7 A;  4HW0 A;  4M72 A;  5H6R A;  3RDI A;  1ZHF A;  3DFG A;  1S7O A;  1K7A A;  3HSF A;  3RKY A;  1QZZ A;  3F8N A;  3TOB A;  1P4X A;  5FLX Z;  1U78 A;  1B9M A;  3F6O A;  1Z6T A;  2FA5 A;  2JPB A;  3K69 A;  3NEU A;  3JTG A;  3OOP A;  4AWX B;  2CSO A;  4UXN A;  4OIP F;  3RI4 A;  5BQT A;  4RGS A;  2IA2 A;  3WOD F;  3HRS A;  2O3F A;  2AXL A;  2R7F A;  1KYW A;  2H6C A;  5F64 A;  5D6F A;  1FZP B;  4YFN F;  3KFW X;  5DUI A;  3TGN A;  4PCQ A;  1O7F A;  2MC3 A;  3J80 K;  4I0B A;  2PFB A;  3KP5 A;  2EV6 A;  2XAH A;  3R4K A;  5F6F A;  3WTX C;  4JK1 X;  4ZYE A;  4HLY A;  4KN4 X;  1FBQ A;  4ENJ A;  1G6N A;  1XGN A;  1YLF A;  4LFU A;  1V3F A;  4A0X A;  1ON1 A;  1D3Y A;  4S04 A;  3R61 A;  1W7P B;  1AWC A;  2ACJ A;  1RIO H;  2JTV A;  2MLK A;  4GYG A;  4HQM A;  2Z33 A;  1DUX C;  4Z2Y A;  2HTS A;  3FX3 A;  4I98 B;  2OU2 A;  2P7V B;  4OU0 A;  3N4M A;  2EV5 A;  1B4A A;  3QAH A;  4U0W A;  2JPC A;  1T98 A;  3KP7 A;  1GVJ A;  3TO7 A;  4LG0 B;  4HQE A;  3HYI A;  5ILV A;  2EV0 A;  3VEP A;  2A07 F;  2O61 A;  1LB2 A;  4LLL A;  2IP2 A;  2P5V A;  2EFW A;  3BJ6 A;  4NQW A;  4I01 A;  1WSU A;  1BIA A;  2DW4 A;  1D8J A;  1B9N A;  4KMF A;  5CYV A;  1ZH5 A;  5E8I A;  1RUO A;  1IN7 A;  2FQ3 A;  4P5O A;  1HQC A;  5HDK A;  1GXQ A;  4EMS A;  5CVR A;  2Q2E A;  3BDD A;  3N97 A;  2M8E A;  2AS5 F;  3V7C A;  2Q0O A;  4KYW A;  4O5V A;  2ZNY A;  1P4A A;  2YU3 A;  1QGP A;  1GXP A;  4M74 A;  1SAX A;  2ZME B;  2H09 A;  1ON2 A;  3GFM A;  3WU1 B;  4R1H A;  4G7O F;  5FFX A;  1PP8 F;  4G94 A;  4L0Y B;  2FXA A;  4PZJ A;  3Q9S A;  1SFX A;  3E6C C;  4EJU A;  1MJ9 A;  3SQN A;  3G73 A;  5E17 F;  2QEN A;  2DK5 A;  3DF8 A;  5LHH A;  1SD6 A;  4UUV A;  4HV6 A;  4XSX F;  3F6V A;  5AIQ A;  3F8M A;  3KLN A;  3J80 Z;  3GWZ A;  1ZRD A;  3CUQ B;  2O8X A;  4RGU A;  2IPQ X;  2Q8K A;  2EFO A;  4Q5S F;  3BJA A;  1BM9 A;  2WTE A;  1RZ4 A;  2RV8 A;  4CHU A;  5BPI A;  1XGO A;  1IN6 A;  1CF7 B;  4MGR A;  4L0Z B;  4HX7 A;  2STW A;  4UNO A;  2CYY A;  2E1C A;  3LQQ A;  2FE3 A;  2UXN A;  2DT5 A;  2HYG D;  5AON A;  3L7W A;  1WI9 A;  3CJN A;  1RUN A;  3LAJ A;  2HOE A;  1I1S A;  5FGM A;  3V8L A;  3EUH A;  5E1Z B;  4YIF A;  1DPR A;  4I7H A;  2VC0 A;  1O57 A;  4YFX F;  2BGC A;  2HEO A;  2W57 A;  4ENM A;  2GZW A;  1XCB A;  1XN7 A;  4BXU A;  2QQB A;  1BC8 C;  1K79 A;  1F5T A;  1MGT A;  4ZYH A;  3F8B A;  5L3D A;  3KP4 A;  5E8G A;  3C3W A;  4ESB A;  3TDU C;  4WCG A;  1V4R A;  1QBJ A;  1J9I A;  3OV8 A;  3DXJ F;  1EH7 A;  4D0P A;  2QBY B;  4M6Y A;  2UZK A;  2WV0 A;  4PGH A;  1LDK B;  1XSX A;  1ZLJ A;  4FX4 A;  4ZZD A;  1S29 A;  1EV7 A;  2BEO A;  4XSZ F;  3HIF A;  1YFH A;  4G9Y A;  3ROU A;  3R6S A;  1I1G A;  3GZ5 A;  3KP3 A;  3I5U A;  1OYW A;  4OIR F;  4AIK A;  1MZB A;  1HSJ A;  2HKO A;  2YPR A;  2EK5 A;  3GX4 X;  1U5T B;  2HTJ A;  4L9N A;  3ELK A;  3KLO A;  2ETH A;  2P6S A;  1IW7 F;  4IF4 A;  4BAY A;  3WE3 A;  1U2W A;  5A2Q K;  1BI2 A;  2K27 A;  2HKX A;  4UV8 A;  1KQ9 A;  1YW8 A;  2D45 A;  2V1X A;  1BI0 A;  1SMT A;  3BZ6 A;  3V4G A;  4YII A;  4BHP A;  1E2X A;  1XSD A;  2PN6 A;  3M7G A;  3I59 A;  4KIG A;  1Z9C A;  3BP8 A;  4G6Q A;  1UB9 A;  3D5L A;  1EH8 A;  3F3X A;  3GYH X;  2WWY A;  1Z6R A;  2ADU A;  4HAM A;  1REP C;  1ZLK A;  2F5C A;  1SFU A;  4Y13 A;  2PLY A;  2LNB A;  3M8E A;  2GQQ A;  2V6C A;  3O2P E;  5K1Y A;  1IXS B;  4CIC A;  1YW7 A;  1BI1 A;  5D8K B;  3RKX A;  4M71 A;  1HKT A;  3HTS B;  2GIV A;  4ENK A;  3ZMU A;  2LDU A;  2VE9 A;  4ZYG A;  3T8R A;  1KU3 A;  3WGH A;  1H9T A;  4GO1 A;  1W4M A;  2O6G E;  4XRF A;  3IL2 A;  3EYY A;  1LJ9 A;  1S6L A;  1FY7 A;  3KP2 A;  5L3G A;  2PG4 A;  3WTZ A;  4A5N A;  4LK1 F;  4RB2 C;  4KUM A;  4BHC A;  3QRF F;  1G3Y A;  1DPU A;  3M8F A;  3KE2 A;  3JW4 A;  2XAJ A;  1UST A;  1J7K A;  1T6S A;  3RTR A;  4U0V A;  1IRG A;  1WKM A;  1T0F A;  3R0A A;  2IRF G;  1USS A;  1IF1 A;  1ZG1 A;  5LRS A;  3QU3 A;  3SZP A;  2ESH A;  4ZYD A;  5D5X B;  1JHH A;  1ZRF A;  2O03 A;  2EWN A;  4Q47 A;  5FD5 A;  3HOS A;  3I71 A;  3IHU A;  2GXB A;  4IXA A;  2QQ9 A;  4IRI A;  4GYI A;  4I09 A;  5D8L B;  3KZY A;  4IRH A;  2W84 A;  3EYI A;  2OZU A;  2YSR A;  1G3W A;  2QLZ A;  2ISY A;  2L4M A;  1QPM A;  3K9T A;  4EJV A;  5A2Q Z;  4M9X A;  4EVI A;  3K0L A;  4P96 A;  3KET A;  2DBB A;  2H6B A;  1HW5 A;  5K5O A;  2YX7 A;  1TQI A;  3FF5 A;  3BRO A;  4Q4Z F;  1BBY A;  4G6D A;  3MCZ A;  1ZYR F;  3RPU A;  2BYV E;  3TOA A;  4CXF A;  3WTU C;  1R36 A;  4KIB A;  5DEQ A;  1TNS A;  4HLX A;  1ZRE A;  3FXR A;  3I0T A;  1FT9 A;  2JZY A;  2V9V A;  2ZJ2 A;  1BIB A;  4L5I A;  2A6H F;  3QOP A;  1SD5 A;  2XAS A;  5HLI A;  4EV0 A;  3L9F A;  4HX4 A;  1IUY A;  1YIO A;  2RN7 A;  2F5E A;  3WTS C;  4LMY A;  3FM5 A;  3J81 K;  1UFM A;  3WTV C;  4GCV A;  2FML A;  1J5Y A;  2MBF A;  2HFH A;  2EFN A;  1R1V A;  3DKW A;  2STT A;  5LHI A;  1HW2 A;  2XIG A;  5L3F A;  2MA3 A;  1HKS A;  3ZMZ A;  4UVA A;  3MFK A;  3HSE A;  2PMH A;  3QPH A;  5HLG A;  4HBL A;  2JSC A;  3TO9 A;  4B09 A;  2XAQ A;  5IT3 A;  3U9G A;  3K2Z A;  3P9C A;  4IHS A;  2J5O A;  4KMU X;  3DV8 A;  2HWV A;  1G3T A;  2DQR A;  2GA1 A;  3LQR A;  1P92 A;  2M45 A;  3LA3 A;  4L9T A;  1O3R A;  1S8N A;  4ON0 A;  3VOE A;  2XVC A;  3DEU A;  3WTY C;  4I02 A;  4G7Z F;  1QO0 D;  2RDP A;  4N9I A;  3CUQ C;  2ESN A;  1KQ0 A;  5LGU A;  3HHG A;  2RKH A;  2EFP A;  3PQJ A;  3E6D A;  5E18 F;  3DPT A;  2VOP A;  4G7H F;  4KNY A;  4LB6 B;  3TKY A;  4OIO F;  2FOK A;  1B1B A;  3RJP A;  2RGV A;  4AIH A;  3FXU A;  1KU9 A;  1Y0U A;  3IRQ A;  1TQM A;  2F5F A;  1MDM A;  4OMZ A;  2W85 A;  1ZN2 A;  4NB5 A;  2GA2 A;  3F8C A;  3WTW C;  1FP1 D;  4N9H A;  2E7X A;  2GXG A;  4RAZ A;  2DQL A;  2G7H A;  5D6E A;  2W25 A;  5IT9 K;  1XGM A;  4LLN A;  3E5Q A;  3R60 A;  2RC4 A;  2Y75 A;  3L2C A;  1FBS A;  1XDS A;  1WQ2 A;  4IRG A;  4LG0 A;  3F22 A;  3ISP A;  1XDU A;  1UHM A;  5D4R A;  2FBK A;  5J8F A;  4MHG A;  4R79 A;  3LST A;  3W6J B;  3K1P A;  1S3J A;  1YS6 A;  2F2E A;  4IVN A;  2K7L A;  3HRT A;  5CVV A;  1D5V A;  2PQ8 A;  3J81 Z;  2VN2 A;  5E1W A;  3ULQ B;  4TV7 A;  1OMI A;  2FU4 A;  1S7A A;  1ZG5 A;  3BPV A;  3MZY A;  4RGR A;  3HRM A;  2EB7 A;  3FZV A;  4HV5 A;  4U0Y A;  3I53 A;  2DTR A;  1T39 A;  5FD6 A;  3E97 A;  1U5T C;  5EEG A;  1ZG3 A;  5DCM A;  1OYI A;  3QU6 A;  4QWQ A;  1W5S A;  2HS5 A;  1HW1 A;  3WG9 A;  1JE8 A;  5KVR A;  4EGY A;  1FNN A;  1KYZ A;  4L5J A;  4FX0 A;  1O3S A;  4LJZ F;  1K78 A;  2VT3 A;  4AVP A;  1J0R A;  3GZ6 A;  5CJ9 A;  3L00 A;  5E1X A;  2VBW A;  2HZT A;  3JAM K;  2QWW A;  1H0M A;  2FF4 A;  4KDP A;  2FSW A;  2JRT A;  1IXR C;  5JHU A;  2OZ6 A;  1U6G A;  3FMR A;  4I2O A;  2NRA