2FUG2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase chain 1
publication title Structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 178
sequence length 178
chains with identical sequence B, K, T
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2fug201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fug202
3R2QA 3UMAA 1K3LA 5D9VA 3F63A 3KTBA 14GSA 3UBLA 1ERTA 3HVVA 1EV4A 4IQAA 2DJKA 4X43A 3APOA 3LXTA 1WIKA 1ZYEA 4YAPA 4TR1B 1GLQA 1E2YA 2CAQA 1AC1A 2IMIA 3GRXA 1A0FA 4ID0A 2R4VA 2C8UA 3VFIA 3U6VA 2WJUA 4POKA 1JZOA 5LD0A 1WMJA 2R37A 3CRUA 4O92A 3FRCA 2GVPA 4ECJA 2LUSA 1FG4A 2YWOA 1C72A 1TJDA 3CTGA 4LLRA 4XTSA 1ZL9A 3G7JA 4ZL9A 3TB2A 2X8HA 3RHCA 3ZTLA 4E8EA 3FR9A 4JR4A 1A8YA 2IMKA 1O81A 1PMTA 2PMTA 3F6FA 4F03A 2A2RA 2B6MA 1KNGA 3F4TA 4GQFA 3TRQA 5F05A 5CRWA 3HVSA 3RPPA 4MJCA 3KH7A 4I97A 1SKRB 1XOAA 4TOPA 3I43A 1YKAA 3D21A 4ISDA 1JZWA 3F8UA 4KB3A 2H1AA 1GUHA 1V9WA 5L71A 1JFUA 5CAXA 4GSSA 4FH8A 1ZYQB 1S3AA 3O6TA 3QR6A 1JLVA 4RUVA 18GSA 4WETA 1MD4A 4ECBA 4Q5RA 1G6WA 1X9MB 2VL2A 3ZMLA 4GTUA 1G7OA 4JRRA 4ULXA 5KN3A 3DMLA 4PXOA 2YV7A 2B5EA 2IWTA 5G31A 3TJGA 3G9BA 3ISOA 3FZAA 3IV4A 1U6TA 5F0GA 20GSA 5E4WA 4J57E 3HCZA 3N5OA 4J2FA 1V57A 2C0EA 3IAM2 1WE0A 3GKMA 5A4VA 6GSWA 4XS4A 3F4RA 2VLTA 2RLIA 4MP4A 4PURA 2LRCA 1CQHA 4BVYA 3VURA 4N11A 1X5DA 4RQXA 2VD0A 1F37A 1X5CA 2H66A 3PGTA 2FWFA 1OE8A 1XPVA 4K9ZA 1TI3A 3WGEA 4I8BA 2IMFA 3A5WA 1OC9B 2OKAA 4X0XA 2AHEA 2C1YA 4HQZA 5J5NA 3CBUA 3IDVA 4XHMA 10GSA 1Q4JA 3Q6OA 1G7EA 2KP2A 3VWUA 2GZYA 6GSXA 1R4WA 2FA4A 2B5YA 3TOUA 2WRTA 1UA5A 2D2ZA 2VL3A 3I6AA 2YCDA 4WEYA 4FYBA 3L9VA 4WBRD 1Z6MA 1OAZA 3QAWA 2MBTA 2V6OA 2GTUA 2XC2A 4GSTA 2KHPA 2AJQB 2R5GA 5JWRB 3UARA 2VCWA 4ILFA 5JCWA 3I69A 2L5LA 4YQUA 1A24A 4PNGA 2KP1A 4L5LA 4MJEA 4LL1B 2VCTA 2MBSA 4TR1A 1GLPA 2QC7A 3GTUB 1WP0A 3AY8A 5IMAA 3APSA 3GV1A 3UOMA 2PBJA 2REMA 1F6MC 2VUPA 3TKQA 4GWRA 3PH9A 1T00A 2FCHA 2DIZA 5ELAA 5A4UA 5J41A 1I9DA 1T4ZA 4PQIA 1AXDA 1J9BA 5EVOA 2KLXA 2P31A 1XCCA 3M9KA 5GSSA 3FYGA 1TTZA 5ECPB 1SKWB 2WS2A 2DJ0A 3KXOA 4BVXA 2FGXA 1K0DA 2GQLA 2WULA 3C8EA 4IJ3A 5FHIA 5DJLA 2VOCA 3ZREA 2ON7A 2CX4A 3GH6A 3I9V2 4HQSA 1YF1A 1TRSA 3ZL5A 1XZOA 3ZFBA 4IQ1A 2TRXA 1YEPA 4IN0A 4QL7A 2I1UA 3IHQA 2L4CA 2HZEB 6GSTA 2H6XA 2GT6A 4PX1A 2K18A 3D5JA 2HSYA 4CDOA 4NV5A 5CRHA 5JWQB 1G0TA 2YANA 5D73A 5HFGA 2MMOA 2O85A 2LNSA 4IJIA 5DALB 2H30A 2DBCA 1MD3A 1NM3A 3GNJA 2F8AA 4ACSA 1PSQA 2O8VB 1GL8A 2YOIA 1ILOA 2F3MA 5IOXA 5INYA 3TJKA 2YN1A 5JCGA 3DIEA 2YWNA 3TRXA 5DVBA 1TK5B 3LQ7A 1DE1A 5B8AA 3UVHA 2X99A 1A2JA 1VF3A 3ZIJA 3DKSA 6GSSA 1VRSD 3DGQA 1M9BA 1TRVA 1EP7A 1SYXA 2DJ1A 1SD8A 2VLUA 4KDXA 1B8XA 2LEGA 5F07A 2LJRA 2JSZA 2AB6A 2HFDA 3MNGA 4EF0A 1I5GA 3GH9A 4TR3A 16GSA 4J56E 3M8NA 2YP6A 4DSQA 3O3TA 2PPTA 3DEXA 3H4KA 3GN3A 1PKWA 1M9AA 5J3RA 4NXIA 3KM6A 4HS1A 3M3MA 1FW1A 5H5QA 3GURA 1VF2A 4DSSA 1AQWA 3HD5A 3S9FA 2O89A 4PGTA 1EWXA 4KGIA 2PERA 4WR5A 3F0IA 6GSVA 3Q74A 4BA7A 4EL1A 1HQOA 3FR3A 3GKXA 3M9JA 1R5PA 2LJKA 5JCUA 4F0BA 1YDKA 3A2XA 1K0CA 4EC0A 2IIYA 2LQOA 3Q18A 3EYTA 4HZ2A 4MPGA 4EO3A 5G5EA 2YPMA 2EIOA 4XS4B 3GTUA 1PA3A 4EKZA 3QD9A 4GSNA 3EE2A 2H73A 2NDOA 3W6GA 1IYHA 2H76A 4XCSA 3QAVA 2V32A 1TDIA 5IMZA 4JEDA 1PL1A 2IMEA 1NHOA 1QQ2A 1AAZA 3FZ9A 1U87A 3P2AA 5LNKe 3M1GA 4DVCA 3ZZXA 3HVXA 1FAAA 12GSA 1TP9A 1ZMAA 2C0GA 2L6CA 1AW9A 2N5AA 2PWJA 4MCUA 1GTIA 2LNTA 3BCIA 3LORA 2VCVA 3UEMA 3ZIVA 1R7HA 4X1UA 3GA4A 3IXRA 2IN3A 1SK2A 3H93A 4G2EA 4EVMA 1USBA 5ELGA 4F82A 2H71A 4RI7A 1T7PB 1V2AA 3FZ5A 3C73A 3WGXA 1XBSA 2OA7A 1EGRA 2VO4A 3A3TA 2FWHA 4HU7A 2HZEA 4N10A 5EY6A 3QAGA 4HEA2 1GSEA 1X0RA 4K0NA 2VM2A 1OE7A 1ERUA 2H19A 2YWIA 6GSYA 4NPBA 1TKDB 1XWKA 5DALA 3OR5A 2IPAA 1MEKA 4MZWA 1Z7RA 2CA8A 5HFKA 3C7MA 3ZVJD 4GXZA 1M2DA 4IP6A 1YQ1A 1SK0A 4MZCA 4TKYA 4XS6A 3L4NA 1AUCA 1URMA 1OKTA 1SL1B 2MMAA 3L9SA 5B8BA 2B7JA 4D73B 5JWOB 2HZFA 4CW9A 1QFNA 3EU3A 3D4MA 5AISA 2K6VA 4I2TA 2DLXA 4IW9A 4JR6A 1XOBA 3DWVA 3F3QA 1XIYA 4TXOB 1V98A 2K8SA 2YJ7A 1SJ6A 1EOGA 5COHA 2NVLA 3KEBA 2P5RA 2P0GA 2CVBA 4L0UA 2IFQB 4K8MA 1SL0B 4ZIJA 1DBYA 3DVWA 5J4UA 3LWAA 2BMXA 3MDKA 3HY2A 1KEBA 1Q98A 4YQVA 1PD21 2OE1A 3IAS2 3QPMA 1EEMA 4IHUA 1GSQA 3IOSA 2GSSA 3N9JA 4L5OA 2O7KA 4LL4B 1SJZA 3GSTA 1HNCA 8GSSA 1TRUA 1JHBA 3RDWA 2LTKA 2R3XA 3EU4A 4TW5A 4JZQA 2AAWA 1DSBA 2BJXA 1T1VA 3VI7A 1MTCA 3G7IA 3GL3A 1TI1A 1MDIA 1ZZYA 5AIXA 2EIRA 1TW9A 1YKCA 2JZRA 5DQYA 3GX8A 1W4VA 1SU9A 4GRFA 5GZZB 3D22A 2L59A 1FOVA 1Z7PA 2XPEA 4MPFA 2P5QA 2CZ2A 3EC3A 3F4SA 4G10A 5ID2B 1F9MA 2DIYA 3CSJA 4MJAA 3FEUA 2L5OA 3TKPA 2F51A 4XRAA 4P3YB 4MF7A 4IS0A 5IO0A 2GQMA 3NZNA 4KX4A 3IRAA 3LJRA 2PU9C 2ZNMA 2HE3A 1B4PA 1GSUA 4DSSB 4OCEA 4OD7A 5GAND 1XW5A 2HNLA 2JSYA 3HJMA 4MDCA 4E8HA 4TRXA 4MH3A 3VI5A 3E0UA 1LBKA 4WXTA 4F0CA 3GKNA 1PKZA 1SYRA 4IBPA 4N0VA 3EINA 5HR3A 3BBYA 3ERGA 4WKWA 2NPBA 4IGJA 4TR0A 4LMVA 1TRWA 2GT5A 1FHEA 4TR4A 2DMLA 4NAXA 5AN1A 1B9YC 2H75A 1ERVA 2CT6A 3DRNA 2LJAA 2VM1A 1TK8B 4HI7A 2LRTA 3LFLA 1SD9A 4XIHA 3ZLPA 2HRFA 2YWMA 1GSSA 2ZCTA 3PR8A 1JLWA 4RQRA 1GP1A 2DJ2A 1A2MA 4WR4A 4OFMA 4D73A 