2FUG2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase chain 1
total genus 43
structure length 178
sequence length 178
chains with identical sequence B, K, T
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2fug201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fug202
1EGRA 3E0UA 3HJOA 3QCPA 3FW2A 1SJ6A 2MYGA 1M2BA 1R5AA 1WRYA 1VF4A 5KEJA 4G2EA 2HFDA 3TKQA 2A4VA 4MJAA 1X9SB 1TDIA 5DAKB 2AV4A 4EC0A 4EUYA 2CA8A 1FG4A 4EXJA 1JHBA 3TOUA 2DJJA 3HVXA 2YCDA 17GSA 3W8JA 2H8LA 1BX9A 3O76A 3VFIA 1RW1A 3F63A 4RUVA 3TGZA 1T7PB 1ZGNA 4DEJA 1NHYA 1FOVA 1EV4A 2G0FA 1S3DA 3KJYA 1TRUA 2WZ9A 2N5BA 1PN9A 2GDRA 3A2WA 1J0FA 3E3EA 1HQOA 1AAZA 4EL1A 2DMMA 4J57E 3IE3A 3C1SA 2H70A 2RLIA 5DQSA 3L9UA 2B7JA 2H75A 4KE3A 2YANA 2LQOA 5HR2A 4TOPA 5EY6A 2ZCTA 2HNLA 3HKRA 1T4YA 2IPAA 1BAYA 1FHEA 2FA8A 3HVVA 3V1WA 4KAEA 3W8SA 1AQVA 3KMNA 4GTUA 4D73B 1SL1B 1SENA 1YZXA 5A4UA 2MMZA 5IMAA 5B7CA 2R2JA 4GSSA 5JWQB 1EGOA 2YWOA 4KA0A 1QXHA 3BCIA 2A2SA 3ZMKA 5DALA 5G5FA 2E2MA 1H75A 3GH6A 2GSRA 1WWJA 4V2LA 1T8EB 1NM3A 3FR3A 3IOSA 2GQLA 1WPIA 1XVWA 4F82A 4XS4A 2C3QA 3DYRA 4DSSB 4K9ZA 3W6GA 3L78A 2O7KA 2H6ZA 3TOTA 4TR1A 4YAPA 1A8LA 1AUCA 3ZMLA 1YF0A 3UJ1A 1EOHA 2CVKA 2AYTA 2FWFA 4TN8A 1Z7RA 3VLNA 4X43A 1OYJA 1R5PA 3UBLA 3NOFA 4EO3A 5L71A 4MF7A 4TXVA 4QL7A 2BMXA 1OC9B 3AY8A 1Z3EA 2DJ2A 2G2QA 1R4WA 5IMDA 2OE1A 3TJGA 3ME8A 3GKXA 3L0HA 2PN8A 5LCZA 1GL8A 1R26A 5LNKe 1PGTA 3A3TA 2B5EA 1ZOFA 3KIJA 4POLA 4F0CA 2VOCA 3GTUA 1WP0A 3H93A 2VLVA 1B4PA 4WXTA 3D5JA 4MA9A 4MZCA 4J2FA 1RK4A 1AXDA 1Y25A 5DCGA 4GSNA 2B7KA 2D2ZA 4PXOA 3QOUA 2XBQA 5DDLA 3N5OA 1TRWA 2HYXA 4XTSA 1GSQA 1O81A 2VAFA 1M9BA 1YJ6A 5IIZA 5GZZB 5ID2B 4YQVA 2CVDA 3IDVA 5G5EA 2PVOC 3EU4A 2C1YA 1EV9A 5ECLB 2AUVA 2FD3A 1GUKA 3ZVJA 1UVZA 1XBSA 3MAKA 4HS1A 2VCXA 2CZ2A 2GQMA 5IMCA 3GNJA 1B4QA 3EMPA 2H76A 1U88A 1ZYEA 2IMFA 4GCIA 1TI1A 3ZTLA 4CDOA 2H71A 1JZOA 4KDYA 5FHIA 2YPMA 3KM6A 3QMXA 1Q4JA 5EVOA 3RDWA 2LJKA 5J5NA 4PUAA 2L4CA 1XWBA 1PKZA 3TKSC 5DJMA 4F9ZA 1A24A 2HXKA 2A2RA 3IAM2 5ABRA 6GSYA 1N2AA 5GSTA 2C0DA 4F2IA 3GV1A 1G6YA 2WS2A 3TRPA 3D6IA 2EIQA 2VCQA 19GSA 5AISA 3CMIA 5INYA 4TR4A 1TK0B 1KBNA 2NBSA 4NWYA 4XRDA 3P90A 3HCZA 5DQYA 1GSFA 4PURA 12GSA 1LJRA 3FY7A 4NV5A 2X8GA 3UEMA 2IJYA 2OA7A 1AW9A 4LMWA 1EOGA 2LTKA 5HQPA 4WKWA 3HJPA 13GSA 2E7PA 4WBJA 9GSSA 1ILOA 2LRTA 1USBA 5HFIA 4K7IA 4HDEA 1MTCA 2WGRA 1K0MA 2FHEA 1GUMA 1VGLA 2BTOT 3VPTA 1ON4A 5C00A 2YJ7A 4PNFA 3GKNA 1XFLA 5B6NA 2N5AA 4MPFA 3ME7A 1ZZYA 4O5RA 2M46A 1QK8A 4BA7A 1GLPA 1K3OA 3C71A 3H4KA 3TJJA 3GHAA 4IS0A 4HU9A 4KB3A 2FCHA 4MPGA 2K18A 4PX1A 3C73A 4QL9A 5IOWA 1TP9A 2PMTA 5IO0A 3KD0A 1DE1A 5A4VA 2NPBA 1B9XC 4ZBDA 1PA3A 1FB0A 5IPGA 1LBKA 3LFLA 5ECKB 5KN1A 3D0ZA 3I69A 3QPMA 2JSZA 4JU5A 3CSHA 1ABAA 2XC2A 3Q18A 2V6KA 3MWHA 3ERFA 2FLSA 1G7EA 5CRGA 2H01A 4FIWA 4IQ1A 4HZ2A 3F0IA 1SL0B 14GSA 2CX4A 2C0FA 1EWXA 1SD9A 2NVLA 5ECSA 3IAS2 4GRFA 4OCEA 3QAVA 1T3BA 2YOIA 1SK2A 1OE8A 16GSA 1M7TA 1MD3A 2CX3A 3KXOA 1WE0A 4EE0A 4NXIA 4NPBA 2IN3A 4XHMA 2KHPA 1GNEA 3GRXA 4XS6A 3WGDA 3VI5A 1XWKA 4I6XA 4ZXGA 3KGKA 2YNXA 4NV2A 2H0GA 1GSDA 2ON7A 1K0NA 4IW9A 3IK9A 1K0DA 1M2DA 1TTZA 5HR0A 3WGXA 4MDCA 1A2MA 4ILFA 3EU3A 3KMOA 2J9HA 3US3A 2IMKA 3F3QA 1T00A 4Q5NA 3GX0A 3ZFBA 1O85A 22GSA 5DAKA 1DSBA 5COHA 1ML6A 3H1NA 3UOMA 2H74A 3GKKA 5B8AA 3ZITA 2IWTA 3F4SA 4K1FA 3DWVA 2VCVA 1PQNA 2MMNA 2B1LA 2VM2A 5ECQB 2OJLA 1KEBA 1SYRA 3GFKA 4TKYA 1G6WA 2OE0A 2MBSA 3GMFA 4FYBA 3MNGA 4D73A 2IMDA 5JCWA 5B8BA 2VL3A 3J7Yb 5E59A 4V1Ap 3G7YA 3TKSE 3L9SA 2HE3A 2GSQA 5ENUA 3LXTA 1ZL9A 1QQ2A 1YEXA 1FAAA 4TXOA 4HEA2 4V1Ag 2GSTA 2YZUA 4IKHA 2H0IA 3SWLA 1FVKA 2LV3A 2CAQA 2K6VA 2O85A 5A5KA 5F05A 3TDGA 4ML1A 2JL4A 2FNOA 2GSSA 4KNDA 6GSTA 5AIVA 3GN3A 1A0RP 1FW1A 2GGTA 2KP1A 4F0BA 3A2VA 1S3AA 1O8XA 5B6MA 4ZL9A 2DJ3A 1M9AA 3IK7A 3KTBA 4CHSA 3FZ4A 2H0HA 4K2DA 2VL2C 7GSSA 4ZBBA 3RBTA 5J4UA 4KSMA 4IQAA 2HZEA 2RM6A 5ECPB 1F3BA 2FA4A 4WBRD 4EDYA 2I9HA 4ZL8A 1U6TA 1XWGA 2GZZA 4ACSA 1X5CA 4GXZA 1FB6A 5CRWA 2LUSA 2H66A 5ECMB 2E0QA 5IMFA 4OFTA 1XOBA 3G9BA 2L57A 5IO2A 6GSUA 3WD6A 2O8VB 2L4QA 3HXSA 3N9JA 3F4TA 2PPTA 2FY6A 1YDKA 3CYNA 1EEJA 3VWXA 1TK5B 4EVMA 3U5RE 3CSJA 2GVPA 2I3YA 1VF3A 3FYGA 5C04A 1FVJA 2L59A 2FWHA 4IVFA 2LJAA 3EE2A 2M72A 2PGTA 3UVTA 2LEGA 2GT5A 1C72A 1Z6NA 2IL3A 4LL1B 3FEUA 2IMIA 2C8UA 1XWCA 3TB2A 2X8CA 1B9YC 4MP4A 2HI7A 3TJKA 2NTOA 3CXGA 5E4WA 2N5FA 4ECCA 3LJRA 1X9WB 1WJKA 1SYXA 3G7IA 1SD8A 3UL3A 5EL8A 2OACA 3QFBC 2F8FA 2Z9SA 1KNGA 5G1KA 3TUEA 3IBHA 3QDNA 5F8BA 3IXRA 2H30A 20GSA 3FZ5A 3GYKA 2JZRA 3GKMA 3OR5A 5A4WA 2LJRA 5J41A 4DSQA 3TKSA 4OCFA 4WR5A 3L9VA 2VD0A 4ECBA 1PRXA 3DIEA 3HZ4A 2BJXA 1SU9A 1JFUA 1XW9A 4HQSA 2HLSA 2HT9A 1UC7A 2CQ9A 3F6DA 2LRCA 4FYCA 2LQQA 1OKDA 2X99A 5GAPD 3EC3A 3GA4A 1OC8A 2R5GA 2FUG2 2GTUA 3PINA 4DSRA 5DVBA 1HNAA 5JWOB 1WOUA 3FKFA 1DBYA 1TI3A 4ML6A 1BQ7A 3ZZXA 3RPNA 4DVCA 5CNWA 2VIMA 1V57A 4TXOB 3GTUB 5ID2A 1F6MC 2CAIA 2FGXA 3IHQA 1TKDB 4PGTA 1M0UA 5CP1A 4WF4A 2REMA 3TRQA 4X0XA 4L8EA 1A23A 5JWRB 1GRXA 2XPDA 4OFNA 1W89A 1JZWA 5DALB 2P0GA 4POMA 1IYHA 4TR3A 