2FUG2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
b'FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase chain 1
publication title Structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 178
sequence length 178
chains with identical sequence B, K, T
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2fug201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fug202
2R4VA 4IGJA 3EVIA 1M2DA 3DMLA 2NPBA 5CO3A 5J41A 2Z9SA 3L9SA 3QD9A 1FOVA 1LBKA 4O7HA 4NMUA 2FY6A 3APOA 4H86A 5AIVA 2PUKC 2VCTA 2H1BA 2H76A 1X5DA 4MJCA 3L4NA 4LL1B 3D0ZA 2F3MA 1GTIA 1F3BA 3IR4A 4E8EA 2CVKA 1R26A 1A24A 4K6XA 4IJIA 4EKZA 4K7IA 1VF3A 4WR5A 2CAIA 5JWRB 1XW6A 3BBYA 3TKRA 3GSTA 5G30A 1Z7RA 4LLRA 2A2RA 3F4TA 5HR2A 3GRXA 4Q5RA 4GLTA 1AAZA 3D22A 2VM1A 3GA4A 2H8LA 5DQSA 3WYWA 2HT9A 1J08A 1GNEA 1THXA 1Z3EA 3D4MA 4KDUA 4O5RA 1TK8B 1UVZA 1TU8A 4IN0A 2HSYA 2GSQA 1ILOA 5ELGA 2PMTA 5F06A 5DJLA 3HVVA 2FUG2 5ECQB 1MDJA 4GXZA 1I5GA 2LQQA 4XS6A 2O85A 2WCIA 2RIIA 1EWXA 2RUEA 1XFLA 4MCUA 4WEYA 1TK0B 1TJDA 4BWQA 2HI7A 1YQ1A 4BL7A 2RM6A 1FHEA 2F8AA 1IYIA 3IK9A 3ZZXA 2CQ9A 1JHBA 1SU9A 3I69A 5COHA 3VWXA 4I2TA 2WFCA 3RPNA 4CHSA 1SK1A 2C80A 4WKWA 1TW9A 4FYBA 3ISOA 3LJRA 2CZ2A 3KIJA 17GSA 2BTOT 4JZQA 3KTBA 1A8LA 1S3DA 4BWSA 1OC8A 1SL2B 3QMXA 2I3YA 3VPTA 2NTOA 2WGRA 4KW6A 3KEBA 18GSA 5B6NA 3ZL5A 1GH2A 2LQOA 5AGYA 3ZRDA 1XPVA 3TRXA 3LFLA 4XIHA 2DMLA 3W6GA 5ID2A 3IV4A 2H1AA 3GX8A 1EEMA 5FT3A 2VLTA 1OE8A 1OC9A 1GWCA 4KNDA 2KHPA 2V1MA 4WF5A 1JLWA 3EINA 1E2YA 3FR9A 16GSA 3F9UA 1XVWA 2ZCTA 4G9HA 1XVQA 4KUNA 4PQHA 3GNJA 4DSRA 1DSBA 2HE3A 2TRCP 5G5FA 5DQYA 2NVLA 1QFNA 3W8JA 3EMXA 2EIRA 4NAXA 4K2DA 2FWFA 1SK0A 1EV9A 4MABA 4L5LA 1R4WA 5DDLA 3TCOA 3BD2A 5IPGA 5J9BA 5CRWA 3CRTA 3GSSA 2HYXA 4KDXA 4OFTA 5JCGA 4MZCA 3ZFLA 2YWOA 2LTKA 5JCWA 3UBLA 5A4VA 3AY8A 5J5NA 4EXJA 1JZWA 4ULXA 1Q4JA 2R6KA 5LNKe 1Z9HA 3GV1A 1M2BA 3G7IA 4FYUA 4N10A 3QCPA 3TGZA 1GLQA 1Z6NA 4V2NA 5D93A 3GKMA 3GHAA 1DE2A 2QGVA 4ECBA 1MTCA 2YWIA 4KCAA 4GRFA 5A4WA 2GQLA 1HNCA 5ECNB 5ABRA 2H6YA 3UIWA 2OE0A 2VLUA 4KB3A 4RQXA 1OKDA 1O73A 1VF4A 3C73A 2VCQA 2FA8A 4QL7A 1K3OA 2LS5A 3F63A 5INYA 1N2AA 4GF0A 3KD0A 1ZYEA 2IL3A 5IMVA 3GTUA 3ZITA 2GS3A 1Y6EA 1FAAA 5DJMA 2CVBA 1GTUA 5HQPA 3ZMLA 2F51A 2QSIA 4TXOA 2VCZA 4L0WA 1M9BA 3GL3A 4POMA 2J9HA 1CQGA 1SK2A 1ZGNA 3KCMA 1X9SB 1A0FA 2C0FA 3M0FA 3HVXA 2C0EA 1K0NA 2H01A 2OE3A 3TJJA 4XS1A 3U6VA 1K3YA 3O6TA 5IOWA 1Z5YE 1SKRB 3GFKA 4DSQA 4DSSB 3ERWA 2KP1A 4OD7A 6GSYA 2AYTA 3GH6A 3HXSA 2CV4A 3VWWA 2OBKA 2XBQA 1GSDA 1V58A 2P31A 1G6WA 2LRTA 4XS4A 5AN1A 2C4JA 2J23A 1NM3A 3IBHA 3HKRA 1TTZA 2V32A 1AQWA 4YAPA 1F9MA 2L4QA 2VUPA 5J9CA 1TP9A 5EL8A 3GMFA 1TRSA 1TK5B 1B4QA 2GDRA 5HR1A 2FCHA 3GURA 3WD6A 3F0IA 2DJ3A 4IBPA 5GSSA 4HJ2A 1OYJA 4RUVA 1UA5A 2FA4A 3CBUA 1OVNA 2B5EA 5LD0A 4I6XA 3FY7A 5H5QA 1ACVA 2V6OA 4FIWA 1SYRA 2MZCA 4XTSA 4KDYA 4RI7A 2C3NA 2DJKA 3IRAA 1U6TA 2IFQA 2PGTA 1ERTA 2VCVA 1SENA 2GZPA 3KMNA 2GT5A 5ECIB 2B7KA 4XRAA 3VI5A 4XCSA 1OKTA 3M1GA 1RK4A 2DJJA 1XOBA 3M9JA 4TKYA 1U3IA 1AQVA 2L5LA 2ZUPA 4GCIA 3FRCA 3H1NA 1AUCA 2N5AA 3I9V2 4GQFA 3QDNA 4EF0A 5EVOA 1R5PA 2REMA 2XC2A 1K0MA 3QFAC 2K9FA 3ZYWA 4F2IA 3C1RA 5HFIA 1T4ZA 2WB9A 2E2GA 1TI3A 1K0AA 1Z6MA 5B7CA 2IMIA 1QK8A 2YJ7A 1VGLA 1BX9A 5E59A 5DALA 1SKSB 4Q5FA 3ZTLA 3GX0A 4V1Ag 4J57E 1SD9A 4TR4A 3M9KA 1GTBA 2GZZA 2HRFA 3O76A 2VLVA 3L9VA 1YZXA 5H5RA 2H0GA 5DAKA 2HXKA 2G0FA 4AF2A 4HZ2A 4MPFA 1AC1A 1YY7A 4OFMA 4MH3A 4POKA 4G2EA 1NSWA 1PA3A 3QAGA 3NOFA 4AJ8A 1XW5A 3MAKA 3HZ4A 1WMJA 4WF4A 1QUWA 3KP8A 1V2AA 4V2MA 2L4CA 2L59A 3FKFA 5ECPB 2LEGA 7GSSA 3H93A 5IMDA 1DBYA 3FR3A 2HZEB 4FYCA 1A2MA 3ERFA 3DGQA 1XBSA 1A8YA 4ZL9A 3VK9A 1N8JA 1YF1A 2H0HA 1OC3A 2JACA 3FZ4A 1ABAA 3E9JB 4HEA2 1SJ6A 2LJRA 2O87A 5D9XA 1HYUA 2BJXA 5EPFA 1GSQA 3GH9A 1ZYQB 2MMNA 2H70A 3CXGA 1ML6A 2AJQB 14GSA 4TR1A 1M2AA 2JZRA 3EC3A 5F8BA 22GSA 3EMPA 4KAEA 1WRYA 3TKSA 4PGTA 1PD21 4MJEA 2D2ZA 1K3LA 4YAVA 2IMKA 4HUAA 2N5BA 4ILFA 2IJYA 5ECLB 5KN0A 5ECOB 2VOCA 1V40A 1NHYA 4TRXA 2PERA 1MDIA 4IHUA 4CW9A 2YWMA 2FLSA 1WJKA 1ZL9A 2QKEA 4EVMA 3BCIA 2B5YA 2QC7A 3UEMA 2LUSA 4HQZA 3LXZA 3D21A 1K0CA 9GSSA 3DVWA 3ED3A 10GSA 2XHFA 3UVHA 2M80A 4I5QA 3HJMA 1SJIA 1BJXA 5IMAA 2PWJA 3EURA 3S9FA 1SYXA 5DVBA 2LSTA 12GSA 4IQ1A 3U5RE 3ZLPA 5CRGA 2P0GA 4MJBA 1SD8A 5CNWA 20GSA 1GSYA 5G2ZA 2GT6A 2VL2C 3JCML 2BMXA 2GSTA 4YQUA 3EE2A 1FB6A 1HNAA 3UOMA 1BG5A 2F8FA 2VL3A 3TB2A 4F0BA 2KP2A 4Q5QA 4HI7A 4BA7A 4P3YB 4OMVA 3TKQA 2VD1A 4MDCA 1EGRA 3QOUA 3CMIA 3CSHA 3IXRA 2H71A 3RHCA 3ERGA 4JEDA 3Q18A 1LU4A 1SJZA 4EUYA 2V6KA 1T4YA 4PUAA 5ENUA 1BQ7A 2DBCA 4TR3A 8GSSA 3A3TA 4TR0A 1XWBA 4WR4A 3GUSA 4WXTA 4KGIA 1GL8A 2K6VA 3PH9A 3FHKA 3C8EA 1MD3A 4K0GA 3F8UA 1EOGA 1EEJA 4IELA 1EP8A 2XBIA 2DJ0A 1VRSD 1JZOA 1M99A 5LCZA 2O7KA 3RAZA 1KBNA 4AJ6A 4IP1A 2HSHA 3HJPA 3ZVJD 1GUMA 2DIYA 2YP6A 3HA9A 1R5AA 1PL1A 2CVDA 1AQXA 2X8HA 4NHZA 2AV4A 3TKSE 2B1KA 4IQAA 4ZB8A 4TXVA 4PNFA 3D4TA 13GSA 2AHEA 4ECJA 3KGKA 3A2WA 2A2SA 4MJAA 1XCCA 1GSUA 2C8UA 1SKWB 2VCXA 5IM9A 4OCFA 5D8IA 2JSYA 1FO5A 3VPQA 5ID2B 1V57A 5EY6A 1IYHA 2MMZA 