2FUG2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
b'FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase chain 1
publication title Structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 178
sequence length 178
chains with identical sequence B, K, T
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2fug201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fug202
2HT9A 3CBUA 4XTSA 1A0FA 8GSSA 4LLRA 5C00A 4K7NA 1OE8A 1XWBA 3O76A 2RUEA 3ZFLA 3SBCA 3APSA 2HE3A 5D9TA 1T00A 2QC7A 4XRDA 2R2JA 3LFLA 4F82A 2V41A 2DLXA 3IE3A 2L6CA 3C8EA 4HJ2A 2DBCA 1WJKA 1GULA 3GFKA 2L59A 4ZL9A 1GSDA 3QR6A 20GSA 2XPEA 1O81A 1G7EA 3NIVA 1K0CA 2FY6A 4TXOA 1BJXA 3IA1A 1GH2A 4AGSA 2DJ1A 2PU9C 1T3BA 3A2WA 3FYGA 5DALB 5LNKe 4L8EA 1WPIA 2FWHA 3CYNA 4G10A 3CSHA 4RI6A 3I69A 3UARA 5ECKB 1G6WA 4J2FA 3A5WA 16GSA 4WBRD 1WMJA 4DSSA 4WXTA 1QK8A 1ZCPA 1NW2A 1VF2A 4JRRA 1Q98A 4KE3A 3TKSC 1EWXA 1ERVA 3HCZA 5HR2A 3KJYA 5JCUA 1XCCA 2WDUA 3IAM2 3KGKA 4OFNA 1MD4A 1GUMA 1T4ZA 3IBHA 1QQ2A 5IMFA 4IP1A 2LNTA 3PH9A 3TRPA 2IMKA 2KUCA 2WB9A 3IK7A 1GSYA 5ECHB 1OKTA 3TGZA 4HZ4A 1TRUA 5D9XA 1GL8A 1WRYA 2LQQA 1YDKA 5HFIA 9GSSA 1PA3A 2CVDA 3DMLA 1OAZA 2MMZA 1JLWA 1KEBA 1MDJA 1RQMA 3GKNA 4RQXA 3KH9A 3VWWA 3VK9A 2IN3A 5J4UA 2YPMA 3F6DA 3L4NA 3FZAA 2AUVA 2B5EA 3APQA 1RK4A 1ABAA 1GNEA 3IXRA 4P3YB 1M7TA 2RLIA 1EEJA 2IMIA 3CMIA 2CQ9A 2K6VA 5DALA 2R6KA 5GZZB 3LXZA 2KLXA 3GN3A 3KIJA 1YEXA 1Y6EA 1UA5A 5G30A 1B48A 3QD9A 5D73A 2GSSA 5F8BA 2TIRA 3I9V2 2CX4A 4KCAA 5COHA 3MAKA 3UEMA 4OFTA 4V2LA 3VLNA 2HI7A 3HJMA 2C0EA 2L4CA 2VL3A 1O6JA 1YKCA 3C7MA 1O7UA 3F4TA 4EF0A 2L57A 2IL3A 2IJYA 1MDKA 2NPBA 1JZWA 3LYPA 2R4VA 2YWIA 1A8YA 1W4VA 3BOAA 3GL3A 2DSAA 3QFAC 3UAPA 4LMVA 4JR6A 3VWXA 3LYKA 4G9HA 2L5LA 4GSTA 1F6MC 4BVXA 5KN0A 19GSA 1K0BA 1U87A 5EY6A 3HZ4A 3FKFA 2CVKA 3FW2A 4RI7A 1EP8A 1G6YA 1PD21 3NOFA 4GRFA 3HY2A 1TXXA 3ZRDA 1QGVA 1HNCA 4WR5A 1X5EA 2OKAA 2HYXA 1YF0A 3TRXA 2EIRA 3EU3A 4F03A 4K1FA 2C0DA 2NBSA 5AIXA 1ZGNA 1J9BA 1IYHA 3A2VA 2P5RA 1A23A 1U3AA 3EVIA 1EV4A 1GRXA 3ZZXA 3HD5A 4O7HA 2ON5A 3DIEA 1EGOA 2FUG2 3LORA 3IV4A 4CDOA 1M2AA 2IMDA 4F0BA 1X9WB 5DCGA 2PGTA 2L5OA 4FYBA 4N10A 2N5AA 1USBA 3Q74A 3C73A 3G7IA 3Q18A 4KAEA 2H66A 2V6OA 2FA4A 1S3CA 4FO5A 4POLA 3TRQA 1XVQA 4Q5FA 2XBQA 2LNSA 2VL2C 2XC2A 2VUPA 4BL7A 4OD7A 4E8EA 2GZPA 3IOSA 4KH7A 2H6XA 6GSXA 1X9SB 2HSHA 4XRAA 1K0MA 2YWNA 1PL2A 4WBJA 1K0NA 3GURA 4ZB6A 4PNGA 1TW9A 3EINA 4HQZA 4YAPA 4MZWA 2CA8A 4IJIA 3GL5A 3P90A 1UN2A 4NPBA 1OC9B 4L5OA 3D4MA 1TU8A 3M0FA 4EVMA 1KTEA 4KGIA 1THXA 3V1WA 2XPDA 3I6AA 4N11A 5DJLA 2MYGA 4K6XA 3ME7A 1YZXA 5ECOB 1M2BA 2VD0A 6GSVA 1YEPA 2WZ9A 2WRTA 2FA8A 3DWVA 3H93A 2HFDA 1XBSA 3IPZA 3CRTA 4TXVA 5ID2B 4MP4A 1WOUA 1SJZA 2ES7A 4KB3A 2LJRA 2LV3A 2JZSA 3ME8A 3TJFA 1V58A 2O8VB 2H73A 2CAQA 3AY8A 1A2LA 1B8XA 1Q4JA 3VPTA 4QQ7A 3GUSA 4MLYA 1F37A 2F8AA 4ISDA 1DBYA 2DMLA 4AJ8A 1H75A 5CO3A 4MCUA 2PUKC 1FOVA 5DCHA 1XWGA 5IQYA 1YKAA 2OE0A 3Q19A 4K9ZA 4KSMA 3OR5A 4IVFA 3KP9A 3WGXA 2VLUA 4J56E 2C8UA 2MZCA 3M9JA 1Z5YE 3APOA 3E3EA 1GTBA 4TXOB 5DDLA 4L5LA 1JFUA 2B6MA 3LJRA 1EEMA 3GH6A 3EU4A 5GSTA 2DJ3A 2YP6A 4K0GA 4MABA 2IIYA 1TI3A 1TK8B 3TKQA 2EIOA 2X8GA 4MPFA 5J5NA 1GNWA 1OC9A 2C1YA 5A5KA 4DSSB 2MMNA 1QUWA 1YF1A 3U6VA 5KN1A 3QAWA 1LJRA 3WD6A 4F2IA 3FRCA 4ZB9A 3D0ZA 3RHCA 2X8CA 4PUFC 3UJ1A 3H1NA 1PSQA 2GLRA 1PN9A 1PMTA 4WKWA 4X1UA 3F6FA 1TTZA 4N0ZA 2F3MA 5ID2A 4KW6A 4MH2A 1V98A 4NXIA 3TKPA 3C71A 3UOMA 3BCIA 2DC5A 2RM5A 1XW9A 2I81A 2ZCTA 5INYA 2GSRA 3KMNA 2E2GA 3TB2A 5IMAA 5LCZA 2YJHA 2C4JA 2K9FA 3M3MA 4BA7A 3GKXA 3HVSA 4ECBA 4X43A 3JCML 1R26A 5ECMB 5J9CA 2YZHA 2D2ZA 1X5CA 5EVOA 1XPVA 2J23A 4NAXA 5EL8A 4G2EA 4GTUA 1SENA 2GGTA 3CRUA 4ML1A 1E6BA 4YAVA 2LUSA 3HJPA 4XHMA 3S9FA 1GP1A 5J3RA 1T4YA 4OCFA 3UVTA 4HU7A 3F3RA 2KOKA 1FAAA 1Z7RA 1GTAA 3MDKA 1AXDA 2OJLA 2NVLA 3F4SA 3WT2A 3GIXA 5AIVA 2K8VA 2P5QA 3EYTA 4I6XA 1LU4A 3CSIA 1JHBA 1BQ7A 1ZMAA 1AQVA 2H6YA 5JCWA 3IRAA 1TI1A 1MD3A 3WGEA 2IFQB 1XWCA 2JZTA 3WYWA 3M9KA 3HVXA 3TDGA 2B5XA 2LJKA 4TN8A 2VLTA 2NTOA 4NV2A 17GSA 2B3SA 4KNDA 2BMXA 5ENUA 2PWJA 1QXHA 3HYPA 3E9JB 1UC7A 1NSWA 1B4QA 6GSSA 1SD8A 3F8UA 1THOA 2X64A 2O85A 4DEJA 3GYKA 2K8SA 4PXOA 4GLTA 4MJAA 1EZKA 5A4UA 5CP1A 4WEYA 5ELGA 1SKWB 3A3TA 2TRXA 1I9DA 4YQMA 5H5SA 1EOHA 3BBYA 2GS3A 1M0UA 5IMDA 1ML6A 2CX3A 2CT6A 2JADA 2R3XA 3D21A 2REMA 4MZCA 3ZREA 1S3DA 1ZOFA 3VPQA 1ST9A 3IK9A 4BVYA 4KUNA 4IQ1A 3RHBA 1TU7A 4XS4B 7GSSA 1X5DA 1K3OA 2H01A 3RBTA 2M72A 1XFLA 2JSZA 1FW1A 1SKSB 2OACA 2CAIA 4OO4A 4MJCA 4O92A 2ZUPA 2C3QA 4MF6A 2OE1A 3C1SA 3QDNA 1WWJA 3H4KA 1FHEA 3IDVA 5FWGA 5C04A 4WF5A 1YJ6A 2P0GA 2IFQA 3L9VA 1O73A 3UVHA 4ZIJA 4DSQA 1SL0B 2M80A 2EIQA 1G0TA 3W6GA 1Y25A 4JBBA 2WGRA 4CW9A 2LRCA 3CTFA 3UL3A 2FLSA 3G7YA 3KCMA 5CRWA 4IS0A 5D9VA 1U3IA 4IKHA 1FVJA 2L4QA 1ILOA 2XHFA 1SKRB 1BG5A 5IMVA 1SK0A 3FR9A 3KTBA 3FEUA 5A4WA 5FT3A 3PGTA 3TJGA 2H72A 3GHAA 4BWSA 3ZLPA 4BWQA 4AJ7A 4ECCA 2E2MA 4FYUA 3TKSA 2LEGA 2O89A 3TCOA 3HJOA 6GSUA 4FH8A 5ELAA 2GT5A 2H0IA 2VOCA 2PVOC 3GKKA 3QAGA 1NHOA 2G0FA 1O85A 5GSSA 1A24A 1H4OA 1W89A 5E4WA 