1XWCA 2H1GA 3GSSA 2H8LA 3TJJA 5AIVA 1A0RP 3WYWA 5ECMB 2RM5A 2VCQA 3HHVA 1G6YA 5J9BA 4ZL7A 5DQSA 3GMFA 4PQ1A 4OMVA 1FB6A 4O5RA 2C0DA 4MK3A 4TXOA 4PQHA 2V41A 2IL3A 4TN8A 4G9HA 22GSA 3KZQA 3ZFLA 4DSRA 1R26A 5B7CA 13GSA 3ZVJA 3IC4A 3EWLA 1MDKA 2IFQA 2RUEA 1TOFA 1XW6A 4V2NA 2GGTA 4N30A 2GLRA 5C04A 3VWWA 3GX0A 5A5KA 5IMCA 1ABAA 5IQYA 3UAPA 3W8SA 2XBQA 3CXGA 3EVIA 2FLSA 4MJBA 1FVJA 5AGYA 2L4QA 2H0GA 1QK8A 1SJIA 2VL9A 2OADA 4OO5A 1QMVA 1Z6NA 3VK9A 3A2WA 4KNDA 3RHBA 5HFIA 3EURA 2ES7A 4ML6A 2DJJA 2BTOT 1EV9A 3WT2A 4ZBAA 4OCFA 4KDYA 4Q5NA 2B3SA 2DSAA 2M46A 1GTAA 2FA8A 1GNWA 3RAZA 4F9ZA 5D9XA 1LU4A 1EOHA 1QXHA 3HKRA 4K7NA 2G2QA 5ABRA 2E2GA 5HR1A 4AJ7A 1S3CA 2VCXA 5DJMA 4ZILA 3HJOA 4POBA 2FD3A 2GS3A 3ERWA 3C1SA 4ZL8A 5ID2A 2E7PA 1ACVA 3QOUA 1OC3A 2C3NA 1EP8A 2LSTA 3TJBA 1XFLA 4PUFC 3TCOA 4LA1A 2VD1A 2VCZA 4OFTA 2HLSA 4N0ZA 3H1NA 4BWQA 2OBKA 4AJ6A 5A4WA 1B48A 4NWYA 1K3YA 2ALBA 1ZGNA 2VIMA 1NW2A 4MLYA 1NHYA 1M7TA 1Z9HA 1Y25A 2OBIA 1TU8A 1U88A 4IKHA 5H5SA 4HUAA 4EXJA 2JL4A 4YQMA 1M0UA 3L0HA 3DVXA 11GSA 3V1WA 2JACA 3DXBA 3P90A 4BPYA 3QFBC 5DCGA 3VPQA 2N5FA 2GQKA 2ON5A 1YZXA 3KTLA 4MH2A 1BQ7A 1GSDA 2I4AA 2CVKA 3DYRA 4V1Ag 5ECKB 2DC5A 1HNBA 2LKUA 4K1FA 2VLVA 2I3YA 3IK9A 4KAEA 2V1MA 2CAIA 3NOFA 4KA0A 1SKSB 3D4TA 2JZSA 2OE3A 1TXXA 1GUMA 2WB9A 3D6IA 3ZRDA 2IMDA 1O85A 2YNXA 4OO4A 5D9WA 3TDGA 4JBBA 2LV3A 2GSQA 2MMNA 1H75A 3GKKA 2H74A 2HT9A 2C0FA 2E2MA 5CNWA 1CQGA 4HZ4A 1XW9A 1K0BA 5D8IA 2PGTA 3US3A 3IR4A 5G30A 1EGOA 4ZB9A 1VGLA 4GF0A 5ECRB 2PVOC 1N8JA 4HJ2A 2MYGA 2JU5A 2V2GA 5J9CA 4BL7A 3LYPA 5D96A 4KCEA 4I2UA 1K0MA 1THOA 2K9FA 2X8CA 3MWHA 1XWAA 2QGVA 1X5EA 3K8NA 4HU9A 3VWVA 5IIZA 4YAVA 2CX3A 4ZBDA 5GAPD 5D9TA 4ZB8A 1O8XA 2MZCA 2YZUA 1PN9A 5F06A 4AGSA 4YH2A 3F3RA 2B1KA 3HA9A 3UIWA 3HZ4A 4OFNA 2C80A 3TKRA 3LG6A 3ED3A 2H0IA 3QCPA 1Z3EA 2FY6A 5EL8A 3VPTA 1F3BA 3TOTA 3KP8A 2PN8A 1OKDA 5IPGA 5CRGA 2GZZA 1M2BA 1LJRA 1BAYA 2H01A 1QGVA 4G19A 5DAKA 2XHFA 1HNAA 1AQVA 4KDUA 4KE3A 4XRDA 1B4QA 3QFAC 2GSTA 3G7YA 2QKEA 4KH7A 1H4OA 2CZ3A 3C1RA 1V40A 3CTFA 3KD0A 3HZ8A 5DDLA 3BCKA 2X8GA 3HXSA 2XPDA 3F6DA 1JZDA 2H1BA 1PL2A 4AJ8A 2LRNA 2QSIA 1BG5A 1BEDA 3E3EA 2WCIA 4NV2A 1B9XC 4FO5A 1YEXA 2A4VA 2WFCA 2RIIA 3F9UA 5ECHB 3GHAA 2DJ3A 3J7Yk 1EEJA 2EIQA 2L6DA 5CRDA 2F8FA 1NSWA 5CP1A 3KGKA 3FK8A 4ECCA 3GYKA 4ZB6A 3H8QA 1TK0B 4AF2A 3QMXA 1BYEA 2C4JA 1F3AA 2R6KA 3IA1A 4HDEA 5ECIB 3M0FA 1ERWA 5IMVA 3NIVA 3MSZA 2KOKA 3TKSC 1E6BA 4EDYA 4MF5A 1DE2A 3FKFA 1GULA 5G1KA 1JZRA 1OC8A 1OYJA 4IVFA 3LXZA 4JE1A 1X9SB 4L8EA 1V58A 1J0FA 3KMOA 3FY7A 3BOAA 4KSMA 4POMA 2HI7A 1VF4A 2FWGA 4POLA 1HD2A 5ECLB 1O7UA 3ME8A 3GL5A 2RM6A 1HYUA 1BX9A 1YY7A 3TGZA 1WRYA 4Z7XA 5E59A 3UVTA 2B5XA 1T3BA 5IOWA 3E9JB 1R5AA 1Z5YE 4K2DA 1A2LA 3H79A 3W8JA 1GSYA 3A2VA 3RBTA 5G5FA 2FHEA 7GSSA 1O8WA 1SL2B 1SK1A 3CMIA 3GIXA 5CO3A 6GSUA 3JCML 3IPZA 4TVEA 5ECSA 3TUEA 2E0QA 3GFKA 3MAKA 4KUNA 1WOUA 3SBCA 2NBSA 2J9HA 5KN2A 3CSHA 1UN2A 3HJPA 3TJFA 2M72A 5HR0A 1ZOFA 4GLTA 4ZBBA 2XBIA 3WT1A 2I81A 2WGRA 4L0WA 3BJ5A 2TRCP 2H72A 17GSA 2X64A 4I5QA 4K7IA 5B6NA 2A2SA 4ZXGA 1GTUA 5ENUA 1N2AA 4IELA 5IMFA 3O76A 5LCZA 3C71A 5DBQA 3ZYWA 2DMMA 1YJ6A 2GZPA 2R2JA 1IYIA 2L57A 9GSSA 2NTOA 2AV4A 4HOJA 3UJ1A 1FVKA 1KBNA 1K0NA 4EDZA 4V1Ap 2OACA 5ECNB 3Q19A 5G2ZA 1XVWA 4JU5A 3CYNA 4MMMA 1QUWA 1MDJA 2VAFA 4CHSA 2F9SA 5B6MA 1XVQA 3ERFA 3PINA 1PGTA 3KP9A 3L78A 3IE3A 2TIRA 2YV9A 1WJKA 4H86A 4IP1A 4WBJA 5IO2A 3UBKA 2H1DA 2K8VA 2C3QA 1PX7A 5FT3A 2H0HA 1A8LA 1U3AA 2CVDA 2MMZA 1SENA 3EMXA 4XS1A 3L9UA 4DEJA 2ZUPA 4TXVA 3TRPA 1GSFA 5KN1A 1FB0A 4KCAA 1T4YA 2H6YA 2AYTA 2OE0A 3FW2A 1M2AA 1W89A 1GUKA 1OVNA 4V2LA 2VL2C 4MABA 1UC7A 1GTBA 4GQCA 2IJYA 3IBHA 5IPHA 2I9HA 3HYPA 5DCHA 4WF5A 1A23A 1O73A 1XWBA 1O6JA 1YF0A 4LMWA 5HQPA 3CRTA 3VWXA 5DAKB 2V6KA 4Q5QA 2OJLA 3QDNA 1F2EA 4FYUA 1WPIA 3APQA 2B7KA 4MA9A 1RQMA 3BD2A 2J23A 4KSOA 3WD6A 1T8EB 5H5RA 4F2IA 19GSA 2O87A 3KMNA 3LGCA 4HJMA 4QQ7A 3LEFA 1GRXA 3ZMKA 1ON4A 5GSTA 1ZCPA 4O32A 1PX6A 3LSZA 4FYCA 4PUAA 2GDRA 5FWGA 3J7Yb 4Q5FA 3WGDA 1PQNA 1THXA 4GCIA 3VLNA 5KEJA 1TU7A 1GH2A 3P7XA 2HXKA 3FHKA 4ECIA 5ECOB 5ECQB 4ML1A 2PVQA 4WF4A 2GSRA 3IK7A 4I6XA 4O7HA 5HR2A 5G1LA 1M99A 1VF1A 2M80A 2Z9SA 4K7OA 2PUKC 1K3OA 1OC9A 1GNEA 4PNFA 4NMUA 1Y6EA 1AQXA 4EE0A 3KCMA 2HSHA 1UVZA 2G0FA 1EZKA 4MZBA 5D93A 2JZTA 1KTEA 2N5BA 1K0OA 3UL3A 3EMPA 2YJHA 2B1LA 2RUFA 2AUVA 3P8WA 2YZHA 3D0ZA 2LQQA 5CREA 5F8BA 3U5RE 2C3TA 3KJYA 3TKSA 2HRNA 1X9WB 1U3IA 1XWGA 1K0AA 1GWCA 1RK4A 1ST9A 2H70A 2CQ9A 2LS5A 1DUGA 2FUG2 2FNOA 1WWJA 4NHZA 3KIJA 3LYKA 4FIWA 4BWSA 3CSIA 2EC4A 1S3DA 4QL9A 2WZ9A 1PRXA 5C00A 4K0GA 3KH9A 2JADA 2KUCA 5IMDA 5KN0A 4MF6A 3FZ4A 5IM9A 1J08A 3TKSE 4RI6A 2FWEA 2CV4A 4NHWA 2HYXA 3SWLA 5CYYA 1RW1A 3RPNA 4KW6A 4K6XA 1FO5A 3HDCA 2WDUA 3GUSA 3ZITA 4V2MA 5EPFA 3ME7A 3DD3A 1ML6A 3FR6A 1BJXA 1XXUA 4OWYA 1AIUA 4EUYA 2H6ZA
chains in the Genus database with same CATH superfamily