1SL0B 3HD5A 5A4UA 5GAPD 3RDWA 3A2VA 1T8EB 2RLIA 3N5OA 3IK7A 2X8CA 6GSXA 1W89A 4K7NA 4ZIJA 1VF2A 1PSQA 2PN8A 3QR6A 2L6DA 1G6YA 3HDCA 5HFKA 1A2LA 3UBKA 2LRCA 1PKZA 2HFDA 3ZVJA 1EV4A 4L5OA 3GYKA 3TUEA 3H4KA 1QMVA 2GGTA 4JE1A 1WE0A 2R5GA 4GQCA 2L6CA 3ZIJA 4IW9A 1UN2A 1A2JA 4Q5NA 2DMMA 1JLVA 1G7OA 4KH7A 1FW1A 3HJOA 2B1LA 4NV2A 3IDVA 3D5JA 2MBTA 1GSSA 4EL1A 2GSRA 3LQ7A 2H72A 2LRNA 3DVXA 1TKDB 1A23A 1JZRA 5KN3A 1FVKA 1GTAA 11GSA 1T7PB 5J3RA 3GKNA 1TRVA 4LMWA 5H5SA 6GSVA 4HZ4A 3TJBA 4F03A 2CA8A 4OCEA 5IIZA 2VAFA 1K0OA 4HS1A 2JZSA 3L0HA 3PR8A 3GL5A 2MMAA 4FH8A 4IS0A 2MMOA 1AW9A 1JFUA 4QQ7A 4WBJA 4I2UA 2LJKA 4IKHA 1XW9A 3VLNA 1NW2A 3KJYA 2H75A 1M9AA 3WT2A 3DWVA 1O7UA 3E3EA 4X1UA 1GNWA 4IVFA 3DD3A 3IA1A 3DYRA 4O32A 1GULA 4JBBA 3DIEA 3GN3A 4MF7A 1O85A 3J7Yb 4JRRA 3V1WA 3OR5A 2H6ZA 4E8HA 2FWHA 2YNXA 3LORA 4ZB6A 3GTUB 2GQKA 4D73A 4EO3A 1FVJA 1EGOA 3HYPA 5ECMB 3Q19A 4CDOA 5L71A 3ZFBA 3CSJA 4TXOB 5IOXA 5ECSA 1AXDA 2C1YA 5DCHA 2CX3A 4KE3A 1EZKA 1J0FA 1HNBA 3HCZA 4HJMA 5B6MA 2AB6A 1G7EA 3CYNA 5CP1A 1KNGA 1XXUA 3E0UA 4N11A 3LWAA 4F82A 2FNOA 2AUVA 5D9VA 3A5WA 3UL3A 6GSSA 1ZMAA 5IPHA 1TDIA 5CYYA 4QL9A 3TRQA 3FK8A 2H6XA 4TN8A 3LSZA 2YV9A 2M46A 3LYKA 1B9XC 1Y25A 3EWLA 3D6IA 5F07A 3Q6OA 2OJLA 2DIZA 3WT1A 5CAXA 2AAWA 4POLA 1XOAA 2VCWA 4O92A 1PX6A 1ST9A 2GQMA 2EIQA 1KEBA 4EDYA 3GKXA 3C71A 2YJHA 4MA9A 2WULA 1USBA 4ECCA 2F9SA 4K0NA 2H66A 2LJAA 5CRHA 3J7Yk 2IFQB 1B9YC 3NIVA 2X8GA 1M0UA 3UAPA 3TKPA 5B8BA 5D96A 2MYGA 4KSMA 3IOSA 3H79A 3ME8A 2OE1A 3DKSA 2FD3A 1O8XA 4MF6A 2YCDA 1BAYA 2ES7A 3VWUA 2PBJA 1YKAA 3P8WA 4JR6A 3LGCA 2E2MA 3HZ8A 4RI6A 3LEFA 3HHVA 4ZB9A 3RBTA 1W4VA 1LJRA 3KMOA 3N9JA 4MZBA 1ZOFA 2TIRA 3EYTA 2LKUA 2R37A 3VFIA 1X9WB 4ACSA 1URMA 2YZUA 1O81A 1HD2A 2C3TA 3CRUA 3KM6A 5DALB 5G1KA 4N0ZA 4WETA 4ZBDA 4JU5A 2DSAA 3L9UA 1T1VA 2V41A 3BOAA 4PURA 4GTUA 3ME7A 1GP1A 5DAKB 4PQ1A 1U87A 1V9WA 3DRNA 1QXHA 3LXTA 2VO4A 2LNSA 5DBQA 3MNGA 5KN2A 1B8XA 1MD4A 4JR4A 2C0GA 4N30A 4HU9A 2IMFA 4NPBA 1EP7A 1GRXA 2WZ9A 3K8NA 2DLXA 2FGXA 4IP6A 5ECKB 1U3AA 3FZ5A 4MPGA 2I81A 3R2QA 3DXBA 1TI1A 2ON7A 1H4OA 4K1FA 2X64A 4TOPA 2VM2A 4ISDA 1PQNA 3BCKA 4LMVA 2YWNA 4MZWA 4J56E 4ID0A 4NHWA 1X5CA 4K8MA 2H0IA 2H74A 2B6MA 2OADA 3MWHA 3KZQA 4TR1B 5FHIA 2K18A 5C00A 3KTLA 4PNGA 2VL9A 1OE7A 4I8BA 3LG6A 6GSUA 3P7XA 5GSTA 4G19A 4WBRD 1QQ2A 4NWYA 1KTEA 4POBA 4AJ7A 1K0DA 1F2EA 4G10A 1J9BA 2O8VB 3DEXA 2IMEA 3W8SA 5A5KA 2FWGA 1ERWA 1YF0A 5DCGA 5C04A 1DUGA 1X0RA 2G2QA 3TJGA 3FR6A 1FB0A 5IMFA 3TDGA 3WGEA 1R7HA 2I1UA 3VI7A 5JWQB 2DJ1A 4ZBAA 2HLSA 2FWEA 1NHOA 4GSSA 2VIMA 3M8NA 5ECRB 4MH2A 4ML1A 3IPZA 3O3TA 2PPTA 1JZDA 3RHBA 4HQSA 1PGTA 2JZTA 4ZXGA 3KH7A 3KXOA 5G5EA 5GAND 3IE3A 4MK3A 1GUHA 4ECIA 3RPPA 1M7TA 5G1LA 4PQIA 3CTGA 4GSTA 4ZL7A 4EDZA 1YDKA 2LV3A 2OACA 4GSNA 2YOIA 4EE0A 1Z7PA 1SL1B 1WPIA 2OA7A 2IIYA 2GLRA 3UJ1A 2GVPA 2JSZA 3G7YA 1RQMA 4BVXA 4NXIA 2HNLA 3FZAA 2YV7A 3LYPA 1WP0A 4V1Ap 3QAWA 2CX4A 1PRXA 2KUCA 4TVEA 3ZIVA 1T00A 1OC9B 1K0BA 2FHEA 4PX1A 4L0UA 4ZILA 3L78A 4KA0A 3HY2A 1OAZA 3MSZA 5F0GA 1EOHA 2R3XA 1TXXA 2KOKA 4HDEA 4ZBBA 2ON5A 1GSFA 2DC5A 3EU3A 3F4RA 1VF1A 4N0VA 3NZNA 2MBSA 4KX4A 2TRXA 2E7PA 5J4UA 2H30A 2PVQA 3UMAA 1GLPA 5IO0A 2L5OA 2OKAA 6GSTA 2IMDA 2YZHA 2ALBA 1T3BA 2NDOA 4YH2A 3C7MA 4OFNA 2CT6A 2K8SA 4OO4A 4I97A 1TRUA 4X0XA 1XZOA 2GTUA 3MDKA 4F9ZA 5IMZA 2VL2A 3CSIA 3F6DA 1GSEA 1THOA 4NV5A 4KSOA 1WIKA 4FO5A 1YJ6A 2WDUA 2PVOC 3EU4A 1CQHA 4ML6A 1RW1A 4GWRA 3TJFA 2P5QA 1PX7A 4AGSA 2V2GA 3VWVA 4DEJA 5JWOB 3FYGA 2O89A 2XPEA 1XWGA 5IO2A 2CZ3A 5D73A 1B4PA 2C3QA 4DSSA 1S3AA 3KH9A 1ERUA 1V98A 4RQRA 4OWYA 2CAQA 2N5FA 4LL4B 2P5RA 3PGTA 2GZYA 3G9BA 2YPMA 4YQVA 2L57A 3FW2A 3HVSA 4OO5A 4HU7A 2PU9C 5D9WA 2IPAA 3F4SA 6GSWA 1S3CA 5ECHB 3GIXA 3IAS2 2JL4A 2XPDA 3TRPA 4X43A 3I43A 2I4AA 5KN1A 1YEPA 4XHMA 5FWGA 5HR3A 2EIOA 2RUFA 1O6JA 2A4VA 1TRWA 2DJ2A 3F6FA 3G7JA 3TOUA 2H1GA 3IAM2 2K8VA 5CRDA 1TU7A 1A0RP 1XWKA 4BPYA 5ELAA 2I9HA 2JU5A 2VD0A 1ZZYA 2H1DA 1BYEA 2IWTA 2JADA 1DE1A 1QGVA 1MDKA 3VURA 5D9TA 4V2LA 3APQA 4L8EA 4LA1A 1B48A 4ZL8A 4TW5A 2WS2A 4D73B 4BVYA 2EC4A 3BJ5A 1F3AA 1Q98A 1O8WA 5CREA 3F3RA 1MEKA 4XS4B 4J2FA 2NBSA 3TKSC 3APSA 3M3MA 2ZNMA 2X99A 3WGXA 2WRTA 4K9ZA 2KLXA 2R2JA 3CTFA 3F3QA 1H75A 4PXOA 5GZZB 1BEDA 2C0DA 1ON4A 4K7OA 3IC4A 3C1SA 3ZMKA 2HRNA 1ERVA 3P90A 2E0QA 1G0TA 1AIUA 1HQOA 4MP4A 3QPMA 5E4WA 3ZREA 3WGDA 1UC7A 5KEJA 1X5EA 4MF5A 2RM5A 5G31A 5IMCA 3TOTA 2M72A 4KCEA 1U88A 1YKCA 1WWJA 1C72A 4MLYA 3QAVA 1ZCPA 3PINA 2B3SA 3US3A 1E6BA 3SBCA 5HR0A 1XWCA 1I9DA 1YEXA 3UVTA 4MMMA 2GSSA 4Z7XA 5AISA 4F0CA 5F05A 1PMTA 19GSA 1XWAA 4YQMA 5B8AA 3H8QA 4PUFC 5AIXA 5HFGA 2B7JA 4HOJA 1XIYA 1PL2A 3FEUA 1X9MB 1FG4A 2HZEA 4DVCA 3UARA 3SWLA 3IHQA 3A2XA 3FZ9A 1TOFA 2LNTA 1PN9A 3QFBC 5IQYA 2H19A 2WJUA 2YN1A 3P2AA 1WOUA 2OBIA 5JCUA 2IN3A 1F37A 4XRDA 4EC0A 3Q74A 3TJKA 2H73A 1F6MC 2B5XA 3KP9A 4IJ3A 2HZFA 2YANA 3I6AA 3GKKA 1GUKA 1PKWA
chains in the Genus database with same CATH superfamily