4XS4A 1PKWA 4X0XA 5D9WA 4HQSA 2GQMA 1XVWA 3L0HA 2DIYA 1AC1A 1R4WA 4K7IA 1PQNA 2PMTA 1R5AA 5ECSA 1AW9A 2I3YA 5L71A 2HLSA 3QCPA 3M1GA 1QFNA 2H74A 1NM3A 1M99A 3TJBA 1MEKA 5KN2A 5HR0A 4I2TA 4KX4A 2JSYA 1QMVA 4TOPA 4MK3A 4ML6A 5IO2A 2P31A 4IW9A 4GF0A 1SK2A 2B7KA 1V57A 2GQKA 3LSZA 4MH3A 2KHPA 1SK1A 3FZ5A 1YQ1A 2GVPA 5JWOB 2H8LA 1ON4A 4OCEA 1R7HA 5IM9A 1TDIA 1Z6MA 5AN1A 4MDCA 5LD0A 3KM6A 2FWFA 3Q6OA 2GTUA 2F9SA 2MBTA 1YY7A 2L6DA 4PQHA 3TJJA 1X9MB 2E7PA 2YWMA 1AQWA 5ABRA 2H0GA 3HHVA 4IGJA 5F06A 5FHIA 4LL1B 3DVWA 5GAPD 4RQRA 3MNGA 1TP9A 4O5RA 4JEDA 3FZ4A 4KDYA 4Q5QA 1C72A 2I9HA 1F2EA 2C3NA 4NHZA 2WCIA 4YQUA 4MF7A 4ULXA 1HQOA 2FNOA 4O32A 1ACVA 3ZIJA 3FR6A 1LBKA 1JLVA 1IYIA 2DJ0A 4NV5A 4TKYA 3DGQA 1OC8A 5G5FA 3VWVA 1S3AA 3RDWA 5IIZA 1U6TA 2MMOA 4ZBDA 3VI7A 1ERTA 4EE0A 5B7CA 5KN3A 5CYYA 5B8AA 10GSA 4ZL8A 1SU9A 2FCHA 4KDUA 4HUAA 3CSJA 2HSYA 3HZ8A 1B4PA 2BTOT 3SWLA 4J57E 4K7OA 4PURA 1AIUA 3ERGA 4K8MA 2GSTA 3TUEA 3O6TA 4XCSA 5DAKB 4NHWA 2IPAA 2M46A 5HR3A 2VIMA 3J7Yb 4D73B 3H8QA 4EUYA 4KCEA 1XOBA 2ALBA 2AB6A 1BAYA 4HJMA 1TRVA 5E59A 1OC3A 2C0FA 1OE7A 3KD0A 4YQVA 5GAND 1J08A 5AISA 1PX7A 1ZYEA 4L0WA 4OO5A 1X0RA 5JCGA 2AYTA 2H1DA 1BYEA 2GDRA 2QSIA 1A0RP 1FB0A 2LSTA 1WE0A 1A2JA 1GLPA 2HRNA 1UVZA 5ECPB 3L9UA 4PX1A 5HFKA 1AUCA 4POMA 4KSOA 2VCVA 4HOJA 1SYXA 3RAZA 4ZL7A 4XS6A 3NZNA 2LS5A 1XW5A 5G5EA 3ZVJD 1OYJA 1Z7PA 2MBSA 4I2UA 3CXGA 3PINA 1PX6A 5IOXA 3ZVJA 1K0OA 5IMZA 5J41A 2VCXA 1A2MA 3ZIVA 1ERWA 2JZRA 2KP2A 1VF1A 4TR1B 2V6KA 1M9BA 3HVVA 3ZMKA 1DSBA 3LG6A 5A4VA 3G9BA 5G31A 6GSTA 4V2NA 2HZEB 6GSYA 1XZOA 2V32A 1N8JA 3EMXA 4IBPA 3MWHA 4GQFA 4V1Ag 2VCWA 4PNFA 2B1KA 3BD2A 3J7Yk 2LRTA 2H6ZA 2GZYA 5DAKA 5KEJA 2DMMA 13GSA 3HA9A 2WJUA 4MJBA 4POBA 2R5GA 4D73A 1PGTA 3ISOA 4XS1A 4CHSA 2F8FA 1SJ6A 4HS1A 3P8WA 3GSSA 1FG4A 3FY7A 4ZILA 4WF4A 4EXJA 2VL9A 5CRHA 4IN0A 4PQIA 4IHUA 2N5FA 2GQLA 1EOGA 3ERFA 3LGCA 3KTLA 2Z9SA 4L0UA 3EWLA 3GTUB 1PRXA 5G2ZA 11GSA 3VWUA 3FK8A 5F07A 3WT1A 4AJ6A 3DD3A 1KBNA 2FWEA 3UIWA 1BX9A 2ZNMA 1RW1A 2QKEA 4GCIA 2N5BA 5CAXA 3EC3A 4JE1A 3R2QA 2AAWA 2H1AA 3KP8A 4TR0A 2WS2A 2O87A 4GXZA 4JR4A 2OBIA 5IPHA 1ZL9A 5DQSA 3D6IA 1XW6A 3DRNA 4I8BA 5ECLB 1I5GA 5HFGA 1OVNA 2V1MA 3KEBA 3GA4A 3VI5A 2HNLA 4K2DA 2H19A 5CNWA 4ACSA 4ECJA 2R37A 3HKRA 1URMA 5G1LA 2RUFA 5HR1A 2H71A 4TR1A 1V9WA 4RUVA 4V2MA 6GSWA 3GX8A 2LQOA 4MF5A 1Z3EA 4GWRA 3CTGA 3DXBA 2HZEA 3GX0A 4PQ1A 3GRXA 4JU5A 3BJ5A 2WFCA 3E0UA 2HZFA 3ZITA 3FHKA 2JACA 1GSQA 3FZ9A 4ZBBA 2HRFA 4LA1A 2YCDA 5AGYA 3DEXA 3QAVA 4EL1A 4F9ZA 3F63A 2PPTA 3GV1A 3D4TA 2YNXA 1T7PB 2OBKA 3BCKA 4TRXA 3KH7A 1PKZA 2H1GA 2DJJA 2H76A 2MMAA 5H5QA 3ZFBA 5B6NA 3M8NA 3F3QA 3GTUA 3H79A 1FVKA 2LJAA 3EE2A 2CZ2A 2YN1A 4MZBA 4EO3A 3FR3A 5HQPA 4I97A 1B9XC 1GTIA 4F0CA 3ERWA 4HDEA 3DVXA 4ZBAA 3QMXA 4QL7A 5IOWA 2DIZA 4Q5NA 1CQGA 4PGTA 12GSA 1JZRA 1TRWA 2B5YA 1SL1B 4ID0A 3L78A 3QPMA 5J9BA 1CQHA 3ZMLA 2VCTA 4MA9A 3IR4A 5JWRB 4LMWA 4IQAA 2AV4A 5B6MA 1M2DA 4Q5RA 4EC0A 2G2QA 3GH9A 5DJMA 2VD1A 5DQYA 3KZQA 2BJXA 2CVBA 1K0DA 3IHQA 3W8SA 2A2SA 1N2AA 1OKDA 2JU5A 3L9SA 5IO0A 1HYUA 1K3YA 1GSEA 2GSQA 1R5PA 3F9UA 4WR4A 2B1LA 1T1VA 1B9YC 2YANA 1V40A 4WETA 3EMPA 3HDCA 4JZQA 2LKUA 2HXKA 2PN8A 1XIYA 4EDZA 3A2XA 3EURA 5ECIB 3TKRA 1TKDB 1ZZYA 3F4RA 3ZL5A 1SYRA 1JZDA 4V1Ap 4HZ2A 4IJ3A 2YOIA 4IELA 4H86A 2YJ7A 2J9HA 1MDIA 1T8EB 3GSTA 3DYRA 1G7OA 3UBKA 4G19A 3ED3A 2WULA 4AF2A 3N5OA 3LXTA 1GSSA 1DE1A 5D93A 1GLQA 5CRGA 5DBQA 4GQCA 2C0GA 4HEA2 4FYCA 2JL4A 2YZUA 1GUKA 2VAFA 3LWAA 3VFIA 2VCZA 5D8IA 1F3AA 3C1RA 5DVBA 4GSSA 4NMUA 4XIHA 4DSRA 1NHYA 1J0FA 1VRSD 4HI7A 2VM2A 4Z7XA 1A8LA 3TJKA 2C3TA 3K8NA 4DVCA 1VF3A 2I4AA 3TOTA 2VLVA 4E8HA 1VF4A 3QOUA 2QGVA 3GNJA 1K3LA 4GSNA 5CRDA 4QL9A 3I43A 3RPPA 2AHEA 1F3BA 3U5RE 18GSA 2LTKA 3N9JA 1AAZA 4YH2A 4POKA 4FIWA 3IAS2 1HNAA 4TVEA 3LEFA 1WIKA 1K0AA 2YV7A 1O8WA 2PERA 2XBIA 2H70A 5H5RA 2FD3A 4TW5A 4NWYA 3UBLA 5G1KA 3HXSA 1XOAA 2IMFA 3QFBC 1TRSA 1HNBA 3D5JA 4TR4A 2YV9A 1U88A 3KXOA 5JWQB 3O3TA 2NDOA 4ZB8A 1ERUA 4KA0A 1F9MA 3TKSE 4MJEA 2PVQA 2C80A 3P7XA 3WGDA 2FWGA 4I5QA 2A4VA 2I1UA 1TK0B 2IWTA 5ECNB 2CZ3A 3KMOA 4MMMA 3LQ7A 1Z9HA 4OMVA 1XWAA 2DJ2A 1BEDA 4OFMA 1JZOA 4HU9A 5IMCA 3G7JA 4IP6A 2OA7A 14GSA 4MPGA 2OE3A 1GUHA 2RM6A 3RPNA 2DJKA 3VURA 2TRCP 1PL1A 1ZYQB 2GZZA 2VO4A 1DE2A 1MTCA 3ZTLA 3MSZA 1EV9A 4N0VA 4EDYA 4ECIA 2O7KA 2IMEA 3DKSA 2FGXA 4ILFA 1AQXA 5ECQB 5B8BA 2H30A 4ZXGA 2KP1A 2OADA 5ECRB 5D96A 2VM1A 4BPYA 4PUAA 4N30A 1TOFA 1HD2A 2EC4A 2PBJA 2VL2A 1KNGA 5IPGA 1GSFA 1VGLA 2CV4A 1EP7A 1FO5A 1WP0A 4LL4B 3IC4A 1SD9A 1O8XA 3UMAA 3US3A 2AJQB 2RIIA 2H0HA 1SJIA 3PR8A 2A2RA 3F0IA 1SL2B 4TR3A 5CREA 3D22A 2FHEA 2X99A 3GMFA 1XWKA 2VCQA 4EKZA 3W8JA 22GSA 1TJDA 2F51A 3ZYWA 5F05A 5F0GA 2X8HA 1E2YA 1GSUA 3GKMA 2K18A 4KDXA 1XXUA 3TOUA 2E0QA 2YWOA 2H75A 2H1BA 2GT6A 5EPFA 1TK5B 1FB6A 1DUGA 2V2GA 1M9AA 1V2AA 1Z6NA 4K0NA 2LRNA 4OWYA 1GTUA 2B7JA 1EGRA 3P2AA 1GWCA 2ON7A
chains in the Genus database with same CATH superfamily
