2FUG2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase chain 1
total genus 43
structure length 178
sequence length 178
chains with identical sequence B, K, T
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2fug201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fug202
4FYUA 4XRAA 1ACVA 2EIRA 2F8FA 1G7EA 2HFDA 5INYA 3LYPA 1Y25A 5DJMA 1K0CA 4IQAA 3KIJA 4PXOA 4TR3A 2VD0A 2GSSA 2LV3A 3A3TA 1M2AA 4ZXGA 1NW2A 4HDEA 4IS0A 3D6IA 5B8AA 3LQ7A 2K8SA 2HSYA 3N9JA 2LRCA 3KMOA 5H5RA 1TI1A 4V2NA 4OCFA 2VAFA 2WRTA 3P8WA 2WZ9A 3F4RA 1S3DA 2ES7A 4G19A 3CTGA 4IP1A 4CW9A 4OFMA 1SL2B 1KEBA 2HI7A 1M0UA 2M72A 2TIRA 3W8SA 2B6MA 3KTBA 1AW9A 4GQFA 3HZ8A 7GSSA 4ML6A 4RI7A 4K2DA 3F3QA 2HNLA 2V41A 4FH8A 12GSA 4WETA 4RQRA 1OC8A 5JCGA 4PNFA 3GSTA 1VF1A 1QQ2A 3Q19A 2KLXA 1PN9A 2VIMA 14GSA 3CRUA 4K0GA 3DKSA 2IPAA 3QAVA 2HZEA 3MDKA 5ECMB 2ALBA 4EDZA 1BAYA 2H66A 1DE1A 5IMAA 5ECOB 3UMAA 1FOVA 4X1UA 1QFNA 2IJYA 1Z7RA 1Z6MA 1VGLA 3IK9A 3L9UA 2CZ3A 5ENUA 3MNGA 4ID0A 1AAZA 2GQKA 1MDJA 1A24A 1TK0B 2MMNA 1DSBA 16GSA 4ZL9A 1SJ6A 1GSYA 2ZNMA 4MDCA 2GLRA 1E6BA 2NDOA 5HR3A 1THOA 1EOGA 4MCUA 2N5FA 2H1DA 2GT5A 1T7PB 2PGTA 3RHCA 4QL9A 3ZMLA 4J56E 1T4YA 3KEBA 1SL0B 2LJAA 2MMZA 3VFIA 3CSIA 4IQ1A 4DSRA 3TRPA 4G9HA 2H1AA 3J7Yb 3WYWA 4Q5RA 3E9JB 3N5OA 3L9VA 2FY6A 3UL3A 5HR2A 1IYHA 2PMTA 3TJKA 1OE8A 4HJMA 3HY2A 2YWNA 3DWVA 5IPHA 3GMFA 1PA3A 4HU7A 2YWIA 4HQSA 2DC5A 1XXUA 1W4VA 4KB3A 3QMXA 3KM6A 3EVIA 2H6ZA 4E8EA 3ISOA 4ZBAA 3G9BA 3IAM2 1PSQA 1QMVA 2OBIA 4KCEA 4DSSA 3C73A 4Z7XA 3RHBA 2FA4A 4NPBA 2WB9A 1M99A 2C80A 4KUNA 2H19A 2X99A 1TDIA 3GX0A 4KGIA 2M46A 5COHA 1URMA 1XWAA 4MMMA 1N8JA 5HR1A 2MMAA 1YF0A 1Q4JA 4TVEA 1F9MA 4JBBA 1GTUA 3EMXA 3FZAA 2Z9SA 4MF6A 3LWAA 1BJXA 3LG6A 3LXTA 3F3RA 3HCZA 1GSFA 3APOA 2ZCTA 1JLVA 1EOHA 3FY7A 3EU3A 2E2MA 3G7IA 1SJZA 5EVOA 1KTEA 4K7OA 4NMUA 5DQSA 3BCKA 3EINA 5F05A 1MD4A 1XIYA 3I6AA 4YQMA 4WXTA 4F0BA 3VK9A 3IPZA 4TN8A 2E0QA 1S3AA 2DJ3A 6GSUA 3D4TA 2V2GA 4MF7A 5ELGA 2CAQA 4GXZA 2HZFA 4TW5A 4I2TA 2X8GA 2GZPA 2DBCA 1GRXA 1V58A 3BCIA 1BX9A 3ZFBA 5E4WA 1GUMA 3Q74A 1GSEA 1M9AA 2PERA 2YP6A 2F3MA 2JZSA 3M9JA 2PVQA 2J23A 2GQMA 1BYEA 4IP6A 3TCOA 3C7MA 3GFKA 4HEA2 2PWJA 1LJRA 2VCQA 4MABA 3WT1A 2DJJA 3VWWA 1AC1A 4PQ1A 3BOAA 1H4OA 1YKCA 3D4MA 4I2UA 4TXOA 1JZWA 3IOSA 3HVXA 4L8EA 1FB0A 1SYRA 5ECSA 4KH7A 3O76A 2CVKA 1SYXA 3IBHA 1ZYEA 1FHEA 3KTLA 4XS6A 1I9DA 1GTBA 1LBKA 2VUPA 3TGZA 1K3YA 1X9MB 2LTKA 2LEGA 4OWYA 3C1SA 3DVXA 1SL1B 4TRXA 2IN3A 3IRAA 3EE2A 2VL2C 3FKFA 2MBTA 1ML6A 1A0RP 4KX4A 1JLWA 3GKXA 2TRXA 5JWRB 3VPTA 1PX6A 2DIYA 1GTAA 1K0BA 4ECBA 1OE7A 2GVPA 1GLPA 3UARA 2AUVA 2JACA 2I1UA 2MBSA 1OC9A 2VL3A 2KP2A 1O81A 2YN1A 2WJUA 1RW1A 1R4WA 3RPNA 1V2AA 3NZNA 1FW1A 2XPEA 4HQZA 6GSVA 1O85A 1AQVA 2LS5A 3C71A 3APSA 1O6JA 2L57A 3DEXA 4GSNA 1U3IA 2KUCA 2LUSA 1OAZA 4NV5A 2OA7A 3IV4A 1X0RA 2LNSA 2YCDA 1EV4A 3KCMA 3M0FA 2RUEA 3EMPA 1XBSA 4LMWA 4MP4A 2C0FA 3GNJA 3ZIVA 5C00A 3GL5A 2AJQB 5GAPD 3GL3A 5D9VA 1GL8A 2RIIA 2H71A 3ME7A 5LD0A 2DLXA 5G1LA 2QC7A 2N5BA 8GSSA 4HU9A 4MH2A 1OKDA 2E2GA 3F6FA 3IC4A 4IHUA 1MD3A 4PUFC 1EGOA 4ZB9A 4IELA 3CMIA 1ZZYA 4PX1A 1PQNA 2YV7A 3OR5A 3W6GA 4JRRA 2LQQA 4ZB8A 3QOUA 3GH9A 1AXDA 5AIXA 2LRNA 4MLYA 1ERTA 2IWTA 4NHZA 4Q5NA 3UIWA 2D2ZA 2YOIA 4WR5A 1EP7A 5DALB 1TRWA 3QCPA 2AV4A 3FK8A 4OO5A 4GWRA 1YEXA 4PUAA 5D93A 2IL3A 2GTUA 4DSQA 5CRGA 1EEJA 1TI3A 4K0NA 3ZZXA 4I5QA 5D9TA 1F3BA 5DCGA 2R2JA 2B5EA 2C0EA 11GSA 5JCWA 3P90A 5CREA 2CA8A 3ZVJA 3QFBC 3HHVA 5D96A 5IMZA 2DMLA 3LSZA 4MK3A 2VO4A 5HFGA 1MDKA 3TKSC 4IVFA 4NHWA 3LORA 5D8IA 3ZREA 4GCIA 4V2MA 1XW9A 4IGJA 4F0CA 3GRXA 2H6YA 4OD7A 3L9SA 5JWOB 2G2QA 2CVDA 4XRDA 3C1RA 1OC9B 4ZBDA 4EC0A 4ZIJA 3HA9A 2VL9A 4ACSA 3QD9A 4N30A 2GSQA 1T00A 4BVXA 1ILOA 1Z3EA 1QGVA 1GP1A 4ECIA 1XOBA 2FWFA 3H93A 1DE2A 1M7TA 3M3MA 4FIWA 5CP1A 1WIKA 2KOKA 1WRYA 4O32A 2O85A 1GH2A 5DBQA 3FRCA 3ZITA 2CQ9A 3BBYA 2DJKA 5DDLA 2F8AA 1X5DA 5L71A 2CVBA 2PBJA 3GIXA 1SK1A 1XVWA 1J0FA 4TXOB 1V57A 3P7XA 1WE0A 1FVJA 3HVVA 4OFTA 3NOFA 2H0GA 2NPBA 3FZ5A 5DQYA 2DJ1A 3M9KA 1NM3A 4D73A 3KP9A 2OBKA 2EIQA 5C04A 2IFQA 5KN3A 1O8WA 1NSWA 