C;  3ABT A;  4P55 A;  1I27 A;  5HDG A;  5CVI A;  4HX8 A;  4HZF A;  2XGX A;  4R8H A;  3IRR A;  3L09 A;  2E1N A;  2XRN A;  1R1U A;  4UVB A;  2H94 A;  3SZT A;  4JQF A;  3E5U A;  2P5K A;  2FBH A;  1H9G A;  3ERE D;  1T38 A;  3D0S A;  1STZ A;  5JVT A;  4HYE A;  3QP5 A;  5LLQ A;  2K4J A;  3MEX A;  4YFK F;  5IT9 Z;  2DPD A;  1HXD A;  4ASN A;  1FX7 A;  2DO7 A;  3E6B A;  4LGW A;  3G3Z A;  1JXS A;  3O3K A;  1OPC A;  3C7J A;  2K4B A;  3FXQ A;  2FNP A;  1TTY A;  2OAZ A;  2ZXJ A;  4KIC A;  2CQK A;  4OOI A;  4LLG F;  4RAY A;  3P7N A;  3HSR A;  4Y15 A;  4P9U A;  3DQV C;  1QZY A;  1JHF A;  3B73 A;  1FPQ A;  3TO6 A;  2DAO A;  4WXH A;  4A0Y A;  4B8X A;  3WGI A;  1LVA A;  1B59 A;  4KFC A;  3CUO A;  1LDJ A;  1LNW A;  2P5L C;  2CFX A;  2PEX A;  3TDZ C;  1KU2 A;  3ML6 A;  2FBI A;  5D5W B;  4A6E A;  5DDG A;  3I59 B;  1J75 A;  1MKM A;  4LD5 A;  5CLS A;  2FNA A;  1OYY A;  3NQO A;  4KN7 X;  3BWG A;  4BNC A;  1TLH B;  3K1N A;  5F1R A;  3C1D A;  3VOD A;  4XBF A;  4HDV A;  3MAJ A;  5KK1 A;  4E70 A;  3FMQ A;  4EM2 A;  3V8K A;  3SXY A;  1UHW A;  3I64 A;  2EFQ A;  2VC1 A;  4K2E A;  2LSO A;  3JAM Z;  2COM A;  2HQR A;  2L4A A;  3TQN A;  3QP6 A;  3GVA A;  3HTU A;  5AIP A;  2IT0 A;  2D1V A;  1LEA A;  4LB5 A;  1ODD A;  2KRF A;  1XSV A;  3CTA A;  3E5X A;  1SD7 A;  1J2X A;  1TW2 A;  4M9Z A;  1AOY A;  2D1H A;  1LEB A;  4RS8 A;  1PP7 U;  2L3D A;  1KA8 A;  1IN8 A;  2ZKZ A;  2VBZ A;  4A5M A;  2XHK A;  1YYV A;  1TNT A;  3M1E A;  1DDN A;  2IJL A;  2HQN A;  3CDH A;  1R5H A;  5HS9 A;  1MJB A;  2KIF A;  3JSO A;  2PJP A;  3M9A A;  5ICG A;  4U88 A;  2OA4 A;  3GXO A;  3FM3 A;  4AD9 A;  1YG2 A;  2OBP A;  1UCR A;  3HOT A;  3CLO A;  1C0W A;  2X4H A;  1FYK A;  2EA2 A;  2XV4 S;  3I58 A;  2R7D A;  1CGP A;  1GHC A;  2XKP A;  3GO5 A;  5CVJ A;  2BV6 A;  1FSH A;  2L02 A;  1XMA A;  3PQK A;  3COA C;  4OIN F;  1TBX A;  2QVO A;  1MD0 A;  4KT5 C;  5ILU A;  3IWZ A;  5L3C A;  2KIM A;  3DP7 A;  4KA4 A;  1U8R A;  2E7W A;  2HDC A;  1XB4 A;  2HGC A;  1BOA A;  1ULY A;  1FC3 A;  5EEH A;  3I54 A;  5ICF A;  2Z3Y A;  5DD4 A;  4CGZ A;  1IAW A;  5LGN A;  2NAZ A;  2LKP A;  3IC7 A;  2LF7 A;  2UWM A;  3GF2 A;  3KEO A;  2DU9 A;  1ONV A;  4IHT A;  2PBI A;  3J7A O;  4L9V A;  3V8J A;  3U1D A;  2RQP A;  1IZ1 A;  3H3U A;  5BOX A;  4FT8 A;  2V79 A;  4A6D A;  2CGP A;  3ZP5 A;  3V7R A;  2GWR A;  2ZNZ A;  2Z5U A;  2EA4 A;  3ZQ7 A;  3GUD A;  2M1B A;  2MLG A;  2VBX A;  3GFI A;  3Q9V A;  4H0E A;  1XCV A;  4BHB A;  4HDU A;  3W6K B;  2P8T A;  5JI6 A;  4EM1 A;  2CW0 F;  3ZMT A;  4N0B A;  3WTT C;  1WRJ A;  3HHH A;  5LEJ A;  4XLN F;  4DQ2 A;  2ELH A;  4MQ9 F;  5FB2 A;  2DFI A;  5JFR A;  2QM3 A;  3FHZ A;  1ZGJ A;  5ILS A;  1EH6 A;  1PDN C;  4MEX F;  4Y17 A;  5K5Q A;  2NNY A;  1R7J A;  4RB0 A;  2G9W A;  3NRV A;  4A12 A;  1FSE A;  1IN5 A;  1QQI A;  5JR3 A;  2Z99 A;  1Z91 A;  1BC7 C;  1KGS A;  4MTE A;  5LGT A;  4LK0 F;  1MDM B;  1R1T A;  5BPD A;  4OMY A;  3ECH A;  5H6Q A;  2DPU A;  1O3Q A;  3DPL C;  5TJJ A;  4L18 B;  1VTN C;  4I0A A;  1F9N A;  4EGZ A;  1LQ1 A;  4GGG A;  5E20 A;  2JT1 A;  5D4S A;  4CYD A;  1G4D A;  2MD5 A;  3GFL A;  1T2K A;  1W7P A;  2HYF A;  3JTH A;  2ISZ A;  1WWX A;  5ICE A;  2D2W A;  4WF2 A;  1HKQ A;  3LWF A;  4ETS A;  3P9K A;  4XLP F;  2H27 A;  1NHA A;  3LA2 A;  3LAP A;  3QPT A;  1FOK A;  5J6X A;  4RGX A;  2M87 A;  1K6O A;  2RNJ A;  5HVQ C;  2ZO4 A;  1HBX G;  3BJO A;  3KZZ A;  5DD8 A;  5LBQ A;  1IN4 A;  2QYO A;  4FHT A;  4IPA A;  5LHG A;  4Q48 A;  4ENN A;  1YS7 A;  5DYM A;  1F4K A;  4ESJ A;  5DUK A;  2NYX A;  2PMU A;  1Z05 A;  2VON A;  1XMK A;  5HDN A;  3CO7 C;  2J5P A;  2V1U A;  1JGS A;  2QUF A;  2A61 A;  1R58 A;  1TW3 A;  1P6R A;  1SD4 A;  2KIU A;  2OQR A;  3V7S A;  4CDG A;  2P4W A;  5DCM B;  1L3L A;  2ZFW A;  5LEK A;  5ERI A;  2IA1 A;  3WU0 A;  3IKV A;  3U2R A;  3FWE A;  4PGG A;  3EQL F;  4WK8 F;  1PUE E;  4MEY F;  2F5D A;  2ZME A;  1KU7 A;  1Z7U A;  1K78 B;  4F7Z A;  1E17 A;  4UHT A;  4BH9 A;  2MH2 A;  4UV9 A;  4DNC A;  1I6X A;  4BYY A;  1YW9 A;  1ZAO A;  4JBA A;  3GEZ A;  3KCC A;  4EJT A;  3R0J A;  4O6J A;  2KJC A;  3O6B B;  1YQA A;  1FYL A;  4RB1 A;  5L3E A;  2Y48 A;  4CO8 A;  4RB3 C;  1O7L A;  2LF8 A;  4U7D A;  4O3M A;  3CUQ A;  1IXC A;  1TQP A;  3ABU A;  3C18 A;  1OKR A;  2QZ8 A;  1LDD A;  2OQG A;  1FP2 A;  2KKO A;  2L01 A;  1IRF A;  1CF7 A;  1HST A;  2V1D A;  4L9J A;  5J8C A;  2A3S A;  2DK8 A;  2XAG A;  4HA8 A;  2VOO A;  3MWM A;  4NHJ A;  1YO5 C;  4EQQ A;  2RVC A;  3Q5F A;  3ZN1 A;  2KJB A;  5D5U B;  1FWZ A;  2CG4 A;  1P2F A;  5CVU A;  3SFZ A;  4MTD A;  2FEZ A;  2G7U A;  4A0Z A;  2ZBK A;  3F23 A;  5L3B A; 
#chains in the Genus database with same CATH topology
 2CUZ A;  5BMZ A;  1I5Z A;  4Y52 J;  4DZJ A;  2IA0 A;  3BY6 A;  1R00 A;  2OCE A;  3S14 J;  2LMD A;  3EDP A;  1FBU A;  1FLI A;  2EJR A;  3CF5 F;  2WB1 A;  2KQR A;  3D5S C;  3W2V A;  3IV5 A;  2YR2 A;  1FIP A;  3FKJ A;  4V2G A;  5M5W J;  3LSR A;  1F1Z A;  3MKL A;  4HF2 A;  3SHF A;  4CA0 A;  3BOQ A;  5GAE J;  1Q1H A;  2QBY A;  2CWE A;  1WJF A;  1XD7 A;  4FQG A;  4F52 A;  2WC2 A;  1D1A A;  3ECO A;  1A31 A;  1G8X A;  3J7Z I;  1VFC A;  2L7F P;  3T5X A;  5ED4 A;  1OCC H;  3MKY B;  3E3V A;  2VXZ A;  2W1O A;  2EQR A;  1VQL I;  3N05 A;  5HS7 A;  5IYC J;  4B1R A;  4P9F A;  3JRC A;  4HOB A;  3EUA A;  1YTY A;  4C9Y A;  1B72 B;  2P7C B;  4PFO A;  4M6X A;  2M30 A;  1SFK A;  2DA3 A;  3CJR B;  1Z1D A;  5H20 A;  1FYM A;  3IWF A;  4E7S A;  4MQV A;  1BI3 A;  4RAF A;  1U5T A;  5FO5 A;  3VYU B;  1ZR4 A;  2C6Y A;  3DCF A;  4YG2 F;  5J1R A;  5EDN A;  3I4P A;  5HOO A;  3ZMV A;  2GAU A;  4BEH A;  1JUM A;  2FOW A;  1FOY A;  3RKW A;  5KHD A;  2X0L A;  3W3C A;  3RPQ A;  3GLX A;  3LA7 A;  1MJA A;  3OYB A;  1L0O C;  4M9S A;  4IHY A;  3ZQH A;  2BY1 A;  5FFZ A;  1YIJ I;  3HJE A;  1WI3 A;  4RDU A;  4BJ5 C;  3S16 J;  3IKT A;  2LH9 A;  2XC7 A;  2VUM J;  2QCO A;  1VI0 A;  2A69 F;  3FMS A;  1B6A A;  1OJL A;  2XAF A;  2XUB A;  3DBR B;  4WXC A;  1ACI A;  1MBJ A;  2NS0 A;  3H5A A;  2KP6 A;  3A02 A;  5IP7 J;  5C4X J;  3D5R C;  4C30 A;  1U3E M;  1J59 A;  2B0L A;  2JSP A;  1A6I A;  1DP7 P;  4OIQ F;  5EF6 A;  1E3H A;  2UXX A;  4PFP A;  2HI3 A;  3ZPL A;  2Y0M A;  5DTD A;  3REO A;  5FRM A;  1QHG A;  3KEQ A;  4HF1 A;  4AIJ A;  1Z67 A;  2RRE A;  3RIR A;  2DI3 A;  3BPX A;  4LIU A;  1JGG A;  3S32 A;  3KIO A;  3JSP A;  3GFJ A;  4KIT B;  3RYR A;  2ID6 A;  4BAC A;  2R5Y A;  4XL9 A;  5HS8 A;  1SVM A;  1YE9 A;  2O0Y A;  2R3S A;  3VFZ A;  3MZH A;  2DA6 A;  4BQA A;  3K7A J;  5DCF A;  4E7Z A;  2BOL A;  2BY3 A;  2BE5 F;  1X58 A;  3M4O J;  1FIA A;  2XRO A;  2CJJ A;  2FMY A;  5FLX K;  