4ZH4F 2JRMA 3S3NA 3F0CA 3RSNA 4ENMA 2HT9A 1RESA 3CBUA 4HF2A 1IN5A 4XTSA 2EZIA 3ZMUA 1A0FA 3E6CC 3NARA 8GSSA 3MZHA 1S6LA 5DUKA 2ELKA 2O9LA 2VT2A 4LLRA 1UHSA 5C00A 2W85A 5IOYA 2P81A 1P7IA 4HW0A 2H27A 1XGMA 5ILUA 2UZ8A 5HS8A 4KN4X 2TCTA 1MJ9A 5CLSA 4E7SA 4KDPA 1OE8A 4K7NA 3VYRB 1F43A 2M34A 1XWBA 3O76A 2RUEA 4LIUA 3ZFLA 1HKSA 3SZPA 3SBCA 3APSA 1TW3A 2HE3A 2M4KA 2X49A 1FIAA 1QPIA 5D9TA 4FX0A 3BLYA 3SDBA 5FKOA 3AL0B 1T00A 3K1MA 2QC7A 2K9MA 4XRDA 2R2JA 4D7MA 1B1BA 3LFLA 2O8XA 3U21A 4F82A 3L9FA 2V41A 2DLXA 3G1LA 3C2HA 5BOXA 4XLNF 2CS3A 2Z33A 3TEDA 1NG6A 3IE3A 1FOYA 3HOUJ 2L6CA 3C8EA 1ZN2A 2ACJA 4HJ2A 3U1KA 2GOMA 4IQJA 3FBIB 4U88A 1WJKA 2F2EA 2DBCA 3M1EA 5LHGA 1GULA 3GFKA 1YW8A 2L59A 4ZL9A 1GSDA 3S1RJ 5IP7J 1D8JA 3QR6A 3BY6A 3H36A 3M8EA 3TBIA 20GSA 2DOAA 4GFBA 2STTA 1O81A 2XPEA 1G7EA 3NIVA 1K0CA 2FY6A 4TXOA 2ELJA 1BJXA 3D1NI 2CU7A 4UUTA 1GH2A 3IA1A 4AGSA 1Z05A 3MQ0A 4CCOA 2CGPA 4GRIA 2DJ1A 2LVSA 2ECBA 3K2AA 2PU9C 1WKMA 1T3BA 3A2WA 4CDGA 1ZREA 4NC6A 3DEUA 3FYGA 1MH4A 4L0WA 5DALB 1UELB 5LNKe 1B9NA 5AIPA 2KJCA 4QLCU 3JRGA 2F48A 2OD5A 1UB9A 4RGUA 4RB0A 1WPIA 4L8EA 2FWHA 4BKXA 3CYNA 4BXXJ 3CSHA 2E7XA 4G10A 2DO7A 4PJMA 5DCMA 4HDVA 3I69A 4RI6A 2L2OA 1R1TA 2BW3A 3G2BA 4M71A 2XV4S 2XAQA 2AQEA 2EB7A 3UARA 3HHHA 5ECKB 2KZGA 3RTRA 1G6WA 4J2FA 3A5WA 4IPAA 2IEKA 3LL7A 5EZHA 4DIQA 3LA2A 1P4WA 1VQ9I 2M7BA 1XG1A 2PMHA 3NWTA 4EV0A 16GSA 3BPXA 4JX4A 4WBRD 3LWFA 1P4XA 3QP6A 1WMJA 2EA4A 4O6JA 4DSSA 3LNQA 3MIXA 4WXTA 3H92A 1QK8A 2W4SA 2DW4A 3ZGKA 2DT6A 1ZCPA 3JRBA 2GXAA 4AC0A 1NW2A 2AXLA 3F8CA 1VF2A 4YIIA 1Q98A 4JRRA 4KE3A 3TKSC 4KMUX 2CW0F 1WCMJ 1OCCH 3P9CA 1EWXA 1NK2P 1BJAA 1F9NA 3K4JA 1ERVA 2QKMB 1PJRA 5F08A 3CC7I 3L1PA 4RAGA 2RVCA 2V6CA 2A6TA 3CD6I 3HCZA 5HR2A 1ZAOA 3PQKA 3JREA 3OYMA 3KJYA 5JCUA 5FO5A 2HYGD 4UV9A 3TKYA 3ZMVA 2E1CA 5D6FA 3A4CA 3KP2A 5KHDA 4BVXB 1WI9A 4E7HA 1MDMB 3VYUB 4AVZA 5HLGA 4MFEA 1XCCA 2IJLA 5BS6A 5ED4A 1HC8A 1FSEA 3GFJA 4AYBN 2WDUA 3IAM2 2L4AA 3GTGJ 3M4OJ 1X4OA 2KIQA 3KGKA 2ZBKA 3I4MJ 4XQFA 4OFNA 3N97A 2H1KA 4HG2A 2WAEA 4M9ZA 1VFCA 2CV2A 2HTJA 1ZGJA 1GUMA 2DTRA 1MD4A 1T4ZA 1GV2A 4KT6A 3IBHA 4YKFA 1IXSB 1QQ2A 2XSJC 3K10A 4WXDA 5KK1A 1IZ1A 1Z9CA 5IMFA 2K5CA 2P4WA 3FXJA 3ZP5A 4IP1A 3MZ8A 3HOXJ 1KU2A 4LMYA 5ICCA 2LNTA 3PH9A 3TRPA 5IYBJ 1T0FC 2O5RA 2IMKA 2KUCA 1Y6IA 2GA2A 5JVTA 2WB9A 3IK7A 2L3DA 1GSYA 3QYBA 2YX4A 1OKTA 5ECHB 3TGZA 1V5FA 2VIMA 4HZ4A 1TQIA 2HWVA 1KA8A 1TRUA 2M9HA 5D9XA 1B8IB 5DS9A 1GL8A 3QU6A 1YS7A 4I02A 1WRYA 2LQQA 5KOWA 1YDKA 2R7UA 2R0CA 3KEYA 4KICA 5HFIA 9GSSA 2LG4A 5B5EC 4S0HB 4CHUA 2K9SA 4IX7A 1X2NA 1PA3A 2CVDA 2EZKA 3DMLA 3W6JB 1OAZA 2MMZA 2M7AA 3OR2C 2Y48A 4YIFA 1JLWA 1KEBA 4A3MJ 1MDJA 1RQMA 3GKNA 3KH9A 4RQXA 3VWWA 2COMA 2WTEA 2PMUA 4CW9A 1BBYA 2XKPA 2QBYB 4RBOA 3FHNA 2IA0A 2X0LA 3H0GJ 3VK9A 3HGGA 5LGUA 2IN3A 5J4UA 1G3TA 3EPZA 3GO5A 3KCCA 2YPMA 3F6DA 2IPQX 3OYIA 5J40A 3L4NA 3CUOA 1FMVA 3FZAA 4OIQF 2AUVA 2B5EA 3S2HJ 3APQA 5CJ9A 3A0BC 3C1DA 1RK4A 1ABAA 1GNEA 3IXRA 4P3YB 1M7TA 2RLIA 2LOOA 1EEJA 3H0DA 4XKCA 2LREA 2JA8J 4OIRF 2XUBA 1NH3A 2CQXA 3TMOA 2IMIA 3CMIA 2CQ9A 4BJ6C 2K6VA 5ILSA 1PUFB 5DALA 2R6KA 5GZZB 1I3QJ 2W57A 3REOA 4EM2A 1YG2A 3LXZA 2R0GA 3TOBA 2KLXA 5J1UA 2GZWA 3HTSB 3E7LA 4FASD 5B3SH 1EH6A 1YEXA 3GN3A 1Y6EA 3KIJA 1UA5A 2KRHA 4ABZA 5G30A 1OQYA 1B48A 3QD9A 1R00A 4I98B 2A07F 5D73A 2GSSA 5F8BA 3DLLF 4GCVA 3DTEA 2TIRA 3I9V2 2CX4A 4KCAA 5COHA 3MAKA 3UEMA 4OFTA 3OYEA 4PSWA 4HX7A 2HTSA 3BJOA 4V2LA 4BL7B 1QQIA 3VLNA 1W0TA 4EEFG 3CC4I 2VBWA 1T95A 3V7CA 2HI7A 3HJMA 3ROUA 1GV5A 3FIWA 1K78B 2C0EA 2L4CA 2VL3A 1TC3C 4KISA 1O6JA 5EGOB 3TDUC 1YKCA 1J75A 2DT7B 4HDUA 4C9YA 1O7UA 3C7MA 3ONQA 3F4TA 2WAQN 4KT5C 2LH9A 4EF0A 2BGCA 2X1EA 1YJWI 1GHCA 2L57A 2XAFA 2IL3A 2DLLA 2RDPA 2IJYA 2OA4A 3U1DA 2R7SA 4F55A 2KL4A 4CSWA 4F93B 4L9JA 3ASOH 4XRFA 2R0QC 2JT1A 4WK8F 4AIJA 2BY2A 2Y0MA 4BBSJ 1MDKA 1E2XA 1VQLI 3HOWJ 2NPBA 1JZWA 3PQJA 3LYPA 2R4VA 2YWIA 1A8YA 1W4VA 3BOAA 1M3IA 2DSAA 3GL3A 3QFAC 1BR2A 3UAPA 4X6AJ 4JR6A 3SFZA 4LMVA 1A04A 3J7AY 3DXJF 1OFCX 3W2AA 3VWXA 4MNNA 3LYKA 4G9HA 3E3VA 2L5LA 2M1BA 4GSTA 3HOTA 1Z3XA 4LG0B 1F6MC 2OKAA 2EFPA 2XPWA 4PZJA 4BVXA 3G1OA 4EM1A 1MDMA 19GSA 5KN0A 1ETWA 1K0BA 1U87A 1LKXA 5EY6A 4XLCA 3HZ4A 1U2WA 1L0OC 3FKFA 1N25A 1KYZA 2E36A 3OYAA 1O3QA 4IEJA 3RKYA 1ZRCA 1P92A 4DZPA 2CVKA 2K3FA 2VC1A 3AKZA 3FW2A 4RI7A 3T1BA 1W5CC 3TQNA 3L2VA 1EP8A 1EGRA 3RZOJ 2HI3A 3FK7A 1G6YA 1PD21 2R5ZB 3NOFA 4N9HA 4GRFA 1RR7A 2OUMA 1TQPA 1TXXA 4RM3A 2CJJA 1K7AA 1QGVA 2CH0A 3VWBA 1K79A 4XR6A 5FGMA 1HNCA 3ZRDA 4IXAA 2VPRA 2R3SA 4WR5A 1XGSA 1ULYA 4EGZA 3EDPA 1LPQA 2WV1A 1X5EA 5ICEA 2D1VA 1YF0A 2NOGA 2HYXA 5DM6F 3TRXA 2EIRA 5IY5H 4MTDA 2LKXA 1GVDA 4XLFA 3U9GA 2YX7A 3EU3A 1B8IA 2R4GA 4F03A 4K1FA 2E5ZA 3IV5A 5HNFA 2C0DA 5J3LA 4J00A 2NBSA 5AIXA 2W48A 3JSOA 1ZGNA 1J9BA 3QYFA 1O7FA 1IYHA 1QHHD 3E5UA 3A2VA 4HRIA 9ANTA 3J7YJ 5E3LA 2KFDA 3CO7C 1UAAA 2V1UA 1A23A 2P5RA 5H20A 3MD2A 2UZKA 1U3AA 3EVIA 1BIBA 1EV4A 1FP2A 2VQHA 2AO9A 3LSTA 5GADJ 2QBYA 1GRXA 3ZZXA 1WJCA 3HD5A 5FKMA 5D8KB 3DFGA 1U5TB 4BY7J 3PUFA 2ON5A 2VONA 3DIEA 3BR3A 4XNFA 2FUG2 1EGOA 3I58A 3LORA 4HSRA 1ENHA 3IV4A 2ZXWH 4R8HA 4CDOA 2ME6A 1M2AA 3IHGA 1IW7F 1Y0UA 2IMDA 4F0BA 2MSYA 