3GTUA 4JZQA 1JZOA 2YANA 2NBSA 5CNWA 5D9XA 1J9BA 5LCZA 1EV9A 3CSJA 5CRWA 4HUAA 1K0DA 4PQIA 1TJDA 3A2XA 4MZWA 3PINA 1PD21 1HD2A 3U5RE 3IXRA 3UOMA 3S9FA 5B6NA 5ID2B 2B5YA 5J3RA 3H1NA 1A0FA 2C3NA 3ZTLA 4HS1A 6GSWA 2F9SA 3UAPA 3KH9A 4IJ3A 1WWJA 2WS2A 2HRNA 1ABAA 3MWHA 2VCWA 4FYCA 2M80A 1S3CA 1K0MA 2B5XA 2V6OA 3TJJA 3I9V2 4N0VA 4L5OA 1GWCA 2VCTA 2RM6A 2P31A 1OYJA 4KSMA 1VRSD 1KBNA 3F0IA 5D73A 3TRXA 1HYUA 3G7JA 4CHSA 4XS4B 2NVLA 5A4UA 4XIHA 2XBQA 2WDUA 2PU9C 4Q5FA 4BWSA 4POMA 4TKYA 1U88A 2K9FA 1I5GA 1T4ZA 2L4QA 5IMVA 1T1VA 1FB6A 2CV4A 2H1GA 4I97A 2J9HA 2B3SA 1TU7A 3ERFA 4BPYA 3HD5A 4L0UA 2QSIA 4HZ2A 2PUKC 4DVCA 19GSA 5G5FA 4MJCA 5GZZB 5H5SA 1EP8A 2R3XA 1F37A 2FWGA 4MZBA 3F8UA 4ECCA 3DMLA 1BG5A 1UN2A 5F07A 2IMKA 4LMVA 1K0NA 4TR0A 3E3EA 4TR1B 4MF5A 2VLTA 2RM5A 1ZCPA 1GSDA 5HR0A 4BA7A 4EE0A 1A23A 1WJKA 4QL7A 3E0UA 2HE3A 3HZ4A 4EL1A 6GSYA 2GDRA 3I43A 2ON5A 3IA1A 1ST9A 1FG4A 1PRXA 5A4VA 1MEKA 3LJRA 2V6KA 4NXIA 1YDKA 1W89A 2FCHA 1DUGA 2H70A 2XHFA 2N5AA 2V1MA 3FR9A 2GSTA 3TJFA 1X5EA 2LSTA 3UVHA 2FWEA 3ZLPA 1F3AA 1TOFA 2IMEA 3TB2A 5LNKe 2P0GA 3TKQA 5IO0A 2C0GA 1WP0A 3MSZA 2REMA 2VCXA 1TK8B 3ZL5A 3KMNA 3H4KA 5FT3A 4V2LA 1K3OA 2GT6A 3KP8A 5JCUA 3GH6A 4JU5A 2PPTA 1YEPA 5G30A 1XPVA 1YF1A 2WCIA 1MTCA 4EF0A 3K8NA 1IYIA 2JU5A 2H0HA 3HJMA 2EIOA 4NV2A 5ECLB 2OADA 1Q98A 4GQCA 4AJ7A 4XS4A 1PL1A 3W8JA 5D9WA 1SK0A 1G7OA 4NWYA 3RAZA 2DIZA 1AUCA 3LFLA 3NIVA 5KEJA 3GTUB 5ECRB 4YQUA 2ZUPA 5IQYA 2HZEB 1BEDA 3HYPA 1TRUA 3UEMA 3FR3A 3RBTA 1H75A 2H0IA 4L5LA 6GSXA 1XW6A 3TJGA 1V9WA 2IMIA 4PQHA 5GSTA 2H1BA 4P3YB 3TKSE 5KN2A 2L6DA 2FGXA 1B9YC 2VLVA 4GSTA 4EDYA 1EWXA 3A5WA 4CDOA 4ULXA 4AF2A 4I6XA 4IKHA 3EYTA 4IJIA 1NHOA 1TXXA 2YNXA 2LJKA 3GKKA 1TKDB 1JZRA 1O73A 3O6TA 1WOUA 2CX4A 1V98A 3ZVJD 1QUWA 4MPGA 2YV9A 3GYKA 2H30A 2FLSA 1GTIA 3QR6A 4H86A 4KDYA 1NHYA 1XFLA 4KA0A 3DD3A 3CBUA 2DSAA 3VURA 2OE0A 3KZQA 5G2ZA 3CYNA 2GZYA 1A8LA 2LRTA 2C4JA 2ON7A 2B1LA 2WULA 3VWXA 2FNOA 2QGVA 3WGEA 3ZYWA 2YJHA 2YWMA 3TDGA 2VOCA 2L4CA 3ZIJA 4OO4A 3SBCA 2HYXA 4GSSA 5AN1A 2C8UA 1PGTA 2A2RA 1PX7A 4N11A 5KN0A 5J5NA 1VF3A 1ZGNA 1B9XC 1U3AA 1XWKA 2L5LA 1WMJA 1FVKA 2AHEA 1JHBA 1HNCA 2R6KA 1OC3A 3KD0A 3DGQA 3JCML 3KJYA 5ECKB 1TTZA 4F82A 4G10A 4QQ7A 5AISA 3GKNA 10GSA 3UBKA 5DVBA 3Q18A 2JSYA 4K8MA 3CTFA 4FYBA 1CQGA 1R5AA 3O3TA 1USBA 1XWGA 3HJOA 1HQOA 2QKEA 5B8BA 5ELAA 1N2AA 4TOPA 2FUG2 2H75A 5FWGA 2FD3A 1XZOA 4YAVA 1TRSA 4K1FA 2H73A 3H8QA 1G6YA 5ECHB 1UC7A 4ZILA 1A2LA 3WT2A 3RPPA 1GLQA 4XHMA 3D5JA 1GSSA 4BWQA 3CRTA 5DALA 3HDCA 2WFCA 2XBIA 2IMDA 5AIVA 3TKPA 1PKZA 1GULA 3D0ZA 3G7YA 4WF5A 5J4UA 2FA8A 5ECNB 1U6TA 5G1KA 2GQLA 1XVQA 4AGSA 5GAND 2L6CA 1OKTA 4O92A 4RUVA 3DRNA 3GX8A 5AGYA 4HZ4A 1CQHA 5CYYA 3IR4A 2FWHA 3IAS2 3IK7A 2HRFA 1EEMA 3P2AA 4TR4A 5IO2A 2I3YA 4PURA 4FO5A 3F4SA 4ZBBA 3TOTA 2IMFA 3F63A 2RLIA 1DBYA 2TRCP 4POKA 4V1Ap 2NTOA 4KNDA 3LYKA 4EO3A 3GN3A 4JEDA 5IMFA 1JZDA 2JZTA 3PR8A 4GTUA 1PKWA 3D21A 1UVZA 4AJ8A 1XWBA 4WBJA 2GZZA 1YJ6A 6GSSA 3APQA 4MJBA 4N10A 3VPQA 1B4QA 4G2EA 4AJ6A 2VLUA 3Q6OA 5B6MA 4KDUA 3H79A 3GSSA 2K6VA 4RQXA 1OVNA 5A5KA 5IM9A 9GSSA 2IIYA 5J41A 1KNGA 2HXKA 3J7Yk 3M8NA 1E2YA 1ZMAA 5HFIA 1WPIA 1SU9A 4BL7A 1GNWA 5F06A 1QXHA 2DJ0A 3QPMA 4GRFA 1EGRA 2C3QA 2LNTA 1ON4A 4WEYA 1G6WA 1THXA 4OFNA 4HOJA 4ISDA 1XWCA 2AYTA 5DJLA 2B7KA 3EU4A 3VWUA 5A4WA 1J08A 2GGTA 5IPGA 2VCZA 2YWOA 1PMTA 3IDVA 2BTOT 1ZL9A 3I69A 3QFAC 5IOWA 3ED3A 2G0FA 5IMDA 2L5OA 4KW6A 1A2MA 3A2WA 3RDWA 1ERWA 1X9WB 2JL4A 5G31A 2VM1A 1AQWA 3FHKA 1K0OA 1YKAA 5CAXA 1X5CA 2MMOA 1SKRB 3UBLA 2L59A 2OJLA 2CAIA 3A2VA 4Q5QA 4X0XA 1BQ7A 1GNEA 2EC4A 3TJBA 1Y6EA 1PL2A 3EWLA 1XW5A 2CT6A 1SKSB 2P5RA 1V40A 1TK5B 2VD1A 5J9BA 5ECPB 2JSZA 2GSRA 1JFUA 4O7HA 4EKZA 4DEJA 2A2SA 3EURA 4N0ZA 1VF4A 4D73B 3WD6A 2MYGA 1X9SB 3AY8A 2AB6A 2KHPA 5ECIB 1TP9A 4K7NA 2BJXA 1A8YA 1SJIA 3U6VA 5B7CA 2H8LA 4EVMA 4E8HA 3CSHA 5HFKA 1R5PA 4IN0A 2OACA 3ME8A 5F0GA 4MZCA 2RUFA 2HSHA 3MAKA 2I9HA 1XCCA 2O7KA 2GS3A 4J2FA 2R4VA 4ZL7A 4MJAA 1MDIA 1G0TA 3LEFA 5DAKA 4NAXA 4O5RA 1O8XA 5H5QA 4F03A 4HI7A 1YZXA 2OE1A 3US3A 3QAGA 3LGCA 3ZFLA 1SK2A 3M1GA 4TXVA 1AIUA 