2FTBA

Crystal structure of axolotl (ambystoma mexicanum) liver bile acid-binding protein bound to oleic acid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
PFNGTWQVYSQENYEAFLRAVGLPEDIINVAKDINPIIEIQQNGDNFVVTSKTPNQSVTNSFTIGKEAEITSMGGKKIKCTVVLEGGKLVSKTDQFSHIQEVKGNEMVETLTVGGATLIRRSKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein 2, liver
publication title Crystal structure of axolotl (Ambystoma mexicanum) liver bile acid-binding protein bound to cholic and oleic acid
pubmed doi rcsb
molecule tags Lipid binding protein
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2ftbA00
3BLGA 4WFUA 1QG5A 3NPOA 5F1EA 3BU1A 3EM0A 1TW4A 3KFGA 4HPCA 1IFBA 4Y0SA 3WJBA 3RZYA 5HBSA 2AT0X 4NNTA 2Q4NA 1FENA 5HZ8A 1G74A 2WUTA 4QGWA 5HZ6A 5HTDA 5LJGA 1SY3A 2A2UA 5LJHA 1AQBA 1SXXA 4Y0PA 2K23A 1BSOA 1OPAA 3FENA 2X45A 1SA8A 4KIIA 1BBPA 1DFVA 1YWDA 4TNNA 3CBSA 3JS1A 1ZRYA 1TOWA 4ZFXA 5LJKA 1KZWA 3NP1A 2BLGA 2HYSA 4TQ2A 1TVQA 4GNYA 2QO4A 4YBPA 4ORWA 4AZNA 1QWDA 4UU2A 3OJYC 1ICNA 4DQ4A 5LJBA 2RD7C 1GKAA 4M6SA 1DZMA 1XCAA 1MX8A 1HN2A 3EYCA 3KFFA 4GE1A 1SY2A 5FAZA 1KT3A 2RCQA 3FW4A 5F58A 1BRQA 4OMXA 2CBSA 1CRBA 4I9RA 2W2BA 5D8JA 4EEJA 3FMZA 2PY1A 3NQ3A 5HCDC 3FA8A 3P6DA 1XKIA 3G7XA 2DM5A 2ANSA 2OVAA 4YDBA 3FA9A 3NADA 4IAXA 1KOIA 2LFOA 3P6HA 1FDQA 1U0XA 4A60A 2POAA 2ALLX 2FT9A 3APUA 3CR6A 4YH0A 2OZQA 4MVLA 3HK1A 1B8EA 1CJ5A 3TGAA 1VYFA 2WQ9A 3HWFA 1EW3A 4HPDA 1SXWA 1QY0A 3Q6LA 3B2LA 1H91A 1MUPA 4I3DA 5EEDA 1SXUA 1B4MA 1T8VA 3D95A 1QY1A 4QGXA 3IFBA 2JU7A 1KT6A 1LIBA 2IFBA 1RBPA 3P6EA 1HBQA 1SY1A 2QM9A 3TGBA 3KFHA 1AVGI 1B56A 4NP1A 2AT6X 1X8OA 3I0AA 1I04A 1BM5A 5LKFA 2G7BA 3ELXA 1JJXA 2N93A 1GX8A 5LKEA 4A1HA 5HZ9A 3PECA 1GT1A 2MJIA 1MDCA 2CBRA 1KQWA 3FR2A 3GAQA 1GXAA 3DTQA 4TJZA 3UEUA 5FFHA 5BVQA 2A3FX 1OEJA 3O22A 2HNXA 1PMPA 2YG2A 4QYPA 1SXYA 1JYDA 1X8QA 1CBSA 2JN3A 4ZH6A 2P8GA 5EDCA 1DV9A 1KT4A 2LBAA 2OFMX 4ORXA 4HPBA 3PEDA 2FWVA 2NP1A 4ZHGA 5EEEA 2WEWA 1I06A 1A57A 4IB7A 4XMEA 5BVSA 2FR3A 4ORYA 2W2AA 2OFRX 4DQ3A 4OS0A 1G7NA 5LJEA 1BSQA 1PBOA 1Z24A 1ERXA 1O1UA 2JU8A 5KIDA 1BJ7A 1MX7A 1NP4A 5D4AA 4ES7A 2CZTA 1G5WA 2CM9A 1FTPA 1ZNEA 4NYRA 4Y0RA 4XMHA 4ALBA 1OEKA 1YIVA 1B0OA 2GC9A 4ZJ0A 3FW5A 1YWAA 1I4UA 1QFTA 1A3YA 1EALA 5H9NA 4I3CA 1ML7A 4D6AA 3U03A 1BEBA 3JSQA 4IMOA 2EU7X 3VG5A 3VG2A 1X8PA 2A13A 2W2FA 3C76X 1IW2A 3VG7A 1X71A 1ALBA 1GT3A 2RA6A 1JBHA 3WJDA 3F8AA 3KZAA 3TF6A 1LNMA 1ZNGA 1IIUA 1OBPA 1DC9A 4I3BA 5HWZA 1ACDA 1IFCA 2O62A 3WJCA 2RCTA 4WBKA 4ZH9A 1TOUA 2R56A 1I05A 2NNDA 1U17A 2G79A 2QOSC 3VG3A 1KZXA 3AKNA 5F7GA 3NQ9A 3APXA 1PEEA 3HWEA 1JV4A 2OVDA 1S7DA 3PP6A 3CQRA 3L4RA 5B27A 1LIDA 1N0SA 2AT5X 3PH5A 1LFOA 2AKQA 3C78X 1JJJA 4ZHHA 2WEXA 1X8NA 4CK4A 3B2IA 4EFGA 2WWPA 1TXLA 4OS8A 1BWYA 4O9SA 1ZNHA 5HCCC 2FR2A 3ELZA 4ZHDA 1ERBA 4LZVA 1EXSA 3BY0A 4XMDA 4LKPA 2JU3A 1AB0A 5EZ2A 4ZGUA 3RSWA 2HZQA 1HMSA 3BU9A 1DF3A 3IA8A 5CE4A 3U9PC 3FA7A 4UU3A 5BVTA 4AZRA 1EPBA 4GKCA 1X8UA 4IB9A 2LB6A 3BS2A 5HZQA 1AELA 2FS6A 3HWDA 1OBQA 4RUNA 2FS7A 5DG4A 1E00A 4A8ZA 2CM4A 4OS3A 5HCEC 4AZOA 4TKHA 3UEXA 5L8NA 3CQNA 5EPQA 2Q2PA 2R73A 3BRNA 5AQ6A 4IMNA 3SAOA 3FR4A 2WR6A 4OMWA 2AT8X 3BX8A 3WJFA 1BRPA 1OBUA 1DZKA 3HWGA 5HA0A 5L8OA 4PSQA 2GTFX 4YFQA 5FENA 2WQAE 2X46A 4BVMA 4GH7A 1BSYA 1OEEA 4YBUA 4IAWA 3S26A 4TKBA 3B2KA 4QGVA 3P6FA 4NLJA 4XMFA 5HAEA 4YFRA 3FLLA 1P6PA 2G78A 2AMMX 1R0UA 4D6BA 2RQ0A 4BQUA 2KT4B 2A0AA 4QZUA 1ICMA 4WFVA 4Y0QA 4K19A 3CWKA 5H8TA 1KT5A 1SY0A 4AW8A 5B29A 1JYJA 1A2DA 5D47A 3STMX 4A1YA 1CBQA 3TZSA 1KGLA 4TKJA 5F6ZA 3FIQA 4QAEA 2AT3X 2Q9SA 3STKA 3C77X 1YWCA 4ZHFA 2NNQA 4M7MA 1LF7A 3D96A 4YCHA 4LZUA 2L67A 2CZUA 4NNSA 3PH6A 2K62A 1E06A 4XMGA 1S2PA 1LIFA 3D97A 1IKJA 1X89A 2XKLA 2ASNX 2R74A 4ORUA 2WSJA 1L6MA 1LKEA 1YWBA 1ZNDA 2FLJA 1VYGA 1KT7A 5JR8A 4YDAA 4ALOA 2LKKA 1UREA 5F6BA 1QQSA 1YP6A 3CMPA 4YKMA 2F73A 2HMBA 4ZHCA 5KICA 1UZ2X 4GNWA 1VPRA 3MBTA 1HMTA 4RUUA 3MVFA 3WBGA 1KQXA 1QFVA 3NX2A 3P6CA 1OPBA 2XSTA 1NGLA 1U18A 2Q2MA 4I9SA 3FEPA 2ACOA 3BSZE 3WJGA 1PM1X 3CBCA 1T68X 1MVGA 3KFIA 1HMRA 5HZ5A 3EMMA 3T1DA 1LICA 4N7CA 3EBKA 4GRJA 5D45A 4AZPA 3WVMA 3FR5A 4YCEA 5C0NA 4R0BA 3AKMA 4YKOA 4GETA 2AL0X 3VG4A 1DZJA 5IO7A 3TGCA 1YP7A 3NX1A 5L8IA 1O1VA 5K06A 1JZUA 2L9CA 3APVA 2L5PA 3B2HA 1GX9A 4XMCA 3ZQ3A 5IO6A 2JOZA 1ZNLA 3QKGA 4ORSA 1LPJA 5IO5A 1IKEA 2MM3A 4IB8A 3FEKA 3UEWA 4BOEA 2L68A 3APWA 5HTEA 1YUPA 1D2UA 4MVIA 1T0VA 3B2JA 1QABE 4QZTA 1FEMA 4YFPA 2KTDA 1ADLA 1CBRA 1GM6A 4AYHA 4HPAA 1LIEA 1DZPA 4EXZA 5H9AA 2Q39A 3WXQA 4NLIA 5LJDA 2OVEA 1EIIA 2LBVA 2MO5A 5D48A 4YGGA 3UEVA 1S44A 4ZR2A 3WJEA 2GJ5A 1GT5A 2QO5A 1G85A 1EQDA 3ZUOA 4ODDA 1GKAB 1D3SA 1E5PA 5EDBA 4LKTA 4QYNA 4HFOA 1E02A 4YMYA 3ZUIA 1BLRA 3FELA 2QO6A 2HZRA 1O8VA 2E4JA 3O2YA 4YGHA 1EIOA 1A18A 4EDEA 3I17A 5DPQA 4AZQA 4ZCBA 1ZNKA 1FELA 1HBPA 3U0DA 1CBIA 2FTBA 1EPAA 3PPTA 4ORRA 1KXOA 4TLJA 2AH7X 4IBAA 2A2GA 1EUOA 4ARHA 2HLVA 1HQPA 3BX7A 3F9DA 4N7DA 4AZMA 4IB6A 4MVKA 4YGZA 5H9KA 2FRSA 1QY2A 1GT4A 5LJCA 3STNA 1NP1A 3NR3A 4NYQA 1FE3A 3O19A 3VG6A 3DSZA 5KHPA 3FA6A 3EBWA 2ACPX 2NNEA 3P6GA 1RLBE 1GGLA 5HA1A 3K3LA 3KQ0A 5H9LA 3BDRA
chains in the Genus database with same CATH superfamily