3FHZA 4XBFA 1U8BA 3D0SA 1ODDA 3FMWA 5DCGA 1O7LA 4LLLA 1X9WB 2PGTA 2L5OA 4FYBA 2IW5A 5CQGA 3VYSB 4EM0B 2N5AA 4N10A 4MO7A 2E7WA 4XORA 1USBA 3Q74A 3C73A 3WU1B 3G7IA 5FKNA 4I09A 1PUFA 4A3IJ 4C30A 3Q18A 1Y8QB 2W82A 2DA3A 4KAEA 1GLNA 2H66A 2V6OA 2DPUA 2DYRH 4HA8A 2FA4A 1U78A 2BOLA 1S3CA 3S16J 2CQ7A 1HSJA 1XDUA 2EFQA 4LLGF 4FO5A 1K61A 1NTCA 4P5OA 4ZZLA 1SFEA 1DU6A 2EV6A 4PFPA 4XLAA 2VJIA 4POLA 2L7ZA 3TRQA 3CMYA 1P4AA 2XPVA 4ESJA 4HQEA 2UWMA 5GP9A 3KE2A 4N9IA 1XVQA 4Q5FA 3IKVA 2VQLA 2XBQA 4MTEA 2LNSA 2VL2C 2A5WA 3CCVI 1Z6RA 5EJCA 2QENA 2XC2A 1VNDA 2VUPA 2LMDA 4BE0A 4BL7A 2FNAA 1D3YA 1HCRA 5K5RA 3GVAA 1D0XA 1K78A 1XMXA 5LRSA 5JVGF 2QZ8A 3KEQA 2IGOA 5FKKA 5EGOA 4UY8I 4DNCA 3V4GA 4OD7A 4E8EA 3ZPLA 1VZ0A 2GZPA 3IOSA 2KRCA 5A2QK 4KH7A 2X6OA 3OL3A 4LITA 1FYMA 5HVQC 2XGDA 1T56A 2LYCA 2H6XA 5E17F 6GSXA 3H3ZA 1X9SB 2HSHA 2JVGA 2HGCA 1I5ZA 1REPC 3GWZA 3M07A 4PJLA 3AG2H 3KLOA 4IHXA 4XRAA 3B73A 4EJOA 1K0MA 4G0IA 2F4MB 3HYIA 4EJVA 2OV7A 3LSRA 1OYWA 2CFOA 4DYRA 2YWNA 1PL2A 3P7NA 3CCRI 4WBJA 1WJFA 2X6YA 4LG0A 3DWLE 3GZ6A 1K0NA 3GURA 3GTMJ 4ZB6A 2BVMA 1QZEA 4PNGA 3RZDJ 1ITYA 1TW9A 3EINA 4HQZA 3ERED 3S8PA 4I2OA 3F8BA 1ZELA 5FLVA 3PPUA 4MZWA 4YAPA 1RIOH 2CA8A 3G73A 3F21A 2P8TA 4IJIA 3GL5A 2WB1A 1UN2A 1OC9B 1W36C 4Y4RA 2NRAC 2A4HA 2DOFA 5DD8A 3D4MA 1IN6A 1DP7P 4L5OA 3PNVA 1TU8A 3M0FA 3IUOA 4EVMA 4JQFA 1KTEA 3GTJJ 4KGIA 2DQLA 1Z1DA 3BTJA 1THXA 2H8WA 3V1WA 3D5RC 2XPDA 4JK1X 1DPUA 3LA3A 1Q1VA 1JJ6C 3I6AA 2BXZA 2N8GA 2R5ZA 4N11A 3L7WA 1LEBA 5B1BH 5DJLA 4J19A 2MYGA 4K6XA 3ZMZA 4CCKA 3ME7A 2Z99A 5FD5A 1YZXA 3I54A 3TW6A 2MBFA 4HNVA 2R0PA 1SD7A 3FM5A 5ECOB 4NBQA 5IOZA 1VF9A 1M2BA 4HLYA 1O57A 3CO6C 2VD0A 6GSVA 4NC7A 1YEPA 3FKIJ 4HOBA 2MG4A 4G0LA 2WZ9A 2LTPA 1XS9A 2FA8A 2WRTA 3DWVA 1BOAA 3H93A 2NVXJ 2QSGX 1WWXA 4Z2UA 1RKTA 1JTYA 1XBSA 2HFDA 3IPZA 5IPGA 3CRTA 4TXVA 5JLXA 5ID2B 3BG7A 4MP4A 3RYPA 2JA6J 2DKHA 3WE2A 1R71A 3MN2A 1WOUA 2OCCH 1SJZA 2ES7A 4FHTA 2LJRA 2LV3A 4KB3A 4S05A 2JZSA 3ME8A 2WADA 1KU9A 3TJFA 3CCEI 3GW2A 2ZXIA 2LBFB 3ZMSA 1FOKA 3S1MJ 1V58A 3L2QA 3BTLA 2H73A 3WG9A 3TO6A 2CAQA 2O8VB 2PEXA 4O5VA 1D1AA 3AY8A 5F27A 1A2LA 1B8XA 1Q4JA 2OQRA 3VPTA 4HV6A 1U5TA 2MH9A 4KMFA 1LVAA 3HGYA 3GUSA 4MLYA 4QQ7A 1F37A 2F8AA 4ENJA 4OO5A 1MBJA 4ISDA 3C2GA 1HLVA 1BI3A 2V9VA 3N4MA 3SYTA 2DA1A 1DBYA 3E1SA 4BHCA 4GYGA 3IKTA 4EJTA 2DMLA 1BR4A 4WXHA 4E4HA 4AJ8A 1AA7A 1H75A 5CO3A 1H9TA 3V42A 5J8CA 4JX5A 2YU9J 2ZNYA 4MCUA 2CYYA 1VQ5I 2PUKC 1FOVA 1HXDA 3JRDA 5FFXA 1XWGA 5DCHA 4A0YA 5IQYA 2DMNA 1YKAA 2QYOA 4HQMA 3CQFA 2YU3A 5ILVA 2VL8A 2XGEA 3J80K 2OE0A 3GZNB 1NHAA 3Q19A 4K9ZA 4KSMA 2HDDA 2PMZA 2X6WA 5KAIC 1R7JA 3OR5A 1U6GA 4ZYAA 3KP9A 4IVFA 4DW6A 1R22A 5DM7F 2KDZA 3KETA 1HSTA 3KP4A 1AWCA 3WGXA 2VLUA 5J1YA 3ECOA 4J56E 2C8UA 1LDJA 2MZCA 3PUBA 3BR2A 1EA3A 1U3EM 1FNNA 3O3KA 3RJPA 3M9JA 3E97A 4LOCA 1LFUP 1OKRA 3X2QH 1Z5YE 2LY1A 4XICA 2VN2A 3C7JA 3OYJA 4A3KJ 4KFCA 3APOA 3E3EA 1GTBA 4TXOB 5DDLA 4L5LA 1JFUA 5E1ZB 2OZ6A 2B6MA 2JWTA 2CFXA 2HRAA 2RKHA 2ID6A 3LJRA 1O3SA 1EEMA 4QTRA 2LK2A 4I7HA 3ZQLA 3GH6A 2DA6A 2VXDA 4XL9A 3EU4A 2M0CA 3FXUA 3S2WA 3G6EI 3F8MA 4E6KG 1BN5A 3O8GA 2MABA 1OJLA 1SD5A 5GSTA 5CPRB 2DJ3A 2YP6A 4K0GA 4MABA 2IIYA 1TI3A 2OZUA 4L9TA 5FB2A 1TK8B 4GXOA 1WSUA 4XONA 4BXUA 1X1CA 3KLNA 2G7UA 3TKQA 4N0BA 1YW9A 2EIOA 2X8GA 4MPFA 5EF6A 3IRRA 4G8XA 4B47A 2OCEA 2FOKA 3ZCOA 2JMWA 4DBRA 2PG4A 5J5NA 1ACIA 2IGMA 1FZPB 4BH9A 4OU0A 3OV8A 4BUPA 2IT0A 1GNWA 1GUUA 1B6AA 1OC9A 2C1YA 5A5KA 1OYYA 4UUSB 2FMLA 4DSSB 2MMNA 3KZZA 5DYMA 1JUMA 4WWCA 4XKWA 1QUWA 2R7OA 1R23A 2K40A 2VKVA 2XIGA 3IH4A 1YF1A 5KN1A 3U6VA 3OIQA 3QAWA 1LJRA 3WD6A 2F5VA 3WU2C 1RR8C 3MZYA 2ZKZA 4F2IA 1D8KA 3S15J 3FRCA 1PFOA 1YW7A 4ZB9A 4K2EA 2UUZA 3OS2A 3D0ZA 3RHCA 1WVRA 2X8CA 2W00A 3H1NA 4PUFC 4C3IJ 1GXQA 2AQFA 4NQWA 4IZZA 2G0EA 3ZQIA 1PSQA 2GLRA 1TWHJ 1PN9A 1S3RA 1FYLA 1PMTA 2D45A 4WKWA 4MFDA 5LEKA 2K9LA 2NXNB 4X1UA 3F6FA 5HODA 5E3NA 2Y0SA 1G2HA 1I3AA 2XB5A 3ABLH 1TTZA 4N0ZA 3CJTB 4PSXA 2F3MA 5ID2A 3AG3H 2GXBA 1XCBA 2E1MB 3H5AA 3P9KA 1IJWC 1V98A 2JQ7A 4KW6A 4XMYA 4IOCF 2VB6A 3C71A 3UOMA 2L9VA 3OYFA 2VOPA 1BC7C 3BCIA 3LSPA 1DQUA 2DC5A 1FIPA 2WB1N 2RM5A 3Q0UA 5EEGA 3K0LA 1XW9A 3OYCA 2I81A 1R36A 4CY6A 2V9PA 2DA7A 2ZCTA 2GSRA 5INYA 3KMNA 3VDXA 2E2GA 1Z6TA 3EPTA 3SDGA 3B6AA 2WY8Q 2XRLA 3TB2A 2DAOA 5CVUA 4BU2A 2AHQA 3JTHA 5IMAA 5LCZA 4U87A 2CG4A 3COAC 4AIHA 1ETKA 2YJHA 1QHGA 2C4JA 3HRSA 3J7ZI 1WZ2A 3M1CA 2K9FA 3M3MA 4BA7A 3C18A 3WGIA 3W2WA 2HVRA 3GKXA 4Y52J 1EF4A 2EH3A 4BL0B 3HVSA 2FBHA 4ECBA 4AUXA 1FOWA 2A5YB 4X43A 3JCML 1Y0NA 2Q2EB 5J4YA 1R26A 5ECMB 2F4OB 3F8FA 1Z77A 3GTKJ 5J9CA 1WJ5A 3Q9SA 2YZHA 1DGRM 3G4SI 1RUOA 2PLYA 2D2ZA 3NRVA 1YIJI 1SEUA 3DLAA 1JKPC 1ZLKA 1X5CA 2ZJPF 5EVOA 3CJRB 3ZXSA 1ZR4A 1XPVA 2J23A 3RQIA 4NAXA 2R93J 3IWFA 3VODA 2L7MP 5EL8A 1R4NB 2VIXA 4G2EA 1FY7A 4GTUA 1X58A 4TV7A 5BMUA 4A3FJ 2FQ3A 3UNGC 1TLHB 1SENA 2GGTA 3CRUA 4ZC3A 4Q5SF 5L3GA 2QSFX 4HZFA 2PX9A 5TRDA 2LF8A 4ML1A 1MSEC 1IV8A 1E6BA 4YAVA 3KPHA 2EJRA 1I6HJ 2A6EF 3FXQA 2LUSA 3L2WA 2DPDA 4R79A 3Q3SA 4KIFA 3KYCB 1EKEA 1Y1WJ 3HJPA 4M6XA 4XHMA 