2CW8A 2FU4A 2MFZA 3R2QA 3UMAA 1K3LA 5D9VA 1U5TA 3I71A 3F63A 5JI6A 1RRJA 1FTTA 1KZHA 3KTBA 14GSA 1NHAA 3DPTA 4M3BA 4KMUX 3UBLA 2LC2A 4RS8A 3N4MA 1ERTA 3HVVA 1EV4A 2ZMEC 3HRSA 3TQNA 3L2UA 2X6OA 3CJTB 1L0OC 2YX4A 3FM3A 3IKTA 1WRJA 4DBQA 1WH5A 2A6EF 5BOXA 4IQAA 2DJKA 2ZNZA 3ZMVA 4I09A 1CQTA 1X1BA 1X19A 2HOEA 2VT3A 2O3FA 4UUTA 3APOA 3LXTA 1D0XA 4X43A 3CUQB 2OPTA 1WIKA 1ZYEA 2LY1A 4YAPA 4BXUA 4UUSB 4TR1B 1GLQA 4KICA 5IOYA 4IHVA 1E2YA 2CAQA 3S1NJ 1AC1A 2IMIA 4HNUA 3IP4B 4AIJA 3GRXA 1A0FA 4MLOA 1WJEA 1YQAA 4ID0A 2R4VA 3R6SA 2C8UA 1YS6A 1X1AA 2DA6A 4DOZA 2EIKH 3U6VA 3VFIA 3MFKA 2WAEA 3K2ZA 4PCQA 2VQGA 2WJUA 2R7TA 4POKA 1JZOA 2YJ7A 1WMJA 5LD0A 3TGNA 5D5VB 2EINH 4KN7X 4RB1A 1MBGA 2R37A 3CRUA 1F5TA 2H6CA 5FJ8J 4O92A 3FRCA 3HL2A 2GVPA 4ECJA 4K2EA 3E97A 3GW2A 2DT7B 2LUSA 4G7ZF 3I0TA 2BV6A 3IH2A 2BXYA 1HDDC 2KDOA 1FG4A 3GWZA 1I27A 1ULYA 1T8IA 3BQZA 1C72A 1TJDA 2YWOA 3CTGA 4W97A 2OTJI 4LLRA 1B72B 3U1KA 3LSTA 4XTSA 3MWMA 4L9TA 1ZL9A 2Y9YA 2K7LA 4Y4RA 3G7JA 4ZL9A 2DFIA 2P7VB 3HZJA 3TB2A 2F4MB 2X8HA 3E5XA 3J81Z 1VI0A 5E18F 2L9VA 3H3UA 2NVUB 2Y69H 1Q1VA 1IRZA 3IWFA 3KP4A 1TWHJ 3BR2A 2QEXI 2KIUA 5FFXA 3RHCA 3ZTLA 1IV6A 3G1OA 3JCUC 4IHYA 3PNTA 4E8EA 1A5JA 3FR9A 4P96A 3LQQA 5HDGA 4JR4A 1QZZA 4OMYA 1A8YA 2IMKA 1O81A 1PMTA 3SDBA 1BC8C 1BOBA 2E2JJ 2A2RA 2PMTA 3F6FA 3BR6A 5FKMA 2STWA 1W36C 1KNGA 2LREA 3OSGA 3ZQLA 3Q0WA 2B6MA 3F4TA 4GQFA 4O5UA 5F05A 5CRWA 2DA4A 4FX4A 3ZL5A 3HVSA 1OYIA 1T56A 2KLOA 1MNEA 2MH9A 3RPPA 4MJCA 3KX2A 2ZXHA 5HNHA 1YTYA 1YITI 3KH7A 4I97A 1SKRB 2DDAA 3EUKL 4IEJA 1VQ5I 2CV0A 1XOAA 3R3EA 2P6SA 1IN6A 1MIJA 3I43A 4TOPA 1SD6A 2M2EA 2OF7A 4HG2A 2DJIA 3ASOH 2VBXA 4I0AA 4XRMA 1YKAA 3D21A 3KZYA 1ETVA 1T38A 4ISDA 1G3WA 3FDYA 3MKYB 1YRNA 1JZWA 2VXZA 1ZRDA 3F8UA 3DPUA 4KB3A 1PFOA 3OOPA 1TL8A 2K02A 2R5YA 3HOUJ 2H1AA 1WGXA 1GUHA 4OU0A 4C2TA 1V9WA 5L71A 1JJ8C 2KT0A 1SMYF 1JFUA 5CAXA 4GSSA 1UG2A 4FH8A 2DQRA 1ZYQB 1S3AA 2QZ8A 1XTAA 2Z16A 4BU2A 3A2KA 3O6TA 1R00A 3QR6A 3QAHA 1PJRA 3HOZJ 1E17A 1JLVA 1T08B 2R7DA 4RUVA 1A35A 2MSYA 18GSA 3QRFF 4WETA 1RR7A 2V9VA 2HQNA 2VKDA 1MD4A 3NRVA 2F48A 5JVGF 3PJRA 4ECBA 3Q9VA 3ZQIA 3KP6A 3J81K 1T98A 4Q5RA 1BBYA 4F9ZA 1G6WA 2ZB9A 1X9MB 2VL2A 2H6BA 1MZBA 3ZMLA 1FPQA 4GTUA 1GV2A 1I39A 1G7OA 2MW8A 4Y52J 4JRRA 4JX6A 2ZJRF 4IHXA 2L5QA 4M73A 4ULXA 2E1MB 1LJ9A 4QTRA 2ID3A 5KN3A 3S2DJ 4P9UA 4RM3A 3DMLA 4PXOA 1W7PD 4RB0A 2YV7A 3HOXJ 2B5EA 2IWTA 5G31A 6GSWA 2XASA 4MEYF 4UVAA 4LG0B 5CQEA 1W36D 5DEQA 3KFWX 1AOYA 4Y13A 2F6CA 1YJWI 3I54A 3TJGA 2GOXB 2NNNA 2EV5A 2GA1A 3G9BA 1LDJA 2KRCA 3ERED 3ISOA 2BBYA 4A6EA 1ZG1A 4IKFA 5HLTA 3FZAA 3K0LA 4NHJA 3IV4A 4NB5A 5M3FJ 2LKXA 2M87A 2QWWA 3R0AA 5KAIC 2BVLA 3TOAA 1U6TA 3QPLA 2RC4A 2XKOA 5ICCA 4BY1J 1P6RA 3CP2A 2DA7A 5F0GA 5HLHA 20GSA 5E4WA 3BWGA 2JA8J 4J57E 3HCZA 3OIPA 4F93B 3JRGA 3N5OA 3WG9A 4J2FA 1KGSA 1P7IA 1V57A 3J7ZI 1S7OA 3M8EA 3BJ6A 2C0EA 3S93A 4C30A 3IAM2 2RNJA 4A6DA 5C44J 5DTDA 1WE0A 4LOCA 5M5YJ 2JK3A 3GKMA 5A4VA 1L3LA 3K1MA 4E4HA 5F6FA 4M6XA 1M3JA 2CO5A 3F4RA 2MBFA 2VLTA 4XS4A 3GYHX 2RLIA 4Z2TA 1B59A 4M6YA 1XDSA 2BE5F 3S3NA 3DTEA 1SFUA 4MP4A 4PURA 5KVRA 3BG5A 2LRCA 3E6DA 1XGNA 1CQHA 4BVYA 1M1EB 3DKXA 3DTKA 3N05A 4N11A 4M3FA 1AWCA 1X5DA 1WFXA 2VD0A 1NTCA 4RQXA 1NG6A 3TP0A 3L1PA 1F37A 1X5CA 4HV5A 4A3CJ 2H66A 3PGTA 2L4MA 2EB7A 4WX9A 5LRSA 1W4MA 2FWFA 3BR3A 2K3FA 4L9NA 4CCLA 1OE8A 1XPVA 1TI3A 4K9ZA 4OMZA 4K5SA 4I8BA 3WGEA 3IL2A 1PVEA 1MKMA 4BJ5C 5LGNA 1D1CA 2IMFA 3A5WA 2F2EA 1MH4A 3ERMA 4U0WA 1Y6IA 1WI3A 4X6AJ 1OC9B 2X48A 2OKAA 3GFIA 2FQ4A 4X0XA 1K78A 2AHEA 2C1YA 4HQZA 5F04A 4HLYA 3BJOA 2JZYA 1FWZA 2ICWG 3QODA 4C2MJ 2L7MP 4A93J 3TEDA 3CBUA 4YQMA 2CW7A 3IDVA 4XHMA 3ZRGA 10GSA 5CVIA 1GHCA 5EZGA 1P2FA 3CLQA 1ETQA 2LFBA 4PDKA 2X1CA 1Q4JA 3Q6OA 1G7EA 4HDUA 4IRGA 4L9VA 4PSXA 4KITB 2KP2A 3VWUA 2HTSA 2K27A 1Z3XA 4ZYHA 5GTHC 1MBFA 2GZYA 6GSXA 1R4WA 2FA4A 2R0QC 3V4GA 2B5YA 3TOUA 3S3OA 2FNPA 1UA5A 1X2NA 2WRTA 2W7NA 5E3NA 1ETXA 2KPMA 2D2ZA 2VL3A 3I6AA 1U6GA 1X1DA 2VQHA 2D1HA 3CCLI 2ESHA 3L2WA 2YCDA 3BDDA 5F1RA 2DJNA 1RR8C 2OQGA 3LA2A 4WEYA 3JRIA 1QZYA 3L9VA 2DT5A 4FYBA 4WBRD 2RAEA 1W0TA 1XSVA 1Z6MA 3A02A 2XROA 1XX5A 3QQAA 1OAZA 1R5HA 3QAWA 2QCOA 3F72A 1J5YA 1K7AA 2BYVE 1N75A 2D45A 1V55H 2MBTA 2V6OA 1YJ9I 2IS4A 2GTUA 2XC2A 4GSTA 2KHPA 2AJQB 2PN6A 2UUZA 2ELHA 1WKMA 1JGGA 2EIMH 2R5GA 3ZN0A 5JWRB 4JYKA 3FXKA 3UARA 2VCWA 1JUMA 4ILFA 1WWXA 5JCWA 3I69A 5GADJ 2L5LA 4YQUA 1A24A 4PNGA 3OYDA 2KP1A 4L5LA 4MJEA 2RDPA 2QSFX 4LL1B 2ID6A 2EA4A 3LA3A 3O8GA 2NVYJ 3CJQB 2RQPA 4PGGA 5IT9K 2VCTA 4UUSA 4TR1A 1GLPA 2MBSA 1MH3A 2KIMA 2TRTA 3I4PA 2QC7A 3OYCA 3GTUB 1WP0A 1FOKA 1ZREA 2L9SA 3AY8A 1VQKI 5IMAA 1DPUA 3SFIA 3TMOA 3J7AY 1TWAJ 2XB5A 4XOPA 3F8FA 3APSA 1K61A 1A6IA 1XMKA 3GV1A 1UHWA 3UOMA 3OYMA 2PBJA 4XORA 1FTZA 1PUFA 4IHSA 3SDGA 2REMA 2R7OA 2Y2ZA 3KP2A 1F6MC 2VUPA 3TKQA 4GWRA 3CQFA 3F21A 2O9LA 3WTXC 1S8NA 2EPFA 3H5RA 2QQ9A 5EGOB 1FYMA 3OS1A 3DBHB 2KL4A 3PH9A 3B73A 1T00A 1U2WA 2FCHA 2DIZA 5ELAA 5A4UA 1OCZH 1I9DA 5J41A 5DS9A 1TQIA 2DPUA 1T4ZA 4PQIA 3DLLF 1OCCH 3SXYA 1AXDA 1J9BA 2VN2A 1B72A 2KLXA 5DD4A 5EVOA 2P31A 1XCCA 3M9KA 5GSSA 3FYGA 3GLXA 5FGMA 2VJ4A 4BL0B 2UZKA 1TTZA 4NQWA 3FX3A 5ECPB 1SKWB 4M3DA 2DJ0A 2WS2A 3U1DA 3KXOA 2JUCA 1XCBA 1XN7A 4BVXA 