3T1BA 2R4VA 4G0IA 3HSFA 1W0TA 4IGJA 3EVIA 4V19K 1M2DA 4F7ZA 4G9YA 4ZDPA 3DMLA 2NPBA 2V4JC 1KGSA 3L2CA 5CO3A 1BR1A 5J41A 3RZDJ 4HNVA 3CDIA 2Z9SA 2NXNB 3L9SA 3A0HC 1S29A 2QQBA 3QD9A 1FOVA 2R93J 2A2PA 3LSRA 5DEQA 1UG2A 1LBKA 4O7HA 4NMUA 1LPQA 1X1AA 2ISZA 2OBPA 2FY6A 3APOA 2PMUA 3DPLC 2JA2A 3P9CA 2PQ8A 4H86A 3KP2A 3EYIA 4G12A 4DNCA 4HF0A 5AIVA 3CTAA 5J8FA 4CUGA 2PUKC 1LKXA 3J7ZI 1ZYPA 2VCTA 1U5TB 4DBQA 1HW1A 3LSHA 1MJAA 2H1BA 4KN4X 4PQHA 5AIPA 2H76A 1X5DA 2DK8A 1T98A 1S6LA 4MJCA 1T08B 1ETOA 1YX3A 3ERFA 3L4NA 1X4OA 2FOKA 1RKTA 2JRTA 3D0ZA 2F3MA 4LL1B 3I71A 3H9QA 5CPRB 1GTIA 1F3BA 3IR4A 1F9NA 4E8EA 1R5HA 2CVKA 3K4JA 4KUMA 2F4OB 2VJJA 3VSLA 1V4RA 3E7LA 4MIMA 1R26A 2LTPA 4IRIA 1A24A 1Y8RB 2DKHA 2E5ZA 4K6XA 4OIRF 1MBJA 3J80K 1H88C 4FHTA 4IJIA 4EKZA 3WHBA 4AUXA 5HODA 1S72I 4K7IA 3DTIA 4W97A 2L4AA 1VF3A 2CAIA 4M6YA 3RJPA 4WR5A 1XW6A 5JWRB 2WAEA 3CQZJ 4MEYF 4UHTA 3BBYA 3TKRA 1NG7A 4IPAA 1SFUA 3ZOBA 3GTPJ 2F5VA 3GSTA 2ZJRF 5G30A 1BIAA 3TW6A 3W6KB 4YG2F 1Z7RA 3OYMA 2F5DA 3M1EA 2CFXA 3H1CA 4LLRA 2ADUA 4E7LA 3WU1B 2A2RA 4PSWA 3F4TA 3GRXA 4Y13A 5HR2A 1V5EA 5JVGF 2XPEA 2HKOA 3JTHA 3GZ6A 3JRDA 4NDLA 2EV6A 4AIHA 4XOTA 3OYKA 1GDTA 4Q5RA 4GLTA 5IT3A 2K9QA 2ELJA 1AAZA 2KRHA 1YJNI 3D22A 3IL2A 2VM1A 3OOUA 3GA4A 3S2WA 3JAMZ 1I1GA 4G7OF 2H8LA 5DQSA 4EIQA 3HM5A 3WYWA 2HT9A 5CVJA 1PYVA 2EFQA 2MSYA 3BZKA 2LBFA 4F93B 1J08A 2K02A 4HV5A 3RYRA 1GNEA 1THXA 3OIPA 3KCCA 1D1CA 1S9HA 3I4MJ 4M71A 2Z99A 1Z3EA 5GPCA 2EQRA 2W82A 3K2ZA 2ZSHB 2MD0A 4IQ4A 3OS0A 3D4MA 3ECOA 4KDUA 4O5RA 1TK8B 2QLZA 2ZXJA 4XN0A 1UVZA 3ZQCA 1TU8A 1R6RA 1CF7B 3BG3A 2ZBKA 4IN0A 3JCML 2HSYA 1LE8A 1HBXG 1BJAA 1FNNA 1E0EA 2GSQA 1ILOA 4BE2A 5F27A 3IH2A 2K7LA 2WAQA 4N0BA 1A36A 3A1YA 4BY1J 4KMFA 2PMTA 5ELGA 1FTTA 5F06A 4JX4A 2F4MB 5ICCA 2R7UA 1BOBA 2FUG2 3HVVA 5DJLA 5ECQB 1MDJA 4BAYA 2UXXA 4UB6C 5IOYA 1I5GA 4GXZA 1IXSB 1VQMI 2LQQA 3I54A 3RQ4A 4XS6A 1W7PD 3FM5A 3K1MA 5FD5A 2O85A 2RIIA 2WCIA 5FO5A 1EWXA 2RUEA 4YKGA 3DXJF 1XFLA 4ESJA 4MCUA 4WEYA 4RA2A 4DYQA 5DD8A 2HWVA 1TK0B 1TJDA 4BWQA 2HI7A 4KYWA 2HVQA 3SZGA 3GXOA 1HCRA 2D1VA 1YQ1A 3E0JB 3U1DA 3MCZA 2RM6A 5C3EJ 4C9YA 1A04A 1TTYA 2EZKA 5F0HA 2LC2A 1FHEA 2F8AA 1IYIA 3IK9A 2OF7A 3DBHB 2ZCWA 5A2QK 3JSPA 2HEOA 3BR6A 3M7GA 3ZZXA 2M4KA 4L9VA 2CQ9A 1OYIA 2L9VA 1B72B 3S1NJ 1JHBA 1SU9A 3I69A 1JT6A 5COHA 3VWXA 4LMYA 4I2TA 1AOYA 2WFCA 1VZ0A 2WADA 3CP2A 4BJTA 1W5CC 3RPNA 3OYDA 4CHSA 5IPAA 1SK1A 1JUSA 2ZFUA 1GLNA 2C80A 4WKWA 1TW9A 2HQNA 2KPMA 2VKVA 4XM3A 4FYBA 2WV1A 3ISOA 3LJRA 5B1AH 2CZ2A 1OKRA 2DDAA 3V42A 3KIJA 1I3AA 17GSA 1LQ1A 2BTOT 2RN7A 4JZQA 3KTBA 3OYAA 4H4KC 1Y8QB 4A3JJ 1A8LA 5E8IA 1S3DA 4BWSA 2OAZA 1OC8A 1SL2B 3BDDA 3IH4A 3KEOA 2IGNA 1X3WB 2JN6A 3QMXA 2I3YA 4KSMA 3VPTA 3I0TA 3ERMA 2EK5A 2GOXB 1IN5A 2NTOA 2WGRA 4KW6A 3KEBA 4F55A 2X51A 4BKXA 3KFWX 1R7JA 3QPHA 1IG7A 5KK1A 18GSA 5B6NA 3I58A 1ZYNA 1YRNA 4K5SA 1V55H 2OUMA 3ZL5A 4CYDA 2ELHA 3NQOA 1GH2A 2LQOA 5AGYA 3ZRDA 4E7ZA 3CC7I 1XPVA 3PPUA 2E36A 3TRXA 3U9GA 2A05A 3LFLA 2DTRA 1QRYA 4GYIA 4LIVA 2DMLA 4XIHA 2R5YA 4OIQF 2VIXA 1IUFA 3WGGA 3M9AA 2VE9A 3W6GA 5ID2A 2E35A 3M8FA 3IV4A 2H1AA 4XLCA 1EEMA 3GX8A 5FT3A 2VLTA 4OINF 1W7PA 2GLOA 4GRIA 2O8KA 1OE8A 5FKLA 2VE8A 1F5TA 1GWCA 1QNTA 1OC9A 4KNDA 2KLOA 2CRGA 4S04A 4NC6A 3CF2A 2BW3A 5CQGA 4ZDLA 2XROA 1IC8A 1XG8A 2KHPA 2V1MA 1MJ9A 2BOLA 3FXQA 3WTUC 3N4MA 1JLWA 4WF5A 1EA3A 4XBFA 2BY0A 1LEAA 4HYEA 3OYCA 4CYCB 4I6ZA 1E2YA 3EINA 2WB1A 3FR9A 4G6DA 3FMSA 4RMNA 2OCCH 4RLFA 16GSA 3F9UA 1XVWA 1J09A 1T2KA 1B4AA 3LSTA 2ZCTA 4G9HA 1XVQA 2GA1A 3FHZA 2QEXI 3GNJA 2PN6A 5BPDA 3ZQGA 3S1MJ 4BYYA 4BE0A 1WQ2A 3QWLA 1DSBA 1SD6A 2FBIA 4FETA 4PDKA 1ZYRF 2HE3A 3P7NA 4ZYEA 2BBYA 5CVIA 2TRCP 5G5FA 4XKBA 4CDGA 3J7AO 2NVLA 4O5QA 1QFNA 5DQYA 3ABLH 3W8JA 4NC8A 2PJRA 2L01A 4P55A 4DBRA 3EMXA 2EIRA 2JTVA 4NAXA 2MFZA 2CW7A 2AS5F 1NG6A 2XAFA 2ISYA 2MD5A 4K2DA 2FWFA 3NWSA 1SK0A 1YW7A 1GUUA 3ONQA 1F4KA 2PLYA 1EV9A 2IS6A 4OAZA 4MABA 3H36A 1O3SA 4L5LA 1J75A 2FMLA 4CA0A 4CO8A 1R4WA 5DDLA 3TCOA 3G1LA 3E1SA 3BD2A 5IPGA 4IF4A 5EEGA 4BGDA 5J9BA 1K78A 5CRWA 4BL7A 1H89C 5IYCJ 1XGSA 4CZCA 2DT6A 4GXOA 3CRTA 2IVMA 1P4WA 3FMQA 3MQ0A 2M45A 3GSSA 2HYXA 4KDXA 4OFTA 5HOOA 5JCGA 4MZCA 3ZFLA 4BVXB 4A3MJ 2YWOA 2LTKA 3C2HA 5JCWA 3PM1A 4RM2A 4EEFG 3UBLA 5A4VA 4KJZA 2CV1A 1K6YA 3AY8A 5J5NA 3DPUA 2J5PA 4CSWA 4EXJA 2P5VA 1GVJA 1FSEA 3M4OJ 1JZWA 4ULXA 2AO9A 3OS1A 2X49A 2FJ1A 1Q4JA 2R6KA 3FXUA 3EETA 5LNKe 1Z77A 4AC0A 1QZZA 3MMYB 5J1RA 3I4NJ 1Z9HA 3A01B 1HW2A 1YS7A 3BZ6A 4O5VA 2MA3A 4OAYA 2LRDA 3M1CA 3GV1A 5TJJA 4II2A 5DCMA 1WJDA 1M2BA 3G7IA 2Y75A 1OCRH 2VT2A 4FYUA 5ILUA 4ZYGA 1R1VA 4N10A 3DU5A 2W24A 2MH2A 2Y9YA 3QCPA 2MABA 4BBSJ 1GLQA 1Z6NA 4V2NA 3TGZA 5D93A 3GKMA 3PFYA 2XRLA 1IN7A 3F3XA 3GHAA 1DE2A 3TP0A 3AL0C 2O0YA 3DPTA 1XSVA 2EA2A 5GADJ 2QGVA 4OOIA 4ECBA 4EGYA 4XLNF 1MTCA 5DM6F 3LQRA 3CJQB 3RYPA 3VYSB 2YWIA 4KCAA 1IXRC 4P1WA 3WTSC 4GRFA 5A4WA 2GQLA 1W36D 1H0MA 2HZDA 2ZJ2A 3E5XA 1HNCA 4QPQA 5ECNB 3GWZA 5ABRA 4C3JJ 2H6YA 2VQGA 1ODDA 1RZ4A 3LA3A 3SJMA 3UIWA 1FWZA 2RVCA 4HF2A 4B3XA 2OE0A 2Z2SB 2VLUA 2LK2A 1OCCH 4KB3A 3ZR8X 3SQNA 1DUXC 4RQXA 1ZK8A 3FXMA 4ENMA 1ETKA 1XD7A 3OYBA 1OKDA 1O73A 5J8CA 3AAFA 4HPQA 1JKOC 1VF4A 3C73A 2V6EA 