3VI7A 1RK4A 3GKMA 1EZKA 4YAPA 1U87A 1SD8A 1SENA 4EXJA 4WF4A 2JADA 2CZ2A 1HNBA 2B1KA 3TKRA 4HJ2A 4ZL8A 4KSOA 4POLA 5EY6A 3QDNA 3TOUA 3HVSA 4WR4A 1M9BA 3GA4A 4PGTA 4V1Ag 1ZYQB 2C3TA 2YPMA 17GSA 1ZOFA 1UA5A 1B8XA 3FZ9A 1XOAA 2H01A 3WGDA 1C72A 2XPDA 3BJ5A 2YZUA 5IMCA 2F51A 3C8EA 3PGTA 5IOXA 4ILFA 3ZMKA 1F6MC 1FAAA 4MJEA 5G5EA 4LA1A 4X43A 1M2BA 2LKUA 3GV1A 5DCHA 3VI5A 3TUEA 2X8HA 2VCVA 5F8BA 1SKWB 2OE3A 4PNGA 2X8CA 4ML1A 2FHEA 3UJ1A 4K6XA 1K0AA 5ABRA 2LQOA 5JWQB 3CXGA 3HXSA 2I4AA 1B48A 2PVOC 18GSA 2VL2A 3FZ4A 2MZCA 4K9ZA 2K18A 1TW9A 3L0HA 4POBA 5EPFA 2DJ2A 4J57E 3TKSA 3IHQA 2A4VA 4TR1A 1O7UA 2H74A 3D22A 2O89A 3ERGA 5CRDA 4DSSB 3FR6A 1T3BA 1RQMA 2B7JA 4F2IA 3F6DA 3QAWA 2VM2A 3SWLA 4JE1A 5E59A 2C1YA 2P5QA 1LU4A 2HT9A 1K3LA 2X64A 4KCAA 3PH9A 1Z6NA 3F4TA 2V32A 20GSA 3HJPA 3F9UA 1A2JA 3GURA 1M2DA 2H76A 3FEUA 3UVTA 3ZRDA 5ID2A 1R7HA 4LLRA 4EUYA 5CO3A 2H6XA 1TU8A 3GUSA 2BMXA 6GSTA 3L78A 2AAWA 3DIEA 2YZHA 2PN8A 5CRHA 3ERWA 4GF0A 4YQVA 1AQXA 1VF2A 4L0WA 1GSUA 4F9ZA 1F2EA 4YH2A 4XTSA 4WKWA 2YJ7A 13GSA 1R26A 4OMVA 4OCEA 4LL4B 2O87A 3WGXA 4ECJA 4IW9A 4MA9A 3GHAA 5HQPA 1GUHA 4XS1A 5ECQB 4GLTA 3KH7A 4LL1B 1FO5A 1SD9A 1Z5YE 3HKRA 4MPFA 1Z7PA 3FW2A 5GSSA 1HNAA 4JR6A 3LXZA 1ERUA 1QK8A 2JZRA 4RI6A 2I81A 2R5GA 2O8VB 4K7IA 4KE3A 5FHIA 3DXBA 4KDXA 1YY7A 4XCSA 2C0DA 2CX3A 4BVYA 4JR4A 3DVWA 4ZB6A 5KN1A 5IIZA 5J9CA 5DAKB 2R37A 3FYGA 2HLSA 2XC2A 3L4NA 2WGRA 1T8EB 1YQ1A 2KP1A 1ERVA 3KGKA 4KAEA 4I8BA 2DMMA 3R2QA 2H72A 1GUKA 4WBRD 3DYRA 3VWVA 3KXOA 3EC3A 2IFQB 1B4PA 2E7PA 1Z9HA 3IE3A 3V1WA 2LJRA 3TRQA 5EL8A 22GSA 1TRVA 3VLNA 1GSQA 2K8VA 3BD2A 4IBPA 4MH3A 2OKAA
chains in the Genus database with same CATH superfamily
2VI6A 1SVMA 3S3OA 4WF2A 1YS6A 3BZKA 4FYUA 3K1NA 4XRAA 3G3ZA 1MBJA 1BR4A 2MH2A 3GTOJ 2DAOA 1ACVA 4RAYA 3JRCA 4D9JA 1DDNA 2EIRA 2F8FA 1G7EA 2HFDA 4OAYA 5INYA 3LYPA 1ACIA 3PUBA 1Y25A 5DJMA 2GBYA 3MD2A 2JTVA 1K0CA 4V2FA 3HB9A 4IQAA 1R22A 3CCVI 3KIJA 4UVBA 2IXSA 2GZWA 3T1BA 4PXOA 2E5NA 4TR3A 3KP6A 3CCYA 5CPRB 3BTJA 1ERDA 2VD0A 2O0YA 2GSSA 2LV3A 2VODA 3A3TA 4XLFA 3S1QJ 1M2AA 4ZXGA 1MH3A 4L5IA 5LHHA 1NW2A 4UVAA 4HDEA 2GLOA 4DBRA 4BYYA 2E19A 3S16J 4IS0A 3D6IA 5B8AA 5DM6F 3LQ7A 2KT0A 2K8SA 2QA4I 4CCMA 2EWNA 2HSYA 2FRHA 3N9JA 2LRCA 1RETA 2Q8KA 1R4MB 3BQYA 3KMOA 5H5RA 1TI1A 4V2NA 4UB8C 5J8FA 3HBLA 2VAFA 2WRTA 3P8WA 4OCFA 2GXBA 2WZ9A 4QWQA 3F4RA 4U0WA 1S3DA 4BAYA 1E3PA 1OCZH 2ES7A 5D4RA 4G19A 3V42A 3GW2A 4PFPA 5DUKA 3CTGA 3BP8A 3CDHA 4IP1A 1KEBA 4OFMA 3R60A 1SL2B 3CCLI 2VKVA 2HI7A 3CP8A 5F0CA 1M0UA 2M72A 2TIRA 1HKSA 1O7LA 5CVRA 4L0YB 2B6MA 3KTBA 3RJPA 3W8SA 1AW9A 2LY2A 2QLZA 4GQFA 1KU9A 3G6EI 4K5SA 2O5RA 3CDIA 4IVNA 3IL2A 1P4AA 4A2UA 3HZ8A 7GSSA 2AQEA 2YR2A 4K2DA 4ML6A 1ETVA 4RI7A 3LA7A 3GFIA 2X4AA 4CZCA 3K0LA 4HQEA 3F3QA 1Z91A 1ZYNA 5GPCA 3GX4X 1HF0A 4CCNA 2HNLA 1WWXA 2MSYA 1LB2A 1KQ0A 2QQAA 1FYMA 12GSA 2V41A 2M7AA 4FH8A 4RQRA 2HPIA 1OC8A 4WETA 3Q9VA 5JCGA 4PNFA 3GSTA 3ERED 1VF1A 3ZMUA 1QQ2A 2DA3A 2VONA 2A6EF 2VJIA 3I54A 2QEXI 3A0HC 1IC8A 1PN9A 2KLXA 5BOXA 2VIMA 3I59B 14GSA 1TWCJ 3CRUA 2KJBA 2EA2A 4K0GA 1MDMB 2EZIA 1WI9A 2IPAA 3OYBA 5KK1A 3DKSA 2X85A 2W1OA 4PJ0C 2HZEA 3MDKA 3QAVA 1UJ8A 3FDYA 3K4NA 5EZGA 3WGGA 3G73A 5ECMB 1RZ4A 1R36A 5F1JA 3H0DA 1L3LA 4CCLA 2ALBA 2JA8J 1D5YA 1WSUA 1WFXA 4EDZA 3V7CA 1BAYA 2H66A 4UUSB 3J81K 1ETOA 1DE1A 2DA5A 5TRDA 5IMAA 1IV8A 1VQ4I 5ECOB 3UMAA 1FOVA 4X1UA 4XKBA 1Y8QB 1QFNA 2HWVA 3KYDB 5M5WJ 1DP3A 1WHUA 1PJRA 4BVYB 1X1AA 2K9MA 3SZGA 2Z33A 3CF5F 5HDGA 4PJJA 2YUSA 1IO2A 4XRFA 5KHDA 2R5YB 2VPLA 2W00A 1Z7RA 1Z6MA 1VGLA 1VQLI 3IK9A 4LIVA 3F72A 3ZMTA 1F4KA 1OISA 3L9UA 2CZ3A 5LD2C 5ENUA 2CQXA 3E0JB 3MNGA 5LBQA 4ID0A 1AAZA 1BC7C 4BY7J 4M9XA 4XLCA 1CF7A 1MDJA 2GQKA 2MMNA 2FEZA 2L54A 1DSBA 1TK0B 1A24A 4IHWA 5C4XJ 1UMQA 3KEQA 16GSA 1K6YA 3HOZJ 1JGGA 2DI3A 4ZL9A 1G3TA 1SJ6A 1GSYA 3C1DA 2FBHA 2HEOA 5TJJA 3H5AA 1Z7UA 2ZNMA 4Z2RA 4KIFA 4MDCA 2RDPA 2GLRA 1Z0XA 3I53A 1E6BA 2NDOA 2ZMEC 1ZGAA 4B09A 3MVPA 5HR3A 2VN2A 4A12A 4Q47A 1THOA 3PNYA 1EOGA 2VKHA 2RV8A 4OIRF 2XDVA 2FNPA 3IP4B 4MCUA 2N5FA 3D5RC 4KF9A 2XF5A 1W7PA 2H1DA 2E5ZA 4O5UA 5EEHA 1TNTA 