3BLGA 1SWOA 4WFUA 1QG5A 3NPOA 5F1EA 3PQSA 1SLDB 3BU1A 1TW4A 3EM0A 3RE6A 3NBXX 4TNNA 1SREA 3KFGA 4HPCA 1IFBA 4JHQA 4Y0SA 3RKGA 3RZYA 3WJBA 5HBSA 1SRFA 2AT0X 4NNTA 2VFCA 2Q4NA 1FENA 1PBYA 5HZ8A 2OL7A 1G74A 2WUTA 3V8UA 4QGWA 2IZGB 2BSZA 5B2AO 5HZ6A 1I9HA 5HTDA 1SLFB 4ML7B 5LJGA 4U9CA 1SY3A 1SWAA 2A2UA 3ZW0A 1AVEA 4Z2PA 1AQBA 5LJHA 1SXXA 3OBLA 4Y0PA 2Z4HA 2K23A 1BSOA 1OPAA 3FENA 2X45A 1SA8A 4KIIA 3GE2A 1BBPA 1DFVA 1SMPI 1YWDA 2LA7A 3CBSA 1ZRYA 1TOWA 1VWHB 2IZAA 3JS1A 4I60A 2C1SA 5LJKA 3NP1A 2BLGA 2HYSA 4TQ2A 1HXLA 1TVQA 4GNYA 5B11O 2QO4A 4YBPA 4ORWA 4AZNA 1QWDA 2BHVA 3OJYC 1ICNA 2WPUA 1UYOX 4UU2A 3RDXA 1VWRB 4DQ4A 5LJBA 2RD7C 1GKAA 4M6SA 3S5XA 2FKGA 1DZMA 2Y3EA 1SWKA 1XCAA 1MX8A 1HN2A 3EYCA 3KFFA 4GE1A 4JGLA 4IRWA 1SY2A 3HOEA 5FAZA 1KT3A 2RCQA 3FW4A 1IJ8A 2RTCB 1BRQA 4OMXA 5F58A 3MM0A 4ID2A 4BJ8A 2CBSA 1CRBA 2YMSA 2W2BA 4FGIB 4GD9A 3FMZA 2PY1A 2X55A 3NQ3A 4I9RA 4EEJA 3FA8A 5HCDC 3P6DA 1XKIA 3G7XA 1SWNA 1VWGB 2DM5A 2X8SA 3FDCA 3QQ2A 2ANSA 2OVAA 4YDBA 4CDFA 3FA9A 1SWQA 3NADA 2RTGB 2RTQB 1EI5A 1VWPB 4IAXA 2IZFB 1VWNB 1KOIA 2LFOA 3P6HA 1FDQA 3RY1A 1U0XA 4A60A 2POAA 2ALLX 2FT9A 3APUA 3CR6A 4YH0A 2OZQA 4MVLA 3HK1A 1VYOA 2UYWA 1B8EA 1CJ5A 3P24A 1VWOB 3TGAA 1VYFA 2WQ9A 2C1QA 1EW3A 3HWFA 3Q34A 4HPDA 1SXWA 4KH8A 1QY0A 4Y5DA 3Q6LA 3B2LA 1H91A 1MUPA 1SLEB 1NBXA 1SXUA 4I3DA 2IZHB 5EEDA 4YVBA 1KZWA 2DJGA 3RBYA 1B4MA 3RY2A 1T8VA 3D95A 1KL4A 2Y32A 3WYPA 1QY1A 3EW1A 4QGXA 3IFBA 2JU7A 4CPFA 1KT6A 2MWHA 1LIBA 2IFBA 1RBPA 4GDZA 3CKGA 2AVIA 4O3ZA 2JGSA 3P6EA 3VHHA 2UZ2A 1HBQA 4CSBA 1SY1A 2QM9A 3TGBA 2G5LA 3KFHA 3T6LA 1JMZA 1AVGI 1B56A 4NP1A 2AT6X 3S60A 3CKFA 1X8OA 3I0AA 2RTJA 3S5VA 3ZW2A 1I04A 3VPJE 1BM5A 5LKFA 2G7BA 3ELXA 1JJXA 2N93A 3LV4A 5K68A 4EQAC 4NV7A 1GX8A 1LDQA 5LKEA 3T6FA 4A1HA 5HZ9A 3PECA 2I5ZO 1GT1A 2MJIA 5FQ6E 1MDCA 2CBRA 1KQWA 3FR2A 3GAQA 4OKAA 1GXAA 4BX7B 3DTQA 4TJZA 3UEUA 3D4RA 2OFBA 5FFHA 1OEJA 2A3FX 2BS6A 2HNXA 2X8TA 2OY1O 3O22A 5BVQA 1PMPA 4MISA 2YG2A 4QYPA 1SXYA 1JYDA 2RTRB 1N4JA 3PDFA 1X8QA 1CBSA 4L1NA 2JN3A 1RAVA 2P8GA 4GGZA 4MVEA 1KT4A 4O3YA 1PTSA 5EDCA 4ZH6A 1DV9A 2LBAA 1Y55X 2OFMX 4ORXA 1Y9LA 4HPBA 2IZEB 3PEDA 2RTNB 2FWVA 2NP1A 1MOYA 2OF9A 4ZHGA 5EEEA 1KL5A 1I06A 2WEWA 4HWMA 1A57A 4IB7A 4XMEA 5BVSA 3VE1A 2FR3A 4ORYA 2HKDA 2W2AA 1VWAB 2OFRX 4DQ3A 4OS0A 1Y0GA 1G7NA 5LJEA 1BSQA 1PBOA 1Z24A 4U8UM 3RE5A 1ERXA 1HY2A 1O1UA 2JU8A 2CAMA 2X34A 5KIDA 3SOTA 4COTA 1BJ7A 1MX7A 1NP4A 5D4AA 4ES7A 3ZZVA 1NDJA 2CZTA 1G5WA 3T2WA 1FJ1E 2CM9A 1FTPA 3WYQA 1ZNEA 1AVDA 4NYRA 4GUZA 4Y0RA 2ZAIA 4XMHA 4ALBA 1OEKA 1YIVA 1B0OA 2GC9A 4ZJ0A 3FW5A 1YWAA 1I4UA 1QFTA 1VWEB 1A3YA 1EALA 4GJVA 5H9NA 1STRB 4I3CA 1ML7A 1HXZA 3NQKA 4D6AA 3U03A 1BEBA 2GTLN 3JSQA 3HTYA 2GH7A 4IMOA 2EU7X 3VG5A 3RDUA 3VG2A 1X8PA 3RDMA 2A13A 2W2FA 1LCZA 3C76X 1I78A 2JW1A 1IW2A 4JNJA 4O3WA 3VG7A 1X71A 1ALBA 1GT3A 2RA6A 1JBHA 3MX7A 2FKJA 1NQNA 3WJDA 3F8AA 3KZAA 3TF6A 1LNMA 1ZNGA 1IIUA 1OBPA 1LCWA 4KT5A 1DC9A 3RDQA 4I3BA 5HWZA 5IRWA 1ACDA 1IFCA 2O62A 3WJCA 2RCTA 4I6SA 4WBKA 4ZH9A 1TOUA 1NQMA 3VE2A 5L3YA 3RDSA 4CPHB 2R56A 1I05A 1Y53X 2NNDA 4DCBA 1U17A 2QOMA 4EKVA 1W5RA 2G79A 2QOSC 2GTLM 3VG3A 4BX6B 4GU8A 1KZXA 2PI3O 3X00A 3AKNA 5F7GA 3NQ9A 3ZWEA 1VWQB 3APXA 4O3XB 4BX5A 1PEEA 4BX7A 4FBVA 3HWEA 1SRGA 1JV4A 2FHNX 2OVDA 3SZIA 1S7DA 3PP6A 5K67A 3CQRA 3L4RA 5B27A 2M4LA 1LIDA 1N0SA 2AT5X 3MG5A 3PH5A 1LFOA 2Z4IA 2AKQA 4Z6JA 3LHNA 3C78X 1JJJA 1SWTA 4KCAA 2WEXA 1X8NA 2ZAGA 4ZHHA 1E2TA 3B2IA 4CK4A 1DF8A 2WWPA 3VHIA 1TXLA 4O49A 4CDEA 4OS8A 4EFGA 1BWYA 4O9SA 1ZNHA 2VDFA 5HCCC 2FR2A 3ELZA 4ZHDA 1RXKA 1VWKB 1ERBA 2OL8O 1EXSA 2A5CA 3BY0A 4FBOA 4LZVA 4XMDA 4C5PA 4LKPA 2JU3A 1N9YA 1AB0A 5CYBA 5EZ2A 3WJEA 4ZGUA 3RSWA 2HZQA 1HMSA 3BU9A 1DF3A 3IA8A 5CE4A 3U9PC 3FA7A 3RDOA 4UU3A 4GJSA 5BVTA 4AZRA 1EPBA 4GKCA 3EW2A 1X8UA 4Z28A 3D9WA 4IB9A 1LELA 5B10O 2LB6A 1KFFA 4CV7A 2ZSCA 3PQUA 3BS2A 1MEPA 5HZQA 1AELA 2FS6A 3HWDA 4GZVA 1SWFA 1OBQA 4RUNA 2FS7A 5DG4A 1E00A 4A8ZA 4BBOA 2CM4A 4OS3A 1WUBA 3WZOA 5HCEC 4AZOA 4TKHA 3UEXA 5L8NA 5IXGA 3CQNA 1VWLB 5EPQA 1Y9TA 2Q2PA 4LQZA 2R73A 3BRNA 4IABA 4U8UN 4IMNA 5AQ6A 3SLTA 3SAOA 3FR4A 4B55A 2WR6A 4GGTA 4OMWA 2AT8X 3BX8A 3WJFA 4NW4A 4FQBB 1BRPA 1OBUA 1DZKA 2FGSA 3HWGA 2X4MA 5HA0A 5L8OA 1K24A 2G8CO 2OL6O 1STSB 4PSQA 1LUQA 2GTFX 4YFQA 4CPHA 5FENA 2WQAE 2X46A 5B5FA 4ZGFA 4BX6A 4BVMA 3HPEA 4GH7A 1BSYA 1SWSA 2VFBA 1OEEA 2OVSA 4YBUA 4IAWA 5B3MO 3S26A 4FBRA 4TKBA 3B2KA 4INNA 2BT9A 3P6FA 4NLJA 4QGVA 4XMFA 5HAEA 5F2BA 4O4UA 4YFRA 5AEOA 2RTEB 3FLLA 1P6PA 3JQOA 2G78A 2X32A 5AJBA 2AMMX 4WHIA 1RXHA 1R0UA 4PJ2A 2RQ0A 2F09A 4U46A 3WZPA 2KT4B 4BQUA 2OFAA 4D6BA 2A0AA 4QZUA 5BYPA 1ICMA 3LTWA 4Z27A 4WFVA 4Y0QA 4K19A 3CWKA 2X8FA 5H8TA 1KT5A 1SY0A 4AW8A 4GGRA 5B29A 1JYJA 1A2DA 4JO6A 5D47A 3STMX 4A1YA 1CBQA 1KL3A 4BX5B 2JMBA 3TZSA 2RTDB 1SWPA 5IRAA 4ON1A 1KGLA 1SWHA 4TKJA 3FIQA 2RTAA 5F6ZA 4CDCA 4QAEA 1SWDA 2AT3X 2Q9SA 3KVNA 3C77X 2OY5O 1SRIA 3STKA 1YWCA 4ZHFA 2NNQA 4M7MA 4I95A 4QNIA 1LF7A 1K3BA 2OF8A 3RWXA 3D96A 2OY8A 3E3CA 4YCHA 1W4TA 4LZUA 2L67A 1NC9A 2MHDA 2CZUA 4NNSA 2Y3FA 3OE3A 3PH6A 2K62A 1E06A 4XMGA 1S2PA 2RTBB 2BS5A 1LIFA 2AF5A 5FQ8E 1UYNX 3VU1A 3D97A 1IKJA 4BCSA 5CSEA 1X89A 2XKLA 1VWIB 2ASNX 2QCBA 2R74A 4ORUA 2WSJA 1L6MA 1LKEA 1YWBA 1ZNDA 2KD2A 2FLJA 1VYGA 5IRUA 1SLGB 1KT7A 5D8JA 5JR8A 4YDAA 4ALOA 2LKKA 1UREA 5F6BA 3P02A 3PK2A 1QQSA 1RXJA 1YP6A 3WOVA 3CMPA 3AEHA 4YKMA 2F73A 2HMBA 1N43A 1SWUA 4ZHCA 5KICA 1SWCA 1UZ2X 4GNWA 2IZDB 1VPRA 2RTIB 1HMTA 3MBTA 4RUUA 3MVFA 3WBGA 2FHLA 1KQXA 1QFVA 3NX2A 3P6CA 4GDAA 1OPBA 2XSTA 1NGLA 1U18A 1STPA 3WZNA 2Q2MA 3ZW1B 4U3QA 3AUMO 4I9SA 3FEPA 2ACOA 1JJUA 3BSZE 3WJGA 1PM1X 1LDOA 3CBCA 1T68X 1MVGA 3KFIA 3SLOA 4CPEA 3WZQA 1HMRA 4KC8A 3EMMA 3T1DA 5HZ5A 1LICA 1MK5A 1N7YA 2RTHB 3EBKA 4N7CA 4GRJA 4MEEA 4OEMA 5D45A 3WVMA 4AZPA 4BGFA 3FIDA 3FR5A 4YCEA 5C0NA 4R0BA 2RTPB 2IZKA 3AKMA 4YKOA 