2VOD A;  1UG2 A;  5BS6 A;  4JX6 A;  4NUB A;  4M73 A;  2VQL A;  5LRR A;  3GW2 A;  2NNN A;  3LFK A;  2K86 A;  2TRT A;  5EJC A;  2KIQ A;  2MC4 A;  1W5T A;  4UVC A;  4BU2 A;  3WHB A;  1FMV A;  2ZJP F;  2YX4 A;  3E6M A;  4G8X A;  2E5Z A;  4N4O B;  3B02 A;  1R23 A;  1JKR C;  2JJ7 A;  2HVR A;  4BY1 J;  5C4J J;  4XOR A;  1BJA A;  3K1M A;  2A5Y B;  2H8W A;  3GTL J;  2WA0 A;  2E1M B;  1SMY F;  3T1B A;  2MH9 A;  2QQA A;  1VF9 A;  2GOX B;  1AA7 A;  3VDX A;  2V26 A;  2CO5 A;  2IS1 A;  2L7M P;  2BW3 B;  1D0X A;  3KP6 A;  4CZZ A;  4IJA A;  2CU7 A;  3JRB A;  1Y8R B;  2VE8 A;  2XKO A;  4DOZ A;  1IO2 A;  3S2H J;  1RPW A;  2VL8 A;  3WGG A;  1VQP I;  1ZRC A;  3HUG A;  2AXT C;  4EJW A;  4D7N A;  5HNF A;  1TZL A;  3CO6 C;  6PAX A;  5K5R A;  3AKZ A;  2OTL I;  3WE2 A;  2GLO A;  3RYP A;  1ZAR A;  2HR3 A;  3H3Z A;  1KQ8 A;  5K7H A;  5EYR A;  3ZMD A;  3AAF A;  2N8G A;  3ZQC A;  3ABK H;  2K85 A;  2JK3 A;  2W24 A;  1IV8 A;  5ICC A;  2ZCW A;  1TWH J;  2BY2 A;  2K02 A;  4MNU A;  3T8T A;  2H1L A;  1RNL A;  1P4W A;  1S5L C;  2CQ7 A;  3CP2 A;  4ZZL A;  4BDZ A;  2LY1 A;  1YRN B;  4EJO A;  2K3F A;  2OV7 A;  1Z3X A;  2M5W A;  3H92 A;  4HF0 A;  2MD0 A;  3F21 A;  3CES A;  4ZH4 F;  2DA2 A;  4HPQ A;  1D1B A;  4QLC U;  4BDY A;  4ESF A;  4A2U A;  2PI0 A;  1R5G A;  2A6E F;  2OD5 A;  4BXF A;  2RNG A;  2L54 A;  1XGS A;  1R22 A;  3VYS B;  5J47 A;  4WX9 A;  5D5V B;  2BBY A;  1MBH A;  1G3S A;  3ZMS A;  1D8K A;  2VBY A;  4U7B A;  1LVK A;  4GXO A;  4C3I J;  1GV5 A;  2P6T A;  3RQI A;  4V19 K;  3BC8 A;  4M6V A;  1QNT A;  3HL2 A;  3ZN0 A;  2E35 A;  4XLE A;  3L1P A;  4KIF A;  1HF0 A;  1W7P D;  5DV5 A;  1O3T A;  4S05 A;  3HRU A;  2KMU A;  4QPQ A;  1MMD A;  1SFE A;  2JMW A;  2OPT A;  1RI7 A;  2TDX A;  1Y39 A;  4LG3 A;  1PYV A;  3T0Y A;  5FKK A;  2Z9O A;  2DLL A;  1A04 A;  2O7O A;  4EM0 B;  1WCM J;  2VT2 A;  3P9I A;  1ZGA A;  2A68 F;  4WWC A;  3F72 A;  5TRD A;  4ZDP A;  3PFI A;  1K6Y A;  1X3U A;  3LSI A;  1Y56 A;  3EET A;  3MQ0 A;  4MIM A;  3S2W A;  3F8F A;  3GZN B;  2Y2Z A;  3QPL A;  3AG4 H;  2DMP A;  2WB1 N;  3VB2 A;  4BKX A;  2FRH A;  4PDK A;  1AHD P;  3WHC A;  2K9S A;  1BN5 A;  2M2E A;  2IVM A;  2IW5 A;  3SZG A;  3MKW B;  2KLO A;  3LSJ A;  4WXD A;  5HLH A;  1EJ9 A;  1K83 J;  1OR7 A;  4HW0 A;  4M72 A;  5H6R A;  1V54 H;  2KDO A;  3RDI A;  4A3C J;  1ZHF A;  3K4N A;  3DFG A;  1S7O A;  2AO9 A;  3OY9 A;  4S0H B;  3JRD A;  1K7A A;  3HSF A;  5J4V A;  4XKB A;  3RKY A;  1QZZ A;  3F8N A;  3FHN A;  3TOB A;  1P4X A;  3OOU A;  5FLX Z;  1U78 A;  1B9M A;  3F6O A;  4UUS A;  2HOT A;  1Z6T A;  2FA5 A;  2AHQ A;  2W48 A;  2JPB A;  3H5R A;  3K69 A;  3NEU A;  2TCT A;  3JTG A;  2JQ7 A;  1UHS A;  4BBR J;  4JOM A;  3OOP A;  4AWX B;  2W4S A;  3PSI A;  2CSO A;  3BR6 A;  4UXN A;  5FJ8 J;  1NTC A;  5EG0 B;  3I4M J;  2BHZ A;  1AU7 A;  1E3O C;  2XSD C;  4OIP F;  3RI4 A;  3KEY A;  5BQT A;  4RGS A;  2LRE A;  2IA2 A;  3K6G A;  3WOD F;  3G6E I;  1POG A;  3HRS A;  2O3F A;  3BG6 A;  2H1K A;  2AXL A;  2JA6 J;  2EZK A;  4XLC A;  1OQY A;  2R7F A;  3CJT B;  1KYW A;  2E34 A;  2H6C A;  5F64 A;  5D6F A;  1FZP B;  3FXJ A;  2VPR A;  1H89 C;  2BY0 A;  4YFN F;  3KFW X;  5DUI A;  3TGN A;  3VSL A;  4PCQ A;  4RLQ A;  1O7F A;  2MC3 A;  3LSG A;  4F3Q A;  3BR1 A;  3J80 K;  4I0B A;  2IS2 A;  2PFB A;  3KP5 A;  1QPI A;  1MBK A;  1RKT A;  1ZK8 A;  2EV6 A;  2XAH A;  4FAS D;  1J9I A;  2FUG 2;  4CCJ A;  3R4K A;  2V9K A;  5F6F A;  5GTI C;  3WTX C;  4JK1 X;  5TIS C;  2E36 A;  4ZYE A;  1JUP A;  4KN4 X;  4EAT A;  1FBQ A;  4HLY A;  2K40 A;  4ENJ A;  1V5G A;  1G6N A;  1XGN A;  3ZCO A;  4KIS A;  1YLF A;  2X1E A;  4LFU A;  1V3F A;  4A0X A;  4F91 B;  1W1W E;  1ON1 A;  1D3Y A;  4S04 A;  4A3G J;  2R5Z B;  1OCO H;  2XPU A;  4I76 A;  4A3F J;  3R61 A;  3DU6 A;  1W7P B;  3K70 C;  1AWC A;  4DW6 A;  2L9N A;  3OYN A;  1ETX A;  4A3M J;  2ACJ A;  3CZ6 A;  1RIO H;  3FIS A;  2CQN A;  4HRI A;  2ECC A;  2JTV A;  2MLK A;  4GYG A;  2F5V A;  4HQM A;  2Z33 A;  1DUX C;  4Z2Y A;  4DGW B;  2HTS A;  2Z1D A;  3E7L A;  3FDY A;  1GUU A;  2IEK A;  2BVM A;  3FX3 A;  4I98 B;  4PJL A;  2Y9Y A;  1ZEL A;  2G0E A;  2ME6 A;  5HLT A;  2OCC H;  1W0U A;  4IEJ A;  2OU2 A;  2P7V B;  2DA1 A;  1MBE A;  3IH2 A;  4I6Z A;  2I10 A;  2DFF A;  2NVY J;  4OU0 A;  3N4M A;  2EV5 A;  1B4A A;  1KON A;  2M4K A;  3QAH A;  4U0W A;  3IP4 B;  3GCM A;  2VJ4 A;  4Z6Y A;  2JPC A;  1T98 A;  3KP7 A;  2P0W A;  1VQN I;  3CCU I;  4MFD A;  1GVJ A;  3TO7 A;  4LG0 B;  4HQE A;  1UG0 A;  2XPW A;  3ZGK A;  1Y0N A;  2X48 A;  5JLW A;  5CKT A;  3HYI A;  4D5C A;  1VQ7 I;  1EA3 A;  5ILV A;  4XKW A;  4PJJ A;  2EV0 A;  3VEP A;  2A07 F;  2O61 A;  2X9D A;  1SAU A;  1LB2 A;  4M3B A;  2IP2 A;  3OIO A;  4LLL A;  2P5V A;  4FIS A;  2EFW A;  3PSF A;  3BJ6 A;  5EGO A;  4NQW A;  4I01 A;  1R4M B;  1WSU A;  1ZTR A;  1BIA A;  1FOX A;  2DW4 A;  1MNM C;  1D8J A;  1B9N A;  4KMF A;  5CYV A;  1ZH5 A;  5E8I A;  1RUO A;  1IN7 A;  2FQ3 A;  2QF7 A;  4P5O A;  3VWB A;  3CC2 I;  2M34 A;  1HQC A;  3Q0W A;  3G1M A;  5HDK A;  1GXQ A;  4EMS A;  5CVR A;  2Y0S N;  4G12 A;  2Q2E A;  3BDD A;  2MW8 A;  3N97 A;  4X1E A;  1Z3Y A;  3GTQ J;  2M8E A;  2AS5 F;  3TMO A;  3V7C A;  2Q0O A;  5E3M A;  4KYW A;  2ZNY A;  1P4A A;  4O5V A;  3E1S A;  2YU3 A;  2Z16 A;  1QGP A;  1GXP A;  4M74 A;  4OAZ A;  3C2G A;  4G6T B;  1SAX A;  2M3A A;  2ZME B;  3HB9 A;  2H09 A;  4FE7 A;  5IPA A;  4FTH A;  1AKH A;  1ON2 A;  3GFM A;  4M3D A;  3WU1 B;  4R1H A;  4G7O F;  4A3J J;  2PMZ N;  5FFX A;  1WH5 A;  5M5Y J;  2XF5 A;  1PP8 F;  5FKL A;  4G94 A;  4L0Y B;  1PVE A;  4XLH A;  2FXA A;  2W00 A;  4A3L J;  4PZJ A;  4JYK A;  3OYI A;  3Q9S A;  1SFX A;  3E6C C;  3MMY B;  4EJU A;  1MJ9 A;  1Z21 A;  2QKM B;  3SQN A;  3G73 A;  5E17 F;  1B8I A;  2QEN A;  4F55 A;  4W97 A;  1Z7L A;  2DA5 A;  2DK5 A;  2PX9 A;  3DF8 A;  5LHH A;  1SD6 A;  4UUV A;  1MMA A;  4HV6 A;  4XSX F;  1F36 A;  3F6V A;  2F48 A;  5AIQ A;  3OYC A;  2WY8 Q;  2JN6 A;  3F8M A;  3KLN A;  3J80 Z;  3GWZ A;  2KRH A;  1HLV A;  1ZRD A;  4NDL A;  4UY8 I;  3CUQ B;  5B5E C;  3RCO A;  3F9K A;  2O8X A;  4RGU A;  1WJD A;  2IPQ X;  3CF2 A;  2Q8K A;  4RA2 A;  2EFO A;  4DBQ A;  2KFD A;  4Q5S F;  3BJA A;  3K4C A;  1BM9 A;  2WTE A;  3FXM A;  4B43 A;  1RZ4 A;  2RV8 A;  4DYQ A;  3HPH A;  4ZDO A;  2X51 A;  1R6R A;  4CHU A;  5BPI A;  1XGO A;  1IN6 A;  1CF7 B;  1QZE A;  1EKE A;  1BA5 A;  4MGR A;  2LBF A;  4L0Z B;  4HX7 A;  2LG4 A;  2STW A;  3J7A Y;  4UNO A;  2Q1Z B;  1NK2 P;  2CYY A;  2DT7 B;  2E1C A;  3LQQ A;  2R7R A;  2FE3 A;  2V7F A;  2IGK A;  2UXN A;  1K4T A;  3BQZ A;  3IH4 A;  2DT5 A;  1UZC A;  2HYG D;  5KAF C;  1K61 A;  5AON A;  