4EVIA 4KFCA 2GT5A 1R7JA 1T7PB 4ESFA 1J09A 1GLNA 4G6QA 1T39A 4B47A 3UNGC 3EUKL 5KCMA 2A69F 3LSTA 5HVQC 3J80Z 3LAPA 3GVAA 3OS2A 1S3RA 2PGTA 3RHCA 4QL9A 2IA0A 4A3BJ 4MO7A 5GPAA 3ZMLA 3BLYA 2A68F 4ZTFA 1IG7A 3CLOA 4J56E 2JA7J 2ZSHB 3LSKA 4CCOA 4H0EA 2PJRA 1T4YA 4XRSG 1I6XA 1T08B 3KEBA 4UUTA 3W3CA 3W2AA 4AYBA 3C3WA 1SL0B 1FWZA 2Y30A 1VQ8I 2MYSA 3SHFA 2LJAA 3E6MA 3GWZA 2BE5F 3BJOA 2IS4A 1RKWA 2M9HA 1JUPA 4BXFA 2HVQA 1Z21A 1LDDA 2KJCA 1G3WA 4II2A 2MMZA 2DQLA 3VFIA 1LDKB 3R6SA 3CSIA 4IQ1A 1VQOI 4BHCA 4X4JA 4DSRA 1YHQI 2H1KA 3TRPA 4G9HA 3RKYA 2HDWA 2H1AA 4OOIA 3J7Yb 2R3SA 2JPCA 3QRFF 4LGWA 3WYWA 4CSWA 2FMLA 5D4SA 1VNDA 4Q5RA 2BOLA 3ZQGA 3J7AY 3E9JB 3TOBA 3MMYB 3N5OA 2YPRA 4PFOA 3L9VA 4BDZA 2FY6A 2DN0A 1SD5A 3MWMA 4IRHA 4YIFA 3UL3A 1Z05A 1E17A 5HR2A 1HBXG 1IDZA 4RLQA 3MAJA 1FOYA 5DV5A 5A2QZ 3PO2J 1IYHA 1MMSA 4EJWA 3ELKA 4BDYA 2PMTA 3TJKA 1JGSA 1OE8A 4A0ZA 4HJMA 3OYIA 1YIOA 3HY2A 2YWNA 1T6SA 1SFXA 3DWVA 3O3KA 2HQRA 5IPHA 2W25A 4CXFA 3GMFA 1PA3A 2JUCA 1R49A 2FXAA 1GHCA 4HU7A 2P5VA 2LG4A 4F91B 3DF8A 3K9TA 2FNAA 4YELA 5B3SH 3IRRA 2R7ZJ 3S1NJ 2YWIA 4HQSA 2QCOA 5DS9A 4S05A 2XB0X 1IV6A 2DC5A 1XXUA 3F8BA 1W4VA 2KDZA 2QUFA 3RZOJ 2R7UA 4KB3A 4D7NA 3OYGA 3HPHA 4P96A 3QMXA 2CFXA 3KM6A 3HZJA 2A6HF 1R5GA 3ISPA 2KFDA 4UXNA 3EVIA 2CRGA 3O2PE 3V4GA 2V9VA 2H6ZA 4L5EA 4E8EA 4PZJA 1GDTA 2RREA 3ISOA 4P9FA 1MMAA 2B0LA 2BHYA 4ZBAA 3M07A 2E1CA 3G9BA 3IAM2 3DLLF 1PSQA 1QMVA 4JX5A 5DEQA 2OBIA 1QGPA 4KCEA 3KP4A 4DSSA 2HRAA 1TW3A 3KP2A 4P5OA 3EPTA 1V5EA 1X1PA 3DTEA 1E2XA 3I3LA 3DBLB 5CJ9A 5HLIA 1YRNA 2OUMA 5E20A 3C73A 4Z7XA 4G6TB 4I02A 4JX6A 3RHBA 2K9LA 4RGXA 5FKKA 2FA4A 4NPBA 2K9QA 2WB9A 4Z2TA 1SAXA 1RR7A 1X3UA 4RLFA 2DODA 1O3SA 1XC5A 2JA6J 1WCMJ 1M99A 3H5NA 2C80A 4KUNA 2H19A 3KEYA 2DYSH 1ZTRA 3ROUA 4DGWB 4CYCB 1AKHB 1TDIA 2X99A 1R5ID 3GX0A 4KGIA 2M46A 4JYKA 1YJNI 5COHA 2FBKA 2ZXWH 1URMA 2JWTA 1XWAA 1H9TA 4MMMA 1N8JA 3ZQCA 2DOFA 2BZTA 2VUMJ 3HSRA 4D5CA 5HR1A 3PPUA 2TRTA 2ETHA 3W6JB 2MMAA 1YF0A 1Q4JA 4TVEA 1Y1WJ 5FO5A 1F9MA 3NWTA 4I6ZA 3HOXJ 1ZRFA 4JBBA 1W5SA 1VI0A 3OOPA 1GTUA 3EMXA 3FZAA 2Z9SA 4MF6A 1FBSA 2E35A 3BG3A 3U21A 3HDDA 3LWAA 3F8NA 2BVLA 1BJXA 3LG6A 4IRIA 3WTWC 3R0JA 3VEPA 3LXTA 2KIMA 3F3RA 3HCZA 4Z2UA 1GSFA 3FHNA 1QZYA 4E7IA 3APOA 2ZCTA 1OLTA 1QVTA 1JLVA 1S3JA 2V26A 3NQOA 5D9WA 4XICA 4A3DJ 1UELB 1EOHA 3MZ8A 3S2WA 2VBXA 4BQQA 2E2MA 3EU3A 3FY7A 4A5PA 4PJNA 2E2IJ 1OCOH 1SJZA 1ONVA 3G7IA 3CCEI 2LNBA 1KTEA 5EVOA 2LVSA 4K7OA 2E2HJ 1L0OC 1S6LA 2QWWA 4NMUA 2ELHA 5DQSA 3BG7A 1J75A 3BCKA 3EINA 1WJAA 4I0AA 3ECOA 5F05A 4XNFA 3D0SA 1MD4A 3BY6A 3ZMSA 1U3EM 1XIYA 2COBA 3GBGA 3OY9A 3I6AA 4YQMA 1B8IB 1Z1DA 1W4MA 2NRAC 4WXTA 4M3FA 3CCRI 4F0BA 3VK9A 5BMZA 3RQ4A 1FTTA 4IO9F 4N4OB 3IPZA 1GV2A 3CTAA 4TN8A 2RC4A 3KEOA 3F21A 1ZR4A 1XSDA 1S3AA 2DJ3A 1PUFB 4AIDA 4EEFG 2E0QA 2WAEA 2L9RA 3GMEA 6GSUA 3D4TA 2H8RA 3DEEA 1RNLA 3KP3A 2V2GA 4MF7A 4BQAA 1WH7A 4HX4A 5BQTA 3RPQA 2CAQA 5ELGA 3OR2C 3ZR8X 2DO7A 3KLNA 4GXZA 4GRIA 2HZFA 3FF5A 4BBSJ 4TW5A 1UAAA 3E97A 1JUMA 5JR3A 2R0PA 2QA2A 3GXOA 2XROA 3M1CA 2JMWA 2LP0A 2M4GA 3SDGA 4ANJA 4K2XA 1EV7A 1FIPA 5HS9A 2DMQA 3EUHA 3IWZA 2MC4A 4I2TA 2X8GA 2F5EA 3DEUA 3KZIC 4N4NB 2QSHX 2GZPA 2DBCA 1LFBA 2ACJA 4RB0A 1FY7A 1GRXA 1MJ9A 3QWLA 5LRSA 3PFIA 1V58A 3BCIA 1WJFA 5JHUA 2UWMA 1I1SA 3KP7A 1BX9A 3ZFBA 5J40A 3TEDA 5E4WA 4BE1A 3WTTC 3CUOA 1GUMA 3Q74A 4MQVA 1CQTA 3ASOH 3I59A 1GSEA 3ML6A 1M9AA 1IJWC 2PERA 3ZQIA 1HDDC 2F3MA 2LF8A 2JZSA 3DLAA 2PVQA 2YP6A 2J23A 3M9JA 4MTEA 1MDMA 2GQMA 1BYEA 4II3A 1XN7A 5BNGA 2F5CA 2WWYA 4IP6A 4C3HJ 3TCOA 1DGWY 4OMYA 3C7MA 3GFKA 2DXIA 3DU6A 3ZMVA 3I55I 4HEA2 2F4IA 3ASNH 2PWJA 1LJRA 2VCQA 4FASD 4A69C 4MABA 2TDXA 3MN2A 2Y0SA 3WT1A 3FMQA 3ZQHA 1P2FA 1FP1D 1Y0UA 1AC1A 2DJJA 4PQ1A 3VWWA 1BW6A 3VSLA 3BOAA 4BQOA 2O8KA 1H4OA 4G0KA 3A02A 1YKCA 1ETWA 5IYDJ 1XG8A 5FB2A 2RAEA 3D4MA 2K7LA 3F8MA 3WTSC 4I2UA 4TXOA 2FF4A 1JZWA 2WB1A 4CICA 2PI0A 3HVXA 3IOSA 4L8EA 2KRHA 3FM3A 1I5ZA 4M6XA 1FB0A 4CDGA 4FE7A 3P9CA 1TT5B 1LVAA 2KLOA 4B43A 3PQJA 1FMVA 3FBNB 1SYRA 1H0MA 4HSCX 3CF2A 4BEHA 1PN0A 3L9FA 2ZJ2A 1V3FA 1O3RA 1OCPA 4MHGA 1MIJA 3G1OA 