1N9MA 4GETA 2AL0X 2BC3A 3VG4A 1DZJA 3SZHA 5IO7A 4OELA 3TGCA 1YP7A 3NX1A 5L8IA 2KTSA 1O1VA 5K06A 1JZUA 2L9CA 2X56A 2L5PA 3APVA 1GX9A 3B2HA 2IZBA 3OD9A 2C4IA 4XMCA 3T2XA 3VHMA 3ZQ3A 5IO6A 2JOZA 2RTLA 1ZNLA 2KW1A 3VGWA 3QKGA 4ORSA 1LPJA 5IO5A 1IKEA 2IZLB 2MM3A 2IZJA 3FEKA 2IZCB 4IB8A 4O4SA 5B5GA 2L68A 3UEWA 3APWA 4BOEA 1VWJB 1YUPA 1D2UA 1LCVA 5HTEA 4MVIA 1VWDB 5AJCA 1T0VA 3B2JA 1MM9A 1QABE 1JQPA 1FEMA 4QZTA 4YFPA 5JD2A 2KTDA 1ADLA 1CBRA 1GM6A 4AYHA 2IZIA 2DJFA 4NV8A 3ZW0B 2MF6A 1SRJA 4HPAA 1LIEA 1DZPA 1VWCB 1HQQA 4EXZA 5H9AA 2OYBO 2Q39A 2RTKA 4L3RA 4DNEA 1OSPO 1JIWI 3WXQA 4NLIA 3F6ZB 2OVEA 4U8UO 4GK9A 5LJDA 2LBVA 2OY7A 1EIIA 2MO5A 5D48A 1WBIA 2A8GA 4YGGA 3UEVA 1S44A 4QQ1A 4ZR2A 2GJ5A 1RSUB 2RTOB 1GT5A 1VWBB 1SWLA 2QO5A 1G85A 1EQDA 3ZUOA 4CDDA 4ODDA 1GKAB 1D3SA 1W6FA 1E5PA 4O4OA 2RN4A 4LKTA 4QYNA 5EDBA 4HFOA 1E02A 4YMYA 3ZUIA 1VWMB 1BLRA 3FELA 2RTMA 2F01A 2HZRA 2QO6A 4KC7A 4QRLA 1O8VA 4Y59A 5FQ7E 2E4JA 3O2YA 5CHKA 1JMXA 4YGHA 1EIOA 1RSTB 1A18A 3N91A 4EDEA 3I17A 5DPQA 4AZQA 1VWFB 4ZCBA 1Y52X 2QMIA 4O4XA 1ZNKA 1SWBA 4ZFXA 1FELA 1HBPA 4Z2VA 3U0DA 1CBIA 2FTBA 1EPAA 3PPTA 4ORRA 1KXOA 4TLJA 2AH7X 3UAQA 3SZJA 3ZW1A 4IBAA 2A2GA 4CPIA 1EUOA 1SWGA 2I5VO 2HLVA 1HQPA 3BX7A 3F9DA 4N7DA 4ARHA 4AZMA 4IB6A 4MVKA 2A5BA 3H3IA 4YGZA 5H9KA 2FRSA 1QY2A 1GT4A 1SWEA 3SLJA 3STNA 5LJCA 1SWRA 1NP1A 3NR3A 4NYQA 1FE3A 3FYFA 3O19A 3VG6A 4Z2OA 3EC5A 3DSZA 4MIRA 3FA6A 5KHPA 3EBWA 2ACPX 2NNEA 3P6GA 1RLBE 1GGLA 3HOLA 5HA1A 1SRHA 2GTLO 3K3LA 3KQ0A 3ZI8A 1GX3A 5H9LA 1SWJA 2RTFB 3BDRA
chains in the Genus database with same CATH topology
3BLGA 4WFUA 1QG5A 3NPOA 5F1EA 3PQSA 3BU1A 3EM0A 1TW4A 3NBXX 3KFGA 4HPCA 1IFBA 3RKGA 4Y0SA 3WJBA 3RZYA 5HBSA 2AT0X 4NNTA 2Q4NA 1FENA 5HZ8A 1G74A 2WUTA 3V8UA 4QGWA 5HZ6A 5HTDA 4ML7B 5LJGA 4U9CA 1SY3A 3ZW0A 2A2UA 5LJHA 1AQBA 1SXXA 3OBLA 4Y0PA 2Z4HA 2K23A 1BSOA 1OPAA 3FENA 2X45A 1SA8A 4KIIA 3GE2A 1BBPA 1DFVA 1SMPI 1YWDA 2LA7A 3CBSA 1ZRYA 1TOWA 3JS1A 4TNNA 5LJKA 1KZWA 3NP1A 2BLGA 2HYSA 4TQ2A 1TVQA 4GNYA 2QO4A 4YBPA 4ORWA 4AZNA 1QWDA 2BHVA 3OJYC 1ICNA 4UU2A 4DQ4A 5LJBA 2RD7C 1GKAA 4M6SA 3S5XA 1DZMA 1XCAA 1MX8A 1HN2A 3EYCA 3KFFA 4GE1A 4JGLA 1SY2A 3HOEA 5FAZA 1KT3A 2RCQA 3FW4A 5F58A 1BRQA 4OMXA 4ID2A 2CBSA 1CRBA 2YMSA 2W2BA 4FGIB 4I9RA 3FMZA 2PY1A 5D8JA 3NQ3A 4EEJA 5HCDC 3FA8A 3P6DA 1XKIA 3G7XA 2DM5A 2X8SA 2ANSA 2OVAA 4YDBA 3FA9A 3NADA 1EI5A 4IAXA 1KOIA 2LFOA 3P6HA 1FDQA 1U0XA 4A60A 2POAA 2ALLX 2FT9A 3APUA 3CR6A 4YH0A 2OZQA 4MVLA 3HK1A 1B8EA 1CJ5A 3P24A 3TGAA 1VYFA 2WQ9A 3HWFA 1EW3A 4HPDA 4KH8A 1SXWA 1QY0A 3Q6LA 3B2LA 1H91A 1MUPA 4I3DA 5EEDA 1SXUA 3RBYA 1B4MA 1T8VA 3D95A 1QY1A 4QGXA 3IFBA 2JU7A 1KT6A 2MWHA 1LIBA 2IFBA 1RBPA 4GDZA 4O3ZA 3P6EA 1HBQA 4CSBA 1SY1A 2QM9A 3TGBA 3KFHA 1AVGI 1B56A 4NP1A 2AT6X 3S60A 1X8OA 3I0AA 3S5VA 3ZW2A 1I04A 3VPJE 1BM5A 5LKFA 2G7BA 3ELXA 1JJXA 2N93A 3LV4A 4EQAC 1GX8A 5LKEA 4A1HA 5HZ9A 3PECA 1GT1A 2MJIA 5FQ6E 1MDCA 2CBRA 1KQWA 3FR2A 3GAQA 1GXAA 3DTQA 4TJZA 3UEUA 3D4RA 5FFHA 5BVQA 2A3FX 1OEJA 2BS6A 2HNXA 2X8TA 3O22A 1PMPA 4MISA 2YG2A 4QYPA 1SXYA 1JYDA 1X8QA 1CBSA 4L1NA 2JN3A 4O3YA 2P8GA 5EDCA 4MVEA 1KT4A 4ZH6A 1DV9A 2LBAA 2OFMX 4ORXA 1Y9LA 4HPBA 3PEDA 2FWVA 2NP1A 4ZHGA 5EEEA 2WEWA 1I06A 4HWMA 1A57A 4IB7A 4XMEA 5BVSA 3VE1A 2FR3A 4ORYA 2W2AA 2OFRX 4DQ3A 4OS0A 1G7NA 5LJEA 1BSQA 1PBOA 1Z24A 4U8UM 1ERXA 1O1UA 2JU8A 5KIDA 3SOTA 4COTA 1BJ7A 1MX7A 1NP4A 5D4AA 4ES7A 3ZZVA 2CZTA 1G5WA 2CM9A 1FTPA 1ZNEA 4NYRA 4Y0RA 2ZAIA 4XMHA 4ALBA 1OEKA 1YIVA 1B0OA 2GC9A 4ZJ0A 3FW5A 1YWAA 1I4UA 1QFTA 1A3YA 1EALA 5H9NA 4I3CA 1ML7A 3NQKA 4D6AA 3U03A 1BEBA 2GTLN 3JSQA 3HTYA 4IMOA 2EU7X 3VG5A 3VG2A 1X8PA 2A13A 2W2FA 3C76X 2JW1A 1IW2A 4O3WA 3VG7A 1X71A 1ALBA 1GT3A 2RA6A 1JBHA 3MX7A 3WJDA 3F8AA 3KZAA 3TF6A 1LNMA 1ZNGA 1IIUA 1OBPA 4KT5A 1DC9A 4I3BA 5HWZA 1ACDA 1IFCA 2O62A 3WJCA 2RCTA 4I6SA 4WBKA 4ZH9A 1TOUA 3VE2A 2R56A 1I05A 2NNDA 1U17A 2G79A 2QOSC 2GTLM 3VG3A 4GU8A 1KZXA 3AKNA 5F7GA 3NQ9A 3ZWEA 4O3XB 3APXA 1PEEA 4FBVA 3HWEA 1JV4A 2OVDA 1S7DA 3PP6A 3CQRA 3L4RA 5B27A 2M4LA 1LIDA 1N0SA 2AT5X 3PH5A 1LFOA 2Z4IA 2AKQA 3LHNA 3C78X 1JJJA 4KCAA 4ZHHA 2WEXA 1X8NA 2ZAGA 4CK4A 3B2IA 4EFGA 2WWPA 1TXLA 4O49A 4OS8A 1BWYA 4O9SA 1ZNHA 5HCCC 2FR2A 3ELZA 4ZHDA 1ERBA 4LZVA 1EXSA 3BY0A 4FBOA 4XMDA 4LKPA 2JU3A 1AB0A 5CYBA 5EZ2A 4ZGUA 3RSWA 2HZQA 1HMSA 3BU9A 1DF3A 3IA8A 5CE4A 3U9PC 3FA7A 4UU3A 5BVTA 4AZRA 1EPBA 4GKCA 1X8UA 4IB9A 4CV7A 2LB6A 3PQUA 3BS2A 5HZQA 1AELA 2FS6A 3HWDA 4GZVA 1OBQA 4RUNA 2FS7A 5DG4A 1E00A 4A8ZA 2CM4A 4OS3A 5HCEC 4AZOA 4TKHA 3UEXA 5L8NA 3CQNA 5EPQA 1Y9TA 2Q2PA 4LQZA 2R73A 3BRNA 4IABA 4U8UN 4IMNA 5AQ6A 3SAOA 3FR4A 2WR6A 4OMWA 2AT8X 3BX8A 3WJFA 4NW4A 4FQBB 1BRPA 1OBUA 1DZKA 3HWGA 5HA0A 5L8OA 4PSQA 2GTFX 4YFQA 5FENA 2WQAE 2X46A 4ZGFA 4BVMA 4GH7A 1BSYA 1OEEA 2OVSA 4YBUA 4IAWA 3S26A 4FBRA 4TKBA 3B2KA 4INNA 2BT9A 3P6FA 4NLJA 4QGVA 4XMFA 5HAEA 4O4UA 4YFRA 5AEOA 3FLLA 1P6PA 3JQOA 2G78A 5AJBA 2AMMX 4WHIA 1R0UA 4PJ2A 2RQ0A 2F09A 4BQUA 4D6BA 2KT4B 2A0AA 4QZUA 5BYPA 1ICMA 4WFVA 4Y0QA 4K19A 3CWKA 2X8FA 5H8TA 1KT5A 1SY0A 4AW8A 5B29A 1JYJA 1A2DA 5D47A 3STMX 4A1YA 1CBQA 2JMBA 3TZSA 4ON1A 1KGLA 4TKJA 5F6ZA 3FIQA 4QAEA 2AT3X 2Q9SA 3STKA 3C77X 1YWCA 4ZHFA 2NNQA 4M7MA 4I95A 4QNIA 1LF7A 3RWXA 3D96A 3E3CA 4YCHA 4LZUA 2L67A 2MHDA 2CZUA 4NNSA 3PH6A 3OE3A 2K62A 1E06A 4XMGA 1S2PA 2BS5A 1LIFA 5FQ8E 3VU1A 3D97A 1IKJA 1X89A 2XKLA 2ASNX 2R74A 4ORUA 2WSJA 1L6MA 1LKEA 1YWBA 1ZNDA 2KD2A 2FLJA 1VYGA 1KT7A 5JR8A 4YDAA 4ALOA 2LKKA 1UREA 5F6BA 3P02A 1QQSA 1YP6A 3WOVA 3CMPA 4YKMA 