2VCQA 2A68F 2FA8A 1FP1D 3RPQA 3QRFF 1OYWA 3RCOA 4LITA 1VF9A 4NHJA 4QL7A 3TQNA 2MYSA 3AKZA 3L2UA 1K3OA 5E1WA 2LS5A 3BR2A 1BL0A 3BY6A 2FNAA 4U0WA 3F63A 5INYA 1N2AA 1N77A 3V8JA 2QCOA 2R7TA 4GF0A 3ROUA 1UHWA 3WE2A 3TDUC 3UR3C 3KD0A 1ZYEA 1T0FC 2HYFA 3GFJA 3GO5A 2WY7Q 2ZXHA 5DV5A 5EZGA 4A0ZA 2IL3A 2R0CA 1XG1A 5IMVA 3GTUA 1ZAOA 3ZITA 1YJWI 2GS3A 1Y6EA 1Z3YA 2JK3A 1FAAA 5IOZA 5DJMA 3LSJA 5EG0A 2CVBA 2L7KA 1GTUA 5HQPA 1KYZA 2K9NA 4Q4ZF 1JKPC 4XLAA 3ZMLA 5F08A 5FGMA 2Y0SA 3DBLB 1XX5A 1KQ0A 2NYXA 2ZMEB 4KIFA 3WGHA 2F51A 2QSIA 4I7HA 2M0MA 4TXOA 2X6WA 2L9SA 4U0VA 2IEKA 2VCZA 4L0WA 2ZXWH 2OJED 3OSGA 1M9BA 3GL3A 2Y30A 2DMQA 4POMA 2J9HA 3EPTA 2E2HJ 1J5YA 1CQGA 3BR0A 4D0PA 4AD9A 1SK2A 1ZGNA 2E71A 3KCMA 1X9SB 1A0FA 3LA7A 2C0FA 2DAOA 1PUFA 5B5EC 3M8JA 3G6EI 3M0FA 2DO7A 4XNFA 2CW0F 3DLLF 2C0EA 1K0NA 2H01A 2OE3A 1FBUA 3HVXA 1MNMC 3TJJA 2X48A 4XS1A 1U5TC 3WTXC 3JW4A 3U6VA 3QODA 4ENKA 2VOPA 1K3YA 3O6TA 2L7ZA 5AONA 5IOWA 1Z5YE 1G3SA 2D5VA 3U2RA 1SKRB 3GFKA 4MO7A 3H0DA 4DSQA 2EFOA 3QU6A 2LFBA 3ERWA 4DSSB 2KP1A 2LSOA 2KRFA 4G7ZF 2DW4A 4OD7A 4PZJA 6GSYA 2AYTA 3GH6A 3F8FA 2X4AA 3FF5A 4YRVA 3GZNB 1PFOA 4DYCA 1R71A 1P7IA 4C2TA 2CV4A 3FWEA 4B48A 3VWWA 1GV2A 1YE9A 2OBKA 2IW5A 1MH4A 2XBQA 2RV8A 4I01A 1O3QA 1SD5A 1GSDA 5E1XA 1M1EB 1TL8A 3EQLF 1V58A 2P31A 5A2QZ 1ZG5A 3OYLA 1G6WA 2M8EA 2LRTA 2XDVA 5HS8A 1S3JA 5LLQA 3KLOA 1FSHA 2C4JA 3TW7A 2J23A 4XS4A 1NM3A 5AN1A 3IBHA 3FBNB 3HKRA 3KP5A 2P6SA 4LFUA 1TTZA 3P5JA 3B02A 3TOAA 2PEXA 2VQLA 4G94A 1AQWA 2V32A 4YAPA 4LB5A 1F9MA 2VJ4A 5IT9Z 2L4QA 1ZLJA 3IRRA 4ZZLA 3I55I 1QVUA 2VUPA 5J9CA 1TP9A 5EL8A 2RNJA 2N8GA 5KOXA 1IV8A 3GMFA 3F72A 2JWTA 1TRSA 2KFDA 3WTTC 4PSXA 1TK5B 1B4QA 2AQFA 1QBJA 2GDRA 5HR1A 2M3AA 5CVVA 5ICGA 3J7AY 2FCHA 3GURA 1YI2I 2M5WA 3FK6A 1DU6A 3WD6A 3BLYA 3E97A 2DJ3A 3F0IA 4HNUA 5LHHA 4IBPA 3ISPA 5GSSA 1TT5B 2KHMA 4MFEA 4NQWA 1FBSA 1LDJA 3K4KA 1OYJA 4HJ2A 3IHUA 2K3PA 4RUVA 1UA5A 2FA4A 1YHQI 3CBUA 1OVNA 4B3AA 1OR7C 4P9FA 2VB6A 2EV5A 1BN5A 3VFZA 1H9TA 3K9TA 3BG9A 5FKNA 3G73A 3CC4I 2B5EA 5LD0A 4I6XA 2XC7A 5LGTA 3OIQA 5M5YJ 3ZQLA 2HYGD 1ON1A 1XPXA 3FY7A 2HS5A 3TO7A 3PSIA 1ACVA 4H0EA 1SYRA 2MZCA 4UNOA 2V6OA 1VQ7I 5F1RA 3GTGJ 4FIWA 1SAUA 2WY8Q 4KDPA 2X1CA 3MYDA 3PUFA 1BC7C 1IDYA 2C3NA 3N05A 1QA6A 2DJKA 4RI7A 1G3YA 1U9OA 3RSNA 1A6IA 2X4HA 3ZMUA 1FYMA 3IRAA 1U6TA 1UMQA 1CGPA 2VKHA 4E7KA 1B59A 3OY9A 4NC7A 1AU7A 2IFQA 2Q2EA 2PGTA 1WJAA 2KZGA 4UUSA 1ERTA 1V3FA 3JRHA 1DDNA 3HSEA 4PJMA 1SENA 2GZPA 1S7OA 4M9SA 4MNUA 4ANJA 2ICWG 2GT5A 3KMNA 3HOUJ 5ECIB 2GWRA 2IXSA 4I98B 3GUDA 3CMYA 1VQ8I 2E34A 2B7KA 2LKPA 3R3EA 4S05A 4XRAA 4GYGA 2R5ZA 3VI5A 1T95A 1T33A 3H5AA 4XCSA 2VBXA 4XQFA 1OKTA 3M1GA 3O6BB 4N4OB 3QPSA 5K7FA 1WSUA 4BUPA 3AG2H 1RRJA 1B8IB 1RK4A 1J0RA 2DJJA 4FX4A 1XOBA 2E7WA 3M9JA 4TKYA 3MWMA 1GV5A 4XLFA 2R0PA 1U3IA 3DKWA 4M74A 4O6JA 3K2AA 3T8RA 4CCKA 5KCMA 1V54H 1AQVA 2JA6J 2L5LA 2ZUPA 3FIWA 4GCIA 2O7OA 3EYYA 4Z6YA 2ID6A 3FRCA 3H1NA 1AUCA 5LGNA 2N5AA 3HOTA 4XSZF 3CCEI 2GXAA 4PTSA 5IYDJ 3I9V2 1M3IA 4GQFA 5KOWA 3QDNA 2MC3A 3ZLPA 3F8BA 4FQGA 4EF0A 5EVOA 1R5PA 2REMA 3CCJI 1WH5A 2VJ5A 3G3ZA 5DUKA 1LEBA 2XC2A 3ZQQA 1K0MA 3QFAC 2X1DA 1BM9A 2K9FA 3CJNA 3ZYWA 3ZN1A 4PJLA 4F2IA 1F43A 3C1RA 4UB8C 2HPMA 5HFIA 1T4ZA 2WB9A 3J7YJ 2E2GA 2H8RA 1TI3A 1K0AA 1NK3P 1Z6MA 2O03A 2ETHA 5C44J 3WE3A 5J4YA 4M6XA 5B7CA 2IMIA 1QK8A 1Z91A 2YJ7A 4EJVA 1HDDC 3N97A 3DV8A 1BX9A 1R49A 1VGLA 5E59A 2VPLA 4UUVA 5DALA 2CWEA 3QPLA 3SEZA 4Q5FA 2W48A 1SKSB 5M5XJ 3ZTLA 2EIJH 2DJIA 1X1PA 3GX0A 3I53A 4OMYA 3GVAA 4J57E 4V1Ag 1SD9A 1AA7A 2FMYA 4TR4A 4KT5C 4EJOA 2R0QC 3M9KA 1RI7A 2C6YA 1GTBA 2GZZA 3C2BA 1DP7P 2HRFA 3O76A 2VLVA 1VQ5I 1RESA 4A3LJ 2YUSA 1X3ZB 3L9VA 1YZXA 5LGUA 2H0GA 5H5RA 1LVKA 4KICA 4Q48A 4PJNA 3WTVC 1H8AC 2RNGA 2G0FA 2HXKA 5DAKA 3AG3H 3HZJA 2XPUA 4B44A 3SZTA 4WWCA 1NH3A 1WI9A 4HZ2A 4AF2A 4MPFA 3F8CA 5L3CA 1AC1A 1YY7A 2DA6A 4OFMA 4MH3A 4POKA 4BEHA 4CCMA 3QPTA 3CCQI 5CLSA 5J40A 3L7WA 3LSGA 4G2EA 3ZGKA 1NSWA 1PA3A 4IO9F 2VL8A 3NOFA 3QAGA 5JR3A 2DYRH 1O3RA 1ZARA 4AJ8A 1FOKA 4HDVA 1XW5A 3GBGA 4AYBN 1DU0A 3MAKA 3HZ4A 1WMJA 4WCGA 4RB3C 4OU0A 4WF4A 5EGOA 4DZPA 1SANA 3OOPA 1QUWA 3LMMA 3KP8A 1V2AA 4YFXF 4V2MA 2L4CA 2CFOA 2F2EA 1VQPI 2L59A 2VQHA 3FKFA 3HKZN 2HVRA 3HUGB 5ECPB 2LEGA 7GSSA 1MH3A 2VT3A 2DMNA 5E3MA 3H93A 5IMDA 2L54A 3JSOA 2EZHA 4GGGA 1XSXA 4HAMA 3FR3A 1W5TA 1DBYA 3HRMA 5HS7A 2LF7A 2HZEB 4FYCA 2DXIA 2V6CA 3HPGA 1A2MA 2WBMA 2XAQA 5FLXK 1XBSA 3O8HA 3VB2A 1Z3XA 2D1HA 4QLCU 5L3FA 1A8YA 3VK9A 2JA5J 4ZL9A 5BOXA 1OCPA 2CW8A 1N8JA 1YF1A 2H0HA 1YS6A 1OC3A 5E20A 3HOZJ 2JACA 3FZ4A 1W5SA 2HDDA 4U0YA 1ABAA 3E9JB 1VNDA 4A5PA 4FASD 1TWHJ 4HEA2 4HF1A 2VXZA 4MQVA 5FRMA 3A0BC 1Z6RA 4MFDA 1SJ6A 1STZA 3I59B 2A69F 2LY9A 2Z1DA 2XAGA 2EILH 3COAC 4IHSA 4PGGA 3ELKA 2LJRA 3EUKL 4RB0A 2ME6A 4MGRA 4RGXA 4L0YB 2O87A 5D9XA 2GXGA 4NNJA 2OV7A 1JKRC 2R7RA 3KZIC 1LFPA 3LQQA 4M3EA 1HYUA 1L3LA 2BJXA 3K4NA 1X58A 4ESBA 5EPFA 1G8XA 2F6CA 4A3CJ 1GSQA 3FXOA 3GH9A 1ZYQB 3PQJA 2HQAA 2BVMA 2Q0OA 5IP7J 4X0GA 2WA0A 3IWFA 2MMNA 2H70A 1ZQ3P 5D8KB 2LREA 2ESNA 3CF5F 1TT0A 1ZREA 1HKQA 