2FGXA 4ANJA 1K0DA 2GQLA 4BACA 2WULA 2ELJA 1ETWA 2FOWA 4KIGA 1ZGWA 3C8EA 4IJ3A 4XSXF 5M3MJ 4C9YA 2IGOA 5FHIA 1QQIA 4HF0A 2K9SA 5F1JA 2LY9A 1K4TA 3R0JA 5JLXA 4A12A 5DJLA 3M07A 2DMUA 3VYTB 2VOCA 2M7AA 2UXNA 3FIWA 3ZREA 2ON7A 2CX4A 4G6QA 3I9V2 3GH6A 4HQSA 2IGKA 1YF1A 1TW3A 2WAQA 1TRSA 2WV0A 2QUFA 3QYBA 5ICFA 2MYSA 3IRRA 1XZOA 4ICYA 3OOUA 1U5TB 1M3IA 3ZFBA 4IQ1A 4PUSA 4A3IJ 3OYHA 2EK5A 2IVMA 1S7EA 2TRXA 1T0FC 2DKHA 2E7XA 1GV5A 3RPUD 1KU7A 3G3ZA 5CQGA 1YEPA 4IN0A 1FT9A 2I1UA 4BQNA 2L4CA 5LHIA 3IHQA 2HZEB 4QL7A 3FMRA 6GSTA 2X51A 2H6XA 2GT6A 4EM2A 5H6QA 1JKQC 4PX1A 3BG9A 3R61A 2CV1A 2K18A 4XM3A 3D5JA 1RESA 5BQTA 4E6KG 1LPQA 2HSYA 4CDOA 4NV5A 5CRHA 5JWQB 4KUMA 2D1VA 3PO2J 1X4PA 1G0TA 2HVRA 5E1ZB 1VQ6I 2YANA 3WU2C 3M8FA 5D73A 2NOGA 1V54H 3F8CA 2MMOA 5HFGA 2O85A 2LF8A 2LNSA 4IJIA 2HQ5A 5DALB 2TCTA 2H30A 2DBCA 5IYCJ 2KHMA 2WWYA 1IJWC 2JA7J 1MD3A 1NM3A 3GNJA 3H0GJ 3GFLA 4KN4X 2F8AA 4ACSA 4M71A 2R5ZA 2N8GA 1HKQA 1PSQA 2KZGA 2O8VB 1YX5A 2X4AA 2QA1A 2L54A 1GL8A 3OSFA 2YOIA 1BOAA 4FISA 4DIQA 4QPQA 1ILOA 3K4JA 2F3MA 5IOXA 1U8RA 3GTPJ 3D0SA 5INYA 5FKLA 3TJKA 4A3GJ 2YN1A 4J19A 1TP4A 5JCGA 3DIEA 2YWNA 3S17J 2EZIA 5DVBA 3TRXA 1JKOC 3I55I 1TK5B 1MMNA 3LQ7A 1FX7A 2M3AA 3VFZA 4QWQA 1DE1A 4Q47A 2I8DA 2O7OA 4EMSA 4GFBA 1FNNA 2ZFUA 2E35A 2PMUA 1BI1A 2AQEA 5FROA 4LG0A 3UVHA 5B8AA 1DQUA 4L5IA 1B9MA 2KZVA 1HW5A 2EV6A 3CMMA 2X99A 3F8NA 2OAZA 1A2JA 1VF3A 2O0YA 1XC5A 3HSRA 1PN0A 3DKSA 2P6TA 3ZIJA 2JPBA 6GSSA 1QVUA 1R1UA 1VRSD 3DGQA 1M9BA 4M9SA 5BPIA 1OYWA 3GEZA 1TRVA 2F5FA 3AFHA 1EP7A 1SYXA 2DJ1A 5LBQA 2DYSH 4Q48A 1X3WB 1G4DA 1SD8A 5AIQA 1QO0D 4AVZA 3K4MA 1MBJA 2HU9A 2VLUA 4KDXA 1B8XA 1OR7A 3TOBA 1IG7A 3S1QJ 2LEGA 4XMYA 5EYRA 5J3LA 5F07A 1N77A 2LJRA 1IRFA 4N4NB 2QLZA 2P7CB 2IPQX 4RGXA 2JSZA 4DZJA 2AB6A 5EEHA 4I0BA 5IP9J 2R93J 2GXGA 2RVCA 5FLVA 2HFDA 5J1YA 3MNGA 3HC7A 2IEKA 4EF0A 1WCMJ 3KLNA 3MKZA 1I5GA 1O3QA 2WAFA 3GH9A 2M34A 4TR3A 3RPQA 3WODF 1FLIA 3PIPF 16GSA 4UXNA 5AONA 3BPXA 1WJBA 4A0YA 4WK8F 3DV8A 3WGIA 4Z6YA 3NWSA 4RB2C 2CUEA 4EVIA 3CCSI 1A31A 1Y8RB 1FOXA 3M8NA 4J56E 5C4XJ 3T8RA 3AL0C 3KEOA 2PMZA 2YP6A 3A0HC 2FEZA 2HDCA 4DSQA 3O3TA 4GYGA 2M7BA 2XF5A 5TISC 3TBIA 3CO6C 1MMAA 1FC3A 4IXAA 4YIIA 2PPTA 3DEXA 3TO6A 1PUEE 3RYPA 3H4KA 1OMIA 3K9TA 3GN3A 3P9IA 1PKWA 1W7PA 2MG4A 2Z1DA 2R5YB 1T33A 2AO9A 3DEEA 1SAXA 4AU7A 3VODA 3GO5A 1M9AA 4HRIA 2YSRA 4NXIA 5J3RA 2VXDA 2CQ7A 3PIOF 3KM6A 5FKNA 4ZYEA 4U0VA 1E2XA 4HS1A 3M3MA 4CA0A 3CCEI 4PSWA 2K9LA 1FW1A 5H5QA 3GURA 1FZPB 4D7MA 2WB1A 1VF2A 2HGCA 2KRFA 3G71I 4DSSA 1AQWA 3HD5A 3S9FA 2O89A 4PGTA 4CICA 4IVNA 4IOCF 1EWXA 4I2OA 3FHNA 4KGIA 2PERA 4WR5A 3IKVA 1TT0A 3I56I 4B8XA 3F0IA 4CY6A 2AXLA 2OQRA 3K70C 1RC9A 6GSVA 2BHYA 1U9OA 1SVLA 5F27A 1W5CC 3Q74A 5B7CA 3RI4A 3FMSA 3OR2C 3G6EI 3Q0UA 3UKGA 3GZNB 4BA7A 5DCMA 4EL1A 3EYIA 3K4CA 2L9RA 2VKVA 3B02A 4MQ9F 4EQQA 3E5UA 1IN7A 4G6TB 5H20A 5L3GA 1HQOA 3L7WA 2B0LA 2VB6A 3FR3A 1R23A 2PEXA 3PQKA 4ESBA 3GKXA 3M9JA 1R5PA 3D5LA 5K5RA 2LLKA 2LJKA 2VKHA 3ABKH 1O7FA 5JCUA 4F0BA 1YDKA 3A2XA 1MDMB 2O6GE 1K0CA 3VOEA 3EUHA 1KQ8A 4GRIA 3RDIA 2IIYA 4EC0A 4LB5A 2EH3A 3AG2H 3D5RC 2LQOA 4UB8C 1OCOH 5FLXZ 3EYTA 3Q18A 1SMTA 2VKEA 5EEGA 1EH8A 4HZ2A 3FKIJ 4XRSG 4MPGA 4EO3A 5G5EA 1WJFA 2Q1ZB 4XSZF 1JI8A 2XV4S 2YPMA 4H0EA 2IT0A 4ZDOA 4H4KC 2DO7A 2LD5A 4LIVA 2EIOA 4XS4B 3GTUA 3BZ6A 1PA3A 4EKZA 4WF2A 1IF1A 1EF4A 3QD9A 4GSNA 3EE2A 4MNNA 3RQ4A 4QLCU 3F8MA 5DM7F 2H73A 2NDOA 1FMVA 2BY0A 2E1OA 3GF2A 4WXCA 1O57A 3W6GA 2Q0OA 4XLHA 2CMPA 3SZTA 2QQ8A 1IYHA 1BC7C 4IQ4A 4XKWA 2H76A 4XCSA 2O03A 1UB9A 3NWTA 4BVYB 3ASNH 3REOA 5B1AH 1O3TA 3CD6I 3QAVA 3GTOJ 2V32A 3HTUA 1TDIA 5IMZA 4JEDA 3CDIA 1PL1A 4NDLA 4Y33A 3ZQHA 5EGOA 1D5VA 2IMEA 3MZHA 1NHOA 1G2HA 3V8LA 3S15J 1QQ2A 4HYEA 4ZDPA 3S16J 4OIPF 3E6MA 1AAZA 3FZ9A 1U87A 1FBSA 4F55A 2X49A 3K70D 1XCVA 3P2AA 3DTIA 3M1GA 5L3FA 4DVCA 2HYJA 3ZZXA 5LNKe 1QHHD 3HVXA 3EETA 3TW6A 1FAAA 12GSA 3PPUA 1JT0A 4KISA 5CVRA 5L3DA 1TP9A 1FJLA 1V3FA 1ZMAA 2C0GA 1WJAA 4FX0A 3IRQA 2L6CA 2L02A 4D7NA 5KAFC 1AW9A 2N5AA 1YO5C 4RMNA 3L09A 4BH9A 2EFPA 3CUOA 1MW7A 1P92A 2PWJA 4MCUA 3OS0A 1GTIA 2LNTA 4ZC3A 3BCIA 3LORA 1HKSA 2Z9OA 2VCVA 3UEMA 3ZIVA 3B6CA 2KQRA 5IYBJ 2YS9A 1R7HA 1Y8QB 2MD5A 4X1UA 3GA4A 3IXRA 4HSTA 2CGPA 2IN3A 1SK2A 3H93A 4G2EA 3PNVA 1K83J 2HOTA 1USBA 4EVMA 2FE3A 1EKEA 4UB6C 5CKTA 5ELGA 3MIXA 4CCMA 2E1CA 1ZRFA 4F82A 4UVCA 5ILVA 2X6XA 2H71A 4RI7A 1ORKA 1T7PB 1I1GA 1V2AA 4QSHA 2DK5A 3FZ5A 4M72A 3C73A 2NVXJ 3WGXA 3CC2I 1XBSA 2OA7A 1EGRA 3S2HJ 2VO4A 1P7JA 3A3TA 2FWHA 1JUPA 4HV6A 3OY9A 4HU7A 2RGVA 3OWTA 1X4OA 2HZEA 4N10A 5EY6A 3I53A 3QAGA 2DTZA 4HEA2 3C2GA 3IWZA 2LOOA 1GSEA 1X0RA 4X1EA 5CYVA 3VYUB 2FD5A 4K0NA 2C6YA 2RQQA 2XGDA 5EJCA 2M0MA 5EZHA 4BNCA 3AAFA 1OE7A 4G94A 2VM2A 5JHFA 2DXIA 1ERUA 2H19A 2YWIA 2D5VA 6GSYA 4NPBA 1TKDB 1H0MA 1XWKA 5DALA 3OR5A 4ZZDA 3E6CC 2IPAA 3KZZA 2NS8A 3FMQA 2M45A 1MEKA 4EM0B 4DYRA 4MZWA 1Z7RA 1DPRA 2CA8A 5HFKA 3S14J 3C7MA 3C18A 4RAGA 1M2DA 4GXZA 4IP6A 3IHUA 3ZVJD 5BPDA 2DT6A 1BR2A 1FEXA 1YQ1A 1SK0A 4MZCA 2W25A 4TKYA 4M6VA 1TTYA 4XS6A 2W48A 1MNDA 1YE9A 