3TW6 A;  3L7W A;  1WI9 A;  2QA4 I;  5GTH C;  3CJN A;  1WJA A;  1JTX A;  4XK4 A;  5E79 C;  2M4G A;  3UR3 C;  3A03 A;  1WPK A;  2BVL A;  1RUN A;  3LMM A;  3ZQL A;  3LAJ A;  2HOE A;  2WV1 A;  2R7Z J;  1I1S A;  5FGM A;  3PUF A;  1VQ8 I;  3V8L A;  1D1C A;  2OJE D;  1RET A;  3EUH A;  3TED A;  5E1Z B;  1H8A C;  4YIF A;  1X1A A;  1DPR A;  4I7H A;  1HDP A;  2VC0 A;  4BE0 A;  4IHV A;  1DU6 A;  3BZC A;  1O57 A;  3K4L A;  3H36 A;  4YFX F;  2BGC A;  2HEO A;  2W57 A;  4ENM A;  2GZW A;  1XCB A;  4FET A;  4GDF A;  5B1B H;  3M8J A;  1XN7 A;  4BXU A;  2QQB A;  1U9N A;  1BC8 C;  2VQH A;  2Y30 A;  1K79 A;  4Y4R A;  1F5T A;  1MGT A;  4E4H A;  1P9Q C;  4ZYH A;  3F8B A;  5L3D A;  3HOY J;  3KP4 A;  5E8G A;  3L2Q A;  3C3W A;  3ZQG A;  4ESB A;  3TDU C;  4WCG A;  1LFP A;  1V4R A;  3A0B C;  1QBJ A;  4UUT A;  3OV8 A;  3DXJ F;  1EH7 A;  3QQA A;  4D0P A;  4M6Y A;  5IP6 A;  2WV0 A;  4PGH A;  2UZK A;  4IZZ A;  3CCQ I;  1LDK B;  1LE8 A;  3DPU A;  1XSX A;  1ZLJ A;  3K4J A;  5JHF A;  3MN2 A;  4FX4 A;  4ZZD A;  1S29 A;  2E1M C;  4PJ0 C;  1EV7 A;  2WAF A;  4DYR A;  2BEO A;  4XSZ F;  4AID A;  3HIF A;  2VAS A;  1YFH A;  1N25 A;  4G9Y A;  3M3Y J;  3ROU A;  3MD2 A;  3R6S A;  1I1G A;  3OYK A;  4C3H J;  3PL8 A;  4XNF A;  3GZ5 A;  2GIZ A;  3KP3 A;  3I5U A;  1OYW A;  4OIR F;  4DZP A;  1MZB A;  3HEF A;  2LYC A;  4AIK A;  1HSJ A;  3IUO A;  1NG6 A;  3BTL A;  2HKO A;  3H35 A;  2KPM A;  3NAR A;  2EIK H;  2EZL A;  3HKZ A;  5FKO A;  2YPR A;  2EK5 A;  2L9S A;  1U5T B;  3GX4 X;  4XRM A;  3L2R A;  9ANT A;  2HTJ A;  4L9N A;  3ELK A;  2NVT J;  3KLO A;  2LKS A;  2ETH A;  2ELJ A;  4BEH B;  2P6S A;  1IW7 F;  1BOB A;  5FKN A;  5B66 C;  4FCY A;  2ZXW H;  4IF4 A;  1WVR A;  1SAN A;  4BAY A;  3TBI A;  4M3G A;  1RKW A;  1TP4 A;  3WE3 A;  1U2W A;  5EEA A;  5A2Q K;  3DKX A;  1BI2 A;  2K27 A;  3WU2 C;  1NG7 A;  2HKX A;  4UV8 A;  2GBY A;  1KQ9 A;  1X1C A;  1YW8 A;  4GRI A;  2D45 A;  2V1X A;  2M8G X;  1BI0 A;  2CW8 A;  2CV2 A;  1SMT A;  3DTK A;  3I4N J;  3BZ6 A;  3V4G A;  1EF4 A;  2E19 A;  4YII A;  4BHP A;  5IOZ A;  3SDB A;  2VIX A;  1E2X A;  2ZXH A;  1XSD A;  2CUF A;  3CD6 I;  3BCB A;  2PN6 A;  2LVS A;  2L7K A;  3M7G A;  3I59 A;  2HVS A;  2BHY A;  4KIG A;  1Z9C A;  3QOD A;  4J19 A;  1X2N A;  3BP8 A;  4G6Q A;  3FXK A;  3HGY A;  1UB9 A;  2R5Y B;  4B4C A;  3D5L A;  1EH8 A;  3F3X A;  3GYH X;  2WWY A;  1Z6R A;  2ADU A;  4HAM A;  1D5Y A;  1R5I D;  2JA5 J;  2BXZ A;  1REP C;  4PUS A;  1ZLK A;  2F5C A;  1SFU A;  4Y13 A;  4ITV A;  2L5Q A;  2HNH A;  2PLY A;  2LNB A;  3M8E A;  4RAG A;  1U9O A;  4XKV A;  2GQQ A;  2V6C A;  4DBR A;  3O2P E;  5K1Y A;  1IXS B;  3DKY A;  4V2F A;  4CIC A;  1MIJ A;  1YW7 A;  3QWL A;  1BI1 A;  5D8K B;  3RKX A;  4M71 A;  4CYC A;  2IS6 A;  1HKT A;  3HTS B;  2GIV A;  4ENK A;  2ZB9 A;  3EPZ A;  2QGU A;  3ZMU A;  2LDU A;  2VE9 A;  3KPH A;  1JUS A;  4ZYG A;  3T8R A;  1KU3 A;  3WGH A;  1H9T A;  4GO1 A;  1KZH A;  1W4M A;  2O6G E;  4XRF A;  2AQF A;  3IL2 A;  3EYY A;  1LJ9 A;  2WY7 Q;  2DMT A;  1S6L A;  4II2 A;  1HC8 A;  1FY7 A;  2LK2 A;  2M0M A;  4A3B J;  5GP9 A;  1S9H A;  1J09 A;  2EIM H;  3KP2 A;  5L3G A;  2M7A A;  2PG4 A;  3WTZ A;  2JA8 J;  4XMY A;  3P5J A;  4A5N A;  4AYB A;  3G71 I;  3K4B A;  4LK1 F;  4KJZ A;  2GXA A;  5F04 A;  2ID3 A;  4RB2 C;  4KUM A;  1WJC A;  2M0C A;  1OCZ H;  4BHC A;  3QRF F;  3JRA A;  3X2Q H;  1G3Y A;  1DPU A;  4PJM A;  1UEL B;  3M8F A;  3HOV J;  3KE2 A;  1YOV B;  3JW4 A;  3S1N J;  2XAJ A;  1UST A;  2DMN A;  1J7K A;  1UMQ A;  3HXL A;  1T6S A;  3RTR A;  4U0V A;  1IRG A;  5HNH A;  1WKM A;  1T0F A;  2DOA A;  3M1C A;  2ZFU A;  3R0A A;  2IRF G;  1USS A;  2VJJ A;  4AC0 A;  1IF1 A;  3DU5 A;  2ELK A;  1X3Z B;  4BE2 A;  1ZG1 A;  3IH3 A;  3M07 A;  2XRL A;  4JP0 A;  1MND A;  1Q1V A;  3PO3 J;  5LRS A;  2DCE A;  3AG1 H;  3FXL A;  3LOC A;  2XGC A;  3HOZ J;  3QU3 A;  3SZP A;  2ESH A;  4ZYD A;  5D5X B;  1VQM I;  1JJ8 C;  1JHH A;  1ZRF A;  1JT0 A;  2O03 A;  2WAD A;  2EWN A;  1X1B A;  4Q47 A;  4ZTJ A;  2JVG A;  5FD5 A;  1TWG J;  3HOS A;  3I71 A;  3CCR I;  2DXI A;  3IHU A;  2GXB A;  4IXA A;  2QQ9 A;  4IRI A;  2VKE A;  4GYI A;  4I09 A;  5D8L B;  3KZY A;  4IRH A;  2BZT A;  3BQY A;  2W84 A;  3ERM A;  5LD2 C;  3EYI A;  2OZU A;  2OC6 A;  3BG5 A;  4CCO A;  2YSR A;  3BLY A;  4Y33 A;  4QPO A;  1BR2 A;  3CCL I;  1G3W A;  2QLZ A;  2ISY A;  2L4M A;  1QPM A;  3K9T A;  3OR1 C;  4EJV A;  1PUF A;  4B44 A;  3C2B A;  5A2Q Z;  5IOY A;  4M9X A;  4EVI A;  4YEJ A;  3K0L A;  4P96 A;  3KET A;  3I56 I;  3GLL A;  3SYT A;  2VPL A;  2DBB A;  2H6B A;  1HW5 A;  1MBF A;  3V42 A;  1T95 A;  5M5X J;  5K5O A;  2K5C A;  2YX7 A;  3AG2 H;  4LOC A;  1TQI A;  3FF5 A;  2HVQ A;  3BRO A;  5H2F C;  4H4K C;  4Q4Z F;  3GME A;  1BBY A;  4G6D A;  3MCZ A;  1ZYR F;  3I9V 2;  3RPU A;  2BYV E;  2WAE A;  3TOA A;  1MSE C;  3ASN H;  5DM6 F;  1R36 A;  4CXF A;  4KIB A;  4UB8 C;  5DEQ A;  3WTU C;  1TNS A;  4HLX A;  1ZRE A;  3I3L A;  2LD5 A;  3VYR B;  3FXR A;  2HZD A;  3I0T A;  2R93 J;  1FT9 A;  1V55 H;  5E3N A;  2JZY A;  2V9V A;  3ZQQ A;  4UUS B;  5M3M J;  1MNE A;  2ZJ2 A;  4NC6 A;  2JA7 J;  1N77 A;  3TL4 X;  1BIB A;  4L5I A;  3HOU J;  1ERD A;  2A6H F;  2RQQ A;  3LFU A;  3BR5 A;  3QOP A;  1SD5 A;  2XAS A;  5HLI A;  2VKV A;  1A36 A;  3D1N I;  4MFE A;  1XTA A;  4EV0 A;  2FD5 A;  3L9F A;  2ZJR F;  2F6C A;  2W82 A;  4HX4 A;  3HKZ N;  1IUY A;  3S3O A;  2K9N A;  1YIO A;  2XPV A;  2RN7 A;  4JX4 A;  2F5E A;  3WTS C;  3EUK L;  1VQO I;  4LMY A;  3FM5 A;  3J81 K;  1UFM A;  3GBG A;  3WTV C;  4GCV A;  1NK3 P;  1BR1 A;  2FML A;  2LLK A;  1J5Y A;  2JWT A;  4PSX A;  2MBF A;  1VQ9 I;  2HFH A;  2EFN A;  4NBQ A;  4E6K G;  2DA4 A;  2PJR A;  1R1V A;  4ANJ A;  4DJA A;  3TW7 A;  3DKW A;  2STT A;  5LHI A;  1HW2 A;  2XIG A;  3O8H A;  5L3F A;  2MA3 A;  2LY2 A;  3DEE A;  1HKS A;  3DBL B;  3ZMZ A;  1XG1 A;  4UVA A;  3MFK A;  2ZME C;  3HSE A;  2PMH A;  3NWS A;  2WAQ A;  3QPH A;  4BUP A;  3HOW J;  4ZYA A;  5HLG A;  4HBL A;  2JSC A;  3TO9 A;  1W0T A;  4B09 A;  2XAQ A;  2LC2 A;  3G2B A;  5IT3 A;  2HU9 A;  2DFE A;  3U9G A;  4BE1 A;  3K2Z A;  3P9C A;  4IL6 C;  4IHS A;  2J5O A;  4Y7N J;  1TL8 A;  4KMU X;  3DV8 A;  2RAE A;  2HWV A;  1G3T A;  2DQR A;  2GA1 A;  3LQR A;  2EIJ H;  3KZI C;  5EG0 A;  1P92 A;  2M45 A;  3LA3 A;  4L9T A;  1O3R A;  1S8N A;  4ON0 A;  3OYJ A;  5DS9 A;  3VOE A;  2XVC A;  2R7O A;  4XRS G;  3DEU A;  1OFC X;  3WTY C;  4I02 A;  4G7Z F;  1VND A;  3LSH A;  1R9T J;  1QO0 D;  2RDP A;  3OMY A;  4N9I A;  1YI2 I;  3CUQ C;  2ESN A;  1KQ0 A;  3RKQ A;  5LGU A;  3HHG A;  2XSJ C;  2DFH A;  3OWT A;  3OYM A;  4Y3O A;  1TC3 C;  2KRC A;  2RKH A;  2EFP