2F73A 2HMBA 4ZHCA 5KICA 1UZ2X 4GNWA 1VPRA 3MBTA 1HMTA 4RUUA 3MVFA 3WBGA 1KQXA 1QFVA 3NX2A 3P6CA 1OPBA 2XSTA 1NGLA 1U18A 3ZW1B 2Q2MA 4U3QA 4I9SA 3FEPA 2ACOA 3BSZE 3WJGA 1PM1X 3CBCA 1T68X 1MVGA 3KFIA 1HMRA 4KC8A 3EMMA 3T1DA 5HZ5A 1LICA 4N7CA 3EBKA 4GRJA 5D45A 4AZPA 3WVMA 3FR5A 4YCEA 5C0NA 4R0BA 3AKMA 4YKOA 4GETA 2AL0X 3VG4A 1DZJA 5IO7A 3TGCA 1YP7A 3NX1A 5L8IA 2KTSA 1O1VA 5K06A 1JZUA 2L9CA 3APVA 2L5PA 3B2HA 1GX9A 3OD9A 4XMCA 3ZQ3A 5IO6A 2JOZA 1ZNLA 2KW1A 3QKGA 4ORSA 1LPJA 5IO5A 1IKEA 2MM3A 4IB8A 3FEKA 3UEWA 4O4SA 4BOEA 2L68A 3APWA 5HTEA 1YUPA 1D2UA 4MVIA 5AJCA 1T0VA 3B2JA 1QABE 4QZTA 1FEMA 4YFPA 2KTDA 1ADLA 1CBRA 1GM6A 4AYHA 3ZW0B 4HPAA 1LIEA 1DZPA 4EXZA 5H9AA 2Q39A 4L3RA 1JIWI 3WXQA 4NLIA 3F6ZB 2OVEA 4U8UO 4GK9A 5LJDA 2LBVA 1EIIA 2MO5A 5D48A 4YGGA 3UEVA 1S44A 4QQ1A 4ZR2A 2GJ5A 3WJEA 1GT5A 2QO5A 1G85A 1EQDA 3ZUOA 4ODDA 1GKAB 1D3SA 1E5PA 4O4OA 2RN4A 4LKTA 4QYNA 5EDBA 4HFOA 1E02A 4YMYA 3ZUIA 1BLRA 3FELA 4KC7A 2QO6A 2HZRA 5FQ7E 4QRLA 1O8VA 2E4JA 3O2YA 4YGHA 1EIOA 1A18A 3N91A 4EDEA 3I17A 5DPQA 4AZQA 4ZCBA 4O4XA 2QMIA 4ZFXA 1ZNKA 1FELA 1HBPA 3U0DA 1CBIA 2FTBA 1EPAA 3PPTA 4ORRA 1KXOA 4TLJA 2AH7X 3UAQA 3ZW1A 4IBAA 2A2GA 1EUOA 4ARHA 2HLVA 1HQPA 3BX7A 3F9DA 4N7DA 4AZMA 4IB6A 4MVKA 3H3IA 4YGZA 5H9KA 2FRSA 1QY2A 1GT4A 5LJCA 3STNA 1NP1A 3NR3A 4NYQA 1FE3A 3FYFA 3O19A 3VG6A 3DSZA 4MIRA 3FA6A 5KHPA 3EBWA 2ACPX 2NNEA 3P6GA 1RLBE 1GGLA 3HOLA 5HA1A 2GTLO 3K3LA 3KQ0A 3ZI8A 5H9LA 3BDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLG A;  4WFU A;  1QG5 A;  3NPO A;  5F1E A;  3BU1 A;  3EM0 A;  1TW4 A;  3KFG A;  4HPC A;  1IFB A;  4Y0S A;  3WJB A;  3RZY A;  5HBS A;  2AT0 X;  4NNT A;  2Q4N A;  1FEN A;  5HZ8 A;  1G74 A;  2WUT A;  4QGW A;  5HZ6 A;  5HTD A;  5LJG A;  1SY3 A;  2A2U A;  5LJH A;  1AQB A;  1SXX A;  4Y0P A;  2K23 A;  1BSO A;  1OPA A;  3FEN A;  2X45 A;  1SA8 A;  4KII A;  1BBP A;  1DFV A;  1YWD A;  4TNN A;  3CBS A;  3JS1 A;  1ZRY A;  1TOW A;  4ZFX A;  5LJK A;  1KZW A;  3NP1 A;  2BLG A;  2HYS A;  4TQ2 A;  1TVQ A;  4GNY A;  2QO4 A;  4YBP A;  4ORW A;  4AZN A;  1QWD A;  4UU2 A;  3OJY C;  1ICN A;  4DQ4 A;  5LJB A;  2RD7 C;  1GKA A;  4M6S A;  1DZM A;  1XCA A;  1MX8 A;  1HN2 A;  3EYC A;  3KFF A;  4GE1 A;  1SY2 A;  5FAZ A;  1KT3 A;  2RCQ A;  3FW4 A;  5F58 A;  1BRQ A;  4OMX A;  2CBS A;  1CRB A;  4I9R A;  2W2B A;  5D8J A;  4EEJ A;  3FMZ A;  2PY1 A;  3NQ3 A;  5HCD C;  3FA8 A;  3P6D A;  1XKI A;  3G7X A;  2DM5 A;  2ANS A;  2OVA A;  4YDB A;  3FA9 A;  3NAD A;  4IAX A;  1KOI A;  2LFO A;  3P6H A;  1FDQ A;  1U0X A;  4A60 A;  2POA A;  2ALL X;  2FT9 A;  3APU A;  3CR6 A;  4YH0 A;  2OZQ A;  4MVL A;  3HK1 A;  1B8E A;  1CJ5 A;  3TGA A;  1VYF A;  2WQ9 A;  3HWF A;  1EW3 A;  4HPD A;  1SXW A;  1QY0 A;  3Q6L A;  3B2L A;  1H91 A;  1MUP A;  4I3D A;  5EED A;  1SXU A;  1B4M A;  1T8V A;  3D95 A;  1QY1 A;  4QGX A;  3IFB A;  2JU7 A;  1KT6 A;  1LIB A;  2IFB A;  1RBP A;  3P6E A;  1HBQ A;  1SY1 A;  2QM9 A;  3TGB A;  3KFH A;  1AVG I;  1B56 A;  4NP1 A;  2AT6 X;  1X8O A;  3I0A A;  1I04 A;  1BM5 A;  5LKF A;  2G7B A;  3ELX A;  1JJX A;  2N93 A;  1GX8 A;  5LKE A;  4A1H A;  5HZ9 A;  3PEC A;  1GT1 A;  2MJI A;  1MDC A;  2CBR A;  1KQW A;  3FR2 A;  3GAQ A;  1GXA A;  3DTQ A;  4TJZ A;  3UEU A;  5FFH A;  5BVQ A;  2A3F X;  1OEJ A;  3O22 A;  2HNX A;  1PMP A;  2YG2 A;  4QYP A;  1SXY A;  1JYD A;  1X8Q A;  1CBS A;  2JN3 A;  4ZH6 A;  2P8G A;  5EDC A;  1DV9 A;  1KT4 A;  2LBA A;  2OFM X;  4ORX A;  4HPB A;  3PED A;  2FWV A;  2NP1 A;  4ZHG A;  5EEE A;  2WEW A;  1I06 A;  1A57 A;  4IB7 A;  4XME A;  5BVS A;  2FR3 A;  4ORY A;  2W2A A;  2OFR X;  4DQ3 A;  4OS0 A;  1G7N A;  5LJE A;  1BSQ A;  1PBO A;  1Z24 A;  1ERX A;  1O1U A;  2JU8 A;  5KID A;  1BJ7 A;  1MX7 A;  1NP4 A;  5D4A A;  4ES7 A;  2CZT A;  1G5W A;  2CM9 A;  1FTP A;  1ZNE A;  4NYR A;  4Y0R A;  4XMH A;  4ALB A;  1OEK A;  1YIV A;  1B0O A;  2GC9 A;  4ZJ0 A;  3FW5 A;  1YWA A;  1I4U A;  1QFT A;  1A3Y A;  1EAL A;  5H9N A;  4I3C A;  1ML7 A;  4D6A A;  3U03 A;  1BEB A;  3JSQ A;  4IMO A;  2EU7 X;  3VG5 A;  3VG2 A;  1X8P A;  2A13 A;  2W2F A;  3C76 X;  1IW2 A;  3VG7 A;  1X71 A;  1ALB A;  1GT3 A;  2RA6 A;  1JBH A;  3WJD A;  3F8A A;  3KZA A;  3TF6 A;  1LNM A;  1ZNG A;  1IIU A;  1OBP A;  1DC9 A;  4I3B A;  5HWZ A;  1ACD A;  1IFC A;  2O62 A;  3WJC A;  2RCT A;  4WBK A;  4ZH9 A;  1TOU A;  2R56 A;  1I05 A;  2NND A;  1U17 A;  2G79 A;  2QOS C;  3VG3 A;  1KZX A;  3AKN A;  5F7G A;  3NQ9 A;  3APX A;  1PEE A;  3HWE A;  1JV4 A;  2OVD A;  1S7D A;  3PP6 A;  3CQR A;  3L4R A;  5B27 A;  1LID A;  1N0S A;  2AT5 X;  3PH5 A;  1LFO A;  2AKQ A;  3C78 X;  1JJJ A;  4ZHH A;  2WEX A;  1X8N A;  4CK4 A;  3B2I A;  4EFG A;  2WWP A;  1TXL A;  4OS8 A;  1BWY A;  4O9S A;  1ZNH A;  5HCC C;  2FR2 A;  3ELZ A;  4ZHD A;  1ERB A;  4LZV A;  1EXS A;  3BY0 A;  4XMD A;  4LKP A;  2JU3 A;  1AB0 A;  5EZ2 A;  4ZGU A;  3RSW A;  2HZQ A;  1HMS A;  3BU9 A;  1DF3 A;  3IA8 A;  5CE4 A;  3U9P C;  3FA7 A;  4UU3 A;  5BVT A;  4AZR A;  1EPB A;  4GKC A;  1X8U A;  4IB9 A;  2LB6 A;  3BS2 A;  5HZQ A;  1AEL A;  2FS6 A;  3HWD A;  1OBQ A;  4RUN A;  2FS7 A;  5DG4 A;  1E00 A;  4A8Z A;  2CM4 A;  4OS3 A;  5HCE C;  4AZO A;  4TKH A;  3UEX A;  5L8N A;  3CQN A;  5EPQ A;  2Q2P A;  2R73 A;  3BRN A;  5AQ6 A;  4IMN A;  3SAO A;  3FR4 A;  2WR6 A;  4OMW A;  2AT8 X;  3BX8 A;  3WJF A;  1BRP A;  1OBU A;  1DZK A;  3HWG A;  5HA0 A;  5L8O A;  4PSQ A;  2GTF X;  4YFQ A;  5FEN A;  2WQA E;  2X46 A;  4BVM A;  4GH7 A;  1BSY A;  1OEE A;  4YBU A;  4IAW A;  3S26 A;  