1GULA 4I2TA 4LA1A 4I97A 1JZRA 2GQKA 1FO5A 3P7XA 3TKRA 1ACVA 3HZ8A 3TJFA 1AC1A 5KN3A 2AHEA 1QGVA 4O92A 5JCUA 2PVQA 4MF5A 1TK8B 3WT1A 1K3YA 1OVNA 1PL2A 4L5OA 3FR6A 1EP8A 3IPZA 3EMXA 2VCWA 2HSYA 4MABA 3VPQA 4CW9A 3GIXA 1OC9A 1QFNA 4RI6A 8GSSA 4Q5RA 3LXZA 3UIWA 4YH2A 3ZRDA 2DJKA 3M9KA 4JE1A 4ZILA 3M3MA 1ERUA 3LEFA 1V98A 2L5LA 4G10A 3NIVA 3IR4A 2L6DA 1QMVA 3KEBA 3H8QA 1GTUA 4ECIA 4K8MA 4POBA 4Z7XA 5CRHA 3HVSA 1MEKA 1XCCA 1YEPA 2DBCA 3KCMA 1GP1A 3CRUA 2DC5A 3F3RA 3HYPA 4PQ1A 4G19A 1URMA 3PGTA 1ERWA 4KDXA 4JZQA 3ERGA 5DBQA 1XIYA 2O89A 1JZDA 2M80A 2WB9A 2WDUA 4HQZA 5CO3A 1CQGA 4H86A 4YQMA 1K3LA 5J9CA 5D9XA 4JR4A 3CRTA 2VUPA 3DVWA 4WEYA 1N8JA 2C4JA 2GT6A 3KP9A 4ZB8A 4PQHA 2V6OA 1PX7A 3LGCA 1BYEA 2ZUPA 2VD1A 4KW6A 5FT3A 1OC3A 5D73A 1PD21 3HD5A 5KN0A 2ALBA 1YY7A 2CZ3A 3D22A 1U3IA 4FO5A 4OWYA 4ECJA 3ZLPA 4PQIA 3QD9A 2WRTA 1HNCA 4I8BA 3GL5A 2RUFA 4YQUA 4GQCA 1GLQA 1GTBA 1TOFA 3D21A 1O8WA 1DUGA 3ZL5A 3GX8A 2MMAA 3CTGA 1VRSD 4OMVA 4JR6A 2VL2A 1RQMA 2VL9A 1R7HA 2C3NA 3I6AA 1BEDA 3F6FA 3BOAA 3CSIA 5F06A 2P5QA 4ULXA 1TW9A 3HHVA 4O32A 6GSWA 4HJ2A 1K0CA 4LLRA 1V58A 5KN2A 2GS3A 4RQRA 1AQXA 3GSTA 4QQ7A 1XW5A 4YAVA 3KTLA 1O7UA 4WETA 4V2NA 2WCIA 1V40A 2FWGA 5F0GA 3HA9A 2OKAA 2MBTA 3DMLA 4MJBA 3EYTA 1O6JA 2YWIA 2H72A 1SK0A 2GLRA 5IPHA 3C1RA 1Z9HA 4K6XA 1VF2A 2C80A 4HJMA 4HOJA 3RAZA 3VWWA 5GAND 3LYPA 4XIHA 4HI7A 2QC7A 4TR0A 4JBBA 4N10A 1A8YA 3APSA 1SKRB 4TR1B 2OE3A 2K8VA 3M8NA 3PH9A 2X8HA 4XS4B 1AIUA 2ZNMA 1A2JA 3DVXA 1WIKA 3ZIVA 1HD2A 1U3AA 2IMEA 1SK1A 4L5LA 4GQFA 1XZOA 2V41A 3L4NA 2O87A 4GLTA 1F2EA 5G30A 1VF1A 1JLWA 5ECHB 3S9FA 6GSSA 3DRNA 4KCEA 5FWGA 2H1BA 1BG5A 1H4OA 1EP7A 1I5GA 4Q5FA 2ON5A 3F9UA 5AN1A 5HFKA 4I5QA 4OFMA 1XXUA 1GTIA 2F8AA 2HSHA 2LS5A 2YN1A 1I9DA 1NSWA 4GF0A 3IV4A 1ERTA 3P8WA 3KZQA 1YKAA 2LRNA 2HZFA 4BWQA 3TKPA 2EC4A 3Q6OA 1Z7PA 4N30A 1G7OA 1GWCA 1SKWB 2KOKA 4X1UA 2TRCP 1X5EA 5LD0A 4HU7A 4TRXA 4IP1A 1PKWA 2R4VA 2H1AA 2LKUA 3APOA 1NW2A 2H19A 4KDUA 2R6KA 4BVYA 3UVHA 2KLXA 1MDJA 2F3MA 2PU9C 4AF2A 3TJBA 2V2GA 4E8EA 1K0OA 1IYIA 1SJZA 3O3TA 2MMOA 5IMVA 4MH2A 4JEDA 5F07A 4OO4A 1UN2A 1SL2B 4ZB6A 2WULA 4MZBA 1LU4A 2JACA 5D9TA 3R2QA 2H1GA 3CBUA 1TU8A 4NHWA 2OBIA 2C0EA 5HR1A 2OADA 3TCOA 2GZYA 2R3XA 2OBKA 3NZNA 4IBPA 3HY2A 5IOXA 5ECIB 2VO4A 1CQHA 2H1DA 1AQWA 1XPVA 11GSA 3FRCA 3LG6A 5H5RA 3VI7A 4NMUA 5D9WA 3H79A 3MDKA 1GSYA 3D4TA 1M99A 1O73A 1OE7A 5D93A 4MK3A 5J3RA 3CTFA 3O6TA 1XOAA 3UBKA 3VWUA 5EPFA 2XPEA 3M1GA 3P2AA 4BWSA 1ZYQB 4J56E 2TRXA 2DJ1A 1ERVA 2F9SA 5D96A 4P3YB 4Q5QA 1TXXA 1TJDA 3WGEA 2LSTA 2XHFA 1S3CA 4MH3A 2PUKC 5G31A 3GSSA 3KH7A 3EWLA 4IN0A 5IM9A 1TRVA 2AJQB 2X64A 1GSSA 2C3TA 4KGIA 4N0VA 1YKCA 1WMJA 4L0UA 3FZAA 1T4ZA 3LSZA 1Z6MA 3GL3A 3DEXA 4DSSA 3I43A 2B5XA 1PSQA 5D8IA 3ZVJD 3EVIA 4RI7A 2EIOA 3DKSA 1Y6EA 4MF6A 3HDCA 4MJEA 5J9BA 1PX6A 4L0WA 4IP6A 4RQXA 1BJXA 2JU5A 4N0ZA 1K0AA 3BJ5A 2IFQB 5CYYA 3GUSA 4XCSA 1V2AA 5AIXA 1GNWA 3GURA 4WR4A 18GSA 3A5WA 4AJ6A 2NDOA 3E9JB 1Z5YE 4FH8A 3BBYA 2GZPA 1OKTA 1A0FA 2F51A 4PNGA 4K0GA 3UMAA 1TU7A 2L6CA 2V1MA 4OD7A 2YJHA 2YWMA 2DJ0A 1JLVA 2PWJA 2RUEA 1YQ1A 1QUWA 3DD3A 2JZTA 3MSZA 3KP8A 2WFCA 2VLTA 3A2XA 3FZ9A 5DCHA 3ED3A 2HRNA 4KSOA 2JADA 1XVQA 3FHKA 2TIRA 1YF1A 3UAPA 3LQ7A 5AGYA 4LL4B 4EF0A 1J08A 2C0GA 2IIYA 1GTAA 1EZKA 1XWAA 1J9BA 3LWAA 3BCKA 1W4VA 1MD4A 1PMTA 2H73A 3FK8A 1X5DA 2P5RA 4IJIA 4JRRA 2L5OA 3WT2A 1DE2A 2HZEB 3HJMA 3G7JA 4ZIJA 1SJIA 1HYUA 4N11A 2VCZA 5HR3A 5ELAA 2R37A 5G2ZA 2V32A 3EURA 1NHOA 3QR6A 4FYUA 2B6MA 4IGJA 5D9VA 3U6VA 3M9JA 2QGVA 4IHUA 1MDIA 3ZYWA 5IQYA 1ZMAA 2EIRA 2PBJA 1THOA 3QAWA 3Q19A 3VWVA 6GSXA 1X9MB 5G1LA 4AGSA 3IA1A 3JCML 1ZCPA 1TRSA 4ZBAA 2DMLA 1ST9A 5CRDA 2ES7A 1HNBA 5ECRB 1T1VA 3ZIJA 1X0RA 4TVEA 4MMMA 2YV7A 3EINA 4IJ3A 3VURA 4ZL7A 1G0TA 3UARA 2HRFA 2QKEA 5GSSA 5ELGA 2PERA 2KP2A 1GSUA 4OO5A 2B5YA 2WJUA 2RM5A 2H6XA 2VCTA 2YZHA 3F4RA 1B48A 3RPPA 5H5QA 3F8UA 4E8HA 4MZWA 2YV9A 4MCUA 4MLYA 2K9FA 3LORA 2I1UA 4G9HA 4K7NA 3Q74A 2CVBA 3ERWA 3C8EA 4NAXA 3TRXA 4POKA 4V2MA 3K8NA 3D4MA 1E2YA 2YP6A 1K0BA 2DIYA 10GSA 3SBCA 2B1KA 4KX4A 3PR8A 4BPYA 4MJCA 1GSEA 1U87A 1F3AA 3GH9A 3I9V2 2AAWA 5DJLA 2MZCA 1SKSB 5H5SA 3APQA 3J7Yk 2H6YA 2YWNA 4GWRA 4WF5A 4AJ8A 4I2UA 1V9WA 2B3SA 3QAGA 1PL1A 2RIIA 4EKZA 4XRAA 2QSIA 1KTEA 1MDKA 1UA5A 3QFAC 5JCGA 3M0FA 1XW6A 2E2GA 2JZSA 4GSTA 3DXBA 4XS1A 3IC4A 4EDZA 2AB6A 1E6BA 4AJ7A 2I4AA 1GUHA 2P31A 2LNTA 2K8SA 2VM1A 1A2LA 4K7OA 3RHCA 2FWEA 1THXA 3C7MA 6GSVA 1M2AA 2VLUA 2IFQA 4ID0A 3WYWA 3ZREA 2CV4A 4HZ4A 4NHZA 4KH7A 3ISOA 5ECOB 4BL7A 4HUAA 5ECNB 4TW5A 5CAXA 2I81A 5IMZA 3ZFLA 3KH9A 2LNSA 2DSAA 1B8XA 1Q98A 4KCAA 3IRAA 2JSYA 2KUCA 1F37A 2CT6A 3LYKA 3RHBA 1OAZA 1EEMA 4PUFC 2J23A 4IELA 2DIZA 4BVXA 4ZB9A 5CREA 2DLXA 4O7HA 3VK9A 3FR9A 5HFGA 2XBIA 3BD2A 4ISDA 4KUNA 4LMVA 4K0NA 4F03A 1F9MA 1GH2A 3DGQA
chains in the Genus database with same CATH superfamily