A;  4JX5 A;  3PQJ A;  2CW7 A;  3E6D A;  3A0H C;  3K10 A;  1ETY A;  2I5U A;  1BW5 A;  2VJI A;  2M7B A;  5E18 F;  3DPT A;  2VOP A;  1GT0 C;  4G7H F;  4XR6 A;  4KNY A;  2DA7 A;  4LB6 B;  3TKY A;  3OSF A;  4OIO F;  1TT0 A;  2FOK A;  2DTZ A;  1B1B A;  1VQ4 I;  4ABZ A;  3RJP A;  2ME0 A;  2NS8 A;  2RGV A;  4AIH A;  3FXU A;  1KU9 A;  1Y0U A;  4M3F A;  2ZXI A;  4AYB N;  3MKZ A;  3DLL F;  5EGO B;  4NQW B;  1QHH D;  3IRQ A;  1TQM A;  5B3S H;  2HOA A;  2X6O A;  5B1A H;  2F5F A;  4XLA A;  1MDM A;  4OMZ A;  2W85 A;  2DDB A;  3GTP J;  1ZN2 A;  4CH7 A;  4J01 A;  3ASO H;  4NB5 A;  2GA2 A;  3OYA A;  3F8C A;  1OCR H;  3WTW C;  1FP1 D;  4M3E A;  4N9H A;  1N75 A;  2E7X A;  2GXG A;  4RAZ A;  2KDZ A;  3PNY A;  3H0G J;  3L2V A;  2DQL A;  3JRH A;  1Z0X A;  2AQE A;  2G7H A;  4IX7 A;  3BZK A;  5D6E A;  3ZQI A;  3ZQF A;  2IGO A;  3CCV I;  2W25 A;  5CQG A;  5IT9 K;  1XGM A;  4ZTF A;  1GV2 A;  2KZG A;  4LLN A;  1YJ9 I;  3E5Q A;  3R60 A;  3A4C A;  3CME I;  2COB A;  1MW7 A;  1ETW A;  4E7I A;  3DTI A;  1JT6 A;  2RC4 A;  1AKH B;  2Y75 A;  3L2C A;  3A01 A;  1FBS A;  1XDS A;  1WQ2 A;  3KYD B;  4IRG A;  4LG0 A;  1Y8Q B;  1IV6 A;  4B48 A;  3F22 A;  3ISP A;  1LFB A;  2CUJ A;  2LY9 A;  1DQU A;  1UHM A;  1UJ8 A;  1XDU A;  5F0F A;  5D4R A;  2FBK A;  3SJM A;  1JKP C;  5J8F A;  4MHG A;  4R79 A;  3LST A;  2NVQ J;  3W6J B;  2QSF X;  1MMN A;  3K1P A;  2CV1 A;  4UB6 C;  1RES A;  1S3J A;  1YS6 A;  2F2E A;  3PUB A;  3SDG A;  4IVN A;  3BG9 A;  2K7L A;  3HRT A;  5CVV A;  3K2A A;  1D5V A;  2FJ1 A;  3HG9 A;  4EEF G;  2PQ8 A;  1B8I B;  3J81 Z;  1I3A A;  3S3N A;  4P1W A;  2VN2 A;  5E1W A;  2LOO A;  3ULQ B;  4C2T A;  1FMW A;  4IQJ A;  4TV7 A;  1OMI A;  2FU4 A;  5JLX A;  1S7A A;  1ZG5 A;  2R0Q C;  3E0J B;  3A1Y A;  2EPF A;  3BPV A;  3MZY A;  2P81 A;  4RGR A;  3HRM A;  2EB7 A;  3FZV A;  1TWC J;  4HV5 A;  1LFU P;  2H8R A;  2IXS A;  4U0Y A;  3FBN B;  3CP8 A;  2YUS A;  3I53 A;  1A35 A;  1T33 A;  2DTR A;  1ENH A;  1T39 A;  1P7I A;  4A3D J;  5FD6 A;  1G2H A;  4AM3 A;  3E97 A;  1U5T C;  3BR3 A;  3L2U A;  4N4N B;  2K9L A;  2GM4 A;  5EEG A;  4IKF A;  1XX5 A;  2EIL H;  1ZG3 A;  4FE4 A;  3JRI A;  5DCM A;  1UAA A;  4XID A;  4CZC A;  1OYI A;  3QU6 A;  1A6Q A;  4QWQ A;  1W5S A;  3OYG A;  1LKX A;  1IDY A;  1OLT A;  1MH4 A;  2HS5 A;  3JCU C;  1HW1 A;  3IAM 2;  3WG9 A;  1JE8 A;  5KVR A;  4C2U A;  4EGY A;  1FTT A;  2VQC A;  1FNN A;  1KYZ A;  2K9Q A;  1FOW A;  4B3A A;  2E71 A;  4L5J A;  2YS9 A;  2DDA A;  4FX0 A;  1O3S A;  4LJZ F;  2CRG A;  4C2M J;  2VT3 A;  1K78 A;  4AVP A;  2ICW G;  3JRG A;  1J0R A;  2NVX J;  3GZ6 A;  1F43 A;  3GTK J;  5CJ9 A;  3L00 A;  5E1X A;  2VBW A;  1SFO J;  4W1U A;  2HZT A;  2MYS A;  3JAM K;  2QWW A;  1H0M A;  2FF4 A;  4KDP A;  2FSW A;  2EZH A;  2JRT A;  4PJN A;  1IXR C;  3PNT A;  1S72 I;  2FX0 A;  5JHU A;  2OZ6 A;  1U6G A;  1HDD C;  5GPA A;  3FMR A;  5BNG A;  1RR8 C;  2CS3 A;  4I2O A;  2NS7 A;  3HGG A;  2NRA C;  3ABT A;  4P55 A;  1I27 A;  5GPC A;  5HDG A;  5CVI A;  4HX8 A;  3KYL A;  3FKI J;  3ZRG A;  1R71 A;  4HZF A;  2XGX A;  2HOS A;  3OYD A;  2V4J C;  4R8H A;  2LR8 A;  3IRR A;  2IGM A;  1FEX A;  2WBM A;  3L09 A;  1IC8 A;  2E1N A;  1ETK A;  4XKC A;  2XRN A;  1R1U A;  3BT9 A;  3ABM H;  4UVB A;  2H94 A;  3SZT A;  4JQF A;  3O8G A;  2WAQ N;  3E5U A;  2P5K A;  2DYS H;  2FBH A;  1HOM A;  1RR7 A;  1H9G A;  3ERE D;  1LE8 B;  1W36 D;  4BQN A;  2BXY A;  4IQ4 A;  1T38 A;  3D0S A;  1STZ A;  5JVT A;  1WJ5 A;  3OYL A;  3KYC B;  4HYE A;  1XC5 A;  3QP5 A;  1HA8 A;  5LLQ A;  2EIN H;  2K4J A;  5FLV A;  3MEX A;  4YFK F;  2OF7 A;  1QRY A;  5IT9 Z;  2DPD A;  1HXD A;  3RZO J;  4ASN A;  1FX7 A;  2DO7 A;  3E6B A;  4LGW A;  3G3Z A;  3U1K A;  4CCM A;  2HXO A;  1JXS A;  1I6H J;  2CV0 A;  3O3K A;  2CUE A;  1D0Z A;  3PIO F;  4OAY A;  1OPC A;  4QSH A;  1XMX A;  2HPI A;  5LFA A;  3C7J A;  2K4B A;  3Q0U A;  2R4G A;  4XN3 A;  2E2I J;  3CC7 I;  2CQQ A;  3FXQ A;  2FNP A;  1TTY A;  3AL0 B;  2OAZ A;  1QVU A;  2XB0 X;  2NOJ B;  2ZXJ A;  5DM7 F;  3LL7 A;  2X1C A;  3VSK A;  3HPG A;  4KIC A;  2CQK A;  4OOI A;  4LLG F;  4RAY A;  2CH0 A;  4NC7 A;  2QEX I;  3ABL H;  3P7N A;  3JRF A;  1VQ5 I;  3HSR A;  3H9J A;  4E7L A;  3GTM J;  4Y15 A;  4P9U A;  3DQV C;  1QZY A;  2KL4 A;  1JHF A;  3QYE A;  3B73 A;  1M1E B;  3OS0 A;  3G1O A;  1WZ2 A;  1FPQ A;  3TO6 A;  2DAO A;  3QPS A;  4WXH A;  4A0Y A;  4B8X A;  3WGI A;  1LVA A;  1B59 A;  4KFC A;  3SFI A;  3CUO A;  5IYD J;  2R7U A;  1LDJ A;  4PSW A;  1LNW A;  3KX2 A;  2P5L C;  2CFX A;  2PEX A;  3ONQ A;  1KU2 A;  1DGW Y;  3ML6 A;  3TDZ C;  2FBI A;  5D5W B;  1VQK I;  2IAI A;  2O8K A;  3GTJ J;  4A6E A;  5DDG A;  3G1L A;  3I59 B;  1J75 A;  3QOE A;  1MKM A;  4HEA 2;  1WFX A;  3W6V A;  1X3W B;  4LD5 A;  1WJB A;  3SEQ A;  1Y6I A;  4A3I J;  5J1Y A;  5CLS A;  2F4O B;  2FNA A;  3BG7 A;  4X0G A;  3A2K A;  1OYY A;  2O9L A;  3NQO A;  2IGN A;  4KN7 X;  2MG4 A;  3BWG A;  1IJW C;  4BNC A;  2KHM A;  3ESW B;  3S1R J;  1TLH B;  1YX5 A;  4BXX J;  2ZSI B;  1B72 A;  3K1N A;  5F1R A;  1A5J A;  2XGD A;  3C1D A;  3VOD A;  4CYC B;  4XBF A;  3CDI A;  4HDV A;  5K7F A;  3RPU D;  4XQF A;  1W5C C;  3MAJ A;  5KK1 A;  4E70 A;  3FMQ A;  3RQ4 A;  4EM2 A;  1FTZ A;  3V8K A;  3SXY A;  1UHW A;  3I64 A;  2EFQ A;  2VC1 A;  1OIS A;  4BY7 J;  4K2E A;  2LSO A;  3JAM Z;  2COM A;  2I8D A;  3FK7 A;  2HQR A;  3OIP A;  2L4A A;  3TQN A;  1OR7 C;  1U8B A;  3QP6 A;  4IOA F;  3GVA A;  3HTU A;  5AIP A;  2IT0 A;  2D1V A;  1LEA A;  2R7W A;  4LB5 A;  1ODD A;  2KRF A;  3CDL A;  3PNV A;  4RBO A;  1XSV A;  3CTA A;  3E5X A;  4RM3 A;  2R7V A;  1SD7 A;  1J2X A;  1I50 J;  1TW2 A;  4B47 A;  1BJZ A;  4LIV A;  4M9Z A;  2O5R A;  2MAB A;  1ETV A;  1AOY A;  2D1H A;  3OR2 C;  2R7X A;  1LEB A;  4RS8 A;  4XOT A;  1PP7 U;  2L3D A;  4MLO A;  1KA8 A;  3CMY A;  1IN8 A;  2LP0 A;  2ZKZ A;  3CQZ J;  2VJ5 A;  2VBZ A;  4IHX A;  4A5M A;  2UUZ A;  2XHK A;  1YYV A;  2F4M B;  3Q3S A;  3HUG B;  4IO9 F;  1TNT A;  3M1E A;  1BL0 A;  5K7Z A;  1YJN I;  5F0C A;  4LIT A;  4F93 B;  1DDN A;  2IJL A;  3FK6 A;  2V9P A;  5C44 J;  3CJQ B;  2HQN A;  1QVT A;  3ZXS A;  5GAH J;  3OS2 A;  3CDH A;  4A69 C;  1R5H A;  5HS9 A;  1IRZ A;  2DOE A;  2VQG A;  5IP9 J;  3MZ8 A;  1TT5 B;  4BQO A;  3DLA A;  3GTG J;  3H3V K;  1MJB A;  5KNL A;  1V5E A;  2K9M A;  2KIF A;  3JSO A;  2PJP A;  3M9A A;  2KIS A;  5ICG A;  4U88 A;  2OA4 A;  4RLF A;  3NWT A;  3GXO A;  4ZDL A;  3DBH B;  2XF6 A;  3FM3 A;  3CMM A;  4AD9 A;  1YG2 A;  5F27 A;  2OBP A;  1UCR A;  3HOT A;  2NVU B;  3CLO A;  1JKO C;  5EZH A;  1C0W A;  3PJR A;  2X4H A;  2Y31 A;  1FYK A;  1YX3 A;  2A05 A;  2EA2 A;  1MMG A;  3ZOB