2FU2A

Crystal structure of protein spy2152 from streptococcus pyogenes
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
PSEKEILDALSKVYSEQVIQADDYFRQAIFELASQLEKEGMSSLLATKIDSLINQYILTHQFDAPKSIFDLSRLVKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of pyogenecin immunity protein, a novel bacteriocin-like immunity protein from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein SPy2152
total genus 29
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08951 EntA_Immun Enterocin A Immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.50 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Ta0600-like 2fu2A00
2FU2A 1TDPA 2QSBA 2BL8A 2QZGA 2BL7A
chains in the Genus database with same CATH superfamily
3IAS1 2YFAA 4PL4A 2BL8A 3SDJA 3Q8DA 2QZGA 3FBVA 3L0IA 3JSBA 4YZCA 2XTQA 1W3SA 2MJFB 2HGKA 3UITA 3P23A 2ZRRA 3IAM1 4DWLA 2YFBA 2IP6A 2ZW3A 2L1LB 1YO7A 2ETDA 4OAVB 2QGMA 4I1TA 4JCVE 3AJFA 3B55A 2FEFA 2P22B 2JBWA 4PL5A 3F4MA 2JB3A 4GXTA 2BL7A 3DA4A 2A2CA 2V1CC 3LJ2A 4O1OA 3VA9A 4HFVA 2FU2A 4Q9VA 1TDPA 1U5KA 3KP9A 2JB1A 3FNBA 4NV2A 4O1PA 4Z7GA 2FUG1 4AS3A 4YZ9A 4HEA1 2XTRA 3LJ0A 2XMXA 2RLDA 4YZDA 3I9V1 2E8GA 4NV5A 1JQOA 2JB2A 3LJ1A 2CAZB 2QSBA 4PL3A 2A2DA 2RADA 2RIOA 1SJ8A 2K19A 3DA3A 3DO9A 4OAUC 5LNK1 5HGIA 3FVVA 4G75A 2KKMA 2F6MB 4AS2A 2V6EA 2F66B 2GSCA 4U6RA 4Z7HA 4G76A 2JAEA
chains in the Genus database with same CATH topology
2FU2A 1TDPA 2QSBA 2BL8A 2QZGA 2BL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FU2 A;  1TDP A;  2QSB A;  2BL8 A;  2QZG A;  2BL7 A; 
#chains in the Genus database with same CATH topology
 3IAS 1;  2YFA A;  4PL4 A;  2BL8 A;  3SDJ A;  3Q8D A;  2QZG A;  3FBV A;  3L0I A;  3JSB A;  4YZC A;  2XTQ A;  1W3S A;  2MJF B;  2HGK A;  3UIT A;  3P23 A;  2ZRR A;  3IAM 1;  4DWL A;  2YFB A;  2IP6 A;  2ZW3 A;  2L1L B;  1YO7 A;  2ETD A;  4OAV B;  2QGM A;  4I1T A;  4JCV E;  3AJF A;  3B55 A;  2FEF A;  2P22 B;  2JBW A;  4PL5 A;  3F4M A;  2JB3 A;  4GXT A;  2BL7 A;  3DA4 A;  2A2C A;  2V1C C;  3LJ2 A;  4O1O A;  3VA9 A;  4HFV A;  2FU2 A;  4Q9V A;  1TDP A;  1U5K A;  3KP9 A;  2JB1 A;  3FNB A;  4NV2 A;  4O1P A;  4Z7G A;  2FUG 1;  4AS3 A;  4YZ9 A;  4HEA 1;  2XTR A;  3LJ0 A;  2XMX A;  2RLD A;  4YZD A;  3I9V 1;  2E8G A;  4NV5 A;  1JQO A;  2JB2 A;  3LJ1 A;  2CAZ B;  2QSB A;  4PL3 A;  2A2D A;  2RAD A;  2RIO A;  1SJ8 A;  2K19 A;  3DA3 A;  3DO9 A;  4OAU C;  5LNK 1;  5HGI A;  3FVV A;  4G75 A;  2KKM A;  2F6M B;  4AS2 A;  2V6E A;  2F66 B;  2GSC A;  4U6R A;  4Z7H A;  4G76 A;  2JAE A; 
#chains in the Genus database with same CATH homology
 2FU2 A;  1TDP A;  2QSB A;  2BL8 A;  2QZG A;  2BL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...