1U9NA 3F22A 2QSHX 1EJ9A 3HGYA 3CXGA 1ML6A 2AJQB 4A69C 2F48A 4ITVA 4TR1A 14GSA 1IO2A 4L0ZB 1M2AA 2JZRA 3EC3A 2EIKH 2CUEA 22GSA 5F8BA 3L2RA 1KU3A 3HSRA 2DFEA 2ESHA 5IP9J 3EMPA 4KAEA 2LMDA 4IOCF 2QSFX 1IRFA 4Q5SF 1WRYA 1VQOI 3P90A 2F5FA 1QPIA 3K0LA 5J1YA 3TKSA 3F6OA 1GXPA 4PGTA 4PJ0C 1PD21 3J81K 4MJEA 1D1BA 1K3LA 4I99C 2D2ZA 4M3BA 1MBGA 2CQXA 4YAVA 2IMKA 4HUAA 1OPCA 2N5BA 1JHFA 2IJYA 4ILFA 5ECLB 1FIAA 2DCEA 2VOCA 1FY7A 1P6RA 5ECOB 1V40A 5B3SH 2O6GE 1NHYA 5F64A 3CCSI 4TRXA 2PERA 1MDIA 4IHUA 4CW9A 2YWMA 4MTEA 2FLSA 1WJKA 3FX3A 1ZL9A 1CF7A 2QKEA 4EVMA 2FF4A 3B6CA 3BCIA 2B5YA 4KISA 3QOPA 2QC7A 5FJ8J 2LUSA 3LXZA 4HQZA 3D21A 2FU4A 1K0CA 3UEMA 9GSSA 3DVWA 5DDGA 4E6KG 3WODF 2YX7A 3ED3A 1AKHA 1YX5A 10GSA 2XHFA 1BBYA 3UVHA 1XMAA 2UZKA 3H35A 5LHGA 2DFIA 3QQAA 2YR2A 5FFXA 1UZCA 1U2WA 5CKTA 3W2WA 3HXLA 4XR6A 2M80A 3HJMA 1SJIA 4I5QA 4MLOA 1PP7U 3D5SC 4CH7A 1BJXA 3EUHA 5IMAA 1Y0NA 2HFHA 4ASNA 2PWJA 1VQKI 2HZTA 3EURA 1FP2A 1Z1DA 3S9FA 1XCBA 3I4PA 5JVTA 1SYXA 2H6CA 2M30A 5DVBA 2LSTA 12GSA 4IQ1A 4CCNA 4U7BA 1XMXA 1HF0A 1UFMA 1TWFJ 2P0GA 5CRGA 5J1UA 2XKPA 3GTOJ 3K4BA 1IV6A 4MJBA 1SD8A 2BXYA 2OD5A 5CNWA 5KNLA 2MH9A 1B72A 5E3NA 3D5RC 20GSA 1SFXA 3IC7A 1GSYA 2JVGA 5G2ZA 2B0LA 4L9NA 2M9HA 2BMXA 1QZEA 2GSTA 2GT6A 2VL2C 1BI2A 4YFKF 2NVTJ 4YQUA 1JTYA 1QO0D 3BG7A 2M7BA 3JRIA 3JR9A 2PJPA 2QQAA 1FB6A 2ZC2A 2Q1ZB 3EE2A 3HRTA 2ZMEC 1HNAA 4E7SA 3CUQA 3LSPA 2WWYA 4DOZA 4L5EA 3SFZA 1D3YA 3UOMA 2GZWA 2XF6A 1BG5A 2F8FA 2KIFA 2W25A 2VL3A 4Y52J 5GP9A 3O8GA 3TB2A 3Q3SA 2KQRA 4F0BA 2KP2A 2PFBA 2JUCA 4HI7A 4Q5QA 3EDPA 2LLKA 4BA7A 2HTJA 2CQKA 1YTYA 4P3YB 1WGXA 3ABKH 4OMVA 3TKQA 3JRFA 1I50J 1MMGA 1TW3A 4PFOA 3HL2A 2VD1A 1HSTA 1VQLI 4MDCA 1UG0A 2VC1A 3JCUC 3V7CA 4J19A 3QOUA 3CMIA 1SVOA 2KDOA 2LBFB 5TGTA 1Y0UA 5LFAA 1SEUA 3CSHA 3IC8A 3IXRA 4XOPA 1PUEE 1MBEA 1S5LC 2HVSA 2H71A 3RHCA 1GVDA 3ERGA 4JEDA 3TP3A 3Q18A 4N9HA 1FYLA 5HLHA 3F23A 3BT9A 4B4CA 1LU4A 3OYIA 2IA0A 5F1JA 1SJZA 3OR2C 2V6KA 4EUYA 4EMSA 5D6EA 1OFCX 1T4YA 2LH9A 4PUAA 3CZ6A 3Q0WA 3GTLJ 4D9JA 5ENUA 1BQ7A 1E3OC 1G4DA 2DBCA 1BR2A 2QA1A 2B7EA 4TR3A 1O57A 4S0HB 2EWNA 4QWQA 4ESFA 3A3TA 4E7IA 1P9QC 8GSSA 5LD2C 3ABTA 3NARA 1IN8A 1ZKGA 3LA2A 2R7VA 4TR0A 3LSKA 1XWBA 4WR4A 4QTRA 2LR8A 3FXLA 4GCVA 3F0CA 3GUSA 2YSRA 3BR5A 1R1TA 3CMMA 4E7HA 4KGIA 4WXTA 5HNFA 1GL8A 2K6VA 5HLIA 5KVRA 2WAQN 3PH9A 4CYCA 3FHKA 3V8LA 4XLPF 3C8EA 3SYTA 2O9LA 2EPFA 2O8XA 1MD3A 2K9LA 2M4GA 4K0GA 5D5UB 3F8UA 1EOGA 4BL7B 2EZLA 1IRXA 5C4XJ 1EEJA 1VI0A 1QGPA 3K10A 2XIGA 4D7NA 3L2VA 4A5MA 3DKYA 1ZRDA 4IELA 1J2XA 3G1MA 1EP8A 4R8HA 4BDYA 2XBIA 2DJ0A 1VRSD 4QIWN 5EDNA 1SVMA 3KLNA 2VBZA 3S2DJ 4A93J 1JZOA 5D8LB 1M99A 5LCZA 4BHBA 4FT8A 3SFIA 4I0AA 2O7KA 3RAZA 2COMA 3ZMSA 4C2MJ 3K4CA 3G71I 1KBNA 1FIPA 2GIVA 3RI4A 4AJ6A 2JVHA 4IP1A 2K27A 1WCMJ 1RUNA 2HSHA 1YQAA 2TDXA 4M3GA 2E1OA 3HJPA 3ZVJD 5D6FA 1GUMA 2WAFA 2DIYA 2YP6A 3HA9A 5E3OA 2NS0A 2FBKA 2HRKA 2QBYA 1R5AA 3HOWJ 1PL1A 1I5ZA 2CVDA 1AQXA 4BNCA 1QU3A 3HRSA 3BJOA 1XS9A 3S3OA 2X8HA 4DJAA 2LYCA 2NNYA 4NHZA 4KUNA 3CMEI 2DOEA 2AV4A 3TKSE 2B1KA 2OZ6A 4RAZA 4IQAA 4ZB8A 4TXVA 4JP0A 2XAUA 5DYMA 4L9JA 2BHYA 3D4TA 4PNFA 1RIOH 13GSA 2AHEA 4ECJA 2KJBA 4WK8F 1JHHA 5FB2A 1YRNB 3KGKA 1REPC 3A2WA 3OR1C 4A3FJ 2A2SA 4MJAA 1Q1VA 1XCCA 1MMNA 2BGCA 2O61A 1YG2A 2VC0A 1GSUA 2C8UA 1SKWB 3Q5FA 2VCXA 3K7AJ 5IM9A 4NUBA 4OCFA 5D8IA 4JK1X 1ZELA 2JSYA 2EFNA 2GM4A 1FO5A 2DODA 3M07A 4YEJA 3VPQA 2L02A 5ID2B 4MTDA 4PUSA 3GF2A 1V57A 5EY6A 3E5UA 1W7PB 4M3FA 1IYHA 2MMZA 1SL0B 3BR1A 3HD5A 2GXBA 3ZMVA 1YW8A 5A4UA 3Q9VA 4HLYA 5GAPD 2FBHA 1X19A 2LY2A 4RB2C 3UNGC 3RDWA 3BQYA 3A2VA 1HSJA 4M73A 2RLIA 2VUMJ 1T8EB 3N5OA 3KEYA 3LOCA 1DPUA 5F6FA 2P5LC 6PAXA 2PMZN 1BW6A 2DKIA 3LSMA 4DGWB 2VLAA 4USSA 2DT5A 3IK7A 2OZUA 3BC8A 2W1OA 2X8CA 1P4AA 1G6NA 6GSXA 3L09A 3RKQA 3BG5A 2ID3A 4AIDA 3BOQA 3HOXJ 1W89A 4K7NA 1XSDA 2OA4A 4UUTA 4ZIJA 2CQ7A 1VF2A 3E6MA 1PSQA 3ASOH 1WHUA 2IRFG 5D5WB 2PN8A 3K70C 2V1UA 3QR6A 2L6DA 2IS1A 1RKWA 2WB1N 4IJAA 1G6YA 3HDCA 1JE8A 1ZGWA 1K83J 1ETYA 1YYVA 2DMTA 1A2LA 5HFKA 3UBKA 3KIOA 1U3EM 3FK7A 2LRCA 4GO1A 1QHGA 3BJAA 1PKZA 2XGEA 1EV4A 2HFDA 4L5OA 3ZVJA 3GYKA 3TUEA 3H4KA 3S15J 4UY8I 1QMVA 2DI3A 4LK0F 3ML6A 1XGOA 3ZN0A 1WE0A 2NS7A 3PUBA 2GGTA 2R5GA 4JE1A 2XAJA 3HGGA 3MIXA 4GQCA 5ICEA 2L6CA 2P4WA 4U88A 3ZIJA 1TQIA 4IW9A 4HG2A 1I6HJ 3ESWB 1HDPA 1MDMA 2COBA 1JT0A 1K78B 4F52A 3TO9A 1A2JA 1UN2A 4Q5NA 2EZIA 4Z2RA 1HOMA 2E1CA 1JLVA 3K4LA 2QYOA 2DMMA 4KH7A 2HQRA 4EJWA 2XPVA 4HQEA 1FW1A 3HJOA 1G7OA 2HXOA 1G2HA 3BTLA 4IHYA 2WTEA 4IZZA 2KISA 2PX9A 2B1LA 3IDVA 4NV2A 3D5JA 4Y4RA 2MBTA 2XPWA 1GSSA 4EL1A 2LF8A 5L3GA 2K40A 3V4GA 2GSRA 3LQ7A 4U87A 1E3PA 2H72A 2LRNA 3DVXA 4JBAA 1ETWA 2YPRA 4IVNA 5TISC 4ZTFA 1MD0A 1TKDB 3GFIA 1A23A 3RKWA 1JZRA 5KN3A 1FVKA 5C4JJ 1K4TA 1GTAA 11GSA 1T7PB 1UHSA 1FX7A 2NRAC 3J80Z 2LG4A 1DGRM 2DTZA 5DTDA 5J3RA 1EGRA 1QVTA 2CUJA 3SXYA 1IDZA 1TRVA 3GKNA 1P7JA 4LMWA 2EH3A 3PFIA 3H5RA 3ECHA 1ZRFA 5H5SA 4II3A 2K86A 2UUZA 5E17F 2AXLA 2HDCA 4HZ4A 3TJBA 4BJ5C 1IN4A 3CESA 2CA8A 4OCEA 3J81Z 4F03A 2R92J 2ZFWA 5IIZA 3ULQB 5FKOA 3DU6A 2UWMA 