2RREA 1TWAJ 3S9FA 1RETA 2BY0A 1Q1HA 3CP8A 3FBNB 5F1JA 1GP1A 5J3RA 3Q0VA 1T4YA 5GAGJ 4I0BA 4OCFA 2DFIA 1RPWA 3UVTA 4HU7A 4UVCA 1AKHB 3F3RA 5F0HA 2V7FA 2KOKA 1MNEA 1OCPA 4I76A 1FAAA 3DKWA 1G3SA 2V1NA 1KU7A 1SAXA 1S7AA 2XPUA 1AXDA 1GTAA 3JRCA 1Z7RA 3S1QJ 2OJLA 3MDKA 3I4NJ 3HSEA 2NVLA 4BGDA 3F4SA 3GIXA 3WT2A 1W4MA 4YG2F 2RNJA 3ZQCA 5AIVA 2K8VA 2JTVA 2PMZN 2P5QA 2LKPA 2WWYA 3EYTA 4I6XA 2KISA 1USSA 2H1LA 1LU4A 3OSFA 3CSIA 1U0JA 4M73A 1QNTA 1JHBA 3WTZA 3GTPJ 1BQ7A 1IRXA 1ZMAA 2R7ZJ 1ZHFA 2F5DA 4KYWA 4Y15A 4B3XA 1AQVA 4A0ZA 3V8KA 4ZYDA 1Y39A 2H6YA 3IRAA 3PM1A 5JCWA 1TI1A 1MD3A 3WGEA 2QM3A 3GCMA 2IFQB 4ENNA 5F0FA 1UG2A 4UUSA 3DEEA 1XWCA 2JZTA 3WYWA 1U9OA 3M9KA 1S5LC 5DCFA 3HVXA 3TDGA 2CV0A 2ZCWA 2B5XA 4RB1A 3CZ6A 1SFKA 3Q9VA 2LJKA 4TN8A 2VLTA 2HFHA 2NTOA 2VT3A 4NV2A 1FPQA 17GSA 2FE3A 4BAYA 1ORKA 1K6OA 2B3SA 4DOZA 4BQAA 4QPOA 4PJNA 2BMXA 4KNDA 5ENUA 5FKLA 4EVIA 1MH3A 4I01A 1IN7A 4F91B 2PWJA 1ZK8A 1QXHA 4Y7NJ 4BHBA 3E9JB 1UC7A 3HYPA 1IF1A 1NSWA 1B4QA 1VQ6I 3CCYA 6GSSA 1UHMA 1SD8A 2Y75A 3FXKA 3K9TA 5E20A 3EUHA 3F8UA 1THOA 4UVBA 2E2IJ 3R61A 2X64A 3JW4A 2O85A 4JP0A 4DEJA 3B02A 3GYKA 2K8SA 2GIVA 2B7EA 1HOMA 4PXOA 1YJNI 2FQ4A 4GLTA 4MJAA 1EZKA 4USSA 4GDFA 5A4UA 2I10A 5CP1A 4WEYA 5D5WB 3ZN1A 5ELGA 1VTNC 5E8GA 3QRFF 3O6BB 2XKOA 4Y17A 5FFZA 1SKWB 3A3TA 1LUJB 1A31A 2HQRA 3OR1C 1H88C 1I9DA 3K6GA 2TRXA 4Y33A 4YQMA 5H5SA 4NHJA 4G6QA 1UHWA 3HTUA 1EOHA 3BBYA 2GS3A 2MGQA 1TT5B 5TJJA 2HOAA 5KCMA 1IO2A 1M0UA 4HV5A 3IC8A 1ML6A 4AU7A 2CX3A 4AWXB 5IMDA 2DA5A 3AAFA 3EYIA 1MBHA 1SAUA 3WTXC 2CT6A 2DQRA 3GTOJ 2JADA 5ICFA 2R3XA 5LHHA 3K70C 1LQ1A 4DYCA 3D21A 4UNOA 2REMA 2Q2EA 4MZCA 3UKGA 4BBRJ 3Q0WA 2Y0SN 2H6BA 3HM5A 3ZREA 2TRTA 3HG9A 1S3DA 1DU0A 1ZOFA 5FJ8J 3CQZJ 3VPQA 1R5HA 1ST9A 2BZTA 3IK9A 1MBKA 3FM3A 5KVRA 1E3PA 2ZMEC 1HW2A 4KUNA 4BVYA 3KYLA 2GM4A 1HKQA 1HDPA 4IQ1A 1WH5A 3RHBA 2DU9A 2BHZA 2COBA 2HXOA 4AM3A 1TU7A 2XAHA 3PO3J 1JI8A 1RRJA 2NVQJ 4XS4B 7GSSA 4KUMA 3V7RA 2EFWA 4G7OF 1X5DA 1K3OA 4PUSA 2OAZA 3BG3A 4WF2A 3HC7A 3OYHA 4KIGA 3FF5A 4BE1A 2RNGA 1MMNA 4XIDA 2A69F 3L09A 2H01A 3RBTA 2M72A 3ZQFA 1XFLA 2JSZA 5J4VA 3HOYJ 1FW1A 2O3FA 2V1DA 3CUQC 1YJ9I 1SKSB 4BQNA 5GPCA 2OACA 2CAIA 2MA3A 2R7FA 1LB2A 4XSXF 3I53A 1AKHA 3BQYA 2XSDC 4FX4A 2M87A 4OO4A 1V55H 1FX7A 4K5RA 3RCOA 5KNLA 2C6YA 4MJCA 4O92A 2ZUPA 4HX8A 2C3QA 3BJAA 1PYVA 4MF6A 2OE1A 1KQ0A 3ZQ7A 2LLKA 3C1SA 3QDNA 1WWJA 1T6SA 3DU6A 1JE8A 3H4KA 2H8RA 3S93A 3S3OA 3DBLB 1D0ZA 2ESNA 4RGSA 3QAHA 1P9QC 4YFNF 1FHEA 2RV8A 4FT8A 3IDVA 4Z2TA 3LSKA 3QYEA 4A3BJ 2DA4A 5CVRA 5F0CA 1FOXA 5FWGA 2DDBA 1FBQA 4FQGA 4LFUA 3F23A 2HR3A 5F04A 2IGNA 5C04A 1MKMA 2KQRA 2FRHA 2XB0X 4WF5A 2EIJH 1YJ6A 2YR2A 2P0GA 2Q0OA 2Y9YA 2IFQA 1KONA 1LFPA 4F52A 4PFOA 3L9VA 1LVKA 3DU5A 1SFXA 4L18B 3BR1A 1O73A 3CMMA 1PP8F 3UVHA 3HL2A 3FISA 2M80A 4DSQA 2EIQA 1G0TA 1SL0B 4YELA 3EETA 3W6GA 2KDOA 5GAEJ 1Y25A 4JBBA 1MD0A 2FJ1A 4KA4A 2WGRA 4CZZA 4MEXF 4LD5A 1R49A 4IHTA 4V19K 2LRCA 3CTFA 2KLOA 2HYJA 2OTJI 1R1UA 3UL3A 4NB5A 2FLSA 1DUXC 1MJAA 2VBYA 1A36A 3MAJA 1VQKI 1ON1A 2LY9A 4ITVA 3G7YA 3KCMA 5CRWA 2HS5A 1R4MB 4GO1A 1ERDA 3R0AA 3ECHA 2P7CB 1TW2A 4M3BA 4IS0A 1UFMA 5D9VA 2CW7A 4A5MA 2DODA 2DMPA 2CW8A 3I5UA 2TDXA 5HDGA 1OR7C 1U3IA 3SEZA 2F4IA 4IKHA 4CH7A 1FVJA 4ASNA 2OBPA 2HSMA 2L4QA 2XHFA 1ILOA 2LFBA 1SKRB 1BG5A 1MJBA 3DEWA 5K1YA 4OAZA 2ZC2A 5IMVA 1SK0A 2KJBA 3GXOA 3RKWA 3FR9A 3KTBA 2EZLA 3SHFA 2ISYA 3FEUA 3GBGA 3BTIA 5LHIA 4F92B 4D5CA 4LK1F 3VSKA 5FT3A 4ZDLA 5A4WA 3T0YA 3PGTA 3TJGA 4CXFA 2H72A 3GHAA 4BWSA 4KN7X 3ZLPA 4BWQA 4AJ7A 4ECCA 2CQQA 2E2MA 3DKYA 2DA2A 5BPDA 4FYUA 3TP3A 2AXTC 3I64A 5DDGA 1I1SA 3HUGB 4JYKA 3TKSA 5GPAA 3BDDA 2LEGA 1N78A 4NXIA 2O89A 1ZR2A 5H6QA 2GA1A 4A3JJ 1STZA 1FYKA 2B0LA 3BZCA 3TCOA 4M9XA 3HJOA 1MBGA 3QOPA 3GLXA 1BI0A 6GSUA 3OWTA 3G3ZA 4Z2YA 3K4CA 4FH8A 3PSIA 2DMTA 4W1UA 1NG7A 1KYWA 2XGXA 2GT5A 5ELAA 3VOEA 2W1OA 2H0IA 3Q6OA 2QA1A 2VOCA 3U2RA 4L0ZB 5DTDA 2PVOC 3GKKA 3QAGA 1ETQA 4LG3A 1IN8A 2HOTA 2BXYA 1MNMC 2FA5A 3OY9A 2VOOA 1NHOA 2JSCA 1BR1A 3OOUA 2G0FA 1LJ9A 1O85A 5GSSA 4NNJA 3HY2A 1XC5A 1A24A 1H4OA 3PIOF 1W89A 3CCJI 5E4WA 4XS4A 2Y30A 3ZR8X 3GYHX 2DK8A 1MMAA 2LP0A 1PKWA 4X0XA 2UXNA 2HVQA 3FKJA 2GQMA 4HQSA 5D9WA 1XVWA 5B1AH 1AHDP 3I0TA 3L0HA 5A2QZ 1AC1A 2DIYA 1R4WA 3CLOA 2KP6A 2B9SA 3ERMA 2WBMA 4K7IA 2EWNA 1PQNA 1AOYA 5L3FA 2CSOA 2PMTA 3HEFA 3L2CA 1R5AA 1T0FA 3OIOA 1XMAA 5ECSA 1AW9A 3IH3A 3RDIA 5D5UB 2LY2A 1XSDA 2I3YA 4MQ9F 4XLPF 2IA1A 2NNNA 4V2GA 5L71A 5TGTA 4Y3OA 2F5EA 2DOEA 2DDAA 2HLSA 3QCPA 1R5ID 5J8FA 2NS0A 2CWEA 4ZDPA 3M1GA 1QFNA 3PSFA 3CCUI 2FXAA 4DQ2A 3ABTA 2H74A 1NM3A 3H3UA 1M99A 3TJBA 1MZBA 1YTYA 5K5OA 1MEKA 1LFBA 2CO5A 1XN7A 4M3FA 2UXXA 3ZMDA 3LOCA 4CUGA 5KN2A 5HR0A 4I2TA 2I5UA 4KX4A 4UV8A 4HNTA 2JA7J 3MMYB 2JSYA 1QMVA 2DFFA 1VQPI 5BMZA 2XDVA 1PN0A 2NVTJ 4UVAA 4MK3A 4ML6A 1WGXA 4TOPA 4JBAA 5IP9J 2P31A 5IO2A 2O03A 3ABKH 4B1RA 1XMKA 2OTLI 4IW9A 3J81K 3MKWB 4GF0A 2E35A 5BPIA 1ONVA 1SK2A 3F6OA 2B7KA 5FRMA 2H94A 2NYXA 1V57A 2GQKA 1K4SA 3LSZA 1V54H 1WQ2A 4MH3A 2KHPA 3FXLA 1SK1A 3FZ5A 1YQ1A 4U7DA 1S7EA 2GVPA 5JWOB 1USTA 1OCOH 