2DN0A 5B5EC 1AUCA 1URMA 3L4NA 3TRQA 3LOCA 4HQMA 1PUFB 2QBYA 1XB4A 1OKTA 2Y30A 3FBIB 2FNAA 4ZDLA 3WE3A 3ZMZA 6PAXA 2MMAA 1SL1B 1DDNA 2FOKA 3L9SA 1FIAA 5B8BA 2L4AA 2B7JA 4D73B 5JWOB 2R7ZJ 2MLKA 2HZFA 2WAQN 4CW9A 1FYKA 1SVOA 2FBIA 5BMUA 1B1BA 3A4CA 1QFNA 1VQ4I 4LIUA 2V1NA 2LSOA 3KIOA 4IQJA 4IZZA 3EU3A 3D4MA 2L9NA 5AISA 1NK3P 4FT8A 1IW7F 4QPOA 2OC6A 2CWEA 1XMXA 3VURA 2K6VA 4I2TA 2EFWA 2DLXA 1D3YA 3BCBA 3E1SA 2CS3A 4IW9A 4JR6A 1XOBA 4NQWB 2VC1A 3K6GA 2IBDA 3Q5FA 3DWVA 3RPUA 5JR3A 3F3QA 3E0JB 1XIYA 4BVXB 1R5ID 1ZELA 4BBSJ 3JTGA 2JUGA 4RM2A 1I6HJ 2UXXA 3GZ5A 4XR6A 5F0HA 1R36A 4TXOB 4DYCA 4QIWN 1V98A 2X85A 4WXDA 4EM1A 3RIRA 3ZMSA 2K8SA 1O4XA 1FBUA 2EILH 3D5SC 4I76A 4BGDA 3U21A 3K1PA 5EF6A 1SJ6A 2R7FA 3CTAA 1EOGA 3M1CA 2KKOA 1HSJA 3WTUC 4C2UA 5COHA 1K79A 2NVLA 3KEBA 2Q2EA 2MGQA 3I5UA 2BVMA 2G7HA 2P5RA 4C3JJ 2P0GA 2CVBA 5E3MA 4L0UA 4ZJZA 1MJ9A 3ZN1A 2IFQB 4K8MA 1I6XA 2DMQA 1SL0B 1IXRC 5J8FA 4ZIJA 1HCRA 4UUVA 1DBYA 3DVWA 5J4UA 3LWAA 3HRMA 2BMXA 1RKTA 3BZCA 3MDKA 4U0YA 1X2MA 4HX4A 3HY2A 2Y48A 1Z0XA 1BIBA 4MNUA 4NBQA 1NG7A 4BQQA 1KEBA 1Q98A 4YQVA 2P0WA 2PMHA 3LMMA 1PD21 1AKHA 1QBJA 4HOBA 4JX5A 2OE1A 3IAS2 1GVJA 1DP3A 2DODA 3QPMA 3TKYA 1YIOA 1WVRA 1EEMA 4IHUA 5HS9A 1GSQA 1J09A 3DWLE 3CCQI 3IOSA 2GSSA 3N9JA 3ULQB 2G7UA 2WY7Q 1RKWA 1S3RA 4L5OA 1ERDA 2R92J 2O7KA 4IL6C 3R4KA 4LL4B 4EJOA 4Z2YA 2R5ZB 5J1UA 3P9CA 4G8XA 3HB9A 3BLYA 2OU2A 3T0YA 2I5UA 1SJZA 5A4WA 2IAIA 3EPZA 2ZMEB 4MHGA 2LDUA 3HUGA 4IF4A 4ENJA 3GSTA 1ZKGA 5HS7A 1HNCA 4OWRB 1B4AA 1D0ZA 8GSSA 1TRUA 3OMYA 3W6VA 4P55A 1SFOJ 1JHBA 3RDWA 2LTKA 1HXDA 3HOYJ 5DYMA 2R3XA 3F6VA 3V8KA 4E7SA 3EU4A 4TW5A 4JZQA 2AAWA 1DSBA 2BJXA 3DQVC 1T1VA 1SC7A 5FRMA 2R7UA 4A5PA 3VI7A 4M3GA 2LBFA 1MTCA 3G7IA 4OIRF 2QQBA 1R58A 4XICA 5D6FA 2YU9J 3ZQ7A 3GL3A 2PMZN 5ED4A 1TI1A 1JKPC 1MDIA 1BM9A 1D1BA 1ZZYA 1R7JA 4HNTA 2M8EA 1E3PA 5AIXA 4G12A 1ZR4A 4YKGA 2EIRA 1TW9A 1LFPA 2CQNA 4ABZA 1YKCA 3KLOA 2JZRA 1MDMA 4O5QA 3VYSB 5DQYA 2DW4A 3GX8A 2XVCA 2J5OA 2OV7A 2DA2A 5E1WA 1W4VA 4HW0A 1ZYPA 1SU9A 4GRFA 5GZZB 3D22A 1IDYA 3CESA 2E34A 5ILSA 4XN3A 1Z91A 5BMZA 2L59A 3FM5A 1FOVA 3BCAA 3QYFA 3G1LA 4XNFA 1IUYA 1Z7PA 4PJ0C 3L9FA 2XPEA 1BW5A 2BOLA 4MPFA 3LFKA 1R4NB 2P5QA 2CZ2A 2WB1N 1DGWY 2E71A 3EC3A 2CU7A 2V6CA 1IZ1A 4II2A 1WJCA 3F4SA 1ETOA 1QA6A 3FZVA 4V2GA 4E7LA 2DCEA 1Z7UA 4G10A 2GQQA 1RETA 2COBA 1T2KA 2X6WA 3EQLF 4HSCX 1YJNI 5ID2B 2IJLA 3I3LA 1F9MA 2DIYA 3CSJA 4MJAA 3FEUA 1MJBA 1R1TA 1JHFA 2DLLA 2RV8A 4G0KA 1QNTA 2L5OA 3TKPA 4I7HA 4KA4A 2F51A 4XRAA 2HKXA 4P3YB 4MF7A 1YFHA 1GXQA 2XAHA 1I3QJ 2X1EA 2F4IA 3JRBA 1MJAA 1R9TJ 2HQAA 1B8IB 3OIQA 5IT9Z 4IS0A 1W7PB 3B6AA 2VE8A 1BN5A 1LQ1A 3LW9A 4L18B 5IO0A 4RDUA 2GQMA 3NZNA 1A6QA 2KP6A 4KX4A 3IRAA 1T6SA 2LTPA 3LJRA 2PU9C 1GVDA 3FF5A 1R4MB 2HYGD 1PYVA 1X58A 3HEFA 4YELA 4KNYA 2QENA 2FBHA 5FB2A 3K4KA 1VQOI 1Y56A 2Y0SA 5B1BH 2ZNMA 4AWXB 5D4SA 4LLNA 2PG4A 2BY3A 2TDXA 3PFIA 1JJ6C 2HE3A 2OD5A 1Z3YA 1B4PA 1N25A 1GSUA 4DSSB 1POGA 1ZR2A 3F8BA 1ODDA 4BDZA 5FKOA 2A05A 3I58A 4OCEA 4OD7A 5GAND 1XW5A 4V2FA 2HNLA 4DGWB 2JSYA 1EV7A 3HJMA 4MDCA 4E8HA 4B47A 2OBKA 4MH3A 4TRXA 1LDDA 2IP2A 2GLOA 1I1SA 4LD5A 1P9QC 1HC8A 3VI5A 5GP9A 2VLAA 3N97A 1FP1D 2P4WA 3E0UA 1S72I 1LBKA 2EZKA 4E7HA 2OTLI 4KF9A 4WXTA 1J2XA 1USTA 4F0CA 5F0FA 3F3XA 2K4BA 3AG3H 3GKNA 1LUJB 4FHTA 3PL8A 1ZYNA 5DCMB 3DEUA 3JSOA 1GXPA 1J7KA 1YOVB 2EFQA 3DBLB 3GTJJ 1PKZA 2HKOA 3JRCA 1SYRA 3MAJA 3OS2A 3S3MA 4IBPA 2Y9ZA 4RGUA 4N0VA 5BRTA 3NAUA 3JRAA 3EINA 5HR3A 4ZH4F 2R0PA 2DTRA 2GOMA 3SEQA 3BBYA 3ERGA 4WKWA 1J75A 1SVMA 5FFZA 4EV0A 2R7QA 2XRNA 3KZIC 2NPBA 4IGJA 4TR0A 3LQRA 1TRWA 4LMVA 3H9JA 2VQCA 1I50J 4LK0F 3SZGA 2JQ7A 1IRGA 2GT5A 1JKRC 3T1BA 5D5WB 3PUFA 4HNVA 5JFRA 1VFCA 1FHEA 3CCVI 3J80Z 3H5AA 2QQAA 5HDKA 2DMLA 4TR4A 3GZ6A 2BW3B 1V5GA 4NAXA 4HPQA 5AN1A 3GXOA 4CXFA 1B9YC 2H75A 3GMEA 3H3VK 1ERVA 2CT6A 1Z6TA 2EFNA 3LNQA 2BGCA 3DRNA 2LJAA 2H1KA 2VM1A 1YW8A 1TK8B 3L2VA 4D5CA 1HW1A 4HI7A 2V7FA 2LRTA 2JSPA 3LFLA 3U2RA 3MZYA 1IXSB 1PDNC 2M0CA 4NC6A 1SD9A 1D8JA 4XIHA 3ZLPA 2HRFA 4CCNA 3MCZA 4CCOA 2YWMA 4F7ZA 1GSSA 3K7AJ 3MKLA 4RLFA 2FF4A 3JAMZ 3QPSA 1JLWA 5DV5A 2ZCTA 3PR8A 2VI6A 4RQRA 4R8HA 4Q4ZF 2QSGX 5HDNA 4KYWA 1GP1A 2DJ2A 1ZH5A 1A2MA 2E1NA 3S2WA 4WR4A 4OFMA 4D73A 5ICEA 2DOAA 4G7OF 1XWCA 4BXXJ 5TGTA 1BIAA 2DFHA 3VPRA 1S9HA 3E6BA 3KP7A 2H1GA 2DFFA 1R49A 1PP7U 3GSSA 2X4HA 2W57A 3JRHA 2H8LA 3TJJA 4CYDA 5AIVA 1A0RP 3WYWA 5ECMB 1B6AA 2RM5A 1S3JA 3NQOA 2VCQA 3HHVA 3VSLA 1G6YA 3K4LA 5J9BA 4R79A 2KMUA 2E2HJ 1ON2A 3X2QH 2GZWA 2L7FP 2NNYA 4ZL7A 5DQSA 4Y7NJ 3GMFA 4PQ1A 5D4RA 2QA2A 2LH9A 4OMVA 2VBYA 1TWCJ 1FB6A 3KEQA 2RNGA 5DD8A 3U9GA 1VQ8I 2CG4A 4N0BA 4O5RA 3FK7A 3K4BA 2C0DA 1ZLKA 3CP8A 3DFGA 4MK3A 2QKLB 4F52A 2UV1A 2QA4I 1U78A 4PQHA 4TXOA 5DUIA 1MMSA 3H36A 1BI0A 1OCRH 2V41A 4BL7B 3M9AA 2NS0A 1QHGA 1WQ2A 4MIMA 2PFBA 2VE9A 2IL3A 4KFCA 3LAJA 2HZTA 4KIBA 4TN8A 4G9HA 22GSA 5J5NA 3J80K 3KZQA 2YU3A 3CCMI 3ZFLA 4DSRA 3A0BC 1R26A 4A0ZA 3KYDB 1UAAA 1VQ9I 2QF7A 1HW2A 3SFZA 1FP2A 13GSA 1TWFJ 3ZCOA 2L7KA 3EWLA 1MDKA 3IC4A 3ZVJA 3RKXA 2IFQA 3O3KA 1NH3A 2ZSIB 