4KT5C 1U8BA 3E0UA 1EGRA 3BT9A 3HJOA 3QCPA 1LEBA 3FW2A 3WU2C 2GOMA 1UFMA 2LREA 3VYTB 5D4RA 2EV6A 3WTUC 1JJ8C 1SJ6A 3H0GJ 1YI2I 2IW5A 2M34A 3C1DA 4KITB 3M07A 1JKPC 2MYGA 1M2BA 3CC2I 1R5AA 4Z2UA 2RQPA 2K9LA 4BJ5C 1UG2A 4N9HA 3JRHA 2O0YA 1S72I 1WRYA 3FXQA 1Z1DA 1VF4A 5KEJA 4G2EA 3E3VA 4C30A 1D5YA 2DA4A 2HFDA 3TKQA 4BAYA 2A4VA 4AVZA 1KU9A 1XD7A 4HRIA 1TDIA 4XRMA 4MJAA 5DAKB 1X9SB 5FLMJ 2PQ8A 3C2GA 5GAEJ 2F5DA 3HRTA 4A93J 2AV4A 4EC0A 4EUYA 2O9LA 3F8MA 5EJCA 3OWTA 2CA8A 3S1NJ 2HWVA 1FG4A 2XAFA 4ESJA 5HNHA 4EXJA 3QOPA 3TOUA 1SFXA 1JHBA 4B8XA 2DMQA 2A3SA 1TW3A 2DJJA 3HVXA 2YCDA 3N97A 3ELKA 3UVTA 1KYWA 3JRDA 17GSA 3M8EA 2AXLA 3W8JA 1UAAA 2H8LA 1BX9A 3O76A 2HTSA 5JI6A 3VFIA 1RW1A 4Z2TA 3F63A 4RUVA 3TGZA 2VI6A 4IX7A 3VFZA 1ZGNA 1T7PB 3QPLA 5IOYA 4AIHA 4A3BJ 3WU1B 3HGGA 2HDCA 2H6CA 1NHYA 4DEJA 3ABUA 5KOWA 1ONVA 1EV4A 1FOVA 5BS6A 3RPUD 1BR1A 3X2QH 2CQQA 4N0BA 2G0FA 2CYYA 2MC3A 1S3DA 3KJYA 1R58A 1BL0A 1ETXA 4LG3A 2ZJQF 3ZMTA 1S3JA 1O3SA 1Q1VA 2VQLA 1TRUA 3DCFA 2WZ9A 2N5BA 1ZR4A 1IC8A 4LJZF 1PN9A 1VFCA 2GDRA 3A2WA 1J0FA 2QKMB 2HNHA 3E3EA 3H35A 2DDAA 1HQOA 2M5WA 4FETA 5BPIA 3KCCA 1BIAA 4Z6YA 4RB2C 4BXXJ 1AAZA 3GTLJ 4EL1A 1T2KA 5E3NA 4BL7B 3GUDA 1R00A 1G4DA 3KEQA 1RUNA 2ME0A 2DMMA 3C1SA 3IE3A 4J57E 1GLNA 2K4JA 4A0ZA 1DUXC 2H70A 1VQPI 4S05A 3HDDA 2RLIA 2GA2A 1QPIA 3L2UA 5DQSA 1EJ9A 3L9UA 5GTIC 1ZELA 4F93B 2B7JA 3IH3A 2GXAA 2H75A 4TV7A 1TC3C 3ULQB 4UV9A 2DCEA 4KE3A 2YANA 2LQOA 5HR2A 3I4PA 4TOPA 5EYRA 3QP5A 1O4XA 2ZCTA 5EY6A 3C2BA 4ANJA 2ELJA 3AFHA 2YX4A 4U7DA 5FRMA 2L4MA 2HNLA 3HKRA 3ABLH 1T4YA 2IPAA 4CA0A 1BAYA 4IPAA 2IT0A 1FHEA 2DXIA 2QCOA 2FA8A 3HVVA 5IP7J 4DVCA 3V1WA 4KAEA 2M8GX 4HYEA 3TL4X 3W8SA 1AQVA 3RPUA 3OYDA 2VKVA 3KMNA 1I3QJ 4GTUA 3RKQA 1B8IA 4D73B 1SL1B 3IWFA 2LBFB 3TDUC 2H94A 5L3FA 2H1KA 1SENA 1YZXA 4MEYF 5A4UA 3CMYA 5A2QK 3KIOA 3CQFA 3OSGA 2MMZA 2CQXA 2DOEA 5IMAA 4XRFA 3H9QA 5B7CA 2R2JA 5C44J 2DJNA 3I71A 3A1YA 5EDNA 2PLYA 4GSSA 3KEYA 5JWQB 1FC3A 2V1DA 1EGOA 2YWOA 1JKRC 4KA0A 1QXHA 3BCIA 2A2SA 3VSKA 5DALA 2CGPA 1ULYA 3OYLA 2E2MA 5G5FA 4HNVA 1H75A 2ID3A 2JJ7A 3GH6A 3OV8A 2GSRA 3M7GA 1BI2A 1LNWA 1WWJA 3ZQHA 4V2LA 1T8EB 1NM3A 3FR3A 4HX8A 2V1NA 3IOSA 1EA3A 1FOKA 2GQLA 2M4GA 1B9NA 3UKGA 1BOAA 3EUHA 1WPIA 1XVWA 1WJ5A 2BHYA 4F82A 3SZGA 3BQZA 4XS4A 1IV6A 2C3QA 3DYRA 4DSSB 4K9ZA 3W6GA 3L78A 2O7KA 3H9JA 2H6ZA 5GAHJ 3TOTA 2VJ4A 4TR1A 4YAPA 3K4NA 3JSOA 1A8LA 1IUFA 3VPRA 3DV8A 1AUCA 3ZMLA 1YF0A 2HXIA 3AAFA 2CS3A 4NBQA 3UJ1A 2WV1A 3S1MJ 2EBIA 3GCMA 2V26A 2PJRA 1EOHA 2CW8A 2FMLA 1MH4A 2CVKA 1ZTRA 3RPQA 2K02A 5J8CA 1VQMI 4L0YB 3A5IA 2AYTA 1SAUA 2FWFA 2X6YA 3CJQB 4RB0A 1Z7RA 4TN8A 3VLNA 3E6DA 2HQ5A 1VQ4I 4X43A 4I99C 4R8HA 4EIPA 5H2FC 1OYJA 1R5PA 2LDUA 3M3YJ 3UBLA 1SVMA 3NOFA 4EO3A 3OYJA 1OKRA 2EV5A 5B1AH 4E7ZA 1Y39A 2QQ9A 4LIVA 2R7FA 5L71A 4NDLA 4WXDA 2H1LA 1XCBA 2ZXWH 1NH3A 3N05A 4CYDA 4MF7A 2FBIA 1W7PA 4P5OA 4BDZA 4TXVA 4QL7A 2NYXA 2BMXA 1OC9B 3AY8A 5K5OA 3M8JA 4AU7A 1Z3EA 2DJ2A 3NEUA 4BVXB 2G2QA 2VXZA 3QU6A 1R4WA 5IMDA 2OE1A 3R61A 3TJGA 2EA2A 2DK8A 4M9XA 2EFPA 3ME8A 2O5RA 3HTUA 2EV0A 2Y0SN 4JOMA 3OYFA 2FOKA 3GKXA 3L0HA 4KA4A 3R0JA 4QSHA 2VQGA 2PN8A 5LCZA 1GL8A 1R26A 2L5QA 4CICA 5F08A 2Y0SA 1ETVA 2KISA 5LNKe 1ZGAA 1V5FA 3ZQGA 1PGTA 2ZFUA 4U0YA 3A3TA 4I01A 2B5EA 2XKPA 1S7EA 1A6IA 2NS8A 1HW5A 2V1UA 3RZOJ 1V4RA 4KIGA 1ZOFA 3KIJA 4F0CA 1Y6IA 3MN2A 2DFIA 2VOCA 4M73A 3GTUA 2HYJA 3HL2A 4PK4A 4CGZA 5K7FA 1WP0A 2L9RA 3H93A 2VLVA 1MBFA 3VDXA 1B4PA 4WXTA 2LSOA 4HLYA 3FZVA 2D2WA 5CQEA 2Z2SB 4C9YA 4CUGA 3D5JA 1T6SA 4MA9A 3ASOH 1QZYA 4BACA 2VN2A 4HZFA 4ON0A 2NRAC 1FOHA 4V2FA 4MZCA 1G59A 4J2FA 1RK4A 1AXDA 3E6CC 2JVHA 4Y17A 2J5PA 4DZJA 2A6EF 1L3LA 3G1MA 1Y25A 5DCGA 4GSNA 4MGRA 2B7KA 3HUGB 1RNLA 1X1BA 2NOGA 4W1UA 3ZQ7A 3CJRB 2D2ZA 3QOUA 4PXOA 2LK2A 1A31A 5BOXA 1GVJA 3FXKA 2XBQA 5DDLA 1Z21A 1AKHA 1JTYA 3HOVJ 2F5VA 4HSTA 5FD6A 1I1SA 1TRWA 2HYXA 3N5OA 1VTNC 4XTSA 1GSQA 3WGGA 5GP9A 4J01A 1O81A 2VAFA 1M9BA 1HW1A 5HVQC 1YJ6A 3E6MA 4YRVA 5IIZA 2E2JJ 2COMA 3PQJA 2V9VA 5GZZB 1I3AA 5EGOA 2XRLA 3OIPA 5ID2B 4YQVA 2L7FP 1YIJI 3TO7A 2CVDA 2ZFWA 3IDVA 3TOAA 5G5EA 2LVSA 3U9GA 2ZNYA 1Y1VJ 5FKNA 4S0HB 4NB5A 3I58A 1JGGA 2W57A 2X6WA 3KP5A 5H6QA 3HZJA 2X6XA 5HDGA 2W82A 4G8XA 3OYCA 2BVLA 5L3BA 2GXBA 2PVOC 4CHUA 3EU4A 4B44A 2C1YA 1MMDA 2BY0A 5HDKA 1A35A 1EV9A 2AUVA 5ECLB 1OJLA 2FD3A 3D5RC 4YIRX 4HF2A 1IAWA 1GUKA 4MHGA 3ZVJA 1M1EB 4ZYEA 2P5VA 3FXJA 4X6AJ 3OL4A 1UVZA 1XBSA 3MAKA 4HS1A 2OQRA 1MBKA 2VCXA 3K70C 3GTMJ 4CCLA 2CZ2A 3T0YA 3I53A 2BGCA 2BYVE 4S04A 4IRGA 2GQMA 5IMCA 1ZLKA 4BVYB 3GZ5A 1ZH5A 3GNJA 4BE0A 3AG1H 2VT3A 1U8RA 3EMPA 4YKGA 1B4QA 2H76A 5J1YA 3D1NI 1QO0D 1U88A 1ZYEA 2IMFA 3A01B 1ZK8A 1TI1A 3ROUA 4GCIA 2JA7J 3ZTLA 4CDOA 2ZXIA 3DTKA 2H71A 5KCMA 4EJTA 1JZOA 4KDYA 3REOA 3A01A 4A5PA 3J81K 5ERIA 3I59A 5FHIA 1MH3A 1UJ8A 1OCZH 2IS1A 2YPMA 3KM6A 3QMXA 1ETKA 2K85A 1EH8A 3JR9A 1Q4JA 3EDPA 3ZPLA 5EVOA 3RDWA 1N25A 2CSOA 2GLOA 3CCLI 1J9IA 2LJKA 3H5NA 4RAZA 1BC8C 5J5NA 1J59A 2FD5A 4PUAA 5LGTA 5J8FA 1YJWI 2L4CA 4LLGF 3MQ0A 4L5JA 1XWBA 3AKZA 1TWHJ 1T38A 1PKZA 5DJMA 3TKSC 4F9ZA 1POGA 1OCCH 4C2TA 2A05A 1LPQA 4IHXA 2HXKA 2A2RA 1A24A 5H6RA 3IAM2 2XGXA 5ABRA 6GSYA 1N2AA 5GSTA 2ZSIB 2RNJA 3LA3A 4O5QA 3ECOA 2QBYB 1ZHFA 5E1XA 5AIPA 4XLPF 1I50J 1KQ8A 5KAFC 3M1EA 