1X1AA 2ELHA 3FWEA 2ZJRF 1ZG5A 1ON4A 2H8LA 1R7HA 2IXSA 4OCEA 4CO8A 3JRFA 4O7HA 5IM9A 3JCUC 1TDIA 1Z6MA 4U0WA 5AN1A 1APLC 3CCSI 4MDCA 3HZJA 5LD0A 3R6SA 2FWFA 3KZYA 3KM6A 1X1BA 2JRTA 3BG9A 4UHTA 1S9HA 3WODF 5FLXZ 2F9SA 2GTUA 2MBTA 3MKLA 4M3GA 1YY7A 2K7LA 2M0MA 1JUSA 1RC9A 3QP5A 4IF4A 2L6DA 4PQHA 3TJJA 1X9MB 1SMTA 2E7PA 2YWMA 1AQWA 2CUEA 3GMEA 4OIPF 3FXMA 2X4HA 5ABRA 4RAFA 4ANJA 5LD2C 2H0GA 3HHVA 2MFZA 3ABUA 4OINF 4IGJA 4G9YA 4D5FA 5F06A 1YOVB 4XK4A 5FHIA 4LL1B 3DVWA 3FX3A 1F1ZA 3EUKL 5KOXA 3K4KA 3GFIA 2XROA 2RGVA 5GAPD 1EH7A 5DD4A 4XSZF 4C2TA 2R7RA 4RQRA 3MNGA 4EJUA 1ZARA 4MEYF 3TGNA 5HFKA 2ZJQF 2FNPA 4B4CA 3BR5A 1YS6A 2A68F 1TP9A 4H4KC 4O5RA 4EIQA 2X85A 3FK6A 3CLQA 3J80Z 3SZGA 3H5RA 3HUGA 1K83J 1O4XA 2HOSA 5HDKA 2CQNA 4NQWB 3P90A 3NAUA 1QVUA 1YHQI 3HOZJ 3Q5FA 3ULQB 3AFHA 4JEDA 5FRNA 3FZ4A 3G1MA 4KDYA 3FXOA 2B63J 1C72A 2I9HA 4Q5QA 1F2EA 3JTGA 2C3NA 4NHZA 3CCLI 2WCIA 4MF7A 4ULXA 4YQUA 1OPCA 1FTTA 1HQOA 2FNOA 2W25A 1JKOC 4O32A 2A6HF 2KT0A 3BCAA 1ACVA 1CGPA 3ZIJA 3FR6A 3ESWB 1N77A 1X3WB 4E7JA 3HDDA 1JT6A 1LBKA 2QKLB 1JLVA 1J2XA 4A12A 1IYIA 5FLXK 3M8JA 4A3LJ 1IRGA 2DJ0A 4NV5A 4TKYA 2WC2A 3D5SC 1SD6A 2L5QA 3DGQA 3SXYA 5LGNA 1OC8A 3K4BA 5G5FA 5AIQA 4ESFA 3QQAA 1S3AA 3VWVA 3RDWA 4BACA 2DMUA 3B6CA 3MWMA 4I6ZA 5B66C 1QU3A 5IIZA 1U6TA 2MMOA 4ZBDA 2DTZA 3VI7A 2P6SA 2HXIA 2JK3A 2RN7A 5HLTA 2EA2A 1ERTA 2X6XA 4DZJA 2IS6A 3O2PE 4OMZA 1IRFA 4EE0A 5B7CA 1QO0D 5KN3A 4II2A 5CYYA 5B8AA 4EJWA 10GSA 2NVUB 4ZL8A 2XC7A 2QLZA 4NDLA 4AIKA 1SU9A 2FCHA 1TP4A 2J5PA 4MLOA 4KDUA 1UMQA 1QBJA 4CCNA 3CSJA 2HSYA 3HZ8A 1B4PA 4HUAA 3W3CA 1LDKB 2BTOT 2IS1A 3MCZA 3OMYA 1VQ4I 2XF5A 4J57E 3SWLA 3HOVJ 3SEQA 4K7OA 1SC7A 2M2EA 5ICGA 5F1RA 5EG0B 1JXSA 1AIUA 4PURA 3ERGA 3QPTA 2IAIA 4X1EA 2EPFA 4K8MA 2JVHA 2GSTA 3TUEA 3WHBA 3O6TA 3UJ1A 4XCSA 5DAKB 1MIJA 1I50J 1XSVA 4NHWA 4A5PA 2IPAA 3OL4A 4FE4A 2O0YA 4HAMA 4LGWA 1BA5A 2M46A 3F3XA 3LSHA 1E3OC 5HR3A 4E7IA 4KF9A 1TWFJ 1X19A 1D0YA 1HDDC 1ETXA 1GVJA 1Z67A 2RQQA 4L9NA 2Y9ZA 4D73B 3J7Yb 2BVLA 1ETYA 3H8QA 4MHGA 1FMWA 3QWLA 3WTUC 2EIMH 4BQOA 5HDNA 2ESHA 3VSLA 2E2JJ 4QSHA 3CJQB 4EUYA 4KCEA 5D4SA 5LLQA 2GQQA 1XOBA 3S17J 1MMGA 2QA4I 1T8IA 1JKQC 2ALBA 2AB6A 2EIKH 3HRUA 3M3YJ 3BCBA 1BAYA 1FP1D 1X3ZB 2PJRB 4HJMA 2H6CA 5L3BA 1TRVA 3PL8A 4U0VA 5E59A 4XN3A 4YIRX 2LKSA 3MEXA 1O3RA 1OC3A 2C0FA 3ELKA 4C3HJ 3QOEA 2BEOA 4BDYA 1FWZA 1TQMA 1XB4A 1E0EA 1OE7A 2MLKA 3KD0A 5KAFC 4YQVA 2QVOA 4FTHA 5F6FA 1WH7A 5GAND 1A35A 1J08A 1QA6A 1ZH5A 5AISA 1D1CA 3E6DA 3W2VA 1PX7A 3DPLC 1G3WA 1ZYEA 4KJZA 4J01A 1I39A 1X0RA 3JAMZ 4P9FA 2XHKA 2AYTA 2H1DA 2ISZA 2X9DA 1D5YA 1BYEA 4HYEA 2GDRA 2GLOA 4IRIA 1A0RP 2QSIA 1D5VA 2CUFA 1FB0A 3C2BA 3BR0A 1T08B 4EGYA 1I6XA 1X2MA 2LSTA 3EUHC 4A3CJ 1WE0A 1KZHA 4CY8A 1CQTA 4E7KA 5DV5A 1V5EA 4RM2A 1A2JA 1GLPA 2L9NA 2HRNA 4FE7A 4UB6C 1UVZA 2MH2A 1S7OA 4PJJA 5FLMJ 5ECPB 1ZRDA 3L9UA 3BT9A 1U8RA 2ZSHB 4G12A 2DK5A 2M3AA 3HRMA 3OYGA 4Q4ZF 4E7LA 3WTSC 4ZYGA 1AUCA 4PX1A 1QVTA 1Z91A 1J5YA 3F9KA 4POMA 2XVCA 4KSOA 2QQ8A 2VCVA 1O3TA 4HOJA 1MBEA 1FTZA 5IT9Z 3A02A 1XX5A 4CCMA 1SYXA 3RAZA 1WJEA 4ZL7A 2CUZA 4XS6A 1GDTA 1XD7A 3WTTC 1EV7A 4Q47A 1DP3A 3RQ4A 2LS5A 3NZNA 2L7FP 3EQLF 3TP0A 2HVSA 2RAEA 1XW5A 5G5EA 3ZVJD 1OYJA 2EQRA 2FEZA 3A0HC 1Z7PA 1TTYA 4I2UA 2JPBA 1H0MA 2R7XA 3CXGA 4A6DA 2MBSA 2M45A 1ZLJA 1ETVA 4X0GA 1PX6A 3PINA 1W36D 2K02A 4E7ZA 5IOXA 3ZVJA 1K0OA 5IMZA 3LSJA 1S3JA 5J41A 4L5EA 3MFKA 2VCXA 1A2MA 4DYQA 3ZIVA 3KZIC 3DQVC 4R1HA 3KP7A 1ERWA 2M30A 2HPMA 4D9JA 2X1DA 4CYCB 2JZRA 2GWRA 3I55I 4ENKA 3E0JB 4LJZF 1BW5A 2VUMJ 2KP2A 1FBUA 3JAMK 1VF1A 3AL0C 4TR1B 2V6KA 2MC3A 5D8LB 1J9IA 2L0KA 1ZG1A 1M9BA 3HVVA 5J6XA 3ZMKA 1DSBA 2PJPA 2ZSIB 4KITB 4A93J 3LG6A 1P7JA 3CMEI 5A4VA 2LF7A 3G9BA 2HQNA 5G31A 6GSTA 3PFYA 5J47A 4V2NA 2HZEB 6GSYA 4ZTFA 1XZOA 2E1NA 1JGGA 1B72B 2BYVE 3CTAA 3DTKA 2V32A 5D5VB 4QWQA 1N8JA 3CJNA 1AU7A 3EMXA 2VC0A 3MWHA 5K7ZA 4GQFA 4IBPA 2F5FA 1Y8RB 4I0AA 1QZYA 5EG0A 4BVYB 5L3CA 4S04A 4HNUA 1ETOA 4V1Ag 4GYIA 2VCWA 4PNFA 3V7SA 5K7HA 2CRGA 1SMYF 3ISPA 1OLTA 4L5JA 2HZDA 2L54A 3A03A 3A1YA 5LFAA 3VFZA 5IT9K 2B1KA 3BD2A 3J7Yk 2PN6A 2LRTA 2H6ZA 4C2UA 3I71A 2GZYA 5DAKA 2P5VA 3HVNA 3IWZA 3VB2A 5KEJA 2VJJA 2VBZA 3S1NJ 2G7HA 13GSA 2DMMA 1TNTA 3HA9A 2XF7A 2WJUA 3W6KB 2LDUA 5AONA 4MJBA 2ZXHA 4I99C 4PGHA 2R5GA 4POBA 4W97A 4D73A 3LAPA 1PGTA 3ISOA 3L2UA 4XS1A 2QA2A 2BBYA 2F8FA 4CHSA 4D1QA 1A6QA 1KQ8A 2HPIA 1SJ6A 2DMQA 4M74A 4HS1A 1OMIA 3P8WA 3RPQA 2VLAA 2RQPA 4A6EA 1CF7B 1NK3P 1E17A 2KKOA 2OU2A 2VJ5A 4MIMA 2R7VA 1BJZA 3TDZC 2MYSA 4PCQA 4A69C 1I1GA 4HLXA 1YFHA 3GSSA 4A3EJ 2PJRA 1FG4A 3BR6A 3FY7A 4ZILA 4B48A 2R7WA 4XKVA 4WF4A 4EXJA 2I8DA 2VL9A 4AIDA 4G0KA 5CRHA 1MGTA 2IBDA 2XRNA 1FC3A 4XRMA 3ZQHA 4IN0A 4PQIA 2EV0A 4IHUA 1Z3YA 1JTXA 3F72A 4FCYA 2N5FA 3N05A 4NUBA 1ZYRF 4IVNA 2A61A 4XKBA 1EOGA 2GQLA 3ERFA 3LGCA 3KTLA 2QEXI 2K27A 2H09A 2WAQA 2Z9SA 4L0UA 5EEHA 3S2DJ 3EWLA 4BS9A 4XRSG 1QPMA 3BP8A 4UXNA 3MKZA 1PRXA 3GTUB 5G2ZA 11GSA 1LE8B 3VWUA 1H8AC 2FBIA 2KIFA 5H2FC 3FK8A 5F07A 1HA8A 3WT1A 5CYVA 4AJ6A 3JSPA 3TKPA 3CDLA 3DD3A 1U9NA 2P0WA 1KBNA 2FWEA 