2VAFA 2DA7A 3CCRI 2EINH 1K0OA 4HS1A 3D5LA 3FZVA 4KDYA 2JZSA 2DBBA 3L0HA 1WFXA 5FKKA 3PR8A 4KF9A 1LDDA 3GL5A 3FBIB 1FOWA 5J47A 1LJ9A 2MMAA 1YOVB 2G7HA 3DBRB 1HXDA 4FH8A 2ZSIB 4IHXA 4IS0A 1LFBA 2DQRA 5ED4A 1RR8C 2MMOA 3MEXA 3ZMZA 1AW9A 1W0UA 2Z5UA 4A0XA 1D1AA 4HX4A 1JFUA 3R0JA 4QQ7A 3TBIA 4WBJA 1ZG3A 4I2UA 2LKXA 2LJKA 3I56I 3VYRB 2ELKA 5JI6A 4IKHA 3FKJA 3DP7A 3PIPF 2OTJI 1XW9A 3VLNA 2IP2A 3IHGA 2K4BA 1NW2A 4KIGA 1SFOJ 2ECBA 4Z2TA 4J01A 4P5OA 1HQCA 2EFWA 3KJYA 2H75A 1M9AA 3C1DA 2HYJA 3PL8A 3MN2A 3DWVA 1O7UA 2XAHA 5D5XB 3GLLA 4BY7J 3WT2A 3Q0UA 3E3EA 1OCZH 4BXUA 4X1UA 1ZN2A 2ZJPF 3CJRB 1K4SA 1GNWA 3DD3A 4IVFA 2M0CA 3K69A 3R4KA 3GX4X 3DYRA 2P5KA 4RB1A 3IA1A 4O32A 3TEDA 3HDDA 3TDZC 3T0YA 3UKGA 1GULA 4JBBA 1FT9A 3O2PE 3DIEA 4P96A 4YIRX 5F04A 2VXDA 3VEPA 3GN3A 4MF7A 1O85A 3CCLI 1GHCA 4ZYAA 4B47A 4CZZA 5KN0A 1UCRA 2EB7A 3J7Yb 3SZPA 3KETA 4JRRA 2A4HA 3V1WA 3OR5A 2H6ZA 2KZVA 5GPAA 5LBQA 4E8HA 2CV0A 2FWHA 2VBYA 4MEXF 2YNXA 4DSRA 1R36A 3LORA 1LVAA 3CLOA 4ZB6A 3GTUB 4LB6B 2GQKA 3RPUD 4D73A 1XDSA 2UV1A 1LNWA 2IA2A 3BR3A 1MZBA 2Z16A 3K70D 1FVJA 4EO3A 1EGOA 1ZTRA 2E5NA 3KP4A 5EG0B 3HYPA 5ECMB 3TOBA 5IP6A 4ZH4F 3CO6C 3Q19A 3H9JA 4RGUA 4CDOA 5L71A 3ZFBA 3TO6A 3CSJA 1PDNC 1OYYA 4HZFA 4TXOB 5IOXA 5ECSA 2M2EA 1IN6A 2DA1A 4ENNA 1IGNA 2KIQA 4K2EA 1TZLA 4HW0A 4HX8A 4XMYA 4GDFA 1AXDA 2JSPA 2C1YA 1U0JA 5DCHA 4IOAF 5HLTA 2CX3A 1EZKA 4KE3A 1HNBA 3HCZA 1J0FA 1XDUA 2IS4A 3QP6A 4HJMA 5CJ9A 3AG4H 1BI1A 2DOAA 2WC2A 4B8XA 3JAMK 2ZO4A 5EF6A 3H5NA 3C3WA 4JX6A 5BQTA 5B6MA 2V1XA 2CJJA 3BCBA 3LFUA 5JFRA 2AB6A 2IPQX 2E2JJ 1BA5A 1DQUA 3CYNA 5CP1A 1G7EA 3PNTA 1KNGA 1XXUA 4WX9A 5J3LA 4X6AJ 3E0UA 1QPMA 1TNTA 2IA1A 3K1PA 4YKFA 5EEHA 4N11A 3LWAA 4F82A 2FNOA 3KEQA 4RLQA 2AUVA 1SC7A 5D9VA 4ICYA 5CYVA 2F5CA 1IUYA 2MGQA 3A5WA 3UL3A 2A3SA 6GSSA 2X1EA 1M3JA 4A5NA 3DTEA 1ZMAA 5IPHA 4FX0A 2K4JA 4KT6A 5K7ZA 2QKLB 3ZQFA 1N75A 4X4JA 1TDIA 5CYYA 4QL9A 4QPOA 3TRQA 3FK8A 1E3HA 2H6XA 1B8IA 4XONA 2CSOA 4E7JA 1JXSA 2QVOA 4TN8A 3LSZA 2YV9A 2M46A 3A5IA 5FRNA 5JHFA 1WJFA 2DJNA 3VWBA 3LYKA 1B9XC 2W00A 1Y25A 3EWLA 5E8GA 3MKYB 2DPUA 3D6IA 1EH7A 2L9RA 5F07A 2ZNZA 2OJLA 1I1SA 4ZTJA 3Q6OA 3RPUA 2XGDA 1W1WE 2PI0A 2DIZA 3HOVJ 4DIQA 1SD7A 4AWXB 2HNHA 2R7SA 1BI0A 3WT1A 2VASA 3WU2C 4ZJZA 1A35A 1USSA 3VYTB 3BZCA 3U21A 2AHQA 3BTCA 3CCUI 1G3WA 4KA4A 1LB2A 3PJRA 2QA2A 4BVYB 5CAXA 5JLXA 3ZQHA 2NS8A 2JJ7A 4FE7A 4D5CA 2HSMA 2AAWA 1Z21A 1EH8A 5GTHC 4LG3A 4V2GA 3JTGA 1R9TJ 4POLA 1XOAA 2VCWA 4O92A 3CCMI 4IHWA 1PX6A 1ST9A 2GQMA 4IX7A 2EIQA 1KEBA 4OWRB 4EDYA 3GKXA 2V9PA 5BNGA 4BH9A 4LG0B 3C71A 5DS9A 2YJHA 2L3DA 1IF1A 4CHUA 4MA9A 2WULA 3G2BA 1APLC 2HOSA 1USBA 1SVLA 4CICA 2R3SA 2OPTA 1MMAA 4ECCA 2F9SA 2P6TA 2KP6A 3GTMJ 4WXCA 4K0NA 2K9SA 4K2XA 2H66A 2CUFA 2XGXA 2LJAA 3KYLA 4OIPF 5CRHA 5ERIA 3WU0A 1VQ4I 3REOA 2NVYJ 3L9FA 3LL7A 4IHVA 4EM0B 3J7Yk 3ERED 2IFQB 2RDPA 1B9YC 3NIVA 4UUSB 2E1NA 2FQ3A 2X8GA 1K61A 1FZPB 3OL3A 1M0UA 2W4SA 4AYBA 4G0KA 3TKPA 3UAPA 5B8BA 5D96A 2MYGA 2A5YB 3IOSA 5M3FJ 1J7KA 3H79A 1UJ8A 3ME8A 1MBFA 4XKVA 2HXIA 1OISA 1G3TA 1FPQA 1MMDA 3OL4A 5FROA 2ZXIA 2PBIA 2CQQA 5DD4A 2OE1A 1K6OA 3DKSA 2MG4A 2R4GA 1B9MA 3PSFA 2DQLA 2CMPA 3HKZA 3SEQA 2XSDC 3LAPA 2FD3A 3KP6A 1O8XA 3ZRGA 2K85A 4BU2A 4MF6A 2YCDA 1BAYA 2ES7A 4RGRA 3VWUA 1T0FA 2PBJA 1OCOH 2IJLA 4ZYHA 1UAAA 1FOHA 3G1OA 1ZG1A 3U1KA 4XKCA 3PIOF 1O3TA 2P0WA 1YKAA 3P8WA 2M7AA 3LGCA 4JR6A 2E2MA 3V8KA 3HZ8A 4RI6A 3FHNA 3LEFA 2I5UA 5BMZA 2YX4A 4R1HA 1HLVA 4HQMA 3HHVA 3I3LA 5EJCA 3ZMDA 3IP4B 4ZB9A 2TRTA 1X4PA 3OYNA 3CLQA 3EUAA 1ZGJA 1WJEA 3RBTA 2G9WA 1W4VA 2OCEA 1E17A 1P92A 5EEAA 2D2WA 1LJRA 5L3DA 3KMOA 4A6DA 3RIRA 2A5WA 3CUOA 2IGMA 3N9JA 2A61A 3A03A 4MZBA 1ZOFA 2EV0A 4BHCA 2HI3A 4KFCA 4A3BJ 4ZZDA 2TIRA 3ABMH 3EYTA 1N25A 4MQ9F 2DA2A 5H20A 4GFBA 2JA7J 2LKUA 2R37A 5L3EA 3VFIA 1X9WB 3IUOA 3I59A 1PP8F 3HRUA 3E3VA 3Q9SA 2DMUA 2NVQJ 4ACSA 1URMA 2XF5A 2YZUA 3MKWB 1D5YA 1O81A 1HD2A 2C3TA 3KP7A 3CRUA 1U5TA 3KM6A 4LLNA 4XKWA 2EBIA 4XN3A 3LFKA 4CCLA 2F4IA 5DALB 1DPRA 1R00A 1EV7A 4B1RA 2B9SA 3PO2J 1HC8A 4N0ZA 5G1KA 4WETA 3S3MA 4RAFA 4IRGA 2KIUA 1N78A 2KMUA 2LD5A 4ZBDA 3HOSA 1Y6IA 5LRSA 3HYIA 4JU5A 3L2QA 2DSAA 3VDXA 4BBRJ 1T1VA 3L9UA 5DM7F 2V41A 3BOAA 4PURA 4GTUA 3S17J 4X1EA 3ME7A 1GP1A 3OV8A 5DAKB 1XB4A 1RUOA 2FOWA 2W7NA 1YFHA 2DLLA 3DEWA 2L4MA 1FMVA 1QQIA 3FXRA 5FKMA 4PQ1A 4PK4A 1U87A 1S8NA 2UXNA 4BEHB 5DCFA 1V9WA 2XGCA 2JT1A 3DRNA 3I64A 4YIIA 1QXHA 2XF7A 2DFHA 3FISA 2DA4A 1D8JA 3LXTA 4JQFA 5F0FA 3RKYA 2VO4A 5BRTA 1O7FA 3LSIA 4C3IJ 2LNSA 3BP8A 4AIKA 1WZ2A 5DBQA 3MNGA 5IYBJ 2HOTA 1ENHA 3CQFA 3H0GJ 5EGOB 5KAFC 4XLEA 2STWA 3FKIJ 2DA3A 2JPBA 1MW7A 3BTJA 1B8XA 1MD4A 1MJBA 1R5ID 4JR4A 5KN2A 4C2UA 3WHCA 5LHIA 1TLHB 2GA2A 3CO7C 9ANTA 2C0GA 4HU9A 4N30A 1Z6TA 5LRRA 2IMFA 1ZH5A 1X1DA 4BACA 4NPBA 3OYJA 4U7DA 2LY1A 1XTAA 3H3VK 1FEXA 1BR4A 1U8BA 1JJ8C 1EP7A 2WZ9A 2BZTA 2DLXA 3K8NA 2E2IJ 2FGXA 5ILVA 5F0CA 2H6BA 4DZJA 5E79C 5LEKA 4IP6A 5ECKB 4A2UA 1U3AA 3FZ5A 2JRMA 4HBLA 3ABUA 4XICA 2FXAA 4MPGA 1NHAA 3IRQA 3JREA 3FXKA 2I81A 3R2QA 1OR7A 3DXBA 4BQOA 1ZR2A 5HNHA 1TI1A 5KAIC 2ON7A 