1FLIA 2C0DA 3LSPA 3WTZA 4I6ZA 2MABA 1NK2P 4F2IA 1B8IB 2HZTA 3GV1A 3BCAA 5ILUA 1LVAA 2VT2A 2A6HF 2NS0A 1G6YA 3QPHA 2WS2A 3TRPA 3O8HA 3D6IA 5E8GA 5DM7F 2ID6A 5IYBJ 2EIQA 1S5LC 2VCQA 4KN4X 3GFJA 3ZMVA 19GSA 5JVTA 1HSJA 1FBSA 5AISA 4BKXA 3SDBA 5BQTA 1R1UA 3CQZJ 2AXTC 2DMTA 2WB1A 3CMIA 2KRHA 4IQ4A 5AONA 3CCYA 4MNNA 5INYA 1E3PA 1WVRA 3HKZN 2CU7A 4TR4A 3PNYA 4HF0A 4P55A 1TK0B 3JCUC 3OS2A 2WWYA 4UB8C 1FOXA 1KBNA 2NBSA 4NWYA 4XRDA 1ENHA 4FHTA 4KNYA 1IXSB 1XCVA 3P90A 1IN8A 1FIAA 3A03A 3DBLB 2QZ8A 3HRSA 3DLLF 3HCZA 5DQYA 4IZZA 1GSFA 2ZXJA 3I54A 4PURA 1FP1D 3C3WA 3LWFA 4PCQA 4EM1A 12GSA 1LJRA 3L2QA 4E7IA 4RGUA 2OD5A 1B59A 4P9UA 3FY7A 3CCVI 4NV5A 3KP4A 1T56A 2DFHA 3MZYA 2X8GA 1PFOA 3GTPJ 1T0FC 3UEMA 2IJYA 2IVMA 2R5ZA 5ICFA 2IS4A 1HKTA 2WTEA 3BJOA 1M3JA 2OA7A 3HVNA 3HM5A 3NAUA 2NVQJ 3Q9VA 1X4PA 1IXCA 3NWSA 1AW9A 2MLGA 4ICYA 1TP4A 5FRNA 3BROA 4LMWA 1EOGA 4QWQA 2LTKA 5HQPA 1JT6A 3PJRA 2R7TA 2OZ6A 3DU6A 4HW0A 5F1JA 4WKWA 2GIVA 2R7RA 3R6SA 2K9NA 2LKXA 3A2KA 3HJPA 3RKXA 4YEJA 1RI7A 5C3EJ 2IA0A 3H9GA 4CH7A 1YW9A 13GSA 1T39A 2E7PA 2KJCA 4WBJA 9GSSA 4KF9A 1ILOA 2LRTA 4UUSB 2A69F 4BJTA 1NHAA 3G6EI 1USBA 1ZRFA 3E97A 3A02A 5HFIA 2FBKA 4ZJZA 1OYYA 1NTCA 4L5EA 4U0WA 4Y4RA 1O57A 4AC0A 2JT1A 4K7IA 4HDEA 3H1CA 5LHGA 1MTCA 4PZJA 3F6VA 2FE3A 1XB4A 2FQ4A 4Q4ZF 2WGRA 1K0MA 1Y0NA 2FHEA 1GUMA 1VGLA 2J5OA 2BTOT 3VPTA 3JTHA 3W3CA 2FSWA 1TWAJ 2P81A 4M72A 1ON4A 1R6RA 2DU9A 5C00A 4E70A 2YJ7A 1R71A 4A3KJ 2HDWA 3GKNA 4PNFA 1XFLA 4DIQA 1MMNA 3ZN0A 2R4GA 3HPGA 5B6NA 2N5AA 4MPFA 3TEDA 3ME7A 2Z16A 4AYBA 1ZZYA 1IO2A 2A4HA 4O5RA 2OJED 2M46A 1QK8A 4DYRA 2JA8J 4BQNA 3ECHA 2DFFA 1D8JA 4BA7A 2CJJA 4R79A 1GLPA 2OF7A 3DU5A 4A6EA 1ON1A 1F43A 1K3OA 5J40A 3C71A 1QGPA 2ZKZA 3DEWA 5IP6A 2HDDA 3H4KA 3TJJA 3BR2A 2BV6A 3GHAA 1MBEA 2X4AA 3BZCA 4HU9A 4IS0A 5E3LA 2E36A 4KB3A 3ZIJA 1QZEA 2FCHA 2RAEA 4MPGA 3BZ6A 2EIMH 4DGWB 2V4JC 1WHUA 3BTIA 5GADJ 3R3EA 4G0KA 1YS6A 2K18A 1JHFA 1IG7A 2A07F 4PX1A 3C73A 4QL9A 3JAMK 5C4XJ 5IOWA 2ADUA 1TP9A 2KHMA 4P9FA 1X4OA 2PMTA 3IV5A 5GPAA 3S1QJ 4I02A 5IO0A 1MDMB 4IF4A 4EQQA 3KD0A 1U5TA 1APLC 3JRBA 2XSJC 3KP7A 1DE1A 1UB9A 1SANA 4OU0A 1OISA 4BU2A 3FHZA 2R5YA 4LLNA 1B9XC 2NPBA 4Q47A 5LRSA 2UZ8A 4ZBDA 2E7XA 3C7JA 3R0AA 3JRFA 3M4OJ 1PA3A 2VQCA 1JXSA 1FB0A 1Z91A 4B09A 1LBKA 5IPGA 2QVOA 2E1MB 3L2CA 3EPZA 3LFLA 5ECKB 2X49A 4ITVA 5KN1A 3D0ZA 4CCOA 1LKXA 3I69A 3QPMA 1FY7A 1TZLA 2JSZA 2R7OA 3K1NA 4JU5A 3CO6C 1ABAA 5CLSA 4XRSA 2XC2A 3CSHA 4QPQA 2E71A 3Q18A 1O3TA 4B4CA 2CV2A 1TBXA 2M3AA 1JUPA 2EA4A 2V6KA 1MBGA 1ZN2A 2GXGA 2R5ZB 3LSGA 3MWHA 3ERFA 4I76A 3LSJA 3H0DA 2FLSA 2RNGA 1G7EA 5CRGA 2XROA 1XSDA 2H01A 3S2DJ 1DPRA 1MDMA 4FIWA 2R7WA 1XPXA 4IQ1A 4HZ2A 4HDUA 3F0IA 1UHSA 1XC5A 3I0TA 5D8LB 4JYKA 1WGXA 2KLOA 2CX4A 3LAPA 14GSA 1SL0B 4X0GA 3PIOF 3CUQB 2LF8A 2C0FA 1EWXA 4BL7A 1GV2A 2B0LA 3DFGA 1SD9A 3VB2A 1GDTA 2NVLA 3PFYA 2VBXA 2EFQA 3BPVA 1JE8A 1MKMA 3IAS2 1IW7F 4RS8A 1Z9CA 4UNOA 3BDDA 5ECSA 1DDNA 4USSA 4GRFA 1SEUA 4OIRF 3ERED 2F48A 4OCEA 3QAVA 1T3BA 4KDPA 2QUFA 1SK2A 2DA6A 1VQ5I 2YOIA 4K5SA 1OE8A 4BQOA 16GSA 3V8LA 2R7UA 1M7TA 1MD3A 2CX3A 3KXOA 1WE0A 4EE0A 4HG2A 4NXIA 4XRSG 2VIXA 3ABKH 4JQFA 4II2A 5DD4A 2DQRA 3OYNA 2BY1A 2JA6J 1AA7A 4NPBA 5BMUA 2IN3A 2YX7A 4XHMA 5CYVA 3GYHX 1F9NA 2KIFA 5DM6F 2KHPA 3MKLA 5CVVA 2PI0A 1GNEA 4BQAA 3S32A 4FCYA 2G7HA 3A0BC 3KZZA 1B9MA 1MNDA 3SEQA 2OBPA 4BYYA 4HNTA 3GFIA 5JVGF 4MFDA 3IP4B 2VL8A 5CPRB 2QBYA 3RQ4A 1GHCA 3BLYA 4Y33A 4XS6A 3WGDA 2M0MA 2R3SA 3VI5A 4IHWA 1FYKA 1XWKA 2ICWG 4I6XA 4ZXGA 4FISA 3KLNA 4XLCA 1WJBA 3KYLA 2YNXA 3KGKA 3S93A 2BBYA 1ZG1A 2CW7A 3CCSI 4NV2A 3PM1A 3J80Z 3QPTA 2H0GA 1OQYA 5J6XA 1MJBA 4F91B 3HBLA 1GSDA 4AVPA 2ON7A 1JT0A 3S14J 4RB3C 1K0NA 2Y9ZA 2V7FA 2Y69H 4MIMA 3L2VA 4IW9A 3IK9A 4NQWA 1K0DA 1Z7LA 4GO1A 1TWFJ 1M2DA 1ZRDA 1TTZA 2H8RA 4M3BA 5HR0A 2VL9A 3W6VA 5GAGJ 3WGXA 1X2NA 4MDCA 4A0XA 1A2MA 3IRQA 5JR3A 3KP2A 4ILFA 1BR2A 3EU3A 2EZIA 3KMOA 1Y8RB 2J9HA 3O3KA 3US3A 3E5QA 2IMKA 3F3QA 4M74A 3K2AA 4Q5SF 4YFXF 1T00A 2OAZA 2FNAA 4Q5NA 4MEXF 4G94A 4XN0A 3GX0A 3ZFBA 3GF2A 1O85A 4LIUA 4FE7A 22GSA 3M9AA 1LDKB 3PNTA 3ZRGA 1HSTA 1E2XA 2DOFA 4LB6B 2VC1A 1DSBA 3CMAI 5DAKA 3ZQQA 4CCKA 3SQNA 1X3WB 5COHA 1ML6A 3H1NA 4EM0B 1U6GA 3UOMA 5J3LA 4IQJA 2H74A 3IKVA 4L0ZB 2VJJA 2M7AA 2NNNA 3GKKA 5B8AA 2ZO4A 3ZITA 3OS1A 1OYWA 2HQAA 2IWTA 3F4SA 4K1FA 2E5ZA 2PFBA 4QLCU 1GXPA 1ODDA 3I64A 3RCOA 3TQNA 2TDXA 2EWNA 2AQEA 3DWVA 2VCVA 1RRJA 1YX5A 2EJRA 1PQNA 2MMNA 4JK1X 2B1LA 2AQFA 3LW9A 2BY2A 4E7LA 4XLAA 4XSXF 2VM2A 5ECQB 3MVPA 5L3DA 1YIOA 2ZXHA 1P4XA 3WHBA 5HLTA 1KEBA 2OJLA 2YR2A 1OCPA 4M3DA 3VEPA 5LEJA 1IRZA 3MAJA 1SYRA 3GFKA 4EIQA 4TKYA 4FT8A 1G6WA 2F6CA 3BJ6A 2BY3A 2OE0A 4KYWA 2MGQA 2MBSA 3GMFA 4FYBA 4HPQA 2PEXA 1RPWA 3GZNB 4L9TA 5L3EA 2MMOA 5CVUA 3MNGA 2QA4I 2IMDA 1FP2A 4D73A 1J5YA 1R4NB 5JCWA 2UXXA 5B8BA 4EJWA 2VL3A 3J7Yb 5E59A 2DI3A 4V1Ap 2B63J 5FLXZ 3G7YA 3TKSE 4Z2RA 4Z2YA 3GWZA 1EH6A 5ICGA 4KN7X 5HLGA 2HE3A 3L9SA 1OCRH 2RV8A 4BEHB 4LG0A 2UWMA 1FJLA 3IRRA 4BY1J 2VXDA 2IP2A 2RREA 3QOEA 3HYIA 3JTGA 1FYMA 2GSQA 2EILH 3AL0B 4BEHA 