A;  2QSH X;  2XV4 S;  3I58 A;  3CCM I;  2R7D A;  3PM1 A;  3F0C A;  1PUF B;  2BW3 A;  2DMQ A;  3BR2 A;  1CGP A;  1MBG A;  1GHC A;  5EZG A;  1X1D A;  1OCP A;  2XKP A;  3S15 J;  3GO5 A;  5CVJ A;  5KCM A;  3U21 A;  2BV6 A;  2B9S A;  1FSH A;  2L02 A;  1WJE A;  1XMA A;  2Y0S A;  3W2A A;  3PQK A;  2JA2 A;  4HNV A;  4BJT A;  4A3K J;  3COA C;  4OIN F;  1TBX A;  4IHW A;  4RM2 A;  4XN0 A;  2QVO A;  1MD0 A;  4KT5 C;  5ILU A;  3IWZ A;  4NNJ A;  5L3C A;  4KT6 A;  2KIM A;  3DP7 A;  4KA4 A;  1U8R A;  3CCE I;  4CUG A;  1PJR A;  2E7W A;  3HOX J;  2HDC A;  5J3L A;  1XB4 A;  2HGC A;  1BOA A;  3SEZ A;  5JVG F;  2L9R A;  1ULY A;  1FC3 A;  4XRS A;  3LSP A;  5EEH A;  2PMZ A;  3I54 A;  1YRN A;  1ZR2 A;  2X6X A;  5ICF A;  2X1D A;  3QYB A;  2Z3Y A;  5DD4 A;  4CGZ A;  3G4S I;  1IAW A;  4XIC A;  5LGN A;  4ZJZ A;  2NAZ A;  2LKP A;  3IC7 A;  2LF7 A;  1JI8 A;  2UWM A;  3GF2 A;  1SVO A;  4DYC A;  1IUF A;  3KEO A;  2DU9 A;  2E5N A;  1ONV A;  1XS9 A;  4E7H A;  4IHT A;  1RC9 A;  2PBI A;  3J7A O;  4BL0 B;  5TGT A;  2VKD A;  3OSG A;  4L9V A;  3V8J A;  3U1D A;  2Y69 H;  1GVD A;  2RQP A;  2XF7 A;  1SEU A;  1IZ1 A;  3H3U A;  5BOX A;  4HST A;  3RZD J;  4FT8 A;  2V79 A;  4A6D A;  4BS9 A;  2PJR B;  5J40 A;  4L5E A;  2CGP A;  2M9H A;  3HZJ A;  3BTC A;  1OCT C;  3S1M J;  3OS1 A;  2B7E A;  3ZP5 A;  3PO2 J;  3V7R A;  4B3X A;  1K4S A;  2GWR A;  2ZNZ A;  2Z5U A;  2EA4 A;  3ZQ7 A;  3GUD A;  4AVZ A;  1IG7 A;  2M1B A;  1JTY A;  2MLG A;  3K4M A;  3MVP A;  2B63 J;  1CQT A;  2VBX A;  4D1Q A;  3GFI A;  4CCN A;  2YU9 J;  3Q9V A;  1D0Y A;  2DJN A;  4H0E A;  1X4O A;  1XCV A;  4BHB A;  2LTP A;  5F1J A;  4A3E J;  5J1U A;  1TWF J;  4HDU A;  3W6K B;  2LRD A;  2P8T A;  5JI6 A;  4EM1 A;  3HBL A;  2CW0 F;  2L2O A;  3ZMT A;  4N0B A;  3WTT C;  1WRJ A;  1T56 A;  3HHH A;  5LEJ A;  3OL3 A;  2DJI A;  4XLN F;  5IY5 H;  3HDD A;  1MSF C;  4A93 J;  3DTE A;  4DQ2 A;  2R7S A;  3B6C A;  2ELH A;  5FRN A;  4MQ9 F;  5FB2 A;  2HXI A;  1YIT I;  2EZI A;  1Y1V J;  2DFI A;  5JFR A;  3OYF A;  2QM3 A;  2A5W A;  3FHZ A;  2CMP A;  3PFY A;  1ZGJ A;  5ILS A;  1EH6 A;  1PDN C;  4XM3 A;  4MEX F;  4Y17 A;  5K5Q A;  3GTO J;  2NNY A;  3IAS 2;  4E7K A;  2LKX A;  1R7J A;  4RB0 A;  2KZV A;  3K4K A;  4CSW A;  2G9W A;  3NRV A;  4A12 A;  4E7J A;  1FSE A;  1IN5 A;  1QQI A;  5JR3 A;  3AG3 H;  2Z99 A;  2E60 A;  2MGQ A;  3VPR A;  1Z91 A;  2HYJ A;  3AFH A;  1FJL A;  1BC7 C;  3CCJ I;  4X6A J;  1V5F A;  1KGS A;  2HPM A;  2JVH A;  1ITY A;  4IOC F;  2JUG A;  4MTE A;  3CLQ A;  2CQX A;  5LGT A;  4C3J J;  2NOG A;  1SVL A;  3H9G A;  2IBD A;  4QTR A;  4LK0 F;  1MDM B;  1R1T A;  2W7N A;  5BPD A;  4OMY A;  3ECH A;  5H6Q A;  3TP0 A;  2DPU A;  1S7E A;  5M3F J;  1O3Q A;  3DPL C;  5TJJ A;  4L18 B;  1VTN C;  2MSY A;  1F9N A;  4I0A A;  2XAU A;  4EGZ A;  3S17 J;  1LQ1 A;  1RRJ A;  1IDZ A;  4GGG A;  3H9Q A;  5E20 A;  2VKH A;  3K70 D;  1X19 A;  2JT1 A;  2DYR H;  4II3 A;  2LFB A;  5D4S A;  4CYD A;  3EUH C;  4F92 B;  3L2W A;  1G4D A;  3H0D A;  4HSR A;  2R5Z A;  2MD5 A;  3GFL A;  3LSK A;  1T2K A;  1T8I A;  1ZKG A;  1W7P A;  2HYF A;  3JTH A;  2ISZ A;  2F4I A;  1WWX A;  2L9V A;  3LSM A;  5F08 A;  3BR0 A;  2KT0 A;  1X1P A;  4CCK A;  5ICE A;  3HC7 A;  2D2W A;  4WF2 A;  4MO7 A;  1VQ6 I;  1HKQ A;  2Q2E B;  3LWF A;  3A01 B;  4ETS A;  3OYE A;  2HQ5 A;  3P9K A;  4XLP F;  2Y9Z A;  3BTJ A;  2H27 A;  1NHA A;  1O4X A;  1X2M A;  3LA2 A;  3LAP A;  2V1N A;  4D9J A;  1I3Q J;  3QPT A;  1FOK A;  4BJ6 C;  2ZJQ F;  5J6X A;  4RGX A;  3H5N A;  3J7Y J;  2M87 A;  1K6O A;  2RNJ A;  5HVQ C;  1WH7 A;  4YEL A;  2ZO4 A;  1HBX G;  3BJO A;  3Q0V A;  2FQ4 A;  3KZZ A;  5DD8 A;  5LBQ A;  2R92 J;  5HOD A;  2DT6 A;  3S2D J;  1IN4 A;  2HDD A;  5CPR B;  1DGR M;  2QYO A;  4FHT A;  4IPA A;  5LHG A;  4YRV A;  4Q48 A;  4ENN A;  5GAG J;  1YS7 A;  5FRO A;  5DYM A;  1F4K A;  1WHU A;  2XB5 A;  5DUK A;  4ESJ A;  1HCR A;  1BW6 A;  2QBY B;  2NYX A;  1R49 A;  2PMU A;  1Z05 A;  2VON A;  1XMK A;  5HDN A;  3CO7 C;  2J5P A;  2E2H J;  3OYH A;  2V1U A;  2E1O A;  2A6T A;  1JGS A;  5GAD J;  2QUF A;  4QIW N;  2A61 A;  5F0H A;  1R58 A;  4J00 A;  1TW3 A;  1P6R A;  2L7Z A;  1SD4 A;  3WG7 H;  2ZC2 A;  2KIU A;  3W2W A;  2OQR A;  2K3P A;  2GOM A;  3FXO A;  3S8P A;  2UV1 A;  1JJ6 C;  3AL0 C;  4I99 C;  1SC7 A;  3V7S A;  5E3O A;  4CDG A;  2P4W A;  2R7Q A;  3DWL E;  5DCM B;  3S3M A;  1L3L A;  2ZFW A;  4XLF A;  2CFO A;  5LEK A;  5ERI A;  1IRX A;  2EH3 A;  4D7M A;  4NC8 A;  1QA6 A;  2OTJ I;  2IA1 A;  3WU0 A;  2D5V A;  3CC4 I;  2V6E A;  3OL4 A;  1MH3 A;  1XPX A;  3IKV A;  3U2R A;  3LNQ A;  2QKL B;  3FWE A;  4PGG A;  1LUJ B;  3EQL F;  3TP3 A;  4WK8 F;  5KAI C;  1PUE E;  3ZR8 X;  1Y1W J;  2L0K A;  3OIQ A;  2DMU A;  2F5D A;  4MEY F;  2ZME A;  3JR9 A;  1KU7 A;  1Z7U A;  1K78 B;  2VI6 A;  2LBF B;  4F7Z A;  1E17 A;  4UHT A;  3RSN A;  4BH9 A;  2DOF A;  1E0E A;  5E3L A;  2MH2 A;  4UV9 A;  4DNC A;  1ORK A;  1NH3 A;  4OWR B;  1BR4 A;  4BBS J;  1IGN A;  1I6X A;  1YJW I;  4BYY A;  2XGE A;  2IS4 A;  1YW9 A;  1ZAO A;  4JBA A;  3CCS I;  3GEZ A;  4RMN A;  1H88 C;  2E2J J;  2VXD A;  3KCC A;  2HDW A;  2X85 A;  4EJT A;  3R0J A;  1E3P A;  4O6J A;  2KJC A;  3FIW A;  1GLN A;  3CCY A;  3O6B B;  4U87 A;  5FKM A;  2JUC A;  1APL C;  3HM5 A;  1YQA A;  1FYL A;  1X4P A;  2R7T A;  4RB1 A;  5L3E A;  4HNT A;  2Y48 A;  4CO8 A;  2JRM A;  4RB3 C;  1O7L A;  1Z77 A;  1GDT A;  4HNU A;  4YIR X;  2ECB A;  2LF8 A;  3QYF A;  4U7D A;  4O3M A;  2ZSH B;  3CUQ A;  1ZGW A;  2DOD A;  1U0J A;  1IXC A;  1TQP A;  3UNG C;  3ABU A;  1TWA J;  3C18 A;  1OKR A;  1WGX A;  2QZ8 A;  4XOP A;  3S1Q J;  2MFZ A;  3CMA I;  1LDD A;  3BCA A;  2XDV A;  3H1C A;  1YHQ I;  2OQG A;  1FP2 A;  2VB6 A;  3B6A A;  3BTI A;  2KKO A;  2L01 A;  1ZQ3 P;  1ETQ A;  1IRF A;  1N78 A;  2X6W A;  1CF7 A;  1HST A;  2DN0 A;  5FLM J;  2OUM A;  2Z2S B;  4BGD A;  1DP3 A;  2V1D A;  4L9J A;  5J8C A;  3I55 I;  1W36 C;  5J4Y A;  2A3S A;  2DK8 A;  1T08 B;  2XAG A;  4ZC3 A;  4HA8 A;  2VOO A;  3MWM A;  2X6Y A;  4NHJ A;  1YO5 C;  4GFB A;  3PIP F;  3UKG A;  4D5F A;  3FBI B;  4EQQ A;  4AUX A;  2RVC A;  5IYB J;  1R4N B;  2VLA A;  3DEW A;  2QQ8 A;  3Q5F A;  3ZN1 A;  1VZ0 A;  2EBI A;  3C2H A;  1LPQ A;  1QU3 A;  2KJB A;  5C3E J;  4DIQ A;  5D5U B;  4XON A;  1I39 A;  3VYT B;  1FWZ A;  1T0F C;  4PK4 A;  2CG4 A;  2QSG X;  2NXN B;  2HQA A;  1P7J A;  3JRE A;  4AU7 A;  1MMS A;  1P2F A;  1G59 A;  5CVU A;  1JKQ C;  3S93 A;  3BG3 A;  3SFZ A;  4MTD A;  2FEZ A;  4BQQ A;  2G7U A;  4A0Z A;  2ZBK A;  3F23 A;  5L3B A;  3NAU A;  4HG2 A;  1ETO A;  1DU0 A;  4CCL A;  5CQE A; 
#chains in the Genus database with same CATH homology