2RUEA 3LL7A 1TOFA 1XW6A 4V2NA 3WTSC 4GDFA 2GGTA 4AJ6A 1OFCX 1A36A 1LE8A 2GLRA 2PJPA 3O8HA 3JAMK 2LKPA 3W2WA 4AIDA 3IV5A 4N30A 5EDNA 2ZJQF 3EPTA 5C04A 3HOSA 1OPCA 3VWWA 3F9KA 1VQ7I 3GX0A 2K5CA 4CO8A 2STTA 2BZTA 5A5KA 3CMYA 4FE7A 5IMCA 1ABAA 2JJ7A 2CSOA 3M1EA 5IQYA 3UAPA 3MN2A 3W8SA 1D8KA 2XBQA 3G1MA 2EZHA 4S05A 3QU6A 3SJMA 3GTQJ 3CXGA 3FK6A 3EVIA 2FLSA 1LFBA 3BOQA 4MJBA 1P4WA 1BI3A 3EUAA 2G9WA 2F5EA 1T95A 1FVJA 5AGYA 4CCJA 2A6TA 2IA1A 2L4QA 3PSIA 2H0GA 2X0LA 4P5OA 3LA7A 4GO1A 1XDUA 2FMYA 2HTJA 2ZMEA 2AQFA 4IPAA 1QK8A 1SJIA 1TNSA 4Z2UA 1XG8A 4HSRA 4EGYA 2QBYB 1I3AA 2VL9A 4IHTA 3H35A 1TC3C 3G2BA 2V9KA 3OL4A 3F22A 2IS6A 2OADA 4OO5A 1HSTA 1QMVA 1Z6NA 1LDKB 1FSEA 2H1LA 2VJIA 4I98B 4YRVA 2L01A 2XGCA 3JRDA 2V1XA 2XAQA 1K6OA 3A2WA 4KNDA 3RHBA 2XPUA 5HFIA 1VZ0A 2V6EA 3HJEA 3CF2A 4RGRA 5E1XA 3GUDA 3HKZN 2G0FA 3EURA 4L5EA 5IT3A 2ES7A 4ML6A 4MO7A 2BTOT 3H1CA 4LLLA 2DJJA 1EV9A 2PLYA 3P7NA 4U7DA 3WT2A 5E79C 4ZBAA 3A01A 3ZQCA 4OCFA 2XB0X 2VC0A 4KDYA 4LMYA 1UHMA 2VOPA 4Q5NA 4DW6A 3EYYA 3OYKA 2B3SA 2G0EA 1XS9A 2DSAA 3HSEA 4XLAA 1VQNI 3BG6A 1KA8A 1GTAA 3O2PE 2FA8A 1GNWA 2M46A 3RAZA 2ZBKA 1Z6RA 3KETA 2HQRA 5HODA 4OIOF 1G6NA 2GWRA 3MKWB 2XUBA 1EOHA 1LU4A 1QXHA 3HKRA 4K7NA 4I99C 2Z5UA 4XLCA 2G2QA 3I4NJ 5ABRA 3MZ8A 3H9GA 4UVBA 2E2GA 1F9NA 3OYIA 5HR1A 2P5VA 2JMWA 1S3CA 4AJ7A 3IH4A 2VCXA 2XPVA 3GTLJ 5DJMA 3JW4A 5D8KB 4ZILA 4XKCA 2KIQA 2Q2EB 4HX7A 3HJOA 2VJJA 4POBA 3BJAA 1BR4A 5J4YA 3Q9SA 5EG0B 4ESFA 1AU7A 4XKBA 1YI2I 2FD3A 2K9MA 2P8TA 3RZDJ 1IC8A 2GS3A 3ERWA 3C1SA 4ZL8A 5ID2A 2E7PA 4ITVA 4XKVA 1ACVA 3MVPA 2RREA 3CJRB 2Y31A 3HHGA 3F23A 2DA3A 1DU0A 5J8CA 4Q5SF 3M3YJ 3WGGA 5TRDA 3QOUA 1OC3A 5LGTA 2C3NA 1EP8A 1SAUA 1AKHB 2GA2A 2LSTA 1D0YA 4PK4A 3ZMUA 1B8IA 3TJBA 1FIPA 1XFLA 4PUFC 3TCOA 4LA1A 2VD1A 2VCZA 2W24A 4OFTA 2HLSA 4N0ZA 2LMDA 3IUOA 3H1NA 4BWQA 2K86A 1ON1A 1S6LA 2XDVA 3MD2A 4C3IJ 2JT1A 3HSFA 3WTTC 1B48A 1J9IA 1K3YA 2BY2A 2ALBA 4NWYA 3ABTA 1ZGNA 1NW2A 5FD5A 1NHYA 2VIMA 4MLYA 2JTVA 1M7TA 1Z9HA 1Y25A 2OBIA 4KT5C 4ZTJA 1TU8A 1U88A 4E7IA 4IKHA 4B4CA 2JA6J 3MQ0A 1O3SA 3ABMH 5H5SA 3J7YJ 1JTYA 2LRDA 4HUAA 2EZLA 4EXJA 2JL4A 4ZYDA 3HUGB 1OCPA 5L3CA 2JA5J 1M0UA 3DVXA 3L0HA 2WTEA 5AIPA 4RB3C 11GSA 3MMYB 3FISA 3V8JA 3V1WA 2JACA 2PX9A 3JTHA 5JHUA 3DXBA 1D5YA 3P90A 2W00A 2QM3A 4BPYA 3QFBC 4P9FA 3ELKA 1ACIA 5DCGA 1FMWA 4GCVA 3VPQA 2Z33A 2N5FA 1F4KA 2GQKA 4PFOA 2ON5A 2HS5A 3WU0A 1YZXA 2LBFB 3KTLA 5BNGA 2HI3A 4MH2A 1BQ7A 1HOMA 4A69C 4I01A 4UNOA 1GSDA 2I4AA 3GCMA 4XBFA 2CFOA 2CVKA 3AG1H 3DYRA 3GLLA 5DM6F 1XGOA 3LSRA 1MSFC 2IRFG 4V1Ag 2LK2A 4IOAF 5ECKB 5KHDA 4KT6A 5CVJA 3OYFA 3CF5F 1HNBA 3SQNA 2DC5A 2B9SA 4DQ2A 2KIFA 2LKUA 4K1FA 4YFKF 2VLVA 2M30A 4JP0A 3CUQC 2LR8A 2LY2A 4FETA 1HKTA 2I3YA 3HGGA 2Y0MA 3IK9A 4KAEA 3RTRA 3D1NI 4CUGA 4LJZF 2HEOA 2V1MA 2CAIA 2BW3A 3ECHA 3NOFA 4KA0A 4EIQA 4J01A 1SKSB 1HQCA 3D4TA 1I5ZA 2JZSA 2OE3A 2Y0SN 2MH2A 4YFNF 3CMAI 3C1DA 1GUMA 1TXXA 2IXSA 2WB9A 1KYWA 3D6IA 2BY1A 5IY5H 4A5NA 3ZRDA 2IMDA 3RSNA 4O6JA 4XLPF 1O85A 2YNXA 4OO4A 5D9WA 3TDGA 4JBBA 1OJLA 3GFJA 3WE2A 1XSXA 2GSQA 2LV3A 1FBQA 2MMNA 1H75A 5CVVA 2A2PA 3FXRA 1WJDA 3GKKA 3FXMA 3QU3A 4N9IA 3A5IA 2H74A 1BL0A 4Y17A 3KCCA 4IO9F 5EEAA 5E8GA 4RA2A 3DXJF 4O5VA 3HG9A 1BW6A 1LVKA 2HT9A 4CCKA 2C0FA 4CH7A 9ANTA 2E2MA 5CNWA 1CQGA 1QZEA 1UZCA 1YIJI 4HZ4A 4EIPA 3KP5A 4GGGA 5E8IA 1XW9A 1K0BA 1FOHA 5D8IA 1TQMA 4LFUA 2PGTA 3VYRB 1G59A 3US3A 2HYFA 2O8XA 5KNLA 3IR4A 4GXOA 5G30A 1EGOA 4Z2RA 4ZB9A 1XPXA 3KYLA 2X9DA 2KJCA 1VGLA 1IXCA 4GF0A 3LSPA 2WBMA 4R1HA 3AL0B 5ECRB 5F64A 4AIHA 2IA0A 2PVOC 1BJAA 1N8JA 4HJ2A 2MYGA 2JU5A 1RUNA 5HLGA 2V2GA 1S7AA 2ZC2A 4RAYA 5TJJA 3W3CA 5J9CA 3QWLA 3TO9A 4BL7A 3LYPA 5D96A 4N4OB 2XPWA 3BC8A 4XLFA 4KCEA 4I2UA 1K0MA 1THOA 2HXIA 4XL9A 2K9FA 3L2RA 1JUSA 1ONVA 3ZMTA 1K6YA 4OIQF 2X8CA 5B66C 1F43A 3MWHA 2V26A 1XWAA 2Z2SB 2HDWA 4WXHA 3PO3J 1YG2A 1NK2P 1GDTA 1VQMI 1APLC 2QGVA 1N78A 2ZFWA 3KYCB 4AC0A 1X5EA 3K8NA 4HU9A 3PQJA 5E17F 1ZYRF 3CZ6A 3DF8A 1HBXG 2HRAA 3VWVA 4PJMA 5IIZA 1HDPA 4YAVA 2CX3A 4ZBDA 5GAPD 1K4SA 5D9TA 2ZKZA 2K9NA 4ZB8A 1O8XA 2E60A 2A5WA 2KDZA 3FXQA 1FOWA 3RJPA 2MZCA 4CZZA 4BJ6C 2GM4A 2YZUA 5KCMA 1Z05A 2ELKA 2DKIA 1PN9A 4M3EA 3JR9A 5F06A 2M9HA 3SEZA 1G3YA 3HGYA 1JT6A 2XF6A 5KK1A 4AGSA 2E5ZA 1XMAA 4YH2A 1TT5B 4UV9A 3F3RA 2B1KA 2MLGA 4XONA 3IHGA 1QU3A 4PZJA 3HA9A 3UIWA 4AYBA 3HZ4A 1JE8A 4OFNA 3ZQQA 1H9GA 5LFAA 2C80A 3TKRA 3LG6A 4U88A 3ED3A 2JN6A 3OYEA 2H0IA 3QCPA 3J7AO 1W0UA 2E19A 2OJED 3CCUI 1Z3EA 2FY6A 2ECCA 4M74A 2V4JC 2KFDA 5EL8A 4L0ZB 2LVSA 1F36A 2XAFA 3W2AA 1R1VA 3VPTA 3ZR8X 1TW2A 2E1MC 5IYDJ 1F3BA 4F3QA 2BHZA 3TOTA 3KP8A 5HOOA 2PN8A 2I10A 1OKDA 5IPGA 1KU2A 4MEXF 5CRGA 2GZZA 5LHGA 4XN0A 2ZSHB 3JRFA 1LB2A 4D5FA 1B9NA 1M2BA 1LJRA 1BAYA 2CJJA 3I59B 2H01A 2R3SA 1JHHA 1UHSA 2HZDA 2E36A 3M7GA 1QGVA 4PTSA 4G19A 1GUUA 5DAKA 2XHFA 4B3XA 1HNAA 3UR3C 1AQVA 2LF7A 3ESWB 4KDUA 3BR0A 4AIKA 4KE3A 4XRDA 1B4QA 1SFEA 3QFAC 2GSTA 2VPLA 3G7YA 3ZP5A 2QKEA 3FXOA 1V5EA 2R4GA 5E3OA 4KH7A 3ZOBA 2M1BA 1H4OA 2CZ3A 3G4SI 1REPC 3ML6A 1V40A 3C1RA 1OR7C 3LAPA 4NUBA 2VBZA 4DJAA 