4NC6A 3SDBA 2BEOA 3O76A 4KH7A 4DNCA 2M87A 2CVKA 1SYXA 3IBHA 1ZYEA 4L9VA 1FHEA 3KTLA 2CUJA 3PIOF 2V1UA 4XONA 4XIDA 5EJCA 1IN4A 1GTBA 1I9DA 1LBKA 1K3YA 2VUPA 4XS6A 3TGZA 1X9MB 2LTKA 2LEGA 2FA5A 4OWYA 2IAIA 3TDZC 4DBQA 3C1SA 3DVXA 1J0RA 5FLXK 1SL1B 5FKLA 5JI6A 4TRXA 2JSCA 2IN3A 1K7AA 3IRAA 4Y4RA 3EE2A 4KICA 2EFQA 3E1SA 1ZLJA 5CVIA 5H6QA 3IV5A 2VL2C 2DPDA 3FKFA 5ERIA 2MBTA 2DFEA 3GFJA 2VT2A 3WHCA 1ML6A 1A0RP 1BOBA 4KX4A 4Y13A 1JLWA 1G3YA 2ID3A 2KPMA 3MZYA 3CMYA 3GKXA 4CY8A 2TRXA 5JWRB 3MKYB 4CYCA 1AKHA 3VPTA 2CYYA 5HS7A 1MGTA 1PX6A 2DIYA 3DP7A 3ESWB 2VOPA 1SD6A 3G71I 1HLVA 1GTAA 2JVGA 1K0BA 4ECBA 1OE7A 1OCRH 5F27A 3S2HJ 3NARA 1BN5A 2GVPA 1QZEA 4KUMA 4PSWA 1VTNC 1GLPA 2AUVA 3UARA 5B5EC 4QSHA 2I1UA 2JACA 2MBSA 1HDPA 2CJJA 1J5YA 1ZREA 3T8RA 1OC9A 2DOAA 3TL4X 2XRLA 2W48A 5HLTA 1U2WA 2VL3A 2KP2A 2BVMA 3L2WA 1O81A 1ZARA 2HS5A 3HHGA 2WJUA 2YN1A 3SZPA 5LRRA 2HZDA 2N8GA 5IOYA 2IS6A 2L7FP 1FYLA 5JLXA 4AYBN 1RW1A 1R4WA 3RPNA 2IVMA 3F6OA 4CYDA 1V2AA 3NZNA 3CUQB 1FW1A 1A35A 3JRIA 2K3PA 4MQ9F 2XPEA 2K3FA 4HQZA 4LOCA 2DMPA 4RA2A 3OYKA 1O85A 6GSVA 4Y15A 3CD6I 1AQVA 2LS5A 1JKRC 2HI3A 1OQYA 1FBUA 2MD5A 3C71A 3APSA 3JREA 1K6OA 1O6JA 1QRYA 5CVUA 4U0YA 2M4KA 1Y6IA 2LBFA 1U8RA 2L57A 2ZFUA 4GSNA 3ZMZA 1USTA 2HKXA 5E3OA 3K7AJ 1GXPA 5E3MA 1U3IA 4KA4A 1K78B 4KIGA 3HGGA 5KOWA 4CW9A 3S8PA 1IAWA 2KUCA 2LUSA 3Q0UA 2MFZA 1BL0A 1OAZA 3VYUB 1H88C 2OA7A 3IV4A 4NV5A 2P4WA 1X0RA 3RYPA 1EV4A 1Y1VJ 4I09A 3JTGA 2LNSA 3SXYA 2YCDA 3OYMA 2RUEA 3M0FA 2EV5A 3VYRB 5LEKA 4DW6A 1XBSA 1R00A 2P6TA 3EMPA 2ECBA 4ZJZA 4L0ZB 2C0FA 4LMWA 3IH4A 4RMNA 1WH5A 3ZQ7A 4AIKA 3GL5A 3GNJA 3TW6A 5C00A 3ZIVA 2AJQB 2K4JA 1ZKGA 5GAPD 1SEUA 1LDJA 3MCZA 3WTXC 3GL3A 5D9VA 4YG2F 1WJCA 5F6FA 2OD5A 1GL8A 5J4YA 2RIIA 2H71A 1C0WA 3ME7A 2DLXA 5LD0A 2V6EA 4HZFA 5G1LA 5FRNA 3OOUA 2IJYA 4IKFA 1PP8F 3S1RJ 2QC7A 2Z99A 1MSEC 2N5BA 1WJBA 8GSSA 2A61A 4BKXA 2NNNA 4O6JA 4HU9A 3IKTA 1FIAA 2F4MB 3BDDA 1OKDA 4MH2A 2CUZA 2E2GA 1ZYRF 3F6FA 3HOYJ 3IC4A 4CO8A 3HSEA 3H3VK 3ABKH 4IHUA 1MD3A 1IN7A 4PUFC 1EGOA 2DTZA 3I64A 4NQWA 3TGNA 2I5UA 1BOAA 1MNEA 4RGSA 4ZB9A 2L9VA 1XG1A 2KIFA 4IELA 3UR3C 1SC7A 1ZZYA 3CMIA 2X1CA 2Y75A 4QIWN 1W0UA 4PX1A 3HOWJ 4LK1F 1PQNA 2YV7A 4KIBA 2PN6A 3OR5A 1AHDP 3W6GA 4JRRA 3DKYA 3IH2A 2UXXA 3ABTA 2LQQA 2KRCA 3CJRB 1PDNC 4ZB8A 4XK4A 3QOUA 3ZN0A 3GH9A 4FQGA 5K7FA 2QBYB 1AXDA 5AIXA 4UUSA 2LRNA 4ZDOA 4MLYA 1ERTA 3KZZA 1W36D 3JRAA 2IWTA 4NHZA 1JKPC 4Q5NA 2OAZA 2R7TA 5KOXA 3UIWA 1PYVA 3S3NA 2DCEA 2D2ZA 3HRMA 2YOIA 4WR5A 5JFRA 4M3GA 4B1RA 1EP7A 5KAFC 1IF1A 5DALB 2L02A 3FKJA 1TRWA 1F36A 2HYGD 2H09A 3B6CA 3QCPA 2WADA 2RNJA 1G3SA 3RCOA 3CMAI 2AV4A 3JSPA 1XS9A 4C3IJ 2OTLI 2VC1A 2JSPA 1YG2A 3JRFA 3FK8A 4OO5A 4GWRA 1YEXA 1N75A 4PUAA 2IL3A 5EDNA 5D93A 2H94A 2GTUA 4DSQA 1B1BA 5CRGA 1EEJA 1DGRM 5K7HA 1X3WB 5HNHA 2WC2A 3L2RA 3L2QA 5FRMA 1TI3A 4K0NA 1DP7P 3OYFA 5CVVA 2HZTA 3ZZXA 4I5QA 5D9TA 3GZ6A 1WI3A 1F3BA 3R61A 3ZQFA 2HOAA 5DCGA 2ME0A 2R2JA 3OR1C 2B5EA 2VQCA 2C0EA 11GSA 5JCWA 3P90A 5CREA 5LFAA 2CA8A 1FSHA 3H0GJ 3ZVJA 3QFBC 2FJ1A 3JAMK 1ZHFA 1OR7A 2AQFA 3HHVA 4LG0A 4BU2A 5D96A 2K85A 3M4OJ 5IMZA 2DMLA 3K70C 2QF7A 3BCAA 4R79A 3LSZA 4MK3A 2VO4A 1S7OA 2NVUB 1ZG3A 2LOOA 4HG2A 3AG1H 1Y0NA 5HFGA 2ZJQF 1PUFA 1QVUA 4HSTA 1MDKA 4IVFA 2ADUA 3TKSC 3A2KA 2ZBKA 4NHWA 4DYRA 4LK0F 3LORA 5D8IA 3ZREA 4G0IA 4GCIA 3DKXA 4Q4ZF 4HBLA 1YS7A 2GAUA 4M3DA 4UHTA 4AIHA 1XDSA 2XVCA 4AU7A 3JW4A 1XW9A 4IGJA 4IEJA 2M8EA 2H6BA 5GADJ 4HV6A 3E6CC 4F0CA 4QPQA 2EV0A 4G12A 2WA0A 3GRXA 2F2EA 2K4BA 3X2QH 2H6YA 4OD7A 3Q0VA 3L9SA 1XCBA 4ENMA 1BC8C 2CVDA 2G2QA 1YW7A 3I4NJ 4J19A 3C1RA 1X1BA 2GOXB 4XRDA 2LR8A 1OC9B 4A3MJ 2DBBA 4E6KG 4ZBDA 2XGDA 4IHYA 1HSJA 4EC0A 1D1CA 4ZIJA 3RSNA 1D0XA 3W8JA 2L5QA 2QZ8A 2GA2A 5J1RA 3GTMJ 4X6AJ 2F4OB 5HLGA 2VL9A 3HA9A 3DCFA 4ACSA 4X0GA 3LA2A 2E36A 1ZN2A 3QD9A 4N30A 2GSQA 1T00A 4BVXA 1FP2A 1I3QJ 1WJDA 3H3ZA 3JAMZ 1ILOA 3O6BB 4YFKF 1Z3EA 2HVRA 4EM2A 1ORKA 1QGVA 1GP1A 2YU3A 4Z6YA 4ECIA 1XOBA 2FWFA 3H93A 4CUGA 1KZHA 3DFGA 1DE2A 1M7TA 3M3MA 4FIWA 5CP1A 4OIOF 2MG4A 3WTUC 2KIQA 4N9HA 2XAFA 1WIKA 2KOKA 1YW8A 2XGXA 1WRYA 2JK3A 