 5BMZ A;  1I5Z A;  2IA0 A;  3BY6 A;  1R00 A;  3EDP A;  1FBU A;  1FLI A;  2EJR A;  2YR2 A;  1F1Z A;  4HF2 A;  3SHF A;  3BOQ A;  1Q1H A;  2QBY A;  2CWE A;  1XD7 A;  2WC2 A;  3ECO A;  3T5X A;  5ED4 A;  3E3V A;  2VXZ A;  5HS7 A;  4P9F A;  4HOB A;  1YTY A;  2P7C B;  4M6X A;  2M30 A;  1Z1D A;  5H20 A;  1FYM A;  3IWF A;  4MQV A;  1BI3 A;  1U5T A;  5FO5 A;  2C6Y A;  4YG2 F;  3I4P A;  5HOO A;  3ZMV A;  2GAU A;  3RKW A;  2X0L A;  3RPQ A;  3GLX A;  3LA7 A;  1MJA A;  1L0O C;  4M9S A;  5FFZ A;  3IKT A;  2A69 F;  3FMS A;  1B6A A;  2XAF A;  2XUB A;  4WXC A;  2NS0 A;  1U3E M;  1J59 A;  2B0L A;  1DP7 P;  4OIQ F;  2UXX A;  3ZPL A;  2Y0M A;  3REO A;  3KEQ A;  4HF1 A;  4AIJ A;  3RIR A;  2DI3 A;  3BPX A;  3JSP A;  3GFJ A;  3RYR A;  5HS8 A;  2O0Y A;  2R3S A;  3VFZ A;  3MZH A;  4BQA A;  5DCF A;  2BE5 F;  2XRO A;  2FMY A;  5FLX K;  2VOD A;  5BS6 A;  4M73 A;  5LRR A;  3GW2 A;  2NNN A;  3LFK A;  2K86 A;  1W5T A;  4UVC A;  2YX4 A;  3E6M A;  4G8X A;  3B02 A;  1R23 A;  1BJA A;  3K1M A;  2A5Y B;  1SMY F;  3T1B A;  2MH9 A;  2QQA A;  2CO5 A;  3KP6 A;  4CZZ A;  4IJA A;  2VE8 A;  2XKO A;  3WGG A;  1ZRC A;  3HUG A;  4EJW A;  3CO6 C;  6PAX A;  5K5R A;  3WE2 A;  3RYP A;  1ZAR A;  2HR3 A;  3H3Z A;  1KQ8 A;  3ZMD A;  3AAF A;  2W24 A;  5ICC A;  2ZCW A;  4MNU A;  2K02 A;  3T8T A;  1RNL A;  1P4W A;  4ZZL A;  4EJO A;  2M5W A;  3H92 A;  4HF0 A;  3F21 A;  4ZH4 F;  4QLC U;  4ESF A;  4A2U A;  2PI0 A;  1R5G A;  2A6E F;  2OD5 A;  2L54 A;  1XGS A;  1R22 A;  4WX9 A;  5D5V B;  2BBY A;  1G3S A;  3ZMS A;  1D8K A;  2VBY A;  4U7B A;  4GXO A;  2P6T A;  1QNT A;  3ZN0 A;  4KIF A;  1W7P D;  5DV5 A;  1O3T A;  4S05 A;  3HRU A;  1SFE A;  1RI7 A;  2TDX A;  3T0Y A;  2Z9O A;  2DLL A;  1A04 A;  4EM0 B;  2VT2 A;  3P9I A;  1ZGA A;  2A68 F;  4WWC A;  3F72 A;  5TRD A;  3PFI A;  1X3U A;  3EET A;  3MQ0 A;  3S2W A;  3F8F A;  3VB2 A;  2FRH A;  4PDK A;  1BN5 A;  2IVM A;  2IW5 A;  4WXD A;  5HLH A;  1OR7 A;  4HW0 A;  4M72 A;  5H6R A;  3RDI A;  1ZHF A;  3DFG A;  1S7O A;  1K7A A;  3HSF A;  3RKY A;  1QZZ A;  3F8N A;  3TOB A;  1P4X A;  5FLX Z;  1U78 A;  1B9M A;  3F6O A;  1Z6T A;  2FA5 A;  2JPB A;  3K69 A;  3NEU A;  3JTG A;  3OOP A;  4AWX B;  2CSO A;  4UXN A;  4OIP F;  3RI4 A;  5BQT A;  4RGS A;  2IA2 A;  3WOD F;  3HRS A;  2O3F A;  2AXL A;  2R7F A;  1KYW A;  2H6C A;  5F64 A;  5D6F A;  1FZP B;  4YFN F;  3KFW X;  5DUI A;  3TGN A;  4PCQ A;  1O7F A;  2MC3 A;  3J80 K;  4I0B A;  2PFB A;  3KP5 A;  2EV6 A;  2XAH A;  3R4K A;  5F6F A;  3WTX C;  4JK1 X;  4ZYE A;  4HLY A;  4KN4 X;  1FBQ A;  4ENJ A;  1G6N A;  1XGN A;  1YLF A;  4LFU A;  1V3F A;  4A0X A;  1ON1 A;  1D3Y A;  4S04 A;  3R61 A;  1W7P B;  1AWC A;  2ACJ A;  1RIO H;  2JTV A;  2MLK A;  4GYG A;  4HQM A;  2Z33 A;  1DUX C;  4Z2Y A;  2HTS A;  3FX3 A;  4I98 B;  2OU2 A;  2P7V B;  4OU0 A;  3N4M A;  2EV5 A;  1B4A A;  3QAH A;  4U0W A;  2JPC A;  1T98 A;  3KP7 A;  1GVJ A;  3TO7 A;  4LG0 B;  4HQE A;  3HYI A;  5ILV A;  2EV0 A;  3VEP A;  2A07 F;  2O61 A;  1LB2 A;  4LLL A;  2IP2 A;  2P5V A;  2EFW A;  3BJ6 A;  4NQW A;  4I01 A;  1WSU A;  1BIA A;  2DW4 A;  1D8J A;  1B9N A;  4KMF A;  5CYV A;  1ZH5 A;  5E8I A;  1RUO A;  1IN7 A;  2FQ3 A;  4P5O A;  1HQC A;  5HDK A;  1GXQ A;  4EMS A;  5CVR A;  2Q2E A;  3BDD A;  3N97 A;  2M8E A;  2AS5 F;  3V7C A;  2Q0O A;  4KYW A;  4O5V A;  2ZNY A;  1P4A A;  2YU3 A;  1QGP A;  1GXP A;  4M74 A;  1SAX A;  2ZME B;  2H09 A;  1ON2 A;  3GFM A;  3WU1 B;  4R1H A;  4G7O F;  5FFX A;  1PP8 F;  4G94 A;  4L0Y B;  2FXA A;  4PZJ A;  3Q9S A;  1SFX A;  3E6C C;  4EJU A;  1MJ9 A;  3SQN A;  3G73 A;  5E17 F;  2QEN A;  2DK5 A;  3DF8 A;  5LHH A;  1SD6 A;  4UUV A;  4HV6 A;  4XSX F;  3F6V A;  5AIQ A;  3F8M A;  3KLN A;  3J80 Z;  3GWZ A;  1ZRD A;  3CUQ B;  2O8X A;  4RGU A;  2IPQ X;  2Q8K A;  2EFO A;  4Q5S F;  3BJA A;  1BM9 A;  2WTE A;  1RZ4 A;  2RV8 A;  4CHU A;  5BPI A;  1XGO A;  1IN6 A;  1CF7 B;  4MGR A;  4L0Z B;  4HX7 A;  2STW A;  4UNO A;  2CYY A;  2E1C A;  3LQQ A;  2FE3 A;  2UXN A;  2DT5 A;  2HYG D;  5AON A;  3L7W A;  1WI9 A;  3CJN A;  1RUN A;  3LAJ A;  2HOE A;  1I1S A;  5FGM A;  3V8L A;  3EUH A;  5E1Z B;  4YIF A;  1DPR A;  4I7H A;  2VC0 A;  1O57 A;  4YFX F;  2BGC A;  2HEO A;  2W57 A;  4ENM A;  2GZW A;  1XCB A;  1XN7 A;  4BXU A;  2QQB A;  1BC8 C;  1K79 A;  1F5T A;  1MGT A;  4ZYH A;  3F8B A;  5L3D A;  3KP4 A;  5E8G A;  3C3W A;  4ESB A;  3TDU C;  4WCG A;  1V4R A;  1QBJ A;  1J9I A;  3OV8 A;  3DXJ F;  1EH7 A;  4D0P A;  2QBY B;  4M6Y A;  2UZK A;  2WV0 A;  4PGH A;  1LDK B;  1XSX A;  1ZLJ A;  4FX4 A;  4ZZD A;  1S29 A;  1EV7 A;  2BEO A;  4XSZ F;  3HIF A;  1YFH A;  4G9Y A;  3ROU A;  3R6S A;  1I1G A;  3GZ5 A;  3KP3 A;  3I5U A;  1OYW A;  4OIR F;  4AIK A;  1MZB A;  1HSJ A;  2HKO A;  2YPR A;  2EK5 A;  3GX4 X;  1U5T B;  2HTJ A;  4L9N A;  3ELK A;  3KLO A;  2ETH A;  2P6S A;  1IW7 F;  4IF4 A;  4BAY A;  3WE3 A;  1U2W A;  5A2Q K;  1BI2 A;  2K27 A;  2HKX A;  4UV8 A;  1KQ9 A;  1YW8 A;  2D45 A;  2V1X A;  1BI0 A;  1SMT A;  3BZ6 A;  3V4G A;  4YII A;  4BHP A;  1E2X A;  1XSD A;  2PN6 A;  3M7G A;  3I59 A;  4KIG A;  1Z9C A;  3BP8 A;  4G6Q A;  1UB9 A;  3D5L A;  1EH8 A;  3F3X A;  3GYH X;  2WWY A;  1Z6R A;  2ADU A;  4HAM A;  1REP C;  1ZLK A;  2F5C A;  1SFU A;  4Y13 A;  2PLY A;  2LNB A;  3M8E A;  2GQQ A;  2V6C A;  3O2P E;  5K1Y A;  1IXS B;  4CIC A;  1YW7 A;  1BI1 A;  5D8K B;  3RKX A;  4M71 A;  1HKT A;  3HTS B;  2GIV A;  4ENK A;  3ZMU A;  2LDU A;  2VE9 A;  4ZYG A;  3T8R A;  1KU3 A;  3WGH A;  1H9T A;  4GO1 A;  1W4M A;  2O6G E;  4XRF A;  3IL2 A;  3EYY A;  1LJ9 A;  1S6L A;  1FY7 A;  3KP2 A;  5L3G A;  2PG4 A;  3WTZ A;  4A5N A;  4LK1 F;  4RB2 C;  4KUM A;  4BHC A;  3QRF F;  1G3Y A;  1DPU A;  3M8F A;  3KE2 A;  3JW4 A;  2XAJ A;  1UST A;  1J7K A;  1T6S A;  3RTR A;  4U0V A;  1IRG A;  1WKM A;  1T0F A;  3R0A A;  2IRF G;  1USS A;  1IF1 A;  1ZG1 A;  5LRS A;  3QU3 A;  3SZP A;  2ESH A;  4ZYD A;  5D5X B;  1JHH A;  1ZRF A;  2O03 A;  2EWN A;  4Q47 A;  5FD5 A;  3HOS A;  3I71 A;  3IHU A;  2GXB A;  4IXA A;  2QQ9 A;  4IRI A;  4GYI A;  4I09 A;  5D8L B;  3KZY A;  4IRH A;  2W84 A;  3EYI A;  2OZU A;  2YSR A;  1G3W A;  2QLZ A;  2ISY A;  2L4M A;  1QPM A;  3K9T A;  4EJV A;  5A2Q Z;  4M9X A;  4EVI A;  3K0L A;  4P96 A;  3KET A;  2DBB A;  2H6B A;  1HW5 A;  5K5O A;  2YX7 A;  1TQI A;  3FF5 A;  3BRO A;  4Q4Z F;  1BBY A;  4G6D A;  3MCZ A;  1ZYR F;  3RPU A;  2BYV E;  3TOA A;  4CXF A;  3WTU C;  1R36 A;  4KIB A;  5DEQ A;  1TNS A;  4HLX A;  1ZRE A;  3FXR A;  3I0T A;  1FT9 A;  2JZY A;  2V9V A;  2ZJ2 A;  1BIB A;  4L5I A;  2A6H F;  3QOP A;  1SD5 A;  2XAS A;  5HLI A;  4EV0 A;  3L9F A;  4HX4 A;  1IUY A;  1YIO A;  2RN7 A;  2F5E A;  