4TKB A;  3B2K A;  4QGV A;  3P6F A;  4NLJ A;  4XMF A;  5HAE A;  4YFR A;  3FLL A;  1P6P A;  2G78 A;  2AMM X;  1R0U A;  4D6B A;  2RQ0 A;  4BQU A;  2KT4 B;  2A0A A;  4QZU A;  1ICM A;  4WFV A;  4Y0Q A;  4K19 A;  3CWK A;  5H8T A;  1KT5 A;  1SY0 A;  4AW8 A;  5B29 A;  1JYJ A;  1A2D A;  5D47 A;  3STM X;  4A1Y A;  1CBQ A;  3TZS A;  1KGL A;  4TKJ A;  5F6Z A;  3FIQ A;  4QAE A;  2AT3 X;  2Q9S A;  3STK A;  3C77 X;  1YWC A;  4ZHF A;  2NNQ A;  4M7M A;  1LF7 A;  3D96 A;  4YCH A;  4LZU A;  2L67 A;  2CZU A;  4NNS A;  3PH6 A;  2K62 A;  1E06 A;  4XMG A;  1S2P A;  1LIF A;  3D97 A;  1IKJ A;  1X89 A;  2XKL A;  2ASN X;  2R74 A;  4ORU A;  2WSJ A;  1L6M A;  1LKE A;  1YWB A;  1ZND A;  2FLJ A;  1VYG A;  1KT7 A;  5JR8 A;  4YDA A;  4ALO A;  2LKK A;  1URE A;  5F6B A;  1QQS A;  1YP6 A;  3CMP A;  4YKM A;  2F73 A;  2HMB A;  4ZHC A;  5KIC A;  1UZ2 X;  4GNW A;  1VPR A;  3MBT A;  1HMT A;  4RUU A;  3MVF A;  3WBG A;  1KQX A;  1QFV A;  3NX2 A;  3P6C A;  1OPB A;  2XST A;  1NGL A;  1U18 A;  2Q2M A;  4I9S A;  3FEP A;  2ACO A;  3BSZ E;  3WJG A;  1PM1 X;  3CBC A;  1T68 X;  1MVG A;  3KFI A;  1HMR A;  5HZ5 A;  3EMM A;  3T1D A;  1LIC A;  4N7C A;  3EBK A;  4GRJ A;  5D45 A;  4AZP A;  3WVM A;  3FR5 A;  4YCE A;  5C0N A;  4R0B A;  3AKM A;  4YKO A;  4GET A;  2AL0 X;  3VG4 A;  1DZJ A;  5IO7 A;  3TGC A;  1YP7 A;  3NX1 A;  5L8I A;  1O1V A;  5K06 A;  1JZU A;  2L9C A;  3APV A;  2L5P A;  3B2H A;  1GX9 A;  4XMC A;  3ZQ3 A;  5IO6 A;  2JOZ A;  1ZNL A;  3QKG A;  4ORS A;  1LPJ A;  5IO5 A;  1IKE A;  2MM3 A;  4IB8 A;  3FEK A;  3UEW A;  4BOE A;  2L68 A;  3APW A;  5HTE A;  1YUP A;  1D2U A;  4MVI A;  1T0V A;  3B2J A;  1QAB E;  4QZT A;  1FEM A;  4YFP A;  2KTD A;  1ADL A;  1CBR A;  1GM6 A;  4AYH A;  4HPA A;  1LIE A;  1DZP A;  4EXZ A;  5H9A A;  2Q39 A;  3WXQ A;  4NLI A;  5LJD A;  2OVE A;  1EII A;  2LBV A;  2MO5 A;  5D48 A;  4YGG A;  3UEV A;  1S44 A;  4ZR2 A;  3WJE A;  2GJ5 A;  1GT5 A;  2QO5 A;  1G85 A;  1EQD A;  3ZUO A;  4ODD A;  1GKA B;  1D3S A;  1E5P A;  5EDB A;  4LKT A;  4QYN A;  4HFO A;  1E02 A;  4YMY A;  3ZUI A;  1BLR A;  3FEL A;  2QO6 A;  2HZR A;  1O8V A;  2E4J A;  3O2Y A;  4YGH A;  1EIO A;  1A18 A;  4EDE A;  3I17 A;  5DPQ A;  4AZQ A;  4ZCB A;  1ZNK A;  1FEL A;  1HBP A;  3U0D A;  1CBI A;  2FTB A;  1EPA A;  3PPT A;  4ORR A;  1KXO A;  4TLJ A;  2AH7 X;  4IBA A;  2A2G A;  1EUO A;  4ARH A;  2HLV A;  1HQP A;  3BX7 A;  3F9D A;  4N7D A;  4AZM A;  4IB6 A;  4MVK A;  4YGZ A;  5H9K A;  2FRS A;  1QY2 A;  1GT4 A;  5LJC A;  3STN A;  1NP1 A;  3NR3 A;  4NYQ A;  1FE3 A;  3O19 A;  3VG6 A;  3DSZ A;  5KHP A;  3FA6 A;  3EBW A;  2ACP X;  2NNE A;  3P6G A;  1RLB E;  1GGL A;  5HA1 A;  3K3L A;  3KQ0 A;  5H9L A;  3BDR A; 
#chains in the Genus database with same CATH topology
 3BLG A;  1SWO A;  4WFU A;  1QG5 A;  3NPO A;  5F1E A;  3PQS A;  1SLD B;  3BU1 A;  1TW4 A;  3EM0 A;  3RE6 A;  3NBX X;  4TNN A;  1SRE A;  3KFG A;  4HPC A;  1IFB A;  4JHQ A;  4Y0S A;  3RKG A;  3RZY A;  3WJB A;  5HBS A;  1SRF A;  2AT0 X;  4NNT A;  2VFC A;  2Q4N A;  1FEN A;  1PBY A;  5HZ8 A;  2OL7 A;  1G74 A;  2WUT A;  3V8U A;  4QGW A;  2IZG B;  2BSZ A;  5B2A O;  5HZ6 A;  1I9H A;  5HTD A;  1SLF B;  4ML7 B;  5LJG A;  4U9C A;  1SY3 A;  1SWA A;  2A2U A;  3ZW0 A;  1AVE A;  4Z2P A;  1AQB A;  5LJH A;  1SXX A;  3OBL A;  4Y0P A;  2Z4H A;  2K23 A;  1BSO A;  1OPA A;  3FEN A;  2X45 A;  1SA8 A;  4KII A;  3GE2 A;  1BBP A;  1DFV A;  1SMP I;  1YWD A;  2LA7 A;  3CBS A;  1ZRY A;  1TOW A;  1VWH B;  2IZA A;  3JS1 A;  4I60 A;  2C1S A;  5LJK A;  3NP1 A;  2BLG A;  2HYS A;  4TQ2 A;  1HXL A;  1TVQ A;  4GNY A;  5B11 O;  2QO4 A;  4YBP A;  4ORW A;  4AZN A;  1QWD A;  2BHV A;  3OJY C;  1ICN A;  2WPU A;  1UYO X;  4UU2 A;  3RDX A;  1VWR B;  4DQ4 A;  5LJB A;  2RD7 C;  1GKA A;  4M6S A;  3S5X A;  2FKG A;  1DZM A;  2Y3E A;  1SWK A;  1XCA A;  1MX8 A;  1HN2 A;  3EYC A;  3KFF A;  4GE1 A;  4JGL A;  4IRW A;  1SY2 A;  3HOE A;  5FAZ A;  1KT3 A;  2RCQ A;  3FW4 A;  1IJ8 A;  2RTC B;  1BRQ A;  4OMX A;  5F58 A;  3MM0 A;  4ID2 A;  4BJ8 A;  2CBS A;  1CRB A;  2YMS A;  2W2B A;  4FGI B;  4GD9 A;  3FMZ A;  2PY1 A;  2X55 A;  3NQ3 A;  4I9R A;  4EEJ A;  3FA8 A;  5HCD C;  3P6D A;  1XKI A;  3G7X A;  1SWN A;  1VWG B;  2DM5 A;  2X8S A;  3FDC A;  3QQ2 A;  2ANS A;  2OVA A;  4YDB A;  4CDF A;  3FA9 A;  1SWQ A;  3NAD A;  2RTG B;  2RTQ B;  1EI5 A;  1VWP B;  4IAX A;  2IZF B;  1VWN B;  1KOI A;  2LFO A;  3P6H A;  1FDQ A;  3RY1 A;  1U0X A;  4A60 A;  2POA A;  2ALL X;  2FT9 A;  3APU A;  3CR6 A;  4YH0 A;  2OZQ A;  4MVL A;  3HK1 A;  1VYO A;  2UYW A;  1B8E A;  1CJ5 A;  3P24 A;  1VWO B;  3TGA A;  1VYF A;  2WQ9 A;  2C1Q A;  1EW3 A;  3HWF A;  3Q34 A;  4HPD A;  1SXW A;  4KH8 A;  1QY0 A;  4Y5D A;  3Q6L A;  3B2L A;  1H91 A;  1MUP A;  1SLE B;  1NBX A;  1SXU A;  4I3D A;  2IZH B;  5EED A;  4YVB A;  1KZW A;  2DJG A;  3RBY A;  1B4M A;  3RY2 A;  1T8V A;  3D95 A;  1KL4 A;  2Y32 A;  3WYP A;  1QY1 A;  3EW1 A;  4QGX A;  3IFB A;  2JU7 A;  4CPF A;  1KT6 A;  2MWH A;  1LIB A;  2IFB A;  1RBP A;  4GDZ A;  3CKG A;  2AVI A;  4O3Z A;  2JGS A;  3P6E A;  3VHH A;  2UZ2 A;  1HBQ A;  4CSB A;  1SY1 A;  2QM9 A;  3TGB A;  2G5L A;  3KFH A;  3T6L A;  1JMZ A;  1AVG I;  1B56 A;  4NP1 A;  2AT6 X;  3S60 A;  3CKF A;  1X8O A;  3I0A A;  2RTJ A;  3S5V A;  3ZW2 A;  1I04 A;  3VPJ E;  1BM5 A;  5LKF A;  2G7B A;  3ELX A;  1JJX A;  2N93 A;  3LV4 A;  5K68 A;  4EQA C;  4NV7 A;  1GX8 A;  1LDQ A;  5LKE A;  3T6F A;  4A1H A;  5HZ9 A;  3PEC A;  2I5Z O;  1GT1 A;  2MJI A;  5FQ6 