4O32A 1ITYA 2O85A 4KT6A 1GH2A 5DBQA 1Y56A 2VIXA 3FRCA 3ZITA 2CQ9A 1N77A 1IDYA 1K78A 5FROA 2HVSA 1XB4A 3BBYA 2IGMA 3GO5A 1UHMA 5C3EJ 2DJKA 5DDLA 3OYHA 1YTYA 1TQIA 1X5DA 4PJLA 2CVBA 2F8AA 3CC7I 2PBJA 3GIXA 5L71A 3U1KA 1KYZA 4E7HA 1YX5A 2FBIA 4EM0B 1SK1A 1XVWA 1J0FA 3HUGA 3S14J 1Q1HA 4BNCA 4TXOB 1V57A 2FE3A 2O6GE 1SVOA 2PEXA 3P7XA 4BY1J 3TOAA 2HTSA 1FVJA 1WE0A 3ZQLA 3HVVA 2FOKA 3ABMH 1U8BA 4OFTA 3NOFA 4CHUA 1R58A 4HF1A 4MEYF 1BIAA 2A4HA 3FXLA 5FD5A 2H0GA 2NPBA 2Q2EB 2E1OA 1SFKA 2WTEA 4ABZA 1YW9A 4KDPA 3FZ5A 5DQYA 5ICEA 2DJ1A 3RKXA 3M9KA 2BHZA 2XGCA 4IQ4A 5HDKA 1X4PA 2VBYA 5FFXA 4EGZA 1NK2P 1ZRDA 2R93J 1NM3A 2JRTA 4A3GJ 3KP9A 4D73A 4J01A 3IHGA 2OCCH 1QZZA 2QKLB 2OBKA 2EIQA 5FLXZ 2M34A 5C04A 4EIQA 4S04A 1TW2A 2IFQA 1SMTA 2HOEA 4HLXA 3Q0WA 1O8WA 5KN3A 4KISA 4U7DA 4A3JJ 1QU3A 4A3LJ 1NSWA 3GTUA 3HJEA 4JZQA 2V7FA 2ZCWA 1JZOA 4NQWB 2YANA 3MYDA 1YRNB 2NBSA 2XPVA 1JTXA 5CNWA 4CCKA 1I39A 4L18B 5D9XA 5IY5H 1SMYF 1J9BA 3O8HA 4AUXA 5LCZA 2XAGA 1EV9A 5AIPA 2DA1A 2YS9A 5HOOA 3CSJA 5JVTA 2XAHA 1BJAA 5CRWA 1RI7A 1OKRA 3EUHC 4W97A 4HUAA 3E5XA 1K0DA 4PQIA 2R7RA 1TJDA 2NOGA 4A5MA 3A2XA 1Q1VA 4LFUA 4MZWA 2EIMH 3EUAA 2YX7A 2HDDA 1U9OA 1A31A 3AL0B 1UG0A 4L9NA 2FX0A 1PFOA 2JRMA 3GEZA 5ICCA 2V4JC 2KZGA 1QPIA 5JHFA 1DU6A 1TP4A 2XGEA 2DKHA 3PINA 2IJLA 2ZKZA 5LHGA 1PD21 3U9GA 1HD2A 4CGZA 2DFIA 3U5RE 2HR3A 2DMTA 1T98A 2ZJPF 3CQZJ 3IXRA 3UOMA 4ZH4F 3OSGA 3E7LA 3S9FA 5B6NA 3I0TA 3HKZA 1QA6A 2B5YA 5ID2B 2XB5A 4MNNA 5J3RA 4XBFA 2X4HA 3H1NA 2LSOA 1SD4A 1A0FA 2JVHA 4YFNF 1IXRC 4ENNA 2C3NA 3ZTLA 5K1YA 2XRNA 3ZOBA 3K10A 4HS1A 6GSWA 2F9SA 4BL7A 3BZCA 4E7LA 2M8GX 3KYLA 1MBHA 4Y17A 3UAPA 3KH9A 4IJ3A 1FBQA 2ESHA 5E18F 1WWJA 4NHJA 3TP3A 1DQUA 4XRMA 4FCYA 4ZC3A 1K61A 2QENA 1F9NA 2GA1A 4IPAA 1AU7A 2WS2A 4BUPA 2M2EA 1K79A 2A6TA 5D8KB 1NG6A 4A3IJ 1ABAA 2HRNA 3MWHA 2Z3YA 2VCWA 3V7SA 4FYCA 1Z3XA 1Z6TA 4IOCF 1VQ6I 2HYFA 2M80A 3HRSA 1R1UA 4ZYEA 4RAGA 4G7OF 1S3CA 1K0MA 1VQNI 2KZVA 2VE9A 1JHHA 3K2AA 1JJ6C 2B5XA 2V6OA 3HTUA 2GIVA 1UB9A 3TJJA 2BW3A 1JKQC 4EMSA 3I9V2 4WXCA 2NYXA 4XKVA 3LW9A 4N0VA 2QM3A 1FMWA 4O3MA 3WE2A 3R4KA 1ZQ3P 4L5OA 1GWCA 2VCTA 2VBWA 4A6EA 2RM6A 1XPXA 2P31A 1OYJA 4KSMA 2MLKA 2G7HA 3LQRA 3PL8A 2WY7Q 5HNFA 1XMXA 1HW1A 5CKTA 4KMUX 3VYSB 4LJZF 2UZKA 1KBNA 1VRSD 1FOXA 3TBIA 3F0IA 3MKLA 1XMKA 5D73A 3TRXA 1HYUA 2VKDA 2L7MP 2Z5UA 3G7JA 4CHSA 1D8KA 3F8CA 4XS4B 2NVLA 5A4UA 4XIHA 2ZXJA 4ZZLA 3TO6A 2XBQA 3OL3A 2OBPA 2WDUA 2P81A 2PU9C 4Q5FA 4WK8F 3RI4A 3FMRA 4BWSA 1FLIA 3PJRA 2R0QC 4POMA 4FE4A 3VOEA 4BVXB 1XSVA 1W5TA 4KYWA 4TKYA 5LLQA 5HDNA 3FXUA 2CQKA 4D5FA 1U88A 2K9FA 2JA2A 1I5GA 5EF6A 1T4ZA 4HQMA 4PGHA 2L4QA 3L2CA 4UVCA 2IS1A 1XGOA 1T1VA 5IMVA 4ZTJA 1FB6A 2CV4A 3AL0C 3JCUC 3Q9SA 2H1GA 4I97A 3A1YA 3PO3J 2J9HA 1UHWA 3COAC 3BCBA 5GAGJ 2B3SA 5K5RA 1TU7A 2VT3A 1IUYA 2DKIA 3ERFA 4P9UA 1S72I 4BPYA 3BG5A 4HF2A 1TTYA 3FIWA 3HD5A 1WJEA 2DTRA 3QU3A 4MGRA 3BWGA 4L0UA 2VASA 3B02A 1UG2A 2XF6A 3LSIA 3OYNA 2VC0A 2QSIA 4HZ2A 1ETYA 2KIUA 3L09A 2O9LA 2PUKC 4DVCA 19GSA 5G5FA 4G7HF 3OWTA 4MJCA 2ZC2A 1ZH5A 3S3MA 2ZB9A 3R0AA 2R0GA 5GZZB 5H5SA 3ZRGA 1EP8A 1F37A 2R3XA 2FWGA 4Y52J 1ZAOA 2KQRA 3MEXA 2EFPA 3CCJI 4GDFA 4MZBA 2Y31A 3IHUA 3L2UA 3F8UA 4ECCA 4ICYA 3DMLA 1BG5A 4F55A 3RDIA 1ZELA 3WG9A 2A05A 1UN2A 4DZPA 4BEHB 2IMKA 5F07A 4LMVA 2Q2EA 3K4MA 2JPBA 2DA6A 2VE8A 4BJTA 3D5SC 3DTKA 3OYLA 1FEXA 1K0NA 3E3EA 4MF5A 4TR1B 4LIUA 3TW7A 3AG4H 1ZCPA 3I4MJ 1GSDA 2RM5A 2VLTA 5HR0A 5F1RA 4BA7A 2P7CB 3W6KB 4IHVA 3PNVA 1MBKA 2OQRA 4EE0A 2WBMA 5J3LA 3FXOA 1J9IA 2LKSA 5L3CA 4UV9A 3HOUJ 1SAUA 4N9IA 1A23A 3WTYC 3HOSA 3QPSA 3QU6A 4HA8A 4Z2YA 3K4CA 4MNUA 5DD4A 5E8GA 1WJKA 3L2VA 1PP7U 1LEBA 1IN5A 2G0EA 4NC8A 6PAXA 2NAZA 3CJTB 3S17J 4QL7A 3E0UA 4XR6A 3LWFA 4Y33A 4YKGA 3CP2A 4IL6C 2XPUA 2HE3A 5KVRA 3CMEI 3HZ4A 1ULYA 4EL1A 5E1WA 1IRFA 6GSYA 2D2WA 2PMHA 4G7ZF 1VQPI 2GDRA 2QKMB 2XAJA 4I01A 2OC6A 2TCTA 3E5UA 1H9GA 4HF0A 1FJLA 2ON5A 3I43A 2W82A 3IA1A 1ST9A 1V55H 3PFYA 1FG4A 1PRXA 1FYKA 2KL4A 5A4VA 5DCMB 1MEKA 4IOAF 5H20A 3OS1A 3LJRA 5IP6A 2V6KA 2ESNA 4NXIA 3H3UA 5D8LB 3RZDJ 1G6NA 3KETA 5ED4A 1POGA 3FM5A 4GFBA 2ZMEB 1YDKA 