3WTS C;  4LMY A;  3FM5 A;  3J81 K;  1UFM A;  3WTV C;  4GCV A;  2FML A;  1J5Y A;  2MBF A;  2HFH A;  2EFN A;  1R1V A;  3DKW A;  2STT A;  5LHI A;  1HW2 A;  2XIG A;  5L3F A;  2MA3 A;  1HKS A;  3ZMZ A;  4UVA A;  3MFK A;  3HSE A;  2PMH A;  3QPH A;  5HLG A;  4HBL A;  2JSC A;  3TO9 A;  4B09 A;  2XAQ A;  5IT3 A;  3U9G A;  3K2Z A;  3P9C A;  4IHS A;  2J5O A;  4KMU X;  3DV8 A;  2HWV A;  1G3T A;  2DQR A;  2GA1 A;  3LQR A;  1P92 A;  2M45 A;  3LA3 A;  4L9T A;  1O3R A;  1S8N A;  4ON0 A;  3VOE A;  2XVC A;  3DEU A;  3WTY C;  4I02 A;  4G7Z F;  1QO0 D;  2RDP A;  4N9I A;  3CUQ C;  2ESN A;  1KQ0 A;  5LGU A;  3HHG A;  2RKH A;  2EFP A;  3PQJ A;  3E6D A;  5E18 F;  3DPT A;  2VOP A;  4G7H F;  4KNY A;  4LB6 B;  3TKY A;  4OIO F;  2FOK A;  1B1B A;  3RJP A;  2RGV A;  4AIH A;  3FXU A;  1KU9 A;  1Y0U A;  3IRQ A;  1TQM A;  2F5F A;  1MDM A;  4OMZ A;  2W85 A;  1ZN2 A;  4NB5 A;  2GA2 A;  3F8C A;  3WTW C;  1FP1 D;  4N9H A;  2E7X A;  2GXG A;  4RAZ A;  2DQL A;  2G7H A;  5D6E A;  2W25 A;  5IT9 K;  1XGM A;  4LLN A;  3E5Q A;  3R60 A;  2RC4 A;  2Y75 A;  3L2C A;  1FBS A;  1XDS A;  1WQ2 A;  4IRG A;  4LG0 A;  3F22 A;  3ISP A;  1XDU A;  1UHM A;  5D4R A;  2FBK A;  5J8F A;  4MHG A;  4R79 A;  3LST A;  3W6J B;  3K1P A;  1S3J A;  1YS6 A;  2F2E A;  4IVN A;  2K7L A;  3HRT A;  5CVV A;  1D5V A;  2PQ8 A;  3J81 Z;  2VN2 A;  5E1W A;  3ULQ B;  4TV7 A;  1OMI A;  2FU4 A;  1S7A A;  1ZG5 A;  3BPV A;  3MZY A;  4RGR A;  3HRM A;  2EB7 A;  3FZV A;  4HV5 A;  4U0Y A;  3I53 A;  2DTR A;  1T39 A;  5FD6 A;  3E97 A;  1U5T C;  5EEG A;  1ZG3 A;  5DCM A;  1OYI A;  3QU6 A;  4QWQ A;  1W5S A;  2HS5 A;  1HW1 A;  3WG9 A;  1JE8 A;  5KVR A;  4EGY A;  1FNN A;  1KYZ A;  4L5J A;  4FX0 A;  1O3S A;  4LJZ F;  1K78 A;  2VT3 A;  4AVP A;  1J0R A;  3GZ6 A;  5CJ9 A;  3L00 A;  5E1X A;  2VBW A;  2HZT A;  3JAM K;  2QWW A;  1H0M A;  2FF4 A;  4KDP A;  2FSW A;  2JRT A;  1IXR C;  5JHU A;  2OZ6 A;  1U6G A;  3FMR A;  4I2O A;  2NRA C;  3ABT A;  4P55 A;  1I27 A;  5HDG A;  5CVI A;  4HX8 A;  4HZF A;  2XGX A;  4R8H A;  3IRR A;  3L09 A;  2E1N A;  2XRN A;  1R1U A;  4UVB A;  2H94 A;  3SZT A;  4JQF A;  3E5U A;  2P5K A;  2FBH A;  1H9G A;  3ERE D;  1T38 A;  3D0S A;  1STZ A;  5JVT A;  4HYE A;  3QP5 A;  5LLQ A;  2K4J A;  3MEX A;  4YFK F;  5IT9 Z;  2DPD A;  1HXD A;  4ASN A;  1FX7 A;  2DO7 A;  3E6B A;  4LGW A;  3G3Z A;  1JXS A;  3O3K A;  1OPC A;  3C7J A;  2K4B A;  3FXQ A;  2FNP A;  1TTY A;  2OAZ A;  2ZXJ A;  4KIC A;  2CQK A;  4OOI A;  4LLG F;  4RAY A;  3P7N A;  3HSR A;  4Y15 A;  4P9U A;  3DQV C;  1QZY A;  1JHF A;  3B73 A;  1FPQ A;  3TO6 A;  2DAO A;  4WXH A;  4A0Y A;  4B8X A;  3WGI A;  1LVA A;  1B59 A;  4KFC A;  3CUO A;  1LDJ A;  1LNW A;  2P5L C;  2CFX A;  2PEX A;  3TDZ C;  1KU2 A;  3ML6 A;  2FBI A;  5D5W B;  4A6E A;  5DDG A;  3I59 B;  1J75 A;  1MKM A;  4LD5 A;  5CLS A;  2FNA A;  1OYY A;  3NQO A;  4KN7 X;  3BWG A;  4BNC A;  1TLH B;  3K1N A;  5F1R A;  3C1D A;  3VOD A;  4XBF A;  4HDV A;  3MAJ A;  5KK1 A;  4E70 A;  3FMQ A;  4EM2 A;  3V8K A;  3SXY A;  1UHW A;  3I64 A;  2EFQ A;  2VC1 A;  4K2E A;  2LSO A;  3JAM Z;  2COM A;  2HQR A;  2L4A A;  3TQN A;  3QP6 A;  3GVA A;  3HTU A;  5AIP A;  2IT0 A;  2D1V A;  1LEA A;  4LB5 A;  1ODD A;  2KRF A;  1XSV A;  3CTA A;  3E5X A;  1SD7 A;  1J2X A;  1TW2 A;  4M9Z A;  1AOY A;  2D1H A;  1LEB A;  4RS8 A;  1PP7 U;  2L3D A;  1KA8 A;  1IN8 A;  2ZKZ A;  2VBZ A;  4A5M A;  2XHK A;  1YYV A;  1TNT A;  3M1E A;  1DDN A;  2IJL A;  2HQN A;  3CDH A;  1R5H A;  5HS9 A;  1MJB A;  2KIF A;  3JSO A;  2PJP A;  3M9A A;  5ICG A;  4U88 A;  2OA4 A;  3GXO A;  3FM3 A;  4AD9 A;  1YG2 A;  2OBP A;  1UCR A;  3HOT A;  3CLO A;  1C0W A;  2X4H A;  1FYK A;  2EA2 A;  2XV4 S;  3I58 A;  2R7D A;  1CGP A;  1GHC A;  2XKP A;  3GO5 A;  5CVJ A;  2BV6 A;  1FSH A;  2L02 A;  1XMA A;  3PQK A;  3COA C;  4OIN F;  1TBX A;  2QVO A;  1MD0 A;  4KT5 C;  5ILU A;  3IWZ A;  5L3C A;  2KIM A;  3DP7 A;  4KA4 A;  1U8R A;  2E7W A;  2HDC A;  1XB4 A;  2HGC A;  1BOA A;  1ULY A;  1FC3 A;  5EEH A;  3I54 A;  5ICF A;  2Z3Y A;  5DD4 A;  4CGZ A;  1IAW A;  5LGN A;  2NAZ A;  2LKP A;  3IC7 A;  2LF7 A;  2UWM A;  3GF2 A;  3KEO A;  2DU9 A;  1ONV A;  4IHT A;  2PBI A;  3J7A O;  4L9V A;  3V8J A;  3U1D A;  2RQP A;  1IZ1 A;  3H3U A;  5BOX A;  4FT8 A;  2V79 A;  4A6D A;  2CGP A;  3ZP5 A;  3V7R A;  2GWR A;  2ZNZ A;  2Z5U A;  2EA4 A;  3ZQ7 A;  3GUD A;  2M1B A;  2MLG A;  2VBX A;  3GFI A;  3Q9V A;  4H0E A;  1XCV A;  4BHB A;  4HDU A;  3W6K B;  2P8T A;  5JI6 A;  4EM1 A;  2CW0 F;  3ZMT A;  4N0B A;  3WTT C;  1WRJ A;  3HHH A;  5LEJ A;  4XLN F;  4DQ2 A;  2ELH A;  4MQ9 F;  5FB2 A;  2DFI A;  5JFR A;  2QM3 A;  3FHZ A;  1ZGJ A;  5ILS A;  1EH6 A;  1PDN C;  4MEX F;  4Y17 A;  5K5Q A;  2NNY A;  1R7J A;  4RB0 A;  2G9W A;  3NRV A;  4A12 A;  1FSE A;  1IN5 A;  1QQI A;  5JR3 A;  2Z99 A;  1Z91 A;  1BC7 C;  1KGS A;  4MTE A;  5LGT A;  4LK0 F;  1MDM B;  1R1T A;  5BPD A;  4OMY A;  3ECH A;  5H6Q A;  2DPU A;  1O3Q A;  3DPL C;  5TJJ A;  4L18 B;  1VTN C;  4I0A A;  1F9N A;  4EGZ A;  1LQ1 A;  4GGG A;  5E20 A;  2JT1 A;  5D4S A;  4CYD A;  1G4D A;  2MD5 A;  3GFL A;  1T2K A;  1W7P A;  2HYF A;  3JTH A;  2ISZ A;  1WWX A;  5ICE A;  2D2W A;  4WF2 A;  1HKQ A;  3LWF A;  4ETS A;  3P9K A;  4XLP F;  2H27 A;  1NHA A;  3LA2 A;  3LAP A;  3QPT A;  1FOK A;  5J6X A;  4RGX A;  2M87 A;  1K6O A;  2RNJ A;  5HVQ C;  2ZO4 A;  1HBX G;  3BJO A;  3KZZ A;  5DD8 A;  5LBQ A;  1IN4 A;  2QYO A;  4FHT A;  4IPA A;  5LHG A;  4Q48 A;  4ENN A;  1YS7 A;  5DYM A;  1F4K A;  4ESJ A;  5DUK A;  2NYX A;  2PMU A;  1Z05 A;  2VON A;  1XMK A;  5HDN A;  3CO7 C;  2J5P A;  2V1U A;  1JGS A;  2QUF A;  2A61 A;  1R58 A;  1TW3 A;  1P6R A;  1SD4 A;  2KIU A;  2OQR A;  3V7S A;  4CDG A;  2P4W A;  5DCM B;  1L3L A;  2ZFW A;  5LEK A;  5ERI A;  2IA1 A;  3WU0 A;  3IKV A;  3U2R A;  3FWE A;  4PGG A;  3EQL F;  4WK8 F;  1PUE E;  4MEY F;  2F5D A;  2ZME A;  1KU7 A;  1Z7U A;  1K78 B;  4F7Z A;  1E17 A;  4UHT A;  4BH9 A;  2MH2 A;  4UV9 A;  4DNC A;  1I6X A;  4BYY A;  1YW9 A;  1ZAO A;  4JBA A;  3GEZ A;  3KCC A;  4EJT A;  3R0J A;  4O6J A;  2KJC A;  3O6B B;  1YQA A;  1FYL A;  4RB1 A;  5L3E A;  2Y48 A;  4CO8 A;  4RB3 C;  1O7L A;  2LF8 A;  4U7D A;  4O3M A;  3CUQ A;  1IXC A;  1TQP A;  3ABU A;  3C18 A;  1OKR A;  2QZ8 A;  1LDD A;  2OQG A;  1FP2 A;  2KKO A;  2L01 A;  1IRF A;  1CF7 A;  1HST A;  2V1D A;  4L9J A;  5J8C A;  2A3S A;  2DK8 A;  2XAG A;  4HA8 A;  2VOO A;  3MWM A;  4NHJ A;  1YO5 C;  4EQQ A;  2RVC A;  3Q5F A;  3ZN1 A;  2KJB A;  5D5U B;  1FWZ A;  2CG4 A;  1P2F A;  5CVU A;  3SFZ A;  4MTD A;  2FEZ A;  2G7U A;  4A0Z A;  2ZBK A;  3F23 A;  5L3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...