3LXTA 5ENUA 1SD5A 1ZL9A 1QQ2A 4PSWA 1IGNA 1YEXA 1UHWA 2IA2A 4P1WA 1FAAA 1I6XA 2A61A 4AYBN 2EQRA 1WI9A 4UVCA 4TXOA 3RIRA 2KRCA 3DBHB 4HEA2 4V1Ag 1HOMA 2X0LA 1ETOA 2QGUA 2GSTA 2YZUA 4IKHA 2H0IA 2V9KA 3T8TA 3SWLA 3J7ZI 1FVKA 2LV3A 2CAQA 2K6VA 1TW2A 2O85A 5A5KA 5F05A 3MFKA 1JHHA 4ML1A 1B6AA 3TDGA 3P9IA 2JL4A 2FNOA 2GSSA 4KNDA 2PMZA 4ZTJA 6GSTA 5AIVA 3HSFA 3QP6A 2CH0A 3GZ6A 3GN3A 1A0RP 1FW1A 3ZXSA 4E6KG 4BUPA 2BEOA 2GGTA 2KP1A 1O3RA 1MD0A 4F0BA 5IPAA 4A6DA 2KZGA 1RR7A 3VYSB 1S3AA 1O8XA 4WX9A 4N4NB 2WV0A 4ZDLA 3A2VA 3F3XA 1RETA 4ZL9A 5CVJA 1RKWA 5B5EC 1ZQ3P 3SXYA 3RZDJ 1YO5C 4Y15A 4BXFA 4XORA 2DT6A 1M9AA 2DJ3A 3S3MA 3IK7A 1Z67A 2XPVA 2HTJA 3KTBA 4CHSA 3FZ4A 4XKCA 1ZAOA 2H0HA 3OOPA 1MJAA 4WXHA 1AHDP 4K2DA 2E1MC 2GWRA 4HNUA 2VL2C 4UUVA 1VZ0A 7GSSA 4ZBBA 1FWZA 3RBTA 5J4UA 4KT6A 2DLLA 1HC8A 3CDIA 4F55A 2HZEA 4IQAA 4KSMA 2HGCA 2JPCA 3BZKA 2Y9YA 3H92A 5J1UA 2RM6A 5ECPB 1F3BA 1SFEA 2FA4A 4WBRD 4EDYA 1CF7A 1R5HA 2LC2A 4UY8I 2I9HA 4ZL8A 1U6TA 1XWGA 2GZZA 4ACSA 4DBRA 2XRNA 1HXDA 2X85A 3MZ8A 3PNVA 4LITA 1X5CA 2RN7A 4GXZA 1FB6A 5B66C 5CRWA 2HS5A 4XLEA 5B3SH 2LUSA 2H66A 2L0KA 5ECMB 2E0QA 2COBA 5IMFA 2ELKA 4OFTA 1U9NA 4MQVA 1X1DA 1L0OC 3Q9SA 2PJPA 1R22A 3BPXA 3RYRA 3HHHA 1XOBA 2NOJB 3G9BA 3KLOA 2L57A 1U9OA 6GSUA 4LG0B 5IO2A 3LL7A 1AOYA 1XGNA 2ZSHB 3WD6A 1W4MA 3U1KA 1LFUP 2R7SA 1G3SA 4HQEA 4KMUX 5DS9A 3BG6A 1FOYA 3T5XA 2O8VB 2L4QA 4NNJA 1QBJA 3HXSA 2PMHA 4CZCA 2IGMA 3N9JA 4GWRA 4LK1F 3F4TA 2KIUA 4DQ2A 4NUBA 3I55I 2XAQA 3G73A 2PPTA 2CUJA 2PBIA 2FY6A 1YDKA 5LD2C 3BG9A 3Q0VA 3CYNA 2HEOA 3PFIA 2ZMEA 1EEJA 3VWXA 3VODA 4I2OA 1C0WA 4B3XA 4EVMA 4POLA 4MTEA 3U5RE 1TK5B 1XSXA 4BQQA 4QPOA 2R7XA 5EG0A 1U2WA 1YOVB 4ESBA 3G1LA 4U87A 1VQ7I 2G0EA 3CSJA 3KX2A 4A5MA 2GVPA 2JWTA 3ZCOA 1LDDA 2R92J 2VODA 1IJWC 1DU6A 5M3MJ 4WCGA 3HTSB 2M7BA 2FOWA 4CCJA 2I3YA 1ETYA 1Q1HA 2QENA 1PUEE 3UARA 1VF3A 4ZZLA 3FYGA 4PJMA 5C04A 3ZMSA 5CJ9A 1FVJA 3GBGA 2L59A 2FWHA 3HPHA 3CUQC 1VQ6I 2LJAA 3EE2A 4IVFA 2M72A 2PGTA 4EATA 1MMGA 5D6EA 2VBYA 3LSKA 2P7VB 3HRUA 1XDUA 2OC6A 3DPLC 2LEGA 2HKXA 2X1EA 2GT5A 1C72A 4YG2F 4AIJA 2BVMA 1Z6NA 2E1NA 3QQAA 2IL3A 4LL1B 2WA0A 4BHCA 3I4MJ 2IMIA 3FEUA 1U0JA 1OMIA 2C8UA 1D1BA 1FMWA 2HVQA 1XWCA 3TB2A 5A4WA 2X8CA 1B9YC 1O3QA 4MP4A 1HCRA 3OS0A 3DXJF 4I98B 2HI7A 3HIFA 2F2EA 2QQ8A 2JK3A 2FRHA 4DYQA 1N77A 3CDHA 3FM3A 3SHFA 3TJKA 2NTOA 1OFCX 3CXGA 4FASD 5H20A 4HOBA 3PSFA 4E7HA 4OIPF 2N5FA 5E4WA 3L7WA 4ECCA 4M6YA 4RGRA 3RJPA 3K69A 4IRIA 1XMAA 4HQMA 3LJRA 2KP6A 2XKOA 2X6OA 3K6GA 1X9WB 2WY8Q 3IL2A 2E19A 5F0CA 1SYXA 2Y48A 1WJKA 3G7IA 2DA7A 3I3LA 1SD8A 3UL3A 2GM4A 5EL8A 2KFDA 1JI8A 2OACA 3GX4X 3QFBC 2F8FA 4E7SA 3VYRB 2E1CA 2Z9SA 2L2OA 4BHBA 1KNGA 4MTDA 1KGSA 2ZB9A 1YHQI 5G1KA 3TUEA 3IC7A 4LMYA 4XBFA 3IBHA 3LFKA 1SMTA 2GBYA 2NVYJ 3QDNA 5F8BA 3IXRA 4XKBA 2H30A 20GSA 1XSVA 2HI3A 4IJAA 2X4HA 4CCNA 3FZ5A 4GFBA 3GYKA 2ESNA 3FMRA 2DA1A 2W84A 4M3EA 2JZRA 3FXLA 1P7IA 3FKIJ 3GKMA 3OR5A 3S3OA 2LJRA 1FBQA 4BPYA 3TKSA 4GGGA 4V2GA 4OCFA 2GA1A 4WR5A 4XLHA 4DSQA 4XONA 1GUUA 2L9VA 3V4GA 1X1AA 2JSCA 1VQOI 4AJ6A 3L9VA 3CCUI 2VD0A 2EIKH 4ECBA 1ON2A 1PRXA 5KVRA 3DIEA 4N4OB 1XMKA 2BJXA 1V3FA 4A3CJ 1JFUA 1YYVA 1SU9A 3HZ4A 3D5LA 2DMPA 2VPRA 4HLXA 4A3IJ 1B72A 2YUSA 1HLVA 1XW9A 2UZKA 4HQSA 2HLSA 2HT9A 2PX9A 2WBMA 4LGWA 2LYCA 3A4CA 1H8AC 1UC7A 2CQ9A 3V7CA 3F6DA 1X3ZB 2H6BA 1YG2A 2Z33A 3FXUA 2LRCA 4FYCA 2QYOA 4D5CA 2LQQA 2L7ZA 2QWWA 3S15J 1OKDA 2VKDA 2X99A 2CRGA 2NAZA 3EC3A 5GAPD 3GA4A 2OQGA 3EETA 1OC8A 2R5GA 1SD6A 2FUG2 1TL8A 2GTUA 3PINA 2BW3B 3K4BA 1XTAA 5FO5A 5ILVA 4KISA 4DSRA 2BE5F 3TW7A 1S7AA 5DVBA 1HNAA 5JWOB 1G3TA 2Y0MA 1IN4A 4HSRA 3CMEI 2CMPA 5K7ZA 1WOUA 2KPMA 2EK5A 2O6GE 2VBWA 3FKFA 4PGHA 1DBYA 4MLOA 3IHGA 1TI3A 2VJ5A 4ML6A 1BQ7A 2LTPA 4Y13A 3ZZXA 5FFZA 2MW8A 3RPNA 1MBHA 3GFMA 2VIMA 2I5UA 5CNWA 2LRDA 2QEXI 1ZYRF 1EF4A 1QA6A 1V57A 4TXOB 5TGTA 2HXOA 1K83J 3GTUB 4F7ZA 5ID2A 1F6MC 2CAIA 4RGXA 3S1RJ 2FGXA 1OCOH 3IHQA 1TKDB 3J7AY 4OD7A 4PGTA 2IJLA 4C3JJ 1A36A 4UVBA 4LFUA 1M0UA 1LE8B 5CP1A 2LY9A 2WAQN 1B4AA 6PAXA 4II3A 4WF4A 2A2PA 1EKEA 1IN6A 1K4TA 2EB7A 1IF1A 5IT9Z 2REMA 3TRQA 4X0XA 3HRMA 1X3UA 2D45A 4L8EA 5EG0B 1K7AA 1A23A 5M5WJ 3VSLA 2K5CA 3WG9A 2XPDA 5JWRB 1GRXA 1XMXA 4OFNA 1W89A 2X51A 5E79C 1JZWA 2IGOA 2XUBA 2HRKA 5DALB 5HOOA 4G0LA 1ETQA 2LY1A 1TNTA 4GYGA 2XHKA 2IEKA 2P0GA 2R5YB 1W0UA 3ZGKA 3RI4A 2IAIA 2EZLA 4POMA 1IYHA 2YS9A 3G2BA 4WK8F 4TR3A 3IH4A 1GULA 4I2TA 4LA1A 3U21A 4I97A 1J2XA 1JZRA 3J81Z 2HOAA 5BMZA 5H5RA 4GRIA 1KQ0A 1LFPA 5LHIA 2UV1A 5M5XJ 1G6NA 3GTJJ 2GQKA 2VKHA 5IY5H 1FO5A 3P7XA 1YLFA 2XGDA 3GTOJ 1ITYA 4O5VA 5ICEA 1ACVA 3HZ8A 3TJFA 3TKRA 2FJ1A 3HOZJ 1AC1A 5KOXA 4PJ0C 5KN3A 1J7KA 2VE8A 2XF7A 2IPQX 4QTRA 2AHEA 1QGVA 4O92A 5JCUA 1Y0UA 2PVQA 4MF5A 3DF8A 5M5YJ 3FMSA 2EINH 1TK8B 3WT1A 3HJEA 2Z9OA 3BTJA 1U3EM 1K3YA 1OVNA 2F4IA 1VQLI 1OCTC 2BZTA 1SMYF 4YIFA 5BPDA 2KL4A 5JHFA 1PL2A 4L5OA 1IN5A 4EJUA 1W5SA 2GAUA 4HX4A 3FR6A 1EP8A 1Z0XA 3IPZA 2O8XA 1B72B 2M2EA 3EMXA 2VCWA 1YJNI 4KFCA 1EV7A 1WJAA 2HSYA 2M0CA 4MABA 3DBRB 3VPQA 2YPRA 1T98A 1W5TA 5K7HA 3QODA 3T1BA 