E;  1MDC A;  2CBR A;  1KQW A;  3FR2 A;  3GAQ A;  4OKA A;  1GXA A;  4BX7 B;  3DTQ A;  4TJZ A;  3UEU A;  3D4R A;  2OFB A;  5FFH A;  1OEJ A;  2A3F X;  2BS6 A;  2HNX A;  2X8T A;  2OY1 O;  3O22 A;  5BVQ A;  1PMP A;  4MIS A;  2YG2 A;  4QYP A;  1SXY A;  1JYD A;  2RTR B;  1N4J A;  3PDF A;  1X8Q A;  1CBS A;  4L1N A;  2JN3 A;  1RAV A;  2P8G A;  4GGZ A;  4MVE A;  1KT4 A;  4O3Y A;  1PTS A;  5EDC A;  4ZH6 A;  1DV9 A;  2LBA A;  1Y55 X;  2OFM X;  4ORX A;  1Y9L A;  4HPB A;  2IZE B;  3PED A;  2RTN B;  2FWV A;  2NP1 A;  1MOY A;  2OF9 A;  4ZHG A;  5EEE A;  1KL5 A;  1I06 A;  2WEW A;  4HWM A;  1A57 A;  4IB7 A;  4XME A;  5BVS A;  3VE1 A;  2FR3 A;  4ORY A;  2HKD A;  2W2A A;  1VWA B;  2OFR X;  4DQ3 A;  4OS0 A;  1Y0G A;  1G7N A;  5LJE A;  1BSQ A;  1PBO A;  1Z24 A;  4U8U M;  3RE5 A;  1ERX A;  1HY2 A;  1O1U A;  2JU8 A;  2CAM A;  2X34 A;  5KID A;  3SOT A;  4COT A;  1BJ7 A;  1MX7 A;  1NP4 A;  5D4A A;  4ES7 A;  3ZZV A;  1NDJ A;  2CZT A;  1G5W A;  3T2W A;  1FJ1 E;  2CM9 A;  1FTP A;  3WYQ A;  1ZNE A;  1AVD A;  4NYR A;  4GUZ A;  4Y0R A;  2ZAI A;  4XMH A;  4ALB A;  1OEK A;  1YIV A;  1B0O A;  2GC9 A;  4ZJ0 A;  3FW5 A;  1YWA A;  1I4U A;  1QFT A;  1VWE B;  1A3Y A;  1EAL A;  4GJV A;  5H9N A;  1STR B;  4I3C A;  1ML7 A;  1HXZ A;  3NQK A;  4D6A A;  3U03 A;  1BEB A;  2GTL N;  3JSQ A;  3HTY A;  2GH7 A;  4IMO A;  2EU7 X;  3VG5 A;  3RDU A;  3VG2 A;  1X8P A;  3RDM A;  2A13 A;  2W2F A;  1LCZ A;  3C76 X;  1I78 A;  2JW1 A;  1IW2 A;  4JNJ A;  4O3W A;  3VG7 A;  1X71 A;  1ALB A;  1GT3 A;  2RA6 A;  1JBH A;  3MX7 A;  2FKJ A;  1NQN A;  3WJD A;  3F8A A;  3KZA A;  3TF6 A;  1LNM A;  1ZNG A;  1IIU A;  1OBP A;  1LCW A;  4KT5 A;  1DC9 A;  3RDQ A;  4I3B A;  5HWZ A;  5IRW A;  1ACD A;  1IFC A;  2O62 A;  3WJC A;  2RCT A;  4I6S A;  4WBK A;  4ZH9 A;  1TOU A;  1NQM A;  3VE2 A;  5L3Y A;  3RDS A;  4CPH B;  2R56 A;  1I05 A;  1Y53 X;  2NND A;  4DCB A;  1U17 A;  2QOM A;  4EKV A;  1W5R A;  2G79 A;  2QOS C;  2GTL M;  3VG3 A;  4BX6 B;  4GU8 A;  1KZX A;  2PI3 O;  3X00 A;  3AKN A;  5F7G A;  3NQ9 A;  3ZWE A;  1VWQ B;  3APX A;  4O3X B;  4BX5 A;  1PEE A;  4BX7 A;  4FBV A;  3HWE A;  1SRG A;  1JV4 A;  2FHN X;  2OVD A;  3SZI A;  1S7D A;  3PP6 A;  5K67 A;  3CQR A;  3L4R A;  5B27 A;  2M4L A;  1LID A;  1N0S A;  2AT5 X;  3MG5 A;  3PH5 A;  1LFO A;  2Z4I A;  2AKQ A;  4Z6J A;  3LHN A;  3C78 X;  1JJJ A;  1SWT A;  4KCA A;  2WEX A;  1X8N A;  2ZAG A;  4ZHH A;  1E2T A;  3B2I A;  4CK4 A;  1DF8 A;  2WWP A;  3VHI A;  1TXL A;  4O49 A;  4CDE A;  4OS8 A;  4EFG A;  1BWY A;  4O9S A;  1ZNH A;  2VDF A;  5HCC C;  2FR2 A;  3ELZ A;  4ZHD A;  1RXK A;  1VWK B;  1ERB A;  2OL8 O;  1EXS A;  2A5C A;  3BY0 A;  4FBO A;  4LZV A;  4XMD A;  4C5P A;  4LKP A;  2JU3 A;  1N9Y A;  1AB0 A;  5CYB A;  5EZ2 A;  3WJE A;  4ZGU A;  3RSW A;  2HZQ A;  1HMS A;  3BU9 A;  1DF3 A;  3IA8 A;  5CE4 A;  3U9P C;  3FA7 A;  3RDO A;  4UU3 A;  4GJS A;  5BVT A;  4AZR A;  1EPB A;  4GKC A;  3EW2 A;  1X8U A;  4Z28 A;  3D9W A;  4IB9 A;  1LEL A;  5B10 O;  2LB6 A;  1KFF A;  4CV7 A;  2ZSC A;  3PQU A;  3BS2 A;  1MEP A;  5HZQ A;  1AEL A;  2FS6 A;  3HWD A;  4GZV A;  1SWF A;  1OBQ A;  4RUN A;  2FS7 A;  5DG4 A;  1E00 A;  4A8Z A;  4BBO A;  2CM4 A;  4OS3 A;  1WUB A;  3WZO A;  5HCE C;  4AZO A;  4TKH A;  3UEX A;  5L8N A;  5IXG A;  3CQN A;  1VWL B;  5EPQ A;  1Y9T A;  2Q2P A;  4LQZ A;  2R73 A;  3BRN A;  4IAB A;  4U8U N;  4IMN A;  5AQ6 A;  3SLT A;  3SAO A;  3FR4 A;  4B55 A;  2WR6 A;  4GGT A;  4OMW A;  2AT8 X;  3BX8 A;  3WJF A;  4NW4 A;  4FQB B;  1BRP A;  1OBU A;  1DZK A;  2FGS A;  3HWG A;  2X4M A;  5HA0 A;  5L8O A;  1K24 A;  2G8C O;  2OL6 O;  1STS B;  4PSQ A;  1LUQ A;  2GTF X;  4YFQ A;  4CPH A;  5FEN A;  2WQA E;  2X46 A;  5B5F A;  4ZGF A;  4BX6 A;  4BVM A;  3HPE A;  4GH7 A;  1BSY A;  1SWS A;  2VFB A;  1OEE A;  2OVS A;  4YBU A;  4IAW A;  5B3M O;  3S26 A;  4FBR A;  4TKB A;  3B2K A;  4INN A;  2BT9 A;  3P6F A;  4NLJ A;  4QGV A;  4XMF A;  5HAE A;  5F2B A;  4O4U A;  4YFR A;  5AEO A;  2RTE B;  3FLL A;  1P6P A;  3JQO A;  2G78 A;  2X32 A;  5AJB A;  2AMM X;  4WHI A;  1RXH A;  1R0U A;  4PJ2 A;  2RQ0 A;  2F09 A;  4U46 A;  3WZP A;  2KT4 B;  4BQU A;  2OFA A;  4D6B A;  2A0A A;  4QZU A;  5BYP A;  1ICM A;  3LTW A;  4Z27 A;  4WFV A;  4Y0Q A;  4K19 A;  3CWK A;  2X8F A;  5H8T A;  1KT5 A;  1SY0 A;  4AW8 A;  4GGR A;  5B29 A;  1JYJ A;  1A2D A;  4JO6 A;  5D47 A;  3STM X;  4A1Y A;  1CBQ A;  1KL3 A;  4BX5 B;  2JMB A;  3TZS A;  2RTD B;  1SWP A;  5IRA A;  4ON1 A;  1KGL A;  1SWH A;  4TKJ A;  3FIQ A;  2RTA A;  5F6Z A;  4CDC A;  4QAE A;  1SWD A;  2AT3 X;  2Q9S A;  3KVN A;  3C77 X;  2OY5 O;  1SRI A;  3STK A;  1YWC A;  4ZHF A;  2NNQ A;  4M7M A;  4I95 A;  4QNI A;  1LF7 A;  1K3B A;  2OF8 A;  3RWX A;  3D96 A;  2OY8 A;  3E3C A;  4YCH A;  1W4T A;  4LZU A;  2L67 A;  1NC9 A;  2MHD A;  2CZU A;  4NNS A;  2Y3F A;  3OE3 A;  3PH6 A;  2K62 A;  1E06 A;  4XMG A;  1S2P A;  2RTB B;  2BS5 A;  1LIF A;  2AF5 A;  5FQ8 E;  1UYN X;  3VU1 A;  3D97 A;  1IKJ A;  4BCS A;  5CSE A;  1X89 A;  2XKL A;  1VWI B;  2ASN X;  2QCB A;  2R74 A;  4ORU A;  2WSJ A;  1L6M A;  1LKE A;  1YWB A;  1ZND A;  2KD2 A;  2FLJ A;  1VYG A;  5IRU A;  1SLG B;  1KT7 A;  5D8J A;  5JR8 A;  4YDA A;  4ALO A;  2LKK A;  1URE A;  5F6B A;  3P02 A;  3PK2 A;  1QQS A;  1RXJ A;  1YP6 A;  3WOV A;  3CMP A;  3AEH A;  4YKM A;  2F73 A;  2HMB A;  1N43 A;  1SWU A;  4ZHC A;  5KIC A;  1SWC A;  1UZ2 X;  4GNW A;  2IZD B;  1VPR A;  2RTI B;  1HMT A;  3MBT A;  4RUU A;  3MVF A;  3WBG A;  2FHL A;  1KQX