2IP2A 2GWRA 1X1DA 2D1VA 1W89A 2FCHA 1DUGA 3OYEA 2H70A 2XHFA 1U5TC 3RKWA 1LJ9A 2N5AA 2Y2ZA 4ZYGA 2P5KA 2V1MA 3FR9A 2OCEA 2EINH 3UKGA 2GSTA 3TJFA 1JHFA 2V79A 3K4JA 2K02A 2NVXJ 3MKWB 1X5EA 4ITVA 1X2NA 2KDOA 5ILSA 3KFWX 3NWSA 2HXIA 2CG4A 3V8KA 1ZYPA 2LSTA 3QYEA 1VQMI 3DQVC 2FWEA 1F3AA 2M0CA 1TOFA 2IMEA 3TB2A 3ZLPA 5LNKe 2P0GA 3TKQA 5IO0A 2EJRA 1IRXA 1ZRCA 2X1DA 2C0GA 1WP0A 2LBFB 4A3EJ 4YIIA 3MIXA 2E1MB 3BC8A 4QLCU 4LLGF 3JRBA 1TC3C 2A5WA 1HA8A 3ZGKA 1KQ9A 4AIJA 4U7BA 3BT9A 1F5TA 3CC2I 4UUVA 4YEJA 2REMA 2VCXA 4PK4A 3SQNA 1MMDA 3K4BA 4BJ6C 2Z16A 1TK8B 3GZ5A 3ZL5A 1ON2A 5EG0B 3KMNA 3F6VA 1YITI 3H4KA 4I0BA 1EH6A 2LFBA 5EG0A 1YO5C 3HRUA 5FT3A 1V5GA 4V2LA 4A0YA 5L3EA 1G2HA 3BR1A 4GXOA 2VB6A 4HYEA 3LSPA 1H8AC 3WHBA 1EJ9A 2XSDC 1ZGWA 2VLAA 2JA5J 4C2UA 4BXXJ 2GT6A 3KP8A 5JCUA 4EQQA 3RQIA 5FKOA 3GH6A 4FQUA 4JU5A 1TLHB 5DTDA 3J81Z 2VOOA 2PPTA 1YEPA 5G30A 1XPVA 4RBOA 2X6OA 1YF1A 5ICFA 2WCIA 4M3BA 1MTCA 5ICGA 4EF0A 4IXAA 1XMAA 2CU7A 2UXNA 1IYIA 3K8NA 3KIOA 3QAHA 2VQGA 5D5WB 2JU5A 1MSFC 2H0HA 2JZYA 2W24A 2XIGA 3HJMA 3ABLH 1FSEA 5A2QK 2EIOA 1A6QA 4NUBA 4NV2A 5ECLB 3BZ6A 2OADA 1Q98A 1WRJA 3ZQQA 4LD5A 1GV5A 2EPFA 1A36A 4GQCA 1LUJB 4AJ7A 2L9NA 4XS4A 3NEUA 2DT6A 2GOMA 1BI1A 1PL1A 1YOVB 1SK0A 2V9KA 4RDUA 1G8XA 2V1NA 3CCMI 1O3QA 2NS8A 4NWYA 4HDVA 4ENJA 3RAZA 2DIZA 1AUCA 3LFLA 3DPUA 1BR2A 3N05A 1R71A 3NIVA 1VQKI 3PUFA 4FX4A 5KEJA 3H9GA 3GTUB 5E3LA 3N97A 4HPQA 3LSMA 3MSZA 3BQZA 4LB5A 3FKIJ 4M6VA 5ECRB 4YQUA 3LFKA 3M7GA 3QOPA 2ME6A 2ZUPA 5IQYA 5LGUA 4IHSA 1BEDA 5M3FJ 2HZEB 2XF7A 3HYPA 4M72A 5K5OA 1ZG5A 4XLAA 1TRUA 3UEMA 1HKQA 2BXZA 2IGKA 3HKZN 1DUXC 3QODA 1P9QC 1WQ2A 3FR3A 1E0EA 3RBTA 2XASA 3CJQB 1TWFJ 2Y9YA 3FXRA 4Y7NJ 5E17F 1E3OC 1H75A 5FFZA 1K3OA 2EV6A 2HOSA 4XLNF 2H0IA 5M5XJ 4L5LA 3OSFA 2HNHA 3FZVA 2P8TA 4K2EA 6GSXA 3BR6A 3A5IA 1FT9A 1XW6A 3TJGA 2OTJI 1ZGJA 2BV6A 3VB2A 1V9WA 4G0LA 2CW8A 2IMIA 4PQHA 5GSTA 4P1WA 1AOYA 2H1BA 4P3YB 3TKSE 5KN2A 2QVOA 3HGYA 2L6DA 4IHTA 2FGXA 4A0XA 3WU0A 5D5VB 1B9YC 2VLVA 1F43A 5KNLA 4GSTA 4EDYA 1EWXA 2M3AA 2K9SA 4GO1A 4EJOA 2LY1A 4AWXB 1CF7B 3T5XA 3A5WA 2LD5A 4CDOA 3DEXA 5BMUA 4ULXA 2FQ3A 4AF2A 4I6XA 5M3MJ 1HCRA 4IKHA 3EYTA 4M9SA 4IJIA 1NHOA 1ENHA 1W0TA 1TXXA 2YNXA 2E1MC 1G4DA 2CV1A 2LJKA 2KHMA 4CA0A 1U6GA 3HVNA 1S8NA 3GKKA 1TKDB 5KAIC 1JZRA 1O73A 3O6TA 1WOUA 3A0BC 3OYDA 1OPCA 4A5NA 2EZLA 2O3FA 4DJAA 4A3CJ 1V98A 3BR5A 2CX4A 3ZVJD 2CGPA 2ELJA 1T95A 4ON0A 3QQAA 1YFHA 1QUWA 4MPGA 2YV9A 3GYKA 2H30A 3H36A 1QBJA 2FLSA 3M3YJ 1GTIA 1ZLKA 3LL7A 3QR6A 3BPVA 2E2JJ 1NHYA 3DEWA 1XFLA 4H86A 3F8FA 3GZNB 4KA0A 4KDYA 3DD3A 1EH7A 3I5UA 1LEAA 3HOVJ 3CBUA 1A04A 2DSAA 4FHTA 3VURA 2R4GA 1TWAJ 2PJRB 2OE0A 4ZYDA 3KZQA 5G2ZA 3CYNA 3DBHB 2GZYA 1N25A 2WAQN 2PJPA 3WT2A 3CLQA 1GVDA 3OIQA 2QGUA 3HTSB 1BI3A 1IRGA 1RUNA 1A8LA 2LRTA 1D1AA 1TQMA 3QPTA 2C4JA 1R23A 2ON7A 3R3EA 1MKMA 4LLLA 2QQ9A 3P5JA 4BGDA 2J5OA 4NNJA 4U88A 1JKOC 3TP0A 3GCMA 3CC4I 2MA3A 1VF9A 3GTQJ 2DDAA 1TL8A 4KMFA 2WULA 1I50J 4RGUA 3VWXA 3Q3SA 3KZYA 5F08A 3GF2A 2FNOA 2QGVA 3WGEA 3SEZA 2XPWA 2YJHA 3P7NA 3ZYWA 2YWMA 3HRTA 1JI8A 2G9WA 5DCFA 2V1DA 3TDGA 2VOCA 2L4CA 2R7OA 2XAQA 1FZPB 4OO4A 3ZIJA 3SBCA 1G7OA 1U9NA 2CWEA 1IXSB 2RQQA 4C2TA 2P6SA 2HYXA 4GSSA 3G4SI 2A5YB 4ZDPA 4B4CA 5AN1A 2C8UA 3CUQA 4HNTA 5M5YJ 5JVGF 3V7RA 3BPXA 1R6RA 2KRFA 3HPGA 1PGTA 2A2RA 1PX7A 2O8XA 3CUQC 1I6HJ 1Z3YA 4N11A 5KN0A 2VJ4A 5J5NA 2RNGA 1KU3A 2LLKA 1VF3A 5ILVA 1ZGNA 2P5LC 3J80K 1B9XC 1SVLA 1U3AA 1FPQA 1XWKA 1YLFA 1P6RA 1U5TA 5J6XA 5LEJA 2L5LA 2LKXA 4B3XA 5IP9J 3W2WA 4RB1A 1WMJA 1FVKA 2Q0OA 3F9KA 2WB1N 3GTJJ 3S1MJ 4XKCA 2AHEA 3BOQA 2UZ8A 1BM9A 4PCQA 1JHBA 2XUBA 4O5VA 3VFZA 3VODA 1HNCA 2R6KA 3B73A 3SJMA 2HFHA 5HS8A 1OC3A 3DGQA 2VBZA 3KD0A 3JCML 2CUFA 2L0KA 4M73A 2WY8Q 4BJ5C 3KJYA 4TR0A 5ECKB 1TTZA 4F82A 1A5JA 1IXCA 2CQQA 3DPTA 1J59A 1SFEA 4F03A 1IGNA 1X3ZB 1USSA 4G10A 3PIPF 5GAEJ 2DDBA 4QQ7A 3BJ6A 2EFOA 2DJNA 1WGXA 2DFHA 1BBYA 4OU0A 5GTIC 4OIPF 5DYMA 3DWLE 3ZXSA 3GKNA 5AISA 4E7SA 2AXTC 10GSA 3UBKA 5DVBA 2OZ6A 3Q18A 3AAFA 2JSYA 2R5ZA 2E7XA 1YYVA 3JRGA 3CTFA 4K8MA 1DPUA 4FYBA 3HC7A 2R5ZB 1R5AA 1CQGA 3O3TA 5ECSA 