2JPCA 3F8MA 1JJ6C 1H4OA 4OIOF 4K1FA 4HDUA 2X64A 2DDBA 1KONA 4L5JA 5H2FC 5M3MJ 4TOPA 2ZNYA 1RNLA 3OYGA 2VM2A 4ISDA 4P9UA 1PQNA 3BCKA 4G8XA 4LMVA 1JGSA 3HHGA 3GYHX 3VSKA 2QM3A 2YWNA 4LK1F 4A0YA 5GAHJ 3FMWA 4MZWA 4YELA 2W57A 4J56E 4Z2UA 4ID0A 2DK5A 4NHWA 2HGCA 4J00A 2FQ4A 2BHZA 4HV6A 4RBOA 2RKHA 1P4XA 3GFLA 1F36A 4G6TB 1XCVA 1X5CA 5KHDA 1AWCA 5FD6A 2H0IA 1JUMA 2H74A 4K8MA 2R7WA 2B6MA 1XN7A 2L5QA 2OADA 4R79A 2KIMA 2QQ8A 5B66C 3B73A 3DF8A 3HIFA 1FJLA 3MWHA 4AU7A 3MZ8A 4C30A 5EZHA 3HVNA 3KZQA 4DYRA 4TR1B 5FHIA 2K18A 3BROA 2AQEA 4Z2YA 3S3NA 2RQPA 1GRXA 5EYRA 3PO3J 5C00A 1USTA 5HDKA 2W84A 1Z7LA 1T39A 3KTLA 4K5RA 2R7ZJ 2VL9A 4PNGA 2YU3A 3WTWC 2IT0A 2RGVA 1R1UA 5K5RA 3DFGA 1OE7A 4I8BA 1ZRCA 3LG6A 2P7VB 6GSUA 2LDUA 3P7XA 4E70A 5GSTA 4G19A 4WBRD 1QQ2A 2HOEA 2FA5A 4NWYA 1KTEA 2E1MC 3U5RE 4ENJA 4POBA 1YO5C 4AJ7A 4AM3A 1B6AA 2DN0A 2E19A 2O5RA 3MKZA 1EF4A 2ZB9A 3MD2A 3MZYA 1K0DA 3OIOA 1T56A 1ULYA 4ZYDA 1XGNA 3I5UA 4KMUX 1O4XA 3KYDB 3HXSA 1V5GA 5BS6A 5HDGA 1WJBA 3X2QH 5CVRA 1F2EA 4A3EJ 4G10A 1FBQA 1Y1WJ 1J9BA 2O8VB 3DEXA 1VQ6I 2IMEA 5B1BH 4EATA 2H27A 3QU3A 3W8SA 5K5QA 4IRHA 2FNPA 2FWGA 5A5KA 4KNYA 1ERWA 1AKHB 4MNNA 3F9KA 1YF0A 2KJCA 3DCFA 1JTXA 2KDZA 5DCGA 5C04A 1VFCA 1I27A 4WF2A 1MBKA 5HLGA 3HB9A 3KX2A 3QP5A 1DUGA 3V7RA 1X0RA 2G2QA 2STTA 3TJGA 3FR6A 1FB0A 1G59A 5IMFA 2H09A 2G0EA 5GAEJ 2ME0A 4WXHA 3KP3A 1GXQA 1R58A 3TDGA 4B09A 2V26A 5JLWA 1WWXA 3D0SA 1LE8B 2UZ8A 5J4VA 3IV5A 3WGEA 2BYVE 4G7HF 1R7HA 3HC7A 1IAWA 2I1UA 3GW2A 3WTYC 3VI7A 3HEFA 4F91B 5JWQB 4AVPA 4WXDA 2DJ1A 1ITYA 3R0AA 2HLSA 4ZBAA 2FWEA 1X1CA 1NHOA 4GSSA 2VIMA 4BXFA 3M8NA 1ETVA 5ECRB 1FMWA 1O7LA 1Y56A 1ON2A 2BY2A 4MH2A 3IPZA 4ML1A 1SFKA 3O3TA 2PPTA 5GAGJ 4AIJA 3ZXSA 1JZDA 4FE4A 5E18F 1ETQA 5CVUA 2JSCA 2QWWA 2VCVA 3RHBA 3W2VA 6GSVA 5IY5H 3LAJA 2DPDA 2QF7A 5IT9K 4HQSA 3CUQB 1V5FA 2V1DA 1PGTA 2JZTA 4V2FA 4ZXGA 3KH7A 5FLMJ 2K5CA 3V7SA 4G6QA 5H5QA 2HTSA 5L3BA 3OSFA 3KXOA 5G5EA 5GAND 3IE3A 4MK3A 2NAZA 4XRSG 4BE1A 2MC4A 1GUHA 4XRFA 3LW9A 4ECIA 4M9XA 4UVBA 1W36C 1M7TA 3RPPA 4BIKA 2BY1A 1VQ9I 4O3MA 5G1LA 4PQIA 1JI8A 1E2XA 4I76A 1YIJI 1I3QJ 2M8GX 2M87A 3CTGA 4GSTA 4ZL7A 2MLGA 1Q1HA 3F8NA 4EDZA 4N9IA 3L1PA 1YDKA 1QZYA 3M8EA 3ZQIA 2LV3A 1H9GA 3QAHA 4LGWA 1S3RA 4M72A 2QGUA 3T5XA 3S16J 2OACA 4GSNA 2KT0A 3A4CA 3PQKA 2YOIA 4EE0A 2PMZA 1Z7PA 1SL1B 1D0YA 2RC4A 3C2GA 3BCAA 1WPIA 1MMSA 2OA7A 4L5IA 2IIYA 3QYEA 4HX7A 1T8IA 3M3YJ 3DQVC 2GLRA 1WKMA 2GVPA 4TV7A 5H6QA 2JSZA 3UJ1A 1CQTA 3G7YA 1RQMA 2VI6A 4O5UA 3PNYA 1VQNI 3D1NI 5D4RA 2W85A 1WJ5A 4BVXA 1FYKA 4NXIA 1ACIA 2FSWA 2K3FA 4JX5A 2HNLA 4Y17A 1KZHA 3BJ6A 3T8TA 3BTIA 2YV7A 3FZAA 4BQAA 1WP0A 3LYPA 4OMZA 3SDBA 1OMIA 4V1Ap 1R22A 3FM3A 3KPHA 2JUGA 4G0LA 1J9IA 2CX4A 3QAWA 2HPIA 3K1NA 2JZYA 1PRXA 2KUCA 4TVEA 5E1ZB 1PN0A 3Q0VA 2R5YB 4ON0A 2Z3YA 4A3IJ 5AIQA 2V79A 3ZIVA 1T38A 1T00A 3R61A 1OC9B 1K0BA 1LDKB 4E4HA 4JYKA 2GBYA 3A01A 3PNVA 2Z9OA 2FHEA 4HOBA 4PX1A 4L0UA 2BW3B 1K7AA 4EIPA 3GMEA 4ZILA 1PJRA 3KYCB 2XHKA 1SFEA 4PCQA 4EVIA 3L78A 3F6VA 1GT0C 3BQZA 4KA0A 3HY2A 1XGMA 3ZP5A 2CU7A 1MIJA 2QA4I 3CJTB 1OAZA 4XORA 3MSZA 4CY6A 2VN2A 3VPRA 5F0GA 4ZC3A 2QBYB 1EOHA 1SAXA 3W2AA 1BOAA 2MW8A 2R3XA 4Q47A 4BHPA 1TXXA 2KOKA 4HDEA 4ZBBA 1SMTA 3ASNH 2DFFA 1T6SA 2ON5A 1U8RA 4I2OA 1GSFA 2A07F 2DC5A 3EU3A 1XC5A 2PJRB 1Y1VJ 4BJ6C 4M9ZA 5FLXZ 1MSFC 3CDHA 2JA8J 2CUZA 1VF1A 3F4RA 3NZNA 4KX4A 4N0VA 2MBSA 5H6RA 2LNBA 2TRXA 3GFMA 2E7PA 1KQ8A 3TMOA 2IBDA 5J4UA 1A31A 1R23A 3DKXA 2H30A 2PVQA 4PJJA 2IGKA 2FE3A 3UMAA 2NNNA 1GLPA 1FLIA 4FISA 5IO0A 3AG1H 3TKYA 2L5OA 1TW2A 3RDIA 2VODA 3O3KA 2OKAA 4IXAA 3MVPA 1BI3A 2NOGA 1I6XA 1BW5A 6GSTA 2R7XA 2IMDA 2YZHA 2ALBA 1T3BA 3RKXA 1A5JA 4A12A 4XRMA 2NDOA 3ZPLA 2CQNA 4FCYA 3FDYA 4A6EA 4ETSA 5D5VB 3CC2I 4IHTA 4YH2A 1KQ9A 3C7MA 4UXNA 2VQCA 1R4NB 3P9KA 3SHFA 4OFNA 1Z05A 2CT6A 4YFNF 2K8SA 4BDZA 3KZZA 4OO4A 3WG9A 3DEEA 4I97A 2Y9ZA 2RQQA 2VJIA 1TRUA 3DGQA 4X0XA 4LLGF 1BIBA 1WI3A 1XZOA 2XB5A 2GTUA 3B6AA 3MDKA 2YU9J 1Z7UA 2HKXA 4F9ZA 3CP8A 4M3DA 1ZLKA 1MBHA 5IMZA 2VL2A 4CGZA 3CSIA 3F6DA 1GSEA 1THOA 3HPHA 4ZDOA 2R0GA 2LKSA 1RC9A 4NV5A 1K79A 4KSOA 2BEOA 1WIKA 2ZMEA 4LJZF 4RDUA 4FO5A 1B1BA 4L18B 1Z0XA 1YJ6A 3HTSB 2WDUA 4DW6A 5DCMB 3KZYA 2P7CB 4XK4A 1FOXA 2L0KA 1U78A 1F1ZA 4IL6C 2PVOC 1R4MB 2F5EA 3EU4A 3L2WA 1ERDA 2DT7B 1CQHA 1MKMA 4HLXA 4M6VA 4CCJA 4ABZA 4ML6A 1RW1A 2EJRA 2GOMA 4GWRA 5ILSA 3TJFA 2P5QA 3QYBA 1KU2A 1PX7A 4I02A 2L7FP 2V2GA 5FLVA 4AGSA 2XASA 3E6CC 3QOEA 2E1MB 4RGSA 1RR7A 1MDMB 2KRCA 3MFKA 2VKEA 2VOOA 3RZOJ 3VWVA 4DEJA 3AFHA 1X2NA 4HA8A 3E6BA 4YIFA 3FYGA 5JWOB 1WJCA 1NK2P 4UV8A 2O89A 3GCMA 2BE5F 2EIMH 2R7QA 2WV0A 3S93A 3ZQ7A 3R60A 4XSXF 1IJWC 2Q8KA 2BY3A 1XWGA 5IO2A 2CZ3A 5D73A 1B4PA 2C3QA 3E5QA 2XVCA 4DSSA 1S3AA 1A6QA 3P9IA 1KU7A 2NVXJ 2XV4S 1YW9A 3WGIA 2GIZA 3K6GA 1WVRA 3KH9A 1ERUA 3ZCOA 1V98A 4RQRA 3NWTA 4OWYA 1TNSA 1OQYA 2CAQA 2N5FA 4LL4B 2P5RA 3PGTA 1S7EA 2GZYA 3G9BA 3NEUA 2IAIA 4RAYA 2AXTC 2Y69H 2YPMA 2E7XA 3G4SI 4YQVA 2X6OA 2L9NA 2VONA 1MSEC 2L57A 3FW2A 3S14J 3HVSA 4OO5A 4HU7A 3CCVI 1L0OC 4A3KJ 2PU9C 4HRIA 2IPAA 4NBQA 1OLTA 5D9WA 