A;  1QFV A;  3NX2 A;  3P6C A;  4GDA A;  1OPB A;  2XST A;  1NGL A;  1U18 A;  1STP A;  3WZN A;  2Q2M A;  3ZW1 B;  4U3Q A;  3AUM O;  4I9S A;  3FEP A;  2ACO A;  1JJU A;  3BSZ E;  3WJG A;  1PM1 X;  1LDO A;  3CBC A;  1T68 X;  1MVG A;  3KFI A;  3SLO A;  4CPE A;  3WZQ A;  1HMR A;  4KC8 A;  3EMM A;  3T1D A;  5HZ5 A;  1LIC A;  1MK5 A;  1N7Y A;  2RTH B;  3EBK A;  4N7C A;  4GRJ A;  4MEE A;  4OEM A;  5D45 A;  3WVM A;  4AZP A;  4BGF A;  3FID A;  3FR5 A;  4YCE A;  5C0N A;  4R0B A;  2RTP B;  2IZK A;  3AKM A;  4YKO A;  1N9M A;  4GET A;  2AL0 X;  2BC3 A;  3VG4 A;  1DZJ A;  3SZH A;  5IO7 A;  4OEL A;  3TGC A;  1YP7 A;  3NX1 A;  5L8I A;  2KTS A;  1O1V A;  5K06 A;  1JZU A;  2L9C A;  2X56 A;  2L5P A;  3APV A;  1GX9 A;  3B2H A;  2IZB A;  3OD9 A;  2C4I A;  4XMC A;  3T2X A;  3VHM A;  3ZQ3 A;  5IO6 A;  2JOZ A;  2RTL A;  1ZNL A;  2KW1 A;  3VGW A;  3QKG A;  4ORS A;  1LPJ A;  5IO5 A;  1IKE A;  2IZL B;  2MM3 A;  2IZJ A;  3FEK A;  2IZC B;  4IB8 A;  4O4S A;  5B5G A;  2L68 A;  3UEW A;  3APW A;  4BOE A;  1VWJ B;  1YUP A;  1D2U A;  1LCV A;  5HTE A;  4MVI A;  1VWD B;  5AJC A;  1T0V A;  3B2J A;  1MM9 A;  1QAB E;  1JQP A;  1FEM A;  4QZT A;  4YFP A;  5JD2 A;  2KTD A;  1ADL A;  1CBR A;  1GM6 A;  4AYH A;  2IZI A;  2DJF A;  4NV8 A;  3ZW0 B;  2MF6 A;  1SRJ A;  4HPA A;  1LIE A;  1DZP A;  1VWC B;  1HQQ A;  4EXZ A;  5H9A A;  2OYB O;  2Q39 A;  2RTK A;  4L3R A;  4DNE A;  1OSP O;  1JIW I;  3WXQ A;  4NLI A;  3F6Z B;  2OVE A;  4U8U O;  4GK9 A;  5LJD A;  2LBV A;  2OY7 A;  1EII A;  2MO5 A;  5D48 A;  1WBI A;  2A8G A;  4YGG A;  3UEV A;  1S44 A;  4QQ1 A;  4ZR2 A;  2GJ5 A;  1RSU B;  2RTO B;  1GT5 A;  1VWB B;  1SWL A;  2QO5 A;  1G85 A;  1EQD A;  3ZUO A;  4CDD A;  4ODD A;  1GKA B;  1D3S A;  1W6F A;  1E5P A;  4O4O A;  2RN4 A;  4LKT A;  4QYN A;  5EDB A;  4HFO A;  1E02 A;  4YMY A;  3ZUI A;  1VWM B;  1BLR A;  3FEL A;  2RTM A;  2F01 A;  2HZR A;  2QO6 A;  4KC7 A;  4QRL A;  1O8V A;  4Y59 A;  5FQ7 E;  2E4J A;  3O2Y A;  5CHK A;  1JMX A;  4YGH A;  1EIO A;  1RST B;  1A18 A;  3N91 A;  4EDE A;  3I17 A;  5DPQ A;  4AZQ A;  1VWF B;  4ZCB A;  1Y52 X;  2QMI A;  4O4X A;  1ZNK A;  1SWB A;  4ZFX A;  1FEL A;  1HBP A;  4Z2V A;  3U0D A;  1CBI A;  2FTB A;  1EPA A;  3PPT A;  4ORR A;  1KXO A;  4TLJ A;  2AH7 X;  3UAQ A;  3SZJ A;  3ZW1 A;  4IBA A;  2A2G A;  4CPI A;  1EUO A;  1SWG A;  2I5V O;  2HLV A;  1HQP A;  3BX7 A;  3F9D A;  4N7D A;  4ARH A;  4AZM A;  4IB6 A;  4MVK A;  2A5B A;  3H3I A;  4YGZ A;  5H9K A;  2FRS A;  1QY2 A;  1GT4 A;  1SWE A;  3SLJ A;  3STN A;  5LJC A;  1SWR A;  1NP1 A;  3NR3 A;  4NYQ A;  1FE3 A;  3FYF A;  3O19 A;  3VG6 A;  4Z2O A;  3EC5 A;  3DSZ A;  4MIR A;  3FA6 A;  5KHP A;  3EBW A;  2ACP X;  2NNE A;  3P6G A;  1RLB E;  1GGL A;  3HOL A;  5HA1 A;  1SRH A;  2GTL O;  3K3L A;  3KQ0 A;  3ZI8 A;  1GX3 A;  5H9L A;  1SWJ A;  2RTF B;  3BDR A; 
#chains in the Genus database with same CATH homology
 3BLG A;  4WFU A;  1QG5 A;  3NPO A;  5F1E A;  3PQS A;  3BU1 A;  3EM0 A;  1TW4 A;  3NBX X;  3KFG A;  4HPC A;  1IFB A;  3RKG A;  4Y0S A;  3WJB A;  3RZY A;  5HBS A;  2AT0 X;  4NNT A;  2Q4N A;  1FEN A;  5HZ8 A;  1G74 A;  2WUT A;  3V8U A;  4QGW A;  5HZ6 A;  5HTD A;  4ML7 B;  5LJG A;  4U9C A;  1SY3 A;  3ZW0 A;  2A2U A;  5LJH A;  1AQB A;  1SXX A;  3OBL A;  4Y0P A;  2Z4H A;  2K23 A;  1BSO A;  1OPA A;  3FEN A;  2X45 A;  1SA8 A;  4KII A;  3GE2 A;  1BBP A;  1DFV A;  1SMP I;  1YWD A;  2LA7 A;  3CBS A;  1ZRY A;  1TOW A;  3JS1 A;  4TNN A;  5LJK A;  1KZW A;  3NP1 A;  2BLG A;  2HYS A;  4TQ2 A;  1TVQ A;  4GNY A;  2QO4 A;  4YBP A;  4ORW A;  4AZN A;  1QWD A;  2BHV A;  3OJY C;  1ICN A;  4UU2 A;  4DQ4 A;  5LJB A;  2RD7 C;  1GKA A;  4M6S A;  3S5X A;  1DZM A;  1XCA A;  1MX8 A;  1HN2 A;  3EYC A;  3KFF A;  4GE1 A;  4JGL A;  1SY2 A;  3HOE A;  5FAZ A;  1KT3 A;  2RCQ A;  3FW4 A;  5F58 A;  1BRQ A;  4OMX A;  4ID2 A;  2CBS A;  1CRB A;  2YMS A;  2W2B A;  4FGI B;  4I9R A;  3FMZ A;  2PY1 A;  5D8J A;  3NQ3 A;  4EEJ A;  5HCD C;  3FA8 A;  3P6D A;  1XKI A;  3G7X A;  2DM5 A;  2X8S A;  2ANS A;  2OVA A;  4YDB A;  3FA9 A;  3NAD A;  1EI5 A;  4IAX A;  1KOI A;  2LFO A;  3P6H A;  1FDQ A;  1U0X A;  4A60 A;  2POA A;  2ALL X;  2FT9 A;  3APU A;  3CR6 A;  4YH0 A;  2OZQ A;  4MVL A;  3HK1 A;  1B8E A;  1CJ5 A;  3P24 A;  3TGA A;  1VYF A;  2WQ9 A;  3HWF A;  1EW3 A;  4HPD A;  4KH8 A;  1SXW A;  1QY0 A;  3Q6L A;  3B2L A;  1H91 A;  1MUP A;  4I3D A;  5EED A;  1SXU A;  3RBY A;  1B4M A;  1T8V A;  3D95 A;  1QY1 A;  4QGX A;  3IFB A;  2JU7 A;  1KT6 A;  2MWH A;  1LIB A;  2IFB A;  1RBP A;  4GDZ A;  4O3Z A;  3P6E A;  1HBQ A;  4CSB A;  1SY1 A;  2QM9 A;  3TGB A;  3KFH A;  1AVG I;  1B56 A;  4NP1 A;  2AT6 X;  3S60 A;  1X8O A;  3I0A A;  3S5V A;  3ZW2 A;  1I04 A;  3VPJ E;  1BM5 A;  5LKF A;  2G7B A;  3ELX A;  1JJX A;  2N93 A;  3LV4 A;  4EQA C;  1GX8 A;  5LKE A;  4A1H A;  5HZ9 A;  3PEC A;  1GT1 A;  2MJI A;  5FQ6 E;  1MDC A;  2CBR A;  1KQW A;  3FR2 A;  3GAQ A;  1GXA A;  3DTQ A;  4TJZ A;  3UEU A;  3D4R A;  5FFH A;  5BVQ A;  2A3F X;  1OEJ A;  2BS6 A;  2HNX A;  2X8T A;  3O22 A;  1PMP A;  4MIS A;  2YG2 A;  4QYP A;  1SXY A;  1JYD A;  1X8Q A;  1CBS A;  4L1N A;  2JN3 A;  4O3Y A;  2P8G A;  5EDC A;  4MVE A;  1KT4 A;  4ZH6 A;  1DV9 A;  2LBA A;  2OFM X;  4ORX A;  1Y9L A;  4HPB A;  3PED A;  2FWV A;  2NP1 A;  4ZHG A;  5EEE A;  2WEW A;  1I06 A;  4HWM A;  1A57 A;  4IB7 A;  4XME A;  5BVS A;  3VE1 A;  2FR3 A;  4ORY A;  2W2A A;  2OFR X;  4DQ3 A;  4OS0 A;  1G7N A;  5LJE A;  1BSQ A;  1PBO A;  1Z24 A;  4U8U