1VNDA 4NC6A 4CW9A 5ICCA 3GIXA 4G7HF 3BWGA 4MO7A 1OC9A 3SJMA 1J75A 1TTYA 1TT0A 1QFNA 1FYLA 3DLAA 3HG9A 3KZYA 2VC0A 1S8NA 2DJIA 4RI6A 1D0YA 8GSSA 4Q5RA 3LXZA 1KYZA 4WF5A 1X19A 3E7LA 3UIWA 2VJIA 4YH2A 3I59B 3ZRDA 5FKKA 2MSYA 2DJKA 3M9KA 4JE1A 2XAJA 4ZILA 4ETSA 3M3MA 1ORKA 2HR3A 1ERUA 3CCEI 3LEFA 1V98A 1O7FA 4HDVA 2L5LA 1OYIA 1WI3A 2B9SA 2IA1A 2RC4A 3BTCA 2V1XA 5AIQA 4G10A 3NIVA 3IR4A 4HBLA 1AU7A 3M1CA 2L6DA 2M30A 2LBFA 3F23A 2XDVA 4XMYA 1QMVA 3KEBA 2EIJH 3H8QA 1GTUA 4ECIA 4K8MA 4POBA 1P92A 2H27A 4Z7XA 5CRHA 4ZDPA 4M71A 1SFUA 1BC7C 2DN0A 5KNLA 4XOTA 3HVSA 3NRVA 1BI3A 1S6LA 1M3IA 2XAHA 1MEKA 1Z3YA 1VI0A 1XCCA 1Z6RA 3RYPA 1QZZA 1R1VA 1YEPA 3QYEA 4ZYGA 2DBCA 1N78A 2XV4S 3JRAA 3KCMA 2A6TA 1GP1A 5DD8A 4EVIA 3CRUA 2Y30A 2DC5A 4G7ZF 1XGMA 4HSCX 3F3RA 3CJTB 3F22A 2GQQA 2OV7A 2JA5J 1H9GA 3HYPA 3QYBA 3K4LA 4IHYA 4G19A 3OYMA 2E34A 1XGSA 2JMWA 2KMUA 3DWLE 1URMA 4A2UA 1IZ1A 2HFHA 2BOLA 2LLKA 3MKWB 3ESWB 4CY8A 4PGGA 2DQLA 4ENJA 1ERWA 3PGTA 2F5FA 4K5RA 4I09A 1QVUA 4RA2A 3K70D 2AO9A 2STWA 4KDXA 2ZC2A 2XF5A 5D5XB 4RAGA 2HQNA 1G8XA 4XIDA 1QU3A 4JZQA 3KYCB 3OL3A 3LSMA 5HDNA 1UELB 2CFOA 5LRRA 5EGOB 3ERGA 5DBQA 1W36D 1DP3A 3K4JA 1XIYA 5HLHA 3CC4I 2O89A 4PTSA 1BI0A 3CESA 3F0CA 1JZDA 2M80A 2WB9A 3GW2A 3CUQA 1HDPA 1IRFA 1R1TA 2WDUA 4HQZA 5CO3A 3FBIB 1CQGA 4H86A 1REPC 4YQMA 1K3LA 5J9CA 2JSPA 2ECBA 3AG4H 5J4VA 3UR3C 5D9XA 4O3MA 3CRTA 4JR4A 4EGYA 4IL6C 1AWCA 2VUPA 3DVWA 1FOWA 1IRGA 4WEYA 1N8JA 1TQIA 4FE4A 5CQGA 1LQ1A 2Z1DA 2C4JA 2GT6A 1E17A 3KP9A 4ZB8A 4PQHA 2V6OA 1PX7A 1QQIA 3Q0UA 3LGCA 3CMMA 1BYEA 2ZUPA 3FMQA 2DOAA 4BJ6C 2VD1A 3E6BA 2P7CB 2EPFA 5D8KB 4KW6A 4ZYAA 1SC7A 5FT3A 1QHHD 3QWLA 1HKSA 1OC3A 4PDKA 2L54A 3OIQA 4EMSA 3SFZA 4BE1A 1PD21 5D73A 3F8FA 5E17F 3HD5A 5C4JJ 3RKWA 5KN0A 2DT5A 2ALBA 1YY7A 2CZ3A 1BJZA 2QSFX 3D22A 2KIQA 1BA5A 1U3IA 4FO5A 1CF7B 3W2AA 4OWYA 3S17J 1MMSA 2NNYA 3DQVC 3ZQFA 4ECJA 3FXOA 4CXFA 3CJNA 3NARA 4PQIA 3V8JA 5LGUA 1Z05A 2K27A 4KUMA 2WRTA 4RB1A 2G9WA 1HNCA 3GL5A 3QD9A 4I8BA 2RUFA 4G6TB 4L9VA 4M9ZA 2K7LA 3DKWA 4YQUA 3CP8A 3K9TA 3JRCA 1MMAA 4ZTFA 1MNMC 1GLQA 4GQCA 2HOEA 2O3FA 1GTBA 1TOFA 1PJRA 2CUFA 1WKMA 3D21A 1X1CA 2V6CA 2VB6A 4ZC3A 3OYBA 1O8WA 1W7PB 1DUGA 3ZL5A 2XB0X 3GX8A 2MMAA 2L9NA 2V79A 2XPUA 4B48A 2RVCA 3CTGA 2HYGD 3J7AO 1VQ9I 1V5GA 3KFWX 1VRSD 4RAYA 4OMVA 1XN7A 2M45A 4JR6A 1K6OA 2VL2A 3ZLPA 1MNEA 2DAOA 2W24A 4EM2A 1DPUA 3PL8A 2HOSA 1R7HA 1RQMA 2C3NA 1BEDA 3F6FA 3BOAA 3CSIA 3I6AA 2P5QA 5F06A 3L2WA 4JX6A 1XDSA 4ULXA 1UZCA 2DTZA 2RQQA 1TW9A 3HHVA 2M9HA 4O32A 4PFOA 6GSWA 2NVTJ 4HJ2A 1MSFC 1SFKA 1K0CA 4LLRA 1V58A 1JUMA 3PO2J 5KN2A 1X2MA 2OCEA 3D5SC 3FISA 2GS3A 4RQRA 2EFOA 5KHDA 2P0WA 5D6FA 1D3YA 1AQXA 4I0BA 1K78A 2UUZA 3GSTA 4QQ7A 4UB6C 4IHVA 3FK7A 1XW5A 4YAVA 3DPUA 5E3MA 3CZ6A 1T8IA 3H3VK 1OLTA 1O7UA 3KTLA 2ESHA 2C6YA 2WCIA 4V2NA 4WETA 1V40A 3TOBA 3ZMUA 1K79A 2W4SA 1UHMA 5B1BH 3H5AA 2FWGA 3HA9A 5F0GA 2E5NA 2OKAA 2MBTA 3DMLA 3MD2A 4L5IA 4MJBA 2XIGA 2CO5A 1H0MA 5DV5A 3EYTA 3BCBA 2HVRA 3EYIA 1O6JA 2P4WA 3RDIA 2YWIA 5CKTA 2H72A 1AKHB 1SK0A 2GLRA 1U5TC 2CQKA 4IHTA 3ABTA 2QA2A 4DZPA 1LVKA 5IPHA 4OINF 3C1RA 1Z9HA 2MH2A 3WTVC 4K6XA 1VF2A 1PUFA 3BR0A 3ZMDA 2C80A 4FTHA 4IRHA 4Y7NJ 1DP7P 4HJMA 4HOJA 3RAZA 1HQCA 3VWWA 5GAND 2HOTA 1TQPA 2BHZA 4A3MJ 1UMQA 3LYPA 4XIHA 4HI7A 2QC7A 1GV5A 4TR0A 2DFEA 2DKIA 1RUOA 1LB2A 2YU3A 2CQ7A 4JBBA 4NQWB 4BBSJ 1LJ9A 1Y56A 3RSNA 4N10A 1I1GA 1FZPB 5HLIA 5DTDA 3DP7A 1A8YA 3APSA 1SKRB 4C3HJ 5KK1A 1VQNI 4TR1B 4AWXB 2OE3A 2K8VA 1WSUA 4D7MA 1ETWA 2L02A 4DOZA 3M8NA 3PH9A 3BR1A 2X8HA 3SFIA 5J47A 4UXNA 2D5VA 2X48A 2CUZA 5FROA 1AIUA 4XS4B 4BDYA 4AD9A 2ZNMA 2Q2EA 5JFRA 1XGOA 1A2JA 2EH3A 5F64A 3LNQA 1ZG5A 3DVXA 1WIKA 3ZIVA 3AG3H 4BBRJ 3MMYB 2OPTA 2VBZA 1GT0C 3DEUA 3J80K 1HD2A 2F5CA 4WXCA 1U3AA 2X1CA 3SZPA 5JLWA 2IMEA 4BS9A 1SK1A 4L5LA 2LG4A 4GQFA 1P4WA 1XZOA 2Q1ZB 2F4MB 2QF7A 2V41A 3L4NA 4XL9A 5LEKA 3JW4A 3CTAA 2LP0A 1T08B 1JUSA 2MH9A 2QLZA 3K1MA 1F2EA 2FEZA 3S16J 2O87A 4GLTA 5G30A 1VF1A 3MWMA 1JLWA 5ECHB 4QIWN 3FXRA 5D5WB 3R60A 3CF5F 1RZ4A 1SFOJ 1J09A 4LB5A 6GSSA 3DRNA 3S9FA 4KCEA 1FPQA 2PMUA 4CCMA 4IXAA 1P6RA 4U7BA 5FWGA 2IS2A 2Z5UA 2H1BA 2BW3A 3OYKA 4YKFA 2K3FA 2W1OA 2ZMEB 1BW5A 4IOAF 1H88C 1BG5A 4ENNA 1H4OA 4A3GJ 1EP7A 3KZIC 1I5GA 4XR6A 4PJJA 2ON5A 3F9UA 2LKPA 4Q5FA 5AN1A 1SVLA 3ABMH 4CYCB 4V19K 1NG7A 2CG4A 3IC8A 1USTA 4LOCA 4X4JA 1FX7A 1I6HJ 3QU3A 4U0VA 4JX4A 4P96A 1SD7A 1G2HA 1FNNA 2L3DA 5HFKA 1PDNC 4I5QA 4UUTA 4RM2A 4ZYDA 1ZYNA 3H3UA 1DGWY 2ZBKA 2CFXA 2G7UA 4OFMA 3M8FA 3OMYA 4PSXA 5LBQA 2MYSA 5FB2A 1GTIA 1XXUA 2F8AA 1ZLJA 2WC2A 2HSHA 1EH7A 2R0QC 1D0XA 1LUJB 2VUMJ 3IH2A 1IDYA 3DKYA 2LS5A 2YN1A 2YSRA 1I9DA 1NSWA 4GF0A 3HHGA 3IV4A 4U88A 1ERTA 3P8WA 2W00A 3KZQA 3IUOA 3K2ZA 1YKAA 2BXZA 4IO9F 4A3EJ 3G1OA 2K40A 3TKYA 3TW6A 2LRNA 3FIWA 3HEFA 5A4VA 2HZFA 4BWQA 3TKPA 1ZKGA 4RGSA 2EC4A 3Q6OA 3RTRA 1Z7PA 4N30A 4IEJA 1G7OA 1GWCA 1SKWB 4D5FA 2KOKA 4X1UA 1BR4A 1Z6TA 2NS7A 2TRCP 3EPTA 3ASNH 4XKWA 4YELA 1YE9A 3Q5FA 1X5EA 2FX0A 2OTLI 5LD0A 3FMWA 4HU7A 3DTEA 2ISZA 1QNTA 2IBDA 4TRXA 1K78B 1D5VA 4GDFA 1JKOC 