3CTFA 3KD0A 2R7RA 4BXFA 3HZ8A 5DDLA 2DPDA 1W1WE 2GBYA 1HF0A 3BCKA 4A3FJ 2X8GA 2XHKA 4ZTFA 3E3VA 3HXSA 2XPDA 2XF7A 1Z7LA 3BQYA 3F6DA 2COMA 2OA4A 2DQLA 2Z3YA 3CCRI 3WTYC 1JZDA 1UMQA 4B1RA 2H1BA 1RPWA 4UV8A 2ZJ2A 1PL2A 3H5NA 4AJ8A 3LWFA 4XOTA 3R60A 4BAYA 4DNCA 1IGNA 2LRNA 1ZRCA 2MABA 4YKFA 1RUOA 2CW0F 4RGSA 3QOEA 3BP8A 2QSIA 1MBKA 3VEPA 1BEDA 1BG5A 3WGHA 5EG0A 3E3EA 1HLVA 2WC2A 3CLOA 3HKZA 1LFUP 2R0GA 3TDUC 1ZTRA 2JRTA 2WCIA 2ACJA 1R6RA 1RZ4A 4CYCA 2HPMA 4G7HF 4PJNA 2M5WA 3VWBA 4NV2A 1B9XC 2VQLA 1MSEC 4FO5A 4YFXF 3TL4X 2FQ3A 1YEXA 2A4VA 3M8JA 1UELB 2CUJA 2WFCA 3K10A 3RKQA 2RIIA 1LE8B 1DGRM 4TV7A 3ZXSA 4PFPA 4XIDA 2ME0A 4KDPA 3F9UA 1BA5A 4W1UA 5ECHB 1RNLA 3GHAA 4RAZA 2DJ3A 2CUFA 3J7Yk 4LLGF 2IGNA 1EEJA 2EIQA 3FXUA 2F4OB 3OYGA 2L6DA 4USSA 2Z99A 1TLHB 5CRDA 4BQAA 4RAFA 3KPHA 2F8FA 5L3EA 3BG7A 3OYLA 4AD9A 3RKYA 5FRNA 1NSWA 2CV2A 3VK9A 5CP1A 3KGKA 1ZG5A 1HA8A 4YG2F 3FK8A 4ECCA 5K7FA 3QP5A 3GYKA 1YHQI 1T0FA 4ZB6A 5CLSA 1YLFA 5FKKA 2RKHA 1TWGJ 1YX3A 3H8QA 1TK0B 4AF2A 5DDGA 4LB6B 4FASD 1WI9A 3QMXA 2V1DA 1QPIA 3QP6A 4UY8I 1R5GA 2A68F 2FXAA 3CDHA 3ONQA 5ERIA 1BYEA 2M4KA 2C4JA 2VT2A 2A61A 2EWNA 1TNTA 4L5JA 1F3AA 2DFEA 3RQIA 3DBRB 3TP3A 1FYLA 1XGMA 1UFMA 4LGWA 1O7LA 2R6KA 3IA1A 2AXTC 2EFOA 3GVAA 1YW9A 4HDEA 3I64A 4B44A 5ECIB 1Y1VJ 1W5TA 4YIFA 4V19K 1MBEA 3PNYA 4BHBA 2GIZA 2WY8Q 2WV1A 3MEXA 3OYBA 2FJ1A 3M0FA 3VDXA 3V7SA 1ERWA 2XSJC 2XAGA 4A3KJ 5IMVA 4BHCA 3FMWA 4E7JA 3NIVA 2PQ8A 3HHHA 1ZARA 1SD7A 3A01B 2KOKA 3HM5A 1E6BA 1LEAA 3MSZA 4MF5A 2DI3A 3TKSC 4EDYA 1DE2A 3FKFA 1GULA 2EBIA 2FA5A 1JZRA 5G1KA 4L9JA 5C4JJ 1OC8A 3EUHC 2BXZA 1OYJA 4E7ZA 2VASA 3LXZA 2V1UA 2VUMJ 4IVFA 4JE1A 1V58A 4L8EA 1X9SB 2XRLA 1J0FA 2ADUA 3KMOA 3FY7A 3BOAA 4KSMA 4POMA 2EA2A 2HI7A 2M4GA 5FO5A 3HDDA 1VF4A 2ME6A 2OBPA 3DP7A 2FWGA 1ZK8A 2F5VA 2HXOA 4POLA 1UJ8A 3A03A 3F0CA 2LKSA 3H3ZA 1VQLI 3Q0VA 2RN7A 1HD2A 4G0IA 2MD0A 5ECLB 3TO7A 3A1YA 2B63J 2R0CA 2E7WA 5LHHA 1O7UA 4F92B 3ME8A 3GL5A 1Z9CA 3S1MJ 4IRHA 4I02A 4C3HJ 2RM6A 5K7HA 3M4OJ 1HYUA 4Y3OA 4EJTA 1U9NA 1ZLJA 4O3MA 1IN4A 1BX9A 4HZFA 1YY7A 1IRXA 4ZYGA 5D6EA 2P5LC 1X3UA 3TGZA 4GYIA 1WRYA 2CYYA 2ZCWA 4BQOA 1RI7A 1ZQ3P 4Z7XA 5E59A 2VBWA 2F5CA 3UVTA 3TW7A 5CVUA 4U87A 5IPAA 1T3BA 2VJ5A 4ZZLA 2WADA 2M8GX 2DMNA 5IOWA 4ON0A 2XC7A 4RLQA 3EDPA 2GAUA 3W6JB 3E9JB 1R5AA 1Z5YE 4K2DA 2HWVA 1JGSA 3NEUA 4EJVA 5IOZA 1A2LA 3H79A 3WHCA 2JVHA 3K1NA 4CGZA 1GSYA 3W8JA 3A2VA 3RBTA 5J40A 1H88C 5G5FA 3HPHA 1Z1DA 3WTVC 2ZJPF 2FHEA 7GSSA 4J00A 1O8WA 2K85A 3IC7A 1SL2B 1MMDA 1ZAOA 4B3AA 1SK1A 3CMIA 3GIXA 1V5FA 4OINF 3C3WA 1EH7A 4M9ZA 2DA1A 5CO3A 4LG3A 4EJUA 4U7BA 1R71A 1V4RA 2DMPA 3CQZJ 5J1RA 6GSUA 2ISZA 2K9QA 3K4NA 5GPAA 3IPZA 4I6ZA 4TVEA 5ECSA 3JCML 3P5JA 1MGTA 2E0QA 4EJWA 3GFKA 3TUEA 2MC3A 3MAKA 4KUNA 2VIXA 2V79A 3OV8A 4HA8A 2HPIA 5BS6A 1D1AA 3HXLA 1WJ5A 3DKWA 4FTHA 5HNFA 4IX7A 4IHWA 1WOUA 1A04A 1ENHA 1E0EA 4HBLA 3SBCA 4HQEA 2NBSA 2J9HA 3HOVJ 3LSHA 1DP7P 1Y0NA 4E70A 5KN2A 3S1RJ 1WZ2A 1U5TC 1ZGAA 4A3DJ 3CSHA 1UN2A 1P4XA 1YS7A 3IH3A 4MTDA 2HOAA 2H8RA 3AG4H 3HJPA 2EIJH 3TJFA 5DUKA 1QGPA 3RKWA 2VONA 3SZPA 5LRRA 1WHUA 3HYIA 2M72A 3AKZA 5HR0A 2EQRA 1ZOFA 2DAOA 4GLTA 4BBRJ 4ZBBA 2XBIA 4K2XA 1IN8A 3WT1A 2FBKA 2A07F 2I81A 2XAJA 3PM1A 2AS5F 4KIFA 2WGRA 4L0WA 3BJ5A 2TRCP 3BT9A 2LYCA 2H72A 2H94A 5K1YA 2LNBA 2VPRA 2ECBA 3SHFA 1TQPA 2PBIA 4BUPA 3OYAA 2QKMB 2E2IJ 5KOWA 2Y75A 17GSA 4CZCA 1ZN2A 2X64A 4I5QA 4K7IA 3FHZA 4XLNF 4HAMA 5B6NA 3RYRA 3COAC 1F1ZA 1PP8F 2A2SA 1H89C 4PJLA 1J59A 4A3BJ 3DCFA 4LK1F 2LP0A 4ZXGA 4BEHB 1GTUA 4XRFA 5ENUA 5E3LA 3HRTA 1N2AA 2UZ8A 1DU6A 4IELA 3OR1C 5IMFA 3O76A 5LCZA 4LITA 1AHDP 2CUZA 4F91B 5J6XA 3C71A 3BY6A 5M5WJ 1E3HA 5DBQA 1OLTA 3ZYWA 2NS7A 4WCGA 3RCOA 3CCJI 2A5YB 2DMMA 1YJ6A 1KQ0A 5JLWA 2J5PA 2GZPA 3CUQA 2R2JA 4HLXA 5H2FC 3UNGC 2HOSA 4XQFA 1IYIA 2L57A 9GSSA 2R7VA 4EEFG 1KONA 3FWEA 3CC7I 2VOOA 2AV4A 2PI0A 2NTOA 4HOJA 3UJ1A 2R7XA 3BPVA 2YR2A 3I59A 4S0HB 5D8LB 1FVKA 1KBNA 1IN5A 1FOYA 3WTZA 4DZPA 1CF7B 4NC8A 1K0NA 4EDZA 4JBAA 4KMFA 4V1Ap 1USSA 3QPTA 3G73A 2OACA 2W84A 5ECNB 1IDZA 1CGPA 3Q19A 5G2ZA 3BTJA 5A2QZ 4BHPA 3HOTA 4BE2A 1XVWA 4JU5A 2GXAA 3HOWJ 3CYNA 4MMMA 5J4VA 2D2WA 1QUWA 1IUFA 1IV8A 5IP7J 4JOMA 3OL3A 4ETSA 4MGRA 1MDJA 2VAFA 3LSMA 4IJAA 4CHSA 2F9SA 5B6MA 2CH0A 1XVQA 3ERFA 5H6RA 3HVNA 3PINA 1PGTA 4AYBN 3KP9A 2ZNYA 4OAZA 3L78A 3IE3A 2TIRA 2YV9A 1Q1HA 4Y15A 1MNMC 1WJKA 5K5OA 4H86A 2XAUA 4JK1X 4IP1A 4WBJA 5IO2A 4FCYA 3UBKA 2H1DA 4A2UA 3PUBA 4WWCA 3L2QA 3HBLA 2C3QA 2K8VA 1PX7A 3QYEA 5FT3A 4CDGA 2H0HA 5K7ZA 1YYVA 1A8LA 1GT0C 1U3AA 5DCFA 2CVDA 2MMZA 2PJRB 2IW5A 3OYNA 5D5XB 1SENA 1G8XA 3EMXA 3BTCA 2GIVA 4XS1A 4BYYA 4UHTA 4HX8A 3L9UA 1AA7A 2JVGA 3BR1A 2HDDA 4DEJA 2CQXA 2ZUPA 2W1OA 5D9XA 1XG1A 1ZGJA 2HFHA 4TXVA 3TRPA 4CSWA 3HRUA 1XSDA 1TZLA 1GSFA 1VTNC 2QSHX 1SD5A 4DYQA 3BTLA 3KE2A 5D5UB 3BR5A 5GAHJ 1FB0A 4KCAA 5KN1A 3LSIA 2KJBA 1T4YA 4E7KA 3ISPA 2DDBA 1OKRA 2H6YA 3WU1B 2AYTA 2OE0A 3FW2A 4EATA 2HRKA 3ABUA 1M2AA 3NARA 1LEBA 1W89A 1GUKA 1OVNA 3ZGKA 3VB2A 5HS8A 4KJZA 2O5RA 3LSJA 4G9YA 5A2QK 4V2LA 2VL2C 4MABA 1UC7A 1SEUA 1GTBA 4GQCA 