1BC8C 4HPQA 2E34A 2HU9A 1BX9A 2ZNMA 3UIWA 1RW1A 2R7TA 1G6NA 2L9RA 3LFUA 1JJ8C 2QKEA 1WPKA 4GCIA 2GIZA 3HPHA 4P96A 4WX9A 2N5BA 2FD5A 3MVPA 2OF7A 5CAXA 3QPHA 3EC3A 2IVMA 3TO9A 4IKFA 4B3AA 4JE1A 4DGWB 3R2QA 2AAWA 3OYNA 2KHMA 1R9TJ 2H1AA 3KP8A 4TR0A 1QZZA 2M4GA 3WGGA 1XTAA 2O87A 2WS2A 5EDNA 4IQ4A 4WCGA 1VQMI 1ZG3A 4GXZA 4JR4A 2KIUA 4IOAF 3HJEA 2E2HJ 2OBIA 1IC8A 5IPHA 4CZCA 3WU0A 2ZB9A 1ZL9A 2ZO4A 4TVEA 5DQSA 3D6IA 3FZVA 2K85A 4Q48A 3OSGA 2DFEA 1UG0A 1XW6A 3DRNA 2VI6A 5M3MJ 2F6CA 1BM9A 2GOXB 4I8BA 1FSHA 1I5GA 5ECLB 5HFGA 1OVNA 2V1MA 2K9QA 3KEBA 3LAJA 1XGNA 3GA4A 3ZOBA 3VI5A 2E5NA 4HX4A 1DGWY 2HNLA 4ZYEA 5K7FA 1TWCJ 2V26A 2JA5J 4A3DJ 1MSFC 1PVEA 3OS1A 2H19A 1BI2A 1ON2A 2A3SA 2MLGA 5CKTA 3WTVC 5CNWA 4ACSA 2LNBA 2EINH 4XLEA 2R37A 4ECJA 4ZIJA 2FX0A 3HKRA 3KX2A 4LLNA 1OCTC 3OYLA 3PFIA 4Y13A 2VXZA 4C3JJ 1URMA 4CYCA 3MYDA 5G1LA 1GT0C 1IN4A 2RUFA 1MNDA 2HDWA 5HR1A 3DTIA 2H71A 5BQTA 2O61A 1I27A 2BY1A 5GTIC 1V9WA 4TR1A 3F6VA 3LSGA 3ZMTA 4C2MJ 2EBIA 3HB9A 4RUVA 4V2MA 6GSWA 3GX8A 3C3WA 4G94A 3BG5A 2LQOA 4MF5A 1Z3EA 4B8XA 1EH8A 4GWRA 2GBYA 3CTGA 3BJ6A 4YRVA 3DXBA 5IYCJ 2HZEA 3GX0A 4PQ1A 2FMYA 3GRXA 2CUJA 1PDNC 3IC7A 2Z5UA 4JU5A 3BJ5A 1JKRC 2NAZA 1B72A 2WFCA 2DBBA 3WTYC 2ETHA 1W1WE 2V1XA 3CMAI 3WTWC 4BEHB 3E0UA 1H89C 4BJTA 2HZFA 1B4AA 3PNTA 5HOOA 3ZITA 2W84A 4BIKA 2MD5A 3FHKA 2JACA 5M5YJ 2LR8A 2QQBA 5IT3A 1GSQA 2YUSA 1IRZA 5C4XJ 2HRFA 3FZ9A 4ZBBA 1W5SA 2BV6A 4MNUA 3ZRGA 4G6TB 4ZYHA 6PAXA 5HNHA 2ZJ2A 1F5TA 5LBQA 2YSRA 4LA1A 4DBQA 2L01A 2YCDA 2L4MA 5AGYA 3DEXA 3QAVA 4EL1A 2FOWA 4F9ZA 1K4TA 5BNGA 3F63A 3LQQA 3QODA 4L5IA 4K2XA 1WJBA 5JFRA 3RKXA 2PPTA 3GV1A 3D4TA 1W7PB 2YNXA 5C44J 3S14J 3GX4X 2O7OA 2IA2A 2O6GE 3FXRA 5HS9A 2M8GX 3CESA 4H0EA 1CF7A 3J7AO 2OBKA 1T7PB 3BCKA 1B59A 3BQZA 2DI3A 4IRGA 5IP6A 2DN0A 1J7KA 3A5IA 3M7GA 3TOAA 4PTSA 3KH7A 4TRXA 1FBSA 2M5WA 1PKZA 5GTHC 3T8RA 2H1GA 1KQ9A 1C0WA 2DFHA 1TT0A 2QF7A 4ZZDA 4YKGA 2DJJA 2H76A 1P6RA 2MMAA 4IHVA 5H5QA 3KYDB 4V2FA 4LB6B 3DCFA 3ZFBA 3GFLA 2OC6A 2ZMEB 5B6NA 2MW8A 4IJAA 3I3LA 2JA2A 1YX5A 5L3EA 3M8NA 1YX3A 2Z2SB 3F3QA 1W5TA 4P55A 4IRHA 3GTUA 4BE2A 2GAUA 1LE8A 1N75A 1FVKA 2LJAA 1BW6A 3BOQA 3H79A 2FBKA 2VQCA 3H5NA 4MQVA 4HBLA 1WFXA 2CZ2A 2DT5A 2E19A 2J5OA 3V8JA 2DJNA 3OOPA 4BYYA 2VE9A 1OCZH 2DXIA 2YN1A 4MZBA 4EO3A 3FR3A 5M5XJ 5JCGA 5HQPA 3R3EA 4I97A 4ESBA 1RKWA 1TBXA 2IP2A 4CCLA 1V5GA 1B9XC 1GTIA 1G3YA 1XGOA 1A5JA 3ERWA 4HDEA 3HOSA 3DVXA 4ZBAA 4RGXA 4F0CA 3QMXA 4QL7A 3HIFA 2QQAA 2V4JC 3CUQB 3VEPA 5JI6A 5IOWA 4IHSA 2DIZA 4Q5NA 1CQGA 4PGTA 4EIPA 1HW5A 4LB5A 5L3DA 1ZQ3P 12GSA 2LRDA 1JZRA 2AS5F 1TRWA 2B5YA 1Y56A 1OYIA 1ZRFA 2XAGA 3K4NA 4RB3C 1SL1B 4ID0A 3JR9A 3L78A 1IAWA 2UV1A 3QPMA 5J9BA 1CQHA 3ZMLA 2VCTA 2X51A 3IR4A 4MA9A 5JWRB 1BI1A 1IDZA 2VKEA 4LMWA 2RC4A 4IQAA 2AV4A 4IHYA 3IHUA 5B6MA 2HQAA 1XSXA 4O5QA 3BZ6A 4EMSA 1J09A 3CCMI 2X4AA 1M2DA 2VODA 3HKZA 4Q5RA 1V4RA 3VPRA 2A2PA 4E70A 1UCRA 1YRNB 4M3EA 4M6YA 4EC0A 2G2QA 1T98A 1VQNI 4A3GJ 2EK5A 1B9MA 3GH9A 4FQUA 1QGPA 1T39A 5DJMA 4Z6YA 1SD4A 3F8NA 4G6DA 5JHFA 1ZGAA 3LQRA 1PP7U 2VD1A 3M8FA 1WJDA 1XPXA 1POGA 5DQYA 2D5VA 2MD0A 3ZQGA 3KZQA 2BJXA 2CVBA 1K0DA 3IHQA 4YFXF 4B44A 4BHPA 1UZCA 3W8SA 3H9QA 3PO2J 4BQQA 2KRFA 1YITI 2PQ8A 2STWA 5H6RA 1T38A 1FEXA 3L00A 2A2SA 4RAYA 2QQ9A 2ZFWA 1RNLA 3WHCA 1N2AA 1OKDA 2E71A 5JHUA 5E1XA 1HBXG 2FF4A 2JU5A 2PBIA 3L9SA 1U5TC 3RIRA 3OS0A 1HYUA 1K3YA 1GSEA 5IO0A 4Z2RA 4CICA 2GSQA 2JPCA 4N4NB 1R5PA 3F9UA 4WR4A 4BEHA 1M1EB 2B1LA 1T1VA 1B9YC 4CA0A 2Y31A 2YANA 4XN0A 1KU3A 1V40A 3TW7A 1JT0A 3EMPA 3HDCA 4WETA 4JZQA 2LKUA 2HXKA 2PN8A 1MBFA 3J81Z 3HSFA 1XIYA 2KIMA 4EDZA 5DEQA 3A2XA 2NNYA 3LA7A 3L2RA 2JSPA 5GAHJ 3K4LA 4OWRB 3EURA 1J59A 2QWWA 3PNYA 3VYTB 2Y2ZA 4PK4A 1ZGWA 1ZZYA 3OYDA 5ECIB 3KIOA 3TKRA 3ZQQA 2P6TA 1VQOI 1ZYNA 1J0RA 4RS8A 3SZTA 3H1CA 1W7PD 3F4RA 3ZL5A 1WI3A 1D1BA 1JZDA 2WV0A 3DBHB 1SYRA 4HZ2A 4IJ3A 3IL2A 2YOIA 4V1Ap 4G7ZF 4IELA 1WJAA 1S29A 4H86A 4O5UA 2YJ7A 2J9HA 2L02A 3HXLA 4RLFA 1MDIA 1R6RA 1W7PA 3FMRA 4RLQA 3CC2I 1T8EB 4KNYA 1HQCA 1E3HA 3GSTA 2P5LC 3K70D 3QPLA 3DYRA 4JX6A 2EZHA 3EE2A 2VQGA 1VQ7I 3V8LA 1G7OA 3UBKA 3A01B 3GTLJ 3BPVA 3GTQJ 4G19A 3ED3A 1IUYA 2WULA 2F5CA 3DPTA 4RMNA 4RAZA 3TO7A 4L0YB 3LW9A 4AF2A 2ECCA 4NC8A 4P9UA 2CQKA 4JOMA 3N5OA 3K2ZA 3LXTA 1GSSA 2HNHA 2JUCA 1DE1A 5D93A 2R5YB 4YEJA 4B43A 3BZKA 1GLQA 1UJ8A 2ZMEA 5CRGA 2HOEA 5DBQA 4GQCA 2KZVA 2C0GA 2D1HA 1F36A 4HEA2 2VKDA 2NOJB 3K4MA 2DCEA 2Q1ZB 4L9VA 2DJIA 3OYBA 2R92J 4FYCA 1RUNA 5F64A 1BL0A 1KGSA 1RI7A 2JL4A 3QU3A 2K86A 2YZUA 5CVJA 1GUKA 5K5QA 4BJ5C 1FLIA 2VAFA 2VCZA 1F3AA 3C1RA 3LWAA 5D8IA 5DVBA 3VFIA 4GSSA 5D5XB 2PFBA 5JLWA 2FU4A 4NMUA 4XIHA 3LSMA 1YO5C 2KPMA 5JR3A 4N4OB 2V9KA 4DSRA 1NHYA 1DDNA 3T8TA 4RA2A 5HS7A 1J0FA 3CUQA 3NQOA 5CVVA 1VRSD 3CP2A 4HI7A 1Z7LA 1IDYA 1G59A 1QRYA 2BE5F 2W24A 3H3VK 3K1NA 4LK0F 5IPAA 3S3MA 4F7ZA 1BOBA 2VM2A 3KEOA 4Z7XA 2OJED 1A8LA 3DF8A 3HRTA 4M9SA 1ZKGA 4DJAA 2D2WA 2EFOA 3TJKA 2XASA 5CQEA 5LEJA 2C3TA 3K8NA 1SANA 4DVCA 1TZLA 1VF3A 3OIPA 3KP3A 3KP5A 1EJ9A 1LEAA 3R4KA 2Q8KA 2I4AA 1YLFA 2CV1A 3TOTA 1Z0XA 2VLVA 4A5NA 