4IP1A 1PKWA 1CGPA 3G71I 2R4VA 3WODF 3E5UA 1RIOH 2R7VA 3BR3A 2H1AA 1BN5A 5F1RA 2OA4A 2R7QA 5EZGA 3COAC 4KMFA 2CQNA 2LKUA 1NW2A 3APOA 4YFKF 2H19A 5B6MA 4KIBA 4M3GA 2JZYA 3OSFA 4KDUA 3HB9A 3ZR8X 5FJ8J 3QRFF 3TGNA 2R6KA 3C18A 4BVYA 3UVHA 2CUEA 2RKHA 3V42A 2KLXA 5K5RA 3BR5A 5J4YA 1MDJA 2F3MA 3MYDA 2L9SA 3TBIA 3MKZA 1F4KA 2DMUA 3G3ZA 2O8KA 1H9TA 5FLXK 5IYDJ 2PU9C 3FX3A 4AF2A 3MEXA 2Q0OA 2XC7A 3TJBA 5TRDA 5IP9J 2V2GA 4Q48A 5F0FA 3OYIA 2NVXJ 5BRTA 2ACJA 2VQHA 2STTA 2ECCA 2RGVA 2Y31A 3I5UA 3G4SI 5HNFA 4E8EA 3B6CA 1K0OA 2DT7B 3BJAA 5GTHC 3J7YJ 1IYIA 1SJZA 4O5UA 3O3TA 3ZQCA 3PUBA 3L09A 2XVCA 4A3JJ 1W0TA 1D1AA 3F8CA 4ZZDA 1PP8F 3CC7I 5IMVA 1TWGJ 1QPMA 4B43A 4MH2A 1O7LA 4JEDA 5F07A 4OO4A 2OZUA 1UN2A 1SL2B 4ZB6A 4ENMA 2P6SA 2WULA 1YTYA 3O6BB 1QVTA 2VKEA 4MZBA 1LU4A 2JACA 5D9TA 4BHPA 4DBQA 3R2QA 2H1GA 2GZWA 3CBUA 1TU8A 4FX0A 4NHWA 2OBIA 3EYYA 2C0EA 1PP7U 2L7KA 2KT0A 4B47A 1YFHA 5HR1A 1PVEA 4OIQF 2OADA 3TCOA 5J1RA 2LH9A 4F92B 2GZYA 2R3XA 2OBKA 3NZNA 1B1BA 1BIBA 3KP6A 5DEQA 3PSIA 4BY7J 1S29A 4EV0A 3HOWJ 4IBPA 3HY2A 5IOXA 5ECIB 2VO4A 5CRDA 1CQHA 4A3LJ 2H1DA 4AIDA 1HDDC 5F04A 1AQWA 5DUKA 1XPVA 2E2IJ 2Q8KA 11GSA 1BOBA 3CCQI 3FRCA 1I39A 1JTXA 4C3IJ 3LG6A 1RKTA 3H79A 4NMUA 4RLFA 5D9WA 3MDKA 3VI7A 3LSIA 5EF6A 3I4NJ 1GSYA 3D4TA 2LNBA 2JUCA 3BG7A 1OR7C 2LR8A 2P6TA 4CYCA 1BM9A 1M99A 1O73A 1HW2A 4E4HA 1OE7A 3CCRI 5D93A 1RR8C 4MK3A 4PJNA 1YRNB 4G9YA 3K4KA 5J3RA 3DEEA 4HV6A 4RAFA 5HS7A 2BXYA 3JRIA 3CTFA 3BP8A 2FMYA 2M1BA 3O6TA 5BNGA 1XOAA 1XG8A 3UBKA 2CWEA 1K61A 1FT9A 3VWUA 1QHGA 2XPEA 5IOZA 3M1GA 2D1HA 5EPFA 3P2AA 3W6JB 2DYRH 4BWSA 1ZYQB 4M9SA 4XN3A 4J56E 2F4OB 3F72A 2TRXA 2DJ1A 1TLHB 1Y1WJ 1ERVA 2OU2A 4OIOF 4K2EA 4PQ1A 2F9SA 5M3FJ 4P3YB 5D96A 4Q5QA 5E1WA 1TXXA 2MC4A 1TJDA 5K5QA 2P8TA 1YITI 4HV5A 3WGEA 3A0HC 1MZBA 2LSTA 2XHFA 1S3CA 2WAFA 1JGSA 5JLXA 4MH3A 2XPWA 3CUOA 1Y8QB 4FQGA 2P5KA 3ZQLA 2PUKC 5G31A 2K9QA 2M4KA 3NWTA 5IT9K 1FTZA 3GSSA 3VOEA 3BG3A 4I7HA 3KH7A 2QQBA 2CV1A 4DYCA 5CVRA 2XASA 2DPUA 3KP3A 3QPSA 3EWLA 3ISPA 3ML6A 4IN0A 2MBFA 5IM9A 3ONQA 4YFNF 3P5JA 1S3RA 4K2XA 3W2WA 3JREA 1TRVA 2GIZA 2ME6A 3U2RA 3HOTA 2X64A 2AJQB 4E7KA 1GSSA 3BR6A 2C3TA 2K9SA 4KGIA 2KJBA 1Z7UA 4FQUA 4N0VA 3W2VA 1LFBA 4BE2A 3L00A 1YKCA 3WTYC 1WJEA 2KRFA 4G0IA 1WMJA 3BOQA 4L0UA 3FZAA 3LQRA 4XKVA 1T4ZA 4M6VA 2L7MP 3JSPA 1YX3A 3LSZA 1Z6MA 4Y52J 3GL3A 4MQ9F 2KQRA 4ENKA 1KU7A 2E2HJ 3DEXA 1U78A 4BNCA 1FMVA 4DSSA 4OMYA 4IHSA 3I43A 5D4SA 2B5XA 3F6OA 2HSMA 1PSQA 1E3HA 3T8RA 3MZHA 3WE3A 2R7ZJ 4R1HA 3TP3A 1IUYA 5D8IA 4NC8A 3ZVJD 1PN0A 3WGHA 2QA1A 3EVIA 4RI7A 2EZKA 4HX7A 2EIOA 3DKSA 1Y6EA 1BW6A 4I2UA 4MF6A 3HDCA 4MJEA 3BC8A 4CSWA 5FKMA 3ZN1A 3OYGA 5J9BA 2W25A 1PX6A 4H4KC 4HF1A 4IP6A 4L0WA 4OWRB 4RQXA 1BJXA 1IXRC 1D0ZA 2OCCH 3LMMA 2JU5A 3WU0A 4N0ZA 3LA7A 4UUSA 1K4SA 4A3DJ 2N8GA 3HUGA 3CLQA 1K0AA 2IFQB 3BJ5A 1R4MB 3HOSA 1IRXA 4A12A 2B7EA 5CYYA 3GUSA 4XCSA 1V2AA 4HAMA 5AIXA 1I27A 2DO7A 3K0LA 5A2QZ 1GNWA 2HKOA 3GURA 1H89C 1VQ8I 4WR4A 3D0SA 3I56I 18GSA 1F1ZA 2ZJPF 3PO3J 3FDYA 3U1DA 3ZMZA 3OR1C 2M8EA 4B3AA 1S9HA 1ACIA 2NDOA 3LSTA 1J0RA 4OMZA 4LLLA 2V9PA 3E5XA 1Z5YE 3E9JB 4FH8A 4M6XA 4GYIA 2PMZN 3BBYA 3HSRA 2XGCA 5EEGA 3PUFA 2LY2A 2HU9A 5F27A 1IN7A 2EFWA 2GZPA 3DGQA 3WTTC 3MKYB 4ZH4F 5FKOA 1OKTA 1A0FA 2F51A 4PNGA 1T0FA 2WAQA 3F8BA 4OAYA 4UHTA 2HZDA 4K0GA 3UMAA 2DA5A 5D5VB 4CDGA 1TU7A 2L6CA 2V1MA 3KETA 1A5JA 1KA8A 1P2FA 4C2MJ 4FX4A 1R49A 3RQIA 2R0CA 2YJHA 3S8PA 5E8IA 4NC7A 2YWMA 2DJ0A 3TP0A 1JLVA 3ZMKA 3H36A 4ZYHA 3MIXA 1NG6A 3CDLA 4AIKA 2PWJA 4IVNA 5L3CA 2RUEA 2IS6A 2DA3A 5FGMA 2VOPA 4X1EA 4UVAA 1QUWA 1YQ1A 3KPHA 3RKYA 1X58A 5K1YA 3DD3A 3LSRA 2JZTA 3MSZA 4BH9A 3KP8A 1OPCA 5KAIC 4KICA 1YS7A 2WFCA 4BGDA 1R5ID 3C2HA 4JX5A 1ZR2A 2TRTA 4XM3A 1E3OC 1DQUA 3GTQJ 2VLTA 3A2XA 3FZ9A 5DCHA 1A6QA 3H3ZA 5IT3A 2ETHA 2EFNA 1FTTA 3TO6A 1P9QC 3H5RA 3ED3A 2RDPA 1F36A 2Z3YA 3E0JB 4M3FA 1XS9A 2HRNA 1MBJA 2JUGA 2DA2A 4EGZA 2MLKA 4KSOA 1MIJA 2JADA 5GPCA 1XVQA 3FHKA 2TIRA 4XLFA 1YF1A 3UAPA 2JA2A 1I5ZA 5E3OA 2LD5A 3LQ7A 3ZP5A 3AL0C 1NK3P 5AGYA 1MW7A 4LL4B 1WZ2A 2PJRB 1W7PD 4EF0A 3GLXA 1J08A 2C0GA 2DW4A 1ZRCA 2JN6A 2DYSH 1EZKA 1GTAA 1XWAA 2IIYA 4Y3OA 1J9BA 3LWAA 3BCKA 2KZVA 1ERDA 1W4VA 5DCMA 3WHCA 3N4MA 1JJ6C 1MD4A 1PMTA 2H73A 3FK8A 3FK6A 1X5DA 3UNGC 4W97A 4WWCA 4J00A 1BBYA 2WADA 2P5RA 4IJIA 2QSGX 4JRRA 1WRJA 1WCMJ 2A5YB 2L5OA 4XOPA 5HS8A 3WT2A 4J19A 3CF2A 1DE2A 4MFEA 2HZEB 1D8KA 3HJMA 1V55H 3L2RA 1STZA 3G7JA 4ZIJA 1CQTA 1KU3A 3CP2A 1SJIA 4JP0A 1HYUA 1KONA 3VYUB 3E1SA 5LGNA 4N11A 2VCZA 2K86A 3L9FA 5HR3A 2ZNZA 3QAHA 1IV8A 5LLQA 3F8NA 5ELAA 3ERMA 1HBXG 2R37A 4RMNA 2VPLA 5G2ZA 1XG1A 2FNPA 2VLAA 2V32A 3O8GA 2IGKA 5DCMB 3EURA 1GXQA 3OYHA 5E20A 1NHOA 1ZYPA 2H09A 4XLNF 4IOCF 1JKQC 2XB5A 3QR6A 3DTIA 5HODA 4C2UA 1TWCJ 3F9KA 2I8DA 1YRNA 4FYUA 1BI1A 1K6YA 2B6MA 4IGJA 5D9VA 3CO7C 3K10A 3M9JA 2Y75A 3EUAA 4A0YA 3Q0WA 3U6VA 2DBBA 3OOUA 4WF2A 2R7DA 1MDIA 2QGVA 2OUMA 4IHUA 1ZMAA 3ZYWA 2WB1N 5IQYA 2EIRA 2PBJA 1THOA 3QAWA 3Q19A 3VWVA 6GSXA 1FSHA 2E35A 1X9MB 2LFBA 2XAUA 5G1LA 4AGSA 2XGEA 1Z77A 3PQKA 4D0PA 4IKFA 