1VTNC 3JRGA 2KL4A 3F4SA 6GSWA 1U6GA 2LOOA 1S3CA 2HU9A 2ACJA 4FQUA 1EKEA 3EPZA 5ECHB 3GIXA 1LFUP 2Y2ZA 1LUJB 2L2OA 3A2KA 3IAS2 2V1NA 3L00A 3OS2A 1IW7F 2JL4A 2XPDA 3TRPA 4X43A 1ZHFA 2I4AA 3I43A 3E6DA 3S2HJ 1QHHD 1S7AA 2R7FA 4B43A 3GTKJ 5KN1A 1YEPA 4I09A 4XHMA 2VBWA 5FWGA 4XLHA 5HR3A 2EIOA 5GTIC 1NTCA 2RUFA 1X1BA 1DP3A 1O6JA 1HKSA 1TRWA 2A4VA 2A6TA 3S1QJ 3H3UA 2DJ2A 3F6FA 1X3UA 3G7JA 3MAJA 1YJ9I 2XB0X 4XTSA 2H8WA 4BL0B 5K1YA 2P8TA 3DTKA 2LVSA 1IRGA 1TWAJ 2H1GA 3TOUA 3WTZA 1YLFA 3TGNA 1WRJA 2V9VA 5M5WJ 3GZ5A 3IAM2 5JHUA 2HOAA 2K8VA 5CRDA 5D4SA 2ZJQF 1TU7A 2G7UA 2Y0SN 2XSJC 4Y3OA 1A0RP 1XWKA 3GTQJ 1TWCJ 3C7JA 4D1QA 1PUFB 4BPYA 2M34A 4EQQA 5DUIA 5ELAA 2I9HA 1J59A 1FC3A 1WH7A 4HSRA 2JU5A 1Z67A 2VD0A 2Z33A 1ZZYA 4D5FA 2H1DA 5E3LA 1BYEA 3HTUA 1HA8A 2IWTA 1KU9A 2JADA 1DE1A 3CCYA 2Y48A 5FFZA 4PGHA 1QGVA 2ECCA 1MDKA 3VURA 2XKOA 5K5OA 5D9TA 3BWGA 2E60A 2Y31A 2P81A 4V2LA 3APQA 4L8EA 2R7DA 4LA1A 3F21A 3H92A 2L7MP 4XRSA 4BQQA 1FTZA 1B48A 4ZL8A 4TW5A 2WS2A 2H94A 2PMHA 4RS8A 2EFPA 2NVUB 4D73B 4LLLA 2GAUA 3VYUB 4BVYA 4Y15A 2EC4A 4LOCA 5HVQC 3BJ5A 5BPIA 1Y39A 5ICFA 1F3AA 1Q98A 1O8WA 3IH3A 5CREA 3W6JB 1SD4A 3FMRA 3IWZA 4UVAA 1ZR4A 4DQ2A 4EJTA 2NOJB 3F3RA 1MEKA 2LP0A 4J2FA 2NBSA 4A3DJ 4XS4B 3TKSC 4LIUA 2DA5A 1UHMA 1EH6A 3APSA 2O3FA 2RAEA 2TCTA 3A02A 2A6HF 3M3MA 2CG4A 2ZNMA 2BVLA 2X6YA 4LG0A 4C3HJ 2BV6A 3LNQA 2WRTA 3RQIA 2X99A 4K9ZA 3WGXA 3NRVA 3MZHA 2QZ8A 4IKFA 2IS2A 2KLXA 2R2JA 4IQJA 3CTFA 4EV0A 3F3QA 3DEUA 4JOMA 1H75A 3R6SA 4PXOA 5GZZB 4HNTA 2HR3A 1BEDA 2C0DA 1TWGJ 2QQ9A 1ON4A 4K7OA 3IC4A 3C1SA 3ZMKA 2HRNA 3BG6A 1JUPA 1YIOA 1D8KA 4NB5A 1R5GA 4F92B 4RM3A 3JRBA 3JRCA 1ERVA 2HDWA 4NQWB 2J5OA 1OCTC 1G0TA 2E0QA 1AIUA 2M1BA 2CV2A 1ETXA 1HQOA 2K9MA 4CXFA 1TBXA 3BPVA 3OYHA 2VPRA 4BQNA 4MP4A 3HBLA 2FX0A 1MGTA 1TC3C 3QPMA 2QUFA 5E4WA 1BC8C 4KIBA 1FOYA 3WGDA 3RTRA 3ZREA 2H1KA 1UC7A 2GQQA 4BS9A 1X2MA 3EUHC 2B63J 1X5EA 5KEJA 3OWTA 4UV9A 1P2FA 3HHHA 2JQ7A 2RM5A 4MF5A 2OQGA 1TP4A 5G31A 5IMCA 2X85A 4EM2A 3VOEA 2RREA 3FXJA 1IRZA 2HRAA 3TOTA 3S8PA 2M72A 4KCEA 3HJEA 3MKLA 1U88A 1MNEA 1YKCA 3CMAI 1KYWA 1UELB 1C72A 1WWJA 4MLYA 3QAVA 2EA4A 2QENA 1YITI 1ZCPA 3BPXA 3LWFA 3CDLA 2QKMB 2DYSH 4MHGA 3S32A 2B3SA 3PINA 3C18A 3US3A 4D7MA 1E6BA 3TL4X 3SBCA 2Q2EB 2X9DA 4BXXJ 5HR0A 1XWCA 1I9DA 5CQEA 2VKDA 3OMYA 5HS9A 2CH0A 3GLXA 2CYYA 3WG7H 1YEXA 3UVTA 4N4NB 1XMKA 3HOYJ 2GSSA 2OU2A 4MMMA 4Z7XA 3CUQC 2D45A 1RETA 4Y33A 3IKTA 2R5ZB 4L9TA 2KKOA 5AISA 4F0CA 3OYFA 4W1UA 1I39A 2MLKA 2OC6A 5F05A 2I8DA 2CGPA 1PMTA 4Y7NJ 1W4MA 3S1RJ 19GSA 1D0XA 4EM1A 1XWAA 4YQMA 2I10A 2Y0MA 4A3GJ 1KA8A 3AL0B 1IXCA 3GEZA 5B8AA 3H8QA 4PUFC 2V9KA 1ORKA 3K4MA 5HDNA 1OJLA 4XIDA 1UB9A 1Z9CA 5AIXA 2OTLI 1ZGAA 5HFGA 1TQMA 1IZ1A 4QSHA 2BXZA 5J6XA 2B7JA 3HUGA 3QYFA 4HSCX 1HW5A 4HOJA 1XIYA 1POGA 1PL2A 4UVCA 2CO5A 4AVZA 2H1LA 1JKQC 3FEUA 1X9MB 2R7OA 1C0WA 1D0ZA 2A6EF 2JMWA 2CS3A 1FG4A 2HZEA 4DVCA 2DMPA 1ONVA 3UARA 2YS9A 2PG4A 2X6XA 1AHDP 4XL9A 4EJUA 3IHQA 1DGWY 2XRNA 3SWLA 3A2XA 2V7FA 3OYEA 3NAUA 1HKTA 1TOFA 3FZ9A 2XUBA 5LEJA 2LNTA 4CCOA 1PN9A 3QFBC 5IQYA 2FD5A 1BJZA 3GTJJ 2OQRA 1WPKA 4RAGA 2H19A 2WJUA 2YN1A 3P2AA 5BMUA 1WOUA 4HSTA 1SMYF 3W3CA 2IGOA 2OBIA 2IN3A 1F37A 5JCUA 3H3ZA 1RPWA 3VODA 2QSGX 2MBFA 4XRDA 4CY8A 3ZMTA 4EC0A 3Q74A 1JGGA 3H9GA 3TJKA 2DOFA 4KN7X 2H73A 4IEJA 4I0BA 1F6MC 2DU9A 2B5XA 3CD6I 2X0LA 3HG9A 1MNDA 3KE2A 3KP9A 4IJ3A 1PVEA 4PFPA 1D5VA 2HZFA 1TQPA 2YANA 3IKVA 4F3QA 3DLAA 1B9NA 4FTHA 2HQ5A 3JRAA 3I6AA 3GKKA 5K7HA 3DWLE 4EGZA 4KITB 3W6VA 2FEZA 5TRDA 2FRHA 3SDGA 2ZKZA 4LD5A 1GUKA 1PKWA
chains in the Genus database with same CATH topology
2R4VA 4G0IA 4IGJA 3EVIA 1M2DA 4ZDPA 3DMLA 2NPBA 2V4JC 5CO3A 1BR1A 5J41A 2Z9SA 3L9SA 3QD9A 1FOVA 2A2PA 1LBKA 4O7HA 4NMUA 1X1AA 2FY6A 3APOA 3DPLC 2JA2A 4H86A 5AIVA 4CUGA 2PUKC 1LKXA 1ZYPA 2VCTA 4DBQA 3LSHA 2H1BA 2H76A 1X5DA 4MJCA 1YX3A 3L4NA 1X4OA 3D0ZA 4LL1B 2F3MA 3H9QA 5CPRB 1GTIA 1F3BA 3IR4A 4E8EA 2CVKA 3K4JA 3VSLA 2VJJA 1R26A 1A24A 2DKHA 2E5ZA 4K6XA 4IJIA 4EKZA 4K7IA 3DTIA 1VF3A 4WR5A 2CAIA 5JWRB 1XW6A 2WAEA 3BBYA 3TKRA 1NG7A 2F5VA 3GSTA 5G30A 1Z7RA 3OYMA 4LLRA 4E7LA 2A2RA 4PSWA 3F4TA 3GRXA 5HR2A 1V5EA 4XOTA 3OYKA 4Q5RA 4GLTA 2ELJA 1AAZA 2KRHA 3D22A 2VM1A 3OOUA 3GA4A 2H8LA 5DQSA 4EIQA 3WYWA 2HT9A 1PYVA 1J08A 4F93B 1GNEA 2LBFA 1THXA 3OIPA 1D1CA 1S9HA 1Z3EA 2W82A 2ZSHB 2MD0A 4IQ4A 3OS0A 3D4MA 4KDUA 4O5RA 1TK8B 4XN0A 1UVZA 1TU8A 1R6RA 4IN0A 2HSYA 1E0EA 2GSQA 1ILOA 4BE2A 2WAQA 2PMTA 5ELGA 3A1YA 5F06A 2R7UA 3HVVA 5DJLA 1BOBA 2FUG2 5ECQB 1MDJA 4GXZA 1I5GA 2LQQA 3RQ4A 4XS6A 2O85A 2WCIA 2RIIA 1EWXA 4YKGA 2RUEA 1XFLA 4MCUA 4WEYA 1TK0B 1TJDA 4BWQA 2HI7A 2HVQA 3SZGA 1YQ1A 3E0JB 4BL7A 2RM6A 4C9YA 1FHEA 2LC2A 2F8AA 1IYIA 3IK9A 3ZZXA 2M4KA 2CQ9A 1JHBA 1SU9A 3I69A 5COHA 3VWXA 4I2TA 2WFCA 1VZ0A 2WADA 3CP2A 4BJTA 3RPNA 3OYDA 4CHSA 1SK1A 2ZFUA 1GLNA 2C80A 4WKWA 1TW9A 2KPMA 4XM3A 4FYBA 3ISOA 3LJRA 2CZ2A 3KIJA 3V42A 17GSA 2BTOT 4JZQA 3KTBA 3OYAA 4H4KC 1A8LA 1S3DA 4BWSA 1OC8A 1SL2B 2IGNA 3QMXA 2I3YA 3VPTA 2GOXB 2NTOA 2WGRA 4KW6A 3KEBA 4F55A 2X51A 18GSA 5B6NA 1ZYNA 4K5SA 3ZL5A