1XCVA 2HKXA 2QUFA 3D5LA 3M9AA 4E8HA 1TKDB 1ZYPA 4NPBA 2Y69H 1VF4A 1Z21A 5HLIA 2QGVA 3QOUA 5E18F 3GNJA 3EYYA 4YFKF 5E1WA 5EEAA 2MC4A 1T2KA 1K3LA 1YRNA 2LSOA 3GZ5A 4GSNA 5E8IA 5E3OA 3W6VA 5CRDA 3T5XA 4QL9A 4K2DA 3I43A 3BC8A 3RPPA 3I59B 5C3EJ 2LD5A 2X48A 2AHEA 5LGTA 3BTCA 2QCOA 3UR3C 1F3BA 3U5RE 18GSA 4GGGA 2LTKA 1K6YA 3N9JA 4U0YA 1AAZA 3AG4H 4YH2A 3SFIA 3E5XA 4POKA 1H9GA 2KMUA 4BXFA 1X1DA 4XM3A 2NS8A 4FIWA 1S72I 4CGZA 3IAS2 3RYRA 1IUFA 2YPRA 2IRFG 1FJLA 4ZTJA 1HNAA 2QSHX 1WIKA 4RGRA 1K0AA 1M3JA 3LEFA 3H9GA 3ASNH 4HSTA 2YV7A 3PJRA 3BROA 1HW1A 5BRTA 1O8WA 3K69A 2PERA 1GXPA 2JJ7A 2WY7Q 3BWGA 3LSIA 4XRSA 2XBIA 2H70A 4KIBA 5H5RA 2FD3A 4TW5A 4NWYA 3UBLA 5EZGA 1R58A 5G1KA 1OR7A 3HXSA 1IXRC 2IS4A 1XOAA 5DUIA 2IMFA 3QFBC 4K5SA 4WXCA 3HKZN 2XAUA 4UUVA 3DP7A 3F22A 1TRSA 2P7VB 2VJ4A 3IP4B 2ME0A 1JHHA 4QPQA 5J1RA 2HZTA 1HNBA 3D5JA 4TR4A 2YV9A 2BY3A 2R7DA 1U88A 2R7QA 3HPGA 3ML6A 1X4PA 3KXOA 4A2UA 3O3TA 2IGKA 2IS2A 5JWQB 2NDOA 3WGHA 4ZB8A 2O8KA 2WAFA 3RKQA 1ERUA 4KA0A 2Z1DA 1F9MA 3K7AJ 4MJEA 2PVQA 2C80A 1A6IA 3P7XA 3TKSE 3WGDA 2FWGA 4I5QA 2NVYJ 3IH2A 4EQQA 2A4VA 2I1UA 1TK0B 2Z9OA 1MMSA 2IWTA 1IGNA 4PDKA 2VBXA 5ECNB 2CZ3A 3KMOA 4MMMA 4D0PA 5C4JJ 2VASA 3LQ7A 1Z9HA 3HSRA 1V3FA 3O8HA 4IL6C 3SJMA 1XWAA 4OMVA 2EV5A 2DJ2A 3CDIA 4FETA 2NS7A 3A01A 3S32A 3E5QA 4XOTA 1R1VA 1BEDA 3MKYB 2HEOA 4XLHA 2CMPA 3LMMA 3JRAA 5IYDJ 4OFMA 5TISC 4IHWA 1JZOA 2HYFA 2LC2A 4HU9A 5IMCA 2ICWG 4RB2C 3G7JA 3DKXA 4IP6A 2R5YA 2W7NA 2OA7A 2FSWA 3CDHA 1YIOA 3WG7H 1SVLA 2VPLA 4MPGA 2EILH 14GSA 4HF1A 2OE3A 5M3FJ 1GUHA 2RM6A 2VE8A 1RZ4A 4ZJZA 2Z3YA 2OPTA 3RPNA 2DJKA 2L7KA 3RPUD 2TRCP 3VURA 3A2KA 1Y1VJ 3FMSA 1PL1A 1ZYQB 3EUAA 4U7BA 2GZZA 5FROA 2YS9A 2M8EA 4P1WA 3G71I 2VO4A 3RPUA 1DE2A 2HDCA 2XGCA 2QGUA 3H9JA 4ETSA 1OISA 2K9NA 4M6VA 1MTCA 3ZTLA 2L9SA 4UB8C 3MSZA 1EV9A 4N0VA 5E3MA 3GFMA 3DV8A 1IG7A 2ZFUA 3ABMH 1YE9A 3I4PA 3NWSA 1PUEE 1G4DA 4LIVA 4EDYA 4F3QA 4ICYA 2E60A 2O7KA 4ECIA 2IMEA 2GXGA 1R5GA 2P5KA 3E6BA 1YQAA 1BIAA 5D4RA 5EYRA 4EATA 4ZDOA 1TWGJ 1YI2I 3DKSA 2FGXA 4ILFA 4BDZA 1AQXA 5ECQB 1IV6A 5B8BA 1HF0A 2H30A 1SVMA 3BG6A 4ZXGA 2HQ5A 2JZYA 3H35A 1JGSA 5LRRA 2KP1A 1HKTA 2OADA 5ECRB 5D96A 1VQ8I 4PJ0C 1XDSA 2E1OA 1S8NA 4AD9A 2VM1A 2K4JA 4BPYA 4PUAA 4N30A 3HBLA 4M3DA 1TOFA 5HLHA 1MMDA 5M5WJ 1HD2A 4A0XA 5E79C 1SVOA 2V6EA 2EC4A 5CVIA 2HRKA 4BY1J 2PBJA 2VL2A 4MH2A 1KNGA 3JRHA 2EFNA 4B09A 4OIOF 1YYVA 3I56I 2HKOA 4PGGA 3P9IA 2JN6A 4ON0A 5FD6A 1GSFA 1VGLA 4RDUA 2CV4A 4M72A 1G8XA 2V79A 4OAYA 4XOPA 1EP7A 1WP0A 3I59A 4LL4B 1FO5A 2ZXJA 4CYDA 3IC4A 3QPSA 1LNWA 5DCMB 1O8XA 1SD9A 4O3MA 2PI0A 2BW3B 2OQGA 4QIWN 4OOIA 2E1MC 3CF5F 2G9WA 3UMAA 3JRIA 3GEZA 3US3A 2AJQB 4IO9F 2RIIA 3LFKA 2H0HA 5D6EA 4II3A 4AYBA 1Z7UA 1SJIA 3PR8A 4X4JA 1FT9A 2DYSH 1FOHA 1X3UA 2A2RA 3F0IA 1SL2B 2A05A 1TL8A 4TR3A 3DPUA 1ZTRA 3P5JA 3AG1H 5CREA 1SFUA 2VKHA 3D22A 3CF2A 3WE3A 2FHEA 2X99A 3GMFA 1P2FA 4G7HF 3PIPF 1WRJA 3GLLA 1XWKA 2VCQA 1T33A 2K3PA 3ZN0A 2X1CA 4AVPA 4D7NA 3W8JA 1IXCA 4EKZA 2DKIA 4OMYA 3FDYA 3FMQA 2ADUA 3GUDA 22GSA 3GF2A 1TJDA 2F51A 2XF6A 3ZYWA 5F05A 3E6MA 3R60A 1LDDA 4BNCA 1JUPA 3RI4A 5F0GA 3DBRB 1DPRA 2X8HA 3TL4X 4HF0A 3KP6A 3KFWX 1SFOJ 1E2YA 1GSUA 3OYKA 3GKMA 2ID3A 1F4KA 2K18A 1OCRH 4KDXA 1X1PA 1XXUA 3SQNA 1JHFA 2WA0A 3TOUA 3K1PA 2E0QA 2YWOA 1L3LA 5ERIA 4FISA 2H75A 2H1BA 4CCJA 2GT6A 5EPFA 2BHYA 1TK5B 1FB6A 3HHGA 2JUGA 1DUGA 2V2GA 3NEUA 1M9AA 4MGRA 1XG8A 1V2AA 1VI0A 1WHUA 1Z6NA 4K0NA 2LBFA 2LRNA 1W0UA 1MW7A 2ZNZA 1TNSA 2K4BA 2XAJA 3R0JA 4OWYA 1GTUA 2B7JA 3CCQI 4HSCX 2Z16A 3P2AA 1GWCA 3IRQA 2ON7A
chains in the Genus database with same CATH topology
3S3NA 3RSNA 2HT9A 3CBUA 4XTSA 1A0FA 8GSSA 4LLRA 5C00A 2UZ8A 4E7SA 4K7NA 1OE8A 3VYRB 1XWBA 3O76A 2RUEA 4LIUA 3ZFLA 3SBCA 3APSA 2HE3A 2M4KA 2X49A 5D9TA 3BLYA 3SDBA 3AL0B 1T00A 2QC7A 4XRDA 2K9MA 2R2JA 3LFLA 3U21A 4F82A 2V41A 2DLXA 3C2HA 2CS3A 1NG6A 3IE3A 2L6CA 3C8EA 4HJ2A 2GOMA 4IQJA 3FBIB 1WJKA 2DBCA 1GULA 3GFKA 2L59A 4ZL9A 1GSDA 3QR6A 3TBIA 20GSA 2DOAA 2XPEA 1O81A 1G7EA 3NIVA 1K0CA 2FY6A 4TXOA 2ELJA 1BJXA 3IA1A 1GH2A 4AGSA 4CCOA 4GRIA 2DJ1A 2PU9C 1T3BA 3A2WA 3FYGA 5DALB 5LNKe 1UELB 4L8EA 1WPIA 2FWHA 3CYNA 4G10A 3CSHA 4PJMA 4RI6A 3I69A 2L2OA 2BW3A 3G2BA 2AQEA 3UARA 5ECKB 3RTRA 1G6WA 4J2FA 3A5WA 3LL7A 4DIQA 2M7BA 3NWTA 16GSA 4WBRD 1WMJA 4DSSA 3MIXA 4WXTA 1QK8A 2W4SA 3ZGKA 2DT6A 1ZCPA 1NW2A 1VF2A 4JRRA 1Q98A 4KE3A 3TKSC 1EWXA 3K4JA 1ERVA 2QKMB 1PJRA 2A6TA 3HCZA 5HR2A 3KJYA 3OYMA 5JCUA 3A4CA 5KHDA 4BVXB 4E7HA 3VYUB 4AVZA 1XCCA 2WDUA 3IAM2 3KGKA 1X4OA 4XQFA 4OFNA 4HG2A 2WAEA 2CV2A 1GUMA 1MD4A 1T4ZA 3IBHA 4KT6A 4YKFA 1QQ2A 2XSJC 3K10A 5IMFA 2K5CA 4IP1A 2LNTA 3PH9A 3TRPA 1T0FC 2O5RA 2IMKA 2KUCA 1Y6IA 2WB9A 3IK7A 1GSYA 3QYBA 1OKTA 5ECHB 3TGZA 1V5FA 4HZ4A 1TRUA 5D9XA 1GL8A 1WRYA 2LQQA 5KOWA 1YDKA 2R7UA 2R0CA 3KEYA 5HFIA 9GSSA 2LG4A 4IX7A 1PA3A 2CVDA 3DMLA 1OAZA 2MMZA 2M7AA 3OR2C 1JLWA 1KEBA 1MDJA 1RQMA 3GKNA 4RQXA 3KH9A 3VWWA 3FHNA 3VK9A 2IN3A 5J4UA 3EPZA 2YPMA 3F6DA 3OYIA 3L4NA 1FMVA 3FZAA 2AUVA 2B5EA 3APQA 1RK4A 1ABAA 1GNEA 3IXRA 4P3YB 1M7TA 2RLIA 2LOOA 1EEJA 3H0DA