M;  1ERX A;  1O1U A;  2JU8 A;  5KID A;  3SOT A;  4COT A;  1BJ7 A;  1MX7 A;  1NP4 A;  5D4A A;  4ES7 A;  3ZZV A;  2CZT A;  1G5W A;  2CM9 A;  1FTP A;  1ZNE A;  4NYR A;  4Y0R A;  2ZAI A;  4XMH A;  4ALB A;  1OEK A;  1YIV A;  1B0O A;  2GC9 A;  4ZJ0 A;  3FW5 A;  1YWA A;  1I4U A;  1QFT A;  1A3Y A;  1EAL A;  5H9N A;  4I3C A;  1ML7 A;  3NQK A;  4D6A A;  3U03 A;  1BEB A;  2GTL N;  3JSQ A;  3HTY A;  4IMO A;  2EU7 X;  3VG5 A;  3VG2 A;  1X8P A;  2A13 A;  2W2F A;  3C76 X;  2JW1 A;  1IW2 A;  4O3W A;  3VG7 A;  1X71 A;  1ALB A;  1GT3 A;  2RA6 A;  1JBH A;  3MX7 A;  3WJD A;  3F8A A;  3KZA A;  3TF6 A;  1LNM A;  1ZNG A;  1IIU A;  1OBP A;  4KT5 A;  1DC9 A;  4I3B A;  5HWZ A;  1ACD A;  1IFC A;  2O62 A;  3WJC A;  2RCT A;  4I6S A;  4WBK A;  4ZH9 A;  1TOU A;  3VE2 A;  2R56 A;  1I05 A;  2NND A;  1U17 A;  2G79 A;  2QOS C;  2GTL M;  3VG3 A;  4GU8 A;  1KZX A;  3AKN A;  5F7G A;  3NQ9 A;  3ZWE A;  4O3X B;  3APX A;  1PEE A;  4FBV A;  3HWE A;  1JV4 A;  2OVD A;  1S7D A;  3PP6 A;  3CQR A;  3L4R A;  5B27 A;  2M4L A;  1LID A;  1N0S A;  2AT5 X;  3PH5 A;  1LFO A;  2Z4I A;  2AKQ A;  3LHN A;  3C78 X;  1JJJ A;  4KCA A;  4ZHH A;  2WEX A;  1X8N A;  2ZAG A;  4CK4 A;  3B2I A;  4EFG A;  2WWP A;  1TXL A;  4O49 A;  4OS8 A;  1BWY A;  4O9S A;  1ZNH A;  5HCC C;  2FR2 A;  3ELZ A;  4ZHD A;  1ERB A;  4LZV A;  1EXS A;  3BY0 A;  4FBO A;  4XMD A;  4LKP A;  2JU3 A;  1AB0 A;  5CYB A;  5EZ2 A;  4ZGU A;  3RSW A;  2HZQ A;  1HMS A;  3BU9 A;  1DF3 A;  3IA8 A;  5CE4 A;  3U9P C;  3FA7 A;  4UU3 A;  5BVT A;  4AZR A;  1EPB A;  4GKC A;  1X8U A;  4IB9 A;  4CV7 A;  2LB6 A;  3PQU A;  3BS2 A;  5HZQ A;  1AEL A;  2FS6 A;  3HWD A;  4GZV A;  1OBQ A;  4RUN A;  2FS7 A;  5DG4 A;  1E00 A;  4A8Z A;  2CM4 A;  4OS3 A;  5HCE C;  4AZO A;  4TKH A;  3UEX A;  5L8N A;  3CQN A;  5EPQ A;  1Y9T A;  2Q2P A;  4LQZ A;  2R73 A;  3BRN A;  4IAB A;  4U8U N;  4IMN A;  5AQ6 A;  3SAO A;  3FR4 A;  2WR6 A;  4OMW A;  2AT8 X;  3BX8 A;  3WJF A;  4NW4 A;  4FQB B;  1BRP A;  1OBU A;  1DZK A;  3HWG A;  5HA0 A;  5L8O A;  4PSQ A;  2GTF X;  4YFQ A;  5FEN A;  2WQA E;  2X46 A;  4ZGF A;  4BVM A;  4GH7 A;  1BSY A;  1OEE A;  2OVS A;  4YBU A;  4IAW A;  3S26 A;  4FBR A;  4TKB A;  3B2K A;  4INN A;  2BT9 A;  3P6F A;  4NLJ A;  4QGV A;  4XMF A;  5HAE A;  4O4U A;  4YFR A;  5AEO A;  3FLL A;  1P6P A;  3JQO A;  2G78 A;  5AJB A;  2AMM X;  4WHI A;  1R0U A;  4PJ2 A;  2RQ0 A;  2F09 A;  4BQU A;  4D6B A;  2KT4 B;  2A0A A;  4QZU A;  5BYP A;  1ICM A;  4WFV A;  4Y0Q A;  4K19 A;  3CWK A;  2X8F A;  5H8T A;  1KT5 A;  1SY0 A;  4AW8 A;  5B29 A;  1JYJ A;  1A2D A;  5D47 A;  3STM X;  4A1Y A;  1CBQ A;  2JMB A;  3TZS A;  4ON1 A;  1KGL A;  4TKJ A;  5F6Z A;  3FIQ A;  4QAE A;  2AT3 X;  2Q9S A;  3STK A;  3C77 X;  1YWC A;  4ZHF A;  2NNQ A;  4M7M A;  4I95 A;  4QNI A;  1LF7 A;  3RWX A;  3D96 A;  3E3C A;  4YCH A;  4LZU A;  2L67 A;  2MHD A;  2CZU A;  4NNS A;  3PH6 A;  3OE3 A;  2K62 A;  1E06 A;  4XMG A;  1S2P A;  2BS5 A;  1LIF A;  5FQ8 E;  3VU1 A;  3D97 A;  1IKJ A;  1X89 A;  2XKL A;  2ASN X;  2R74 A;  4ORU A;  2WSJ A;  1L6M A;  1LKE A;  1YWB A;  1ZND A;  2KD2 A;  2FLJ A;  1VYG A;  1KT7 A;  5JR8 A;  4YDA A;  4ALO A;  2LKK A;  1URE A;  5F6B A;  3P02 A;  1QQS A;  1YP6 A;  3WOV A;  3CMP A;  4YKM A;  2F73 A;  2HMB A;  4ZHC A;  5KIC A;  1UZ2 X;  4GNW A;  1VPR A;  3MBT A;  1HMT A;  4RUU A;  3MVF A;  3WBG A;  1KQX A;  1QFV A;  3NX2 A;  3P6C A;  1OPB A;  2XST A;  1NGL A;  1U18 A;  3ZW1 B;  2Q2M A;  4U3Q A;  4I9S A;  3FEP A;  2ACO A;  3BSZ E;  3WJG A;  1PM1 X;  3CBC A;  1T68 X;  1MVG A;  3KFI A;  1HMR A;  4KC8 A;  3EMM A;  3T1D A;  5HZ5 A;  1LIC A;  4N7C A;  3EBK A;  4GRJ A;  5D45 A;  4AZP A;  3WVM A;  3FR5 A;  4YCE A;  5C0N A;  4R0B A;  3AKM A;  4YKO A;  4GET A;  2AL0 X;  3VG4 A;  1DZJ A;  5IO7 A;  3TGC A;  1YP7 A;  3NX1 A;  5L8I A;  2KTS A;  1O1V A;  5K06 A;  1JZU A;  2L9C A;  3APV A;  2L5P A;  3B2H A;  1GX9 A;  3OD9 A;  4XMC A;  3ZQ3 A;  5IO6 A;  2JOZ A;  1ZNL A;  2KW1 A;  3QKG A;  4ORS A;  1LPJ A;  5IO5 A;  1IKE A;  2MM3 A;  4IB8 A;  3FEK A;  3UEW A;  4O4S A;  4BOE A;  2L68 A;  3APW A;  5HTE A;  1YUP A;  1D2U A;  4MVI A;  5AJC A;  1T0V A;  3B2J A;  1QAB E;  4QZT A;  1FEM A;  4YFP A;  2KTD A;  1ADL A;  1CBR A;  1GM6 A;  4AYH A;  3ZW0 B;  4HPA A;  1LIE A;  1DZP A;  4EXZ A;  5H9A A;  2Q39 A;  4L3R A;  1JIW I;  3WXQ A;  4NLI A;  3F6Z B;  2OVE A;  4U8U O;  4GK9 A;  5LJD A;  2LBV A;  1EII A;  2MO5 A;  5D48 A;  4YGG A;  3UEV A;  1S44 A;  4QQ1 A;  4ZR2 A;  2GJ5 A;  3WJE A;  1GT5 A;  2QO5 A;  1G85 A;  1EQD A;  3ZUO A;  4ODD A;  1GKA B;  1D3S A;  1E5P A;  4O4O A;  2RN4 A;  4LKT A;  4QYN A;  5EDB A;  4HFO A;  1E02 A;  4YMY A;  3ZUI A;  1BLR A;  3FEL A;  4KC7 A;  2QO6 A;  2HZR A;  5FQ7 E;  4QRL A;  1O8V A;  2E4J A;  3O2Y A;  4YGH A;  1EIO A;  1A18 A;  3N91 A;  4EDE A;  3I17 A;  5DPQ A;  4AZQ A;  4ZCB A;  4O4X A;  2QMI A;  4ZFX A;  1ZNK A;  1FEL A;  1HBP A;  3U0D A;  1CBI A;  2FTB A;  1EPA A;  3PPT A;  4ORR A;  1KXO A;  4TLJ A;  2AH7 X;  3UAQ A;  3ZW1 A;  4IBA A;  2A2G A;  1EUO A;  4ARH A;  2HLV A;  1HQP A;  3BX7 A;  3F9D A;  4N7D A;  4AZM A;  4IB6 A;  4MVK A;  3H3I A;  4YGZ A;  5H9K A;  2FRS A;  1QY2 A;  1GT4 A;  5LJC A;  3STN A;  1NP1 A;  3NR3 A;  4NYQ A;  1FE3 A;  3FYF A;  3O19 A;  3VG6 A;  3DSZ A;  4MIR A;  3FA6 A;  5KHP A;  3EBW A;  2ACP X;  2NNE A;  3P6G A;  1RLB E;  1GGL A;  3HOL A;  5HA1 A;  2GTL O;  3K3L A;  3KQ0 A;  3ZI8 A;  5H9L A;  3BDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...