1KU2A 3GFLA 3IA1A 3JCML 2EZHA 1WFXA 3A5WA 3B6AA 1ZCPA 4DW6A 5DUIA 1TRSA 2DMLA 2R0PA 4ZBAA 3SZTA 3CCJI 1ST9A 2L01A 3P9KA 3FWEA 3SYTA 2P5LC 2ES7A 1HNBA 4YIIA 1FSEA 4MNUA 3S2WA 5ECRB 3GTKJ 1YQAA 1FBUA 2LMDA 2FBHA 5CVIA 5ED4A 4DNCA 5L3GA 5D5UB 1R9TJ 3BQYA 1T1VA 1X0RA 1GVDA 3QYFA 4TVEA 3DKXA 2YV7A 4MMMA 3EINA 4I0AA 4IJ3A 4A69C 3VURA 3FBNB 1BJAA 5FKLA 4ZL7A 1F5TA 3V7RA 4D7NA 5F6FA 1G0TA 1T33A 2LKSA 2ISYA 3GO5A 2CW0F 3LOCA 4KJZA 3P9CA 4XNFA 2MFZA 1VQKI 2QKEA 5GSSA 5ELGA 2HQRA 2PERA 1U5TB 1GSUA 2KP2A 4OO5A 1TT5B 3CCMI 3KE2A 2B5YA 3LA2A 1VF9A 2WJUA 1G3YA 1Z3XA 2H6XA 2RM5A 4ABZA 1QRYA 2VCTA 2YZHA 1B48A 3F4RA 2PG4A 3RPPA 5H5QA 3OIOA 4BIKA 3F8UA 1SD4A 2Y2ZA 2QQAA 2DODA 2X9DA 5DDGA 2V6EA 4E8HA 2L4AA 4MZWA 3EQLF 2YV9A 2VE9A 4DJAA 1KQ9A 2F5EA 4MCUA 4MLYA 1USSA 2KKOA 2K3PA 3TO9A 2VOOA 2K9FA 1WJFA 2MA3A 1WQ2A 4EJVA 1V54H 3SDGA 3LORA 2OTJI 2I1UA 1SVOA 1D1CA 3HOXJ 4G9HA 3PIPF 4K7NA 2E60A 2XSDC 3Q74A 2CVBA 2KDOA 3ERWA 3K4CA 3B73A 3C8EA 4NAXA 4A5NA 3TRXA 4PUSA 3GLLA 4POKA 4V2MA 3K8NA 3D4MA 2KIMA 4EJOA 2KDZA 1WJDA 1ZGWA 1E2YA 2YP6A 4A3FJ 3IWZA 1K0BA 2ZJRF 3OYEA 2MD0A 5IYCJ 2O7OA 2DKHA 1RC9A 3B02A 4OOIA 2DIYA 3KEOA 4L9NA 4LK0F 4XQFA 5EZHA 2Q2EB 10GSA 3SBCA 2B1KA 2X1DA 4KX4A 3K4MA 3MCZA 1DGRM 3PR8A 2JRMA 1SAXA 3BY6A 3GMEA 2FF4A 5FD5A 3VWBA 1GSEA 3FXMA 4MJCA 3FM5A 1U87A 2LF7A 1F3AA 2DK5A 4G6QA 1R36A 3GH9A 2XF6A 3I9V2 4BL0B 1UG0A 2AAWA 2Z99A 5DJLA 2W85A 4PFPA 2MZCA 3WG7H 1LEAA 3S3NA 1SKSB 1YW8A 3V7SA 2VASA 3APQA 3GRXA 5H5SA 9ANTA 4RBOA 5E18F 3J7Yk 2R93J 2H6YA 2YWNA 3EUKL 2DMNA 3BTLA 1KZHA 1YJ9I 1RESA 4G6DA 3OY9A 1ZGJA 2QSHX 2HRFA 5EEAA 2HPMA 1HA8A 1V9WA 2B3SA 1X1PA 4PJLA 1N75A 3GTGJ 3AG2H 4B1RA 3QAGA 4G12A 3EUHC 1PUFB 3R4KA 1PL1A 3HSEA 3PPUA 3Q3SA 3GVAA 2RIIA 4EKZA 4XRAA 2QSIA 5FLVA 3DPTA 1KTEA 4ASNA 2W7NA 1HKQA 1MSEC 2QM3A 2VONA 1MDKA 2O61A 2PN6A 2O03A 2UXNA 3O2PE 1UA5A 5TISC 3QFAC 3LFUA 1TQMA 3HXLA 4RDUA 5HS9A 2A5WA 5JCGA 1DU0A 3M0FA 1R23A 2IXSA 1FIPA 1XW6A 1PYVA 3ZQIA 4ZDOA 2E2GA 1E0EA 5LHHA 1T95A 2JZSA 4E7JA 3K7AJ 4GCVA 2JQ7A 4GSTA 1WPKA 3DXBA 4XS1A 3TMOA 3WTWC 4XK4A 5TJJA 1WH5A 3IC4A 4EDZA 2AB6A 2WY7Q 1A04A 3KYDB 4OAZA 5JHUA 1E6BA 2DDBA 3FHNA 4AJ7A 2I4AA 2JTVA 1S7OA 1GUHA 2P31A 2LNTA 2K8SA 3NQOA 3WTSC 2VM1A 1A2LA 1IDZA 2ZJ2A 2R0GA 1R5GA 2HYFA 4F3QA 3L1PA 4G7OF 2E7WA 3HOUJ 5DYMA 3TDZC 4K7OA 1P4AA 3RHCA 5DCFA 2FWEA 3LSHA 1THXA 1HF0A 4CY6A 3C7MA 2FA5A 1LDJA 3HKZA 4KIFA 6GSVA 3OYAA 1G3WA 3CLOA 4D9JA 2HVSA 3HC7A 4L9JA 1M2AA 3WGIA 2DPDA 3HGYA 1FEXA 3WE2A 1R7JA 1TNSA 2GOXB 2YU9J 3GEZA 2JRTA 2FU4A 2VLUA 1MJ9A 1OR7A 1ZARA 2IFQA 4ID0A 3WYWA 3ZREA 4CO8A 4L18B 3LAJA 4F52A 4XSZF 2E1OA 3F21A 2ELHA 3WTXC 2CV4A 2HRAA 2IGNA 5LFAA 2I10A 5F0HA 4HZ4A 1W1WE 4NHZA 4KH7A 3FKJA 3OR2C 5J41A 3ISOA 5ECOB 2AHQA 4GXOA 5E1ZB 2ZMEC 3IHUA 4D1QA 2ZCWA 2NVUB 3W6KB 2A68F 2MD5A 4XICA 4HA8A 3LQQA 3P7NA 4AM3A 2AS5F 4AJ8A 4HUAA 5ECNB 4CZZA 4TW5A 5CAXA 2NXNB 2XAGA 4EEFG 2I81A 5IMZA 3ZFLA 3KH9A 2M87A 4JBAA 2W48A 1MGTA 2LNSA 2DSAA 3V8KA 2MG4A 1B8XA 1Q98A 3JRGA 4NHJA 3IRAA 4KCAA 2JSYA 2WAEA 2KUCA 3BG5A 3K1PA 4ESFA 1F37A 2CT6A 3LYKA 1UCRA 1LE8A 3RHBA 2CV0A 4H0EA 1OAZA 2HPIA 5ILSA 3GXOA 4O6JA 1EEMA 1YW7A 2FXAA 4PUFC 1P7JA 1WWXA 2DTRA 2JVGA 2J23A 4IELA 4UV8A 2K4BA 4BXUA 2DIZA 4BVXA 4ZB9A 3FF5A 4AUXA 1V5EA 1ZREA 1WJCA 1W36C 4LD5A 2DLXA 4O7HA 5CREA 3JAMZ 3VK9A 3FR9A 5HFGA 2XBIA 3BD2A 3SEZA 2IRFG 2JPBA 1WH7A 4ISDA 4RLQA 1ZG3A 3ZOBA 5FFXA 4KUNA 4LMVA 2QKLB 4N9IA 2FQ3A 2D1VA 2LOOA 4K0NA 1W5CC 2K9MA 3S2HJ 4F03A 3HOYJ 5EEHA 1F9MA 1XX5A 4RM3A 1GH2A 3IKTA 3CD6I 2TCTA 2H8WA
chains in the Genus database with same CATH topology
1EGRA 3E0UA 3HJOA 3QCPA 3FW2A 2GOMA 2LREA 3VYTB 1SJ6A 4KITB 2MYGA 1M2BA 1R5AA 4Z2UA 2K9LA 4BJ5C 1WRYA 1VF4A 5KEJA 4G2EA 4C30A 2HFDA 3TKQA 2A4VA 4AVZA 4HRIA 4MJAA 1TDIA 1X9SB 5DAKB 3C2GA 2AV4A 4EC0A 4EUYA 3OWTA 2CA8A 1FG4A 5HNHA 4EXJA 3TOUA 1JHBA 2DJJA 3HVXA 2YCDA 17GSA 3W8JA 1UAAA 2H8LA 1BX9A 3O76A 3VFIA 1RW1A 4Z2TA 3F63A 4RUVA 3TGZA 1T7PB 4IX7A 1ZGNA 4DEJA 1NHYA 5KOWA 1FOVA 1EV4A 3RPUD 1BR1A 2G0FA 1S3DA 3KJYA 4LG3A 2VQLA 1TRUA 2WZ9A 2N5BA 1PN9A 2GDRA 3A2WA 1J0FA 2QKMB 2HNHA 3E3EA 3H35A 1HQOA 4FETA 1AAZA 4EL1A 4BL7B 2DMMA 4J57E 3IE3A 3C1SA 1GLNA 2H70A 2RLIA 3L2UA 5DQSA 3L9UA 1ZELA 4F93B 2B7JA 2H75A 2DCEA 4KE3A 2YANA 2LQOA 5HR2A 4TOPA 5EY6A 2ZCTA 4ANJA 2ELJA 3AFHA 5FRMA 2HNLA 3HKRA 1T4YA 2IPAA 4CA0A 1BAYA 1FHEA 2DXIA 2FA8A 3HVVA 3V1WA 4KAEA 3W8SA 3TL4X 1AQVA 3KMNA 3OYDA 4GTUA 4D73B 1SL1B 2LBFB 1SENA 1YZXA 5A4UA 2MMZA 5IMAA 3H9QA 5B7CA 2R2JA 4GSSA 3A1YA 3KEYA 5JWQB 1EGOA 2YWOA 4KA0A 1QXHA 3BCIA 2A2SA 3VSKA 5DALA 5G5FA 3ZMKA 3OYLA 2E2MA 1H75A 3GH6A 2GSRA 1WWJA 4V2LA 1T8EB 1NM3A 3FR3A 2V1NA 3IOSA 1EA3A 2GQLA 2M4GA 1WPIA 1XVWA 4F82A 1WJ5A 3SZGA 4XS4A 2C3QA 3DYRA 4DSSB 4K9ZA 3W6GA 3L78A 2O7KA 3H9JA 2H6ZA 3TOTA 2VJ4A 4TR1A 4YAPA 3K4NA 1A8LA 1AUCA 3ZMLA 1YF0A 2CS3A 3UJ1A 1EOHA 2V26A 2PJRA 2CVKA 2CW8A 3A5IA 2AYTA 1SAUA 2FWFA 2X6YA 3CJQB 4TN8A 1Z7RA 3VLNA 4X43A 4EIPA 1OYJA 1R5PA 3UBLA 3NOFA 4EO3A 3OYJA 4E7ZA 4LIVA 5L71A 3N05A 4MF7A 4BDZA 4P5OA 4TXVA 4QL7A 2BMXA 1OC9B