1TBXA 1X1CA 2DYRH 3WG7H 2IJYA 4AM3A 3IBHA 1Y39A 2WA0A 5IPHA 2VL8A 5ILUA 4JX4A 2UWMA 2I9HA 3HYPA 2A6HF 5DCHA 4WF5A 2CFXA 3CJNA 3GTGJ 1A23A 5KOXA 2QGUA 2GXBA 1O73A 1XWBA 4BY7J 1O6JA 4A5MA 1YF0A 2ESNA 4LMWA 1SFKA 2O61A 5HQPA 1DUXC 3CO7C 1U3EM 3CRTA 3VWXA 5CJ9A 4RBOA 4YIRX 1EH6A 2W82A 1OCTC 1LNWA 2HSMA 5DAKB 2V6KA 1G3SA 4Q5QA 2AHQA 2L2OA 4G0LA 2OJLA 3QDNA 3ECOA 2DA5A 1ITYA 3KP3A 4XRSA 1F2EA 1OYYA 3I4MJ 4FYUA 2XGXA 2FMLA 2CRGA 1WPIA 3APQA 4MFEA 2B7KA 1P4AA 4MA9A 3VSKA 1BR1A 1QPMA 1RQMA 1X1PA 3BD2A 3GTMJ 2KRHA 1J0RA 2E5NA 2L7ZA 2J23A 2OUMA 4KSOA 3WD6A 1Z67A 2ISYA 3C2HA 1RIOH 2L3DA 1FSHA 1ETYA 1T8EB 1S5LC 4OOIA 4B09A 3HPGA 1VNDA 5H5RA 2P81A 1H9TA 4F2IA 19GSA 2O87A 3DEWA 3KMNA 3OIOA 3LGCA 2MA3A 4HJMA 1MD0A 5GTIC 2FRHA 2B5XA 1KU3A 4QQ7A 1OQYA 4ESJA 3LEFA 1U8BA 1GRXA 4BE1A 3ZMKA 1ON4A 1JTXA 5GSTA 2K3PA 3CDLA 1ZCPA 2XKPA 3PFYA 5IP6A 4O32A 1PX6A 2CQQA 3CCYA 3LSZA 4FYCA 1KQ9A 1R22A 5B3SH 1ZHFA 4PUAA 2GDRA 4CYCB 1YW7A 5F0CA 5GAEJ 4L0YB 5FWGA 2R7WA 3J7Yb 4Q5FA 3WGDA 2ETHA 1PQNA 1THXA 4GCIA 4K5RA 3VLNA 4BJTA 5KEJA 2IS1A 2W85A 1TU7A 2HNHA 1GH2A 2H09A 4XLEA 3P7XA 1Y1WJ 2B7EA 2HXKA 2NVTJ 3FXLA 3FHKA 4ECIA 1SFXA 1SD4A 2ZO4A 3QPHA 3HIFA 3O6BB 1WSUA 5ECOB 4HDVA 5ECQB 2H27A 4ML1A 2XGEA 4BDYA 1MMGA 2PVQA 1X3ZB 2MC4A 3LSGA 4BE0A 2NXNB 4ENMA 2GSRA 4OAYA 3IK7A 4I6XA 4WF4A 1QRYA 3H92A 5JVTA 3BG3A 3V42A 2NRAC 4O7HA 2CQKA 1O3RA 2JRMA 5G1LA 3LSKA 3WHBA 4A3LJ 1M99A 5HR2A 4BKXA 1VF1A 2DMTA 1GLNA 1XGSA 2DBBA 3RZOJ 2M80A 1LKXA 3W2VA 2ZXWH 2PUKC 2Z9SA 4K7OA 2ZXIA 1K3OA 2W4SA 2P5KA 1STZA 3OYJA 3GFMA 1YRNB 3ZPLA 3BROA 4A0XA 5E20A 1OC9A 1GNEA 4PNFA 2X1DA 4NMUA 1Y6EA 1AQXA 4EE0A 2A4HA 3ROUA 4F03A 3KCMA 2NVQJ 2V9PA 2HVSA 1EA3A 4FQGA 5CPRB 3FBNB 3ZQFA 2HSHA 2BEOA 1UVZA 2FSWA 4M9XA 2OCEA 4PJJA 5HLIA 5ICGA 3H9QA 3GX4X 1IAWA 1EZKA 4MZBA 4IRIA 2DK8A 2JZTA 5D93A 1KTEA 2N5BA 1K0OA 2DU9A 4MTEA 2O8KA 3UL3A 3EMPA 4BIKA 2YJHA 2EV0A 2OZUA 4D0PA 3JSPA 2R7SA 3C2BA 2B1LA 2AUVA 2RUFA 1OISA 2QVOA 1T39A 2FX0A 2OZ6A 3ABLH 3FXJA 4ENNA 2DOEA 4HF1A 2NOJB 3P8WA 3PSFA 4B43A 2YZHA 2EJRA 3F6OA 3D0ZA 4PGHA 2IA2A 2XSDC 3MYDA 4YEJA 5HVQC 5LEJA 2LQQA 5CREA 5F8BA 3U5RE 1UCRA 2JA2A 4ENKA 4D1QA 3BTIA 1IO2A 2C3TA 1EJ9A 3E5QA 4A3JJ 3LFUA 2H8WA 4BEHA 4AVPA 2KISA 3KJYA 3TKSA 3DU5A 2HRNA 1X9WB 4S04A 4XK4A 1U3IA 1XWGA 3TDZC 1K0AA 3DU6A 3GTKJ 3FKJA 2IS2A 2JSCA 2NYXA 1GWCA 3P9KA 1RK4A 1ST9A 4EGZA 2H70A 4NC7A 1Z21A 4ZYAA 4CY8A 4MQVA 2CQ9A 2LS5A 1DUGA 2FUG2 4FE4A 3W6KB 3ZMDA 2FNOA 1WWJA 4JQFA 4NHZA 5LD2C 1KU9A 3CC4I 3KIJA 2K4JA 3LYKA 4FIWA 4BWSA 2VODA 5FLMJ 3CSIA 2JWTA 3GBGA 3L2CA 2YX7A 4MFDA 3CMEI 2EC4A 4NNJA 1S3DA 1CF7A 1G3TA 1W5SA 3V7RA 2Q8KA 4D9JA 2IGMA 4QL9A 4N9HA 1S29A 2HR3A 3WTWC 2WZ9A 4X0GA 4FQUA 5J47A 1PRXA 1LVAA 3DPLC 5C00A 3K69A 4K0GA 3V7CA 3KH9A 2JADA 2KUCA 1WH7A 4II3A 3SYTA 4ASNA 1FY7A 5IMDA 5KN0A 1H8AC 1UG0A 3IC8A 4B48A 3ZQGA 1SANA 3C7JA 4MF6A 2DOFA 1VF9A 1WPKA 2L0KA 3FZ4A 1KYZA 5IM9A 3JREA 1J08A 1Z77A 3TKSE 4RI6A 2NAZA 1K78B 1Y0UA 5LGUA 2A69F 2FWEA 3T8TA 3H0DA 4AUXA 2CV4A 3Q3SA 4CHUA 4NHWA 4BS9A 2OCCH 1BJZA 5L3BA 2HYXA 1XD7A 2X6YA 3E7LA 4A3EJ 5FD6A 3HTSB 3SWLA 2YUSA 3S32A 2QYOA 2YPRA 4DBRA 1JXSA 5CYYA 1C0WA 5GPCA 1U0JA 2A3SA 4P1WA 1RW1A 2XIGA 3T5XA 4A3MJ 4HF2A 3RPNA 4KW6A 4K6XA 5K5QA 3HDCA 2PJRA 1FO5A 3L00A 2K40A 3KEYA 4G6DA 5M5XJ 1VQPI 2WDUA 3GUSA 4V2MA 5C3EJ 3ZITA 1QVTA 2HVQA 2LG4A 2ZXJA 3S8PA 5EPFA 1ZG3A 1BI2A 2JPCA 1MBHA 3QOPA 3ME7A 5LLQA 5FLXK 3K2AA 3DD3A 1ML6A 3FR6A 1ETKA 1BJXA 1E3OC 2F5DA 1XXUA 4X4JA 5F08A 3DLAA 4OWYA 5LEKA 5GAGJ 3BZKA 1AIUA 3DKYA 4EUYA 2H6ZA
chains in the Genus database with same CATH topology
2CW8A 2MFZA 3R2QA 3UMAA 1K3LA 5D9VA 3F63A 3KTBA 14GSA 3DPTA 3UBLA 2LC2A 1ERTA 3HVVA 1EV4A 3L2UA 4DBQA 4IQAA 2DJKA 1X1BA 1X19A 4X43A 3APOA 3LXTA 1D0XA 1WIKA 1ZYEA 2LY1A 4YAPA 4TR1B 1GLQA 1E2YA 2CAQA 1AC1A 2IMIA 4HNUA 3IP4B 3GRXA 1A0FA 4MLOA 1WJEA 4ID0A 2R4VA 2C8UA 1X1AA 3VFIA 4DOZA 3U6VA 2WAEA 2VQGA 2WJUA 2R7TA 4POKA 1JZOA 5LD0A 1WMJA 2R37A 3CRUA 4O92A 3FRCA 3HL2A 2GVPA 4ECJA 2DT7B 2LUSA 2KDOA 1FG4A 2YWOA 1C72A 1TJDA 3CTGA 4LLRA 4XTSA 1ZL9A 4Y4RA 3G7JA 4ZL9A 3TB2A 2X8HA 3RHCA 3ZTLA 3PNTA 4E8EA 3FR9A 4JR4A 1A8YA 2IMKA 1O81A 1PMTA 3SDBA 2PMTA 1BOBA 3F6FA 2A2RA 4F03A 2B6MA 1W36C 1KNGA 2LREA 3F4TA 4GQFA 3TRQA 4O5UA 5F05A 5CRWA 3HVSA 2KLOA 1MNEA 3RPPA 4MJCA 3KX2A 2ZXHA 5HNHA 3KH7A 4I97A 1SKRB 3EUKL 2CV0A 1XOAA 3R3EA 4TOPA 3I43A 4HG2A 2DJIA 1YKAA 3D21A 4ISDA 3FDYA 1JZWA 3MKYB 3F8UA 4KB3A 2VXZA 3DPUA 2H1AA 1GUHA 1V9WA 4C2TA 5L71A 1JFUA 5CAXA 4GSSA 4FH8A 1ZYQB 1S3AA 2Z16A 4BU2A 3A2KA 3O6TA 3QR6A 1PJRA 1JLVA 4RUVA 18GSA 4WETA 1MD4A 2VKDA 3PJRA 4ECBA 4Q5RA 1G6WA 1X9MB 2VL2A 3ZMLA 4GTUA 1G7OA 4JRRA 2L5QA 4ULXA 2E1MB 5KN3A 4RM3A 3DMLA 4PXOA 2YV7A 2B5EA 2IWTA 5G31A 5CQEA 1W36D 3TJGA 2F6CA 2GOXB 3G9BA 2KRCA 3ISOA 4IKFA 5HLTA 3FZAA 3IV4A 1U6TA 2BVLA 3CP2A 5F0GA 20GSA 5E4WA 4J57E 3HCZA 3OIPA 4F93B 3N5OA 4J2FA 1V57A 2C0EA 3S93A 4C30A 3IAM2 1WE0A 3GKMA 5A4VA 6GSWA 4E4HA 4XS4A 3F4RA 2VLTA 2RLIA 4Z2TA 3S3NA 3DTEA 4MP4A 4PURA 2LRCA 1CQHA 4BVYA 3DKXA 3DTKA 3N05A 3VURA 4N11A 1X5DA