1USBA 2X1EA 4G94A 5BS6A 1XWGA 4GCVA 3HJOA 1HQOA 1T0FA 2DFFA 3RPUA 3S93A 2IRFG 4UNOA 2QKEA 5B8BA 1S5LC 5ELAA 4W1UA 1N2AA 2ICWG 2FUG2 1HKTA 4TOPA 1JT6A 1WZ2A 1NK3P 2H75A 5K7ZA 1K83J 4AVPA 5FWGA 1YIJI 1XZOA 2FD3A 4YAVA 2IA1A 1MNMC 1TRSA 1YJWI 1S7EA 4LG3A 2DLLA 5EGOB 4K1FA 2H73A 3H8QA 3FMSA 5E1ZB 2XAUA 1JE8A 1G6YA 1UC7A 3HM5A 5ECHB 4ZILA 1FX7A 5E79C 4C9YA 2DT5A 3AKZA 2B7EA 2H8WA 5FKMA 3HEFA 5FLMJ 1A2LA 1P4WA 3RPPA 1GLQA 1D8JA 5DDGA 4XHMA 3HXLA 3D5JA 3WGIA 3BTIA 2HQNA 1GSSA 4MTDA 3UVHA 3N4MA 5JWOB 3LSHA 2VL8A 3QPLA 3CRTA 4BWQA 5DALA 2HQ5A 3CZ6A 1NG7A 2R7XA 1RESA 3HDCA 2BY2A 5L3BA 3C7JA 1YI2I 2WFCA 2XBIA 2IMDA 3EETA 3ECHA 2CH0A 4KITB 1LPQA 5AIVA 2QSFX 1IW7F 2ZFWA 3QYBA 1Z77A 4X1EA 4BL0B 3TKPA 4RS8A 1PKZA 2LY9A 3CMMA 3CQFA 2R7VA 1GULA 3U1DA 3D0ZA 3F3XA 4KT5C 1QO0D 1KU2A 2ID6A 3G7YA 3LSJA 1S7AA 4WF5A 5J4UA 4B44A 3I56I 2FA8A 5ECNB 1U6TA 2VXZA 1QNTA 5G1KA 4I2OA 2K86A 2GQLA 1MD0A 1XVQA 4AGSA 5GAND 3EQLF 3K1PA 3OL4A 4JBAA 2G7UA 3QP6A 4CZZA 2Y9ZA 2DK5A 3L00A 5LHIA 2RVCA 2L6CA 2VQHA 4FETA 2LREA 1OKTA 1XGMA 4O92A 1KA8A 1TWHJ 4EJUA 5J47A 4F93B 3Q19A 3DRNA 3EDPA 4YFXF 4RUVA 1XDUA 2CO5A 4L9JA 4HV5A 4XLEA 3GX8A 5AGYA 4HZ4A 1ODDA 4XMYA 1CQHA 2J5PA 3GTKJ 4MLOA 5CYYA 2ZXHA 1LKXA 3IR4A 2M5WA 5BPDA 4OMZA 2O61A 3GYHX 2FWHA 1X58A 3IAS2 3IK7A 2HRFA 1NHAA 1REPC 3AG2H 2STTA 2MD0A 1EEMA 4HW0A 5F0HA 3P2AA 4TR4A 5IO2A 2P7VB 5H2FC 4R8HA 2I3YA 4PURA 4FO5A 2EIKH 3F4SA 4ZBBA 2MGQA 2AXLA 3TOTA 2BY3A 3J7ZI 3OMYA 3MZHA 4NBQA 1LFUP 1HOMA 1JXSA 2IMFA 3CO6C 3F63A 2RLIA 1DBYA 4V19K 5DM7F 1D0YA 2CQ7A 2EH3A 2TRCP 4IHXA 2NNYA 4POKA 5DD8A 2PFBA 2X9DA 2ZSIB 1XSXA 4UV8A 1TQPA 2AO9A 2M0MA 2NTOA 3PSFA 1N78A 3LYKA 4KNDA 1WVRA 4EO3A 5IYCJ 3KCCA 1ETKA 3QP5A 3E5QA 3GN3A 4JEDA 3FISA 3RYRA 2W57A 5IMFA 1JZDA 2EB7A 2JZTA 3PR8A 4GTUA 3AG3H 1PKWA 3CDLA 4HSRA 3BG9A 3DTIA 1UVZA 3D21A 4AJ8A 5E3NA 3C2BA 2KKOA 1HXDA 1XWBA 2IPQX 4E7JA 4WBJA 4ETSA 1YJ6A 1P7JA 1KYWA 2GZZA 4C30A 6GSSA 3APQA 2K40A 3AFHA 3MKZA 4MJBA 2HRKA 3U2RA 4XOTA 4N10A 3VPQA 1B4QA 1I27A 1WPKA 2HGCA 4G2EA 4AC0A 3WE3A 3GTGJ 3C2GA 2D5VA 2VLUA 3Q6OA 4AJ6A 5B6MA 1VQ7I 4KDUA 1RUOA 3M9AA 1YX3A 2GXAA 3W6VA 3H79A 3GSSA 4C2MJ 5CLSA 4C3JJ 5C4JJ 5HODA 2L7ZA 2K6VA 4RQXA 4GYIA 1W1WE 3GFLA 2IT0A 4XL9A 4FISA 3DPLC 1OVNA 1RR8C 3FX3A 5EEGA 5A5KA 5IM9A 9GSSA 5BRTA 2IIYA 2BGCA 3JRHA 2H27A 4D0PA 2B1LA 5J41A 4A93J 4V2MA 2C6YA 2RN7A 3DU5A 2PG4A 1E3HA 2Z9OA 3RTRA 3CCUI 4B48A 3QOEA 2F5VA 1ZK8A 1ETXA 1KNGA 1JUSA 4BXUA 2HXKA 3J7Yk 4AM3A 3M8NA 4PJMA 3TKYA 1E2YA 1ZMAA 2HYJA 1RIOH 2R7FA 1PUEE 1HC8A 5HFIA 1WPIA 2NOJB 1SU9A 4BQNA 1NTCA 3IRQA 2X6YA 4XSZF 2HDCA 1GNWA 2XC7A 5F06A 1QXHA 1M1EB 1S29A 3F22A 1JJ8C 2DJ0A 3QPMA 4GRFA 1EGRA 4BE0A 1FTZA 2C3QA 1D1BA 3IWFA 2LNTA 1VFCA 1T38A 1ON4A 4WEYA 4LG0B 2H6CA 1KU7A 1G6WA 1THXA 4OFNA 4CH7A 4I99C 3W2VA 4BE2A 2A07F 4HOJA 4IF4A 4ISDA 3WGHA 1I1GA 2X49A 1IN8A 1XWCA 2E1NA 2VJ5A 4DOZA 5LGTA 2AYTA 5DJLA 2B7KA 3EU4A 3VWUA 1J7KA 1QHGA 2EA4A 2QQBA 1MMNA 3H9JA 4XN3A 1EKEA 2CW0F 5IYBJ 4AD9A 3OS0A 5IOZA 1J08A 3KYCB 3RPUD 3WG7H 2GGTA 3QYFA 5IPGA 2VCZA 3ZMDA 2E34A 4NC7A 1MNDA 3M8JA 4MIMA 4F3QA 3IH3A 3I71A 1IRZA 5DCMA 2RKHA 2X51A 1LQ1A 1PMTA 2YWOA 4J00A 1ZL9A 2ZNZA 1X2MA 2IW5A 2BTOT 3IDVA 2VQLA 2NVQJ 3I69A 4RGRA 2M1BA 3QFAC 4BHBA 2COMA 5D5UB 5IOWA 3CESA 2ZMEA 2ZJRF 1R5HA 3CCSI 2K5CA 2G0FA 3ED3A 5IMDA 2JN6A 3SFZA 4M71A 3A03A 4F52A 2EBIA 2L5OA 3T8TA 3GUDA 4I7HA 4EV0A 2VXDA 4KW6A 1Z7LA 2KMUA 1A2MA 3A2WA 2ZXIA 1Y39A 2GXGA 1ERWA 3RDWA 1DU0A 4M9ZA 2DT7B 1X9WB 4L5JA 2W84A 2JL4A 2DPUA 2L4MA 5F04A 4QTRA 5G31A 2VM1A 4DYCA 1AQWA 3HL2A 1GXQA 1TZLA 2PLYA 3OV8A 2IS2A 2MBFA 1RPWA 3FHKA 1K0OA 1YKAA 1X19A 5CAXA 1X5CA 4B8XA 3IKVA 4I76A 1KONA 1P7IA 2MMOA 3FXKA 3WTZA 3UBLA 1SKRB 5F0FA 4TV7A 1DPRA 2L59A 1EA3A 2CAIA 4IJAA 2OJLA 3A2VA 4Q5QA 2AS5F 1BQ7A 4HOBA 4X0XA 1GUUA 4H4KC 3EYIA 4HLYA 1VQ9I 1GNEA 1RC9A 1LE8A 3BR3A 3F23A 3CO7C 2EC4A 3TJBA 1B8IA 2K27A 1SANA 2VPRA 4B3AA 1Y6EA 3S32A 3IUOA 1PL2A 2X6XA 3FK7A 3A01B 3EWLA 1XW5A 4IRGA 1B59A 2CT6A 2P5RA 2DA7A 4K5RA 1F1ZA 1SKSB 1V40A 1TK5B 5GP9A 2DQRA 2DA4A 2Q1ZB 3F4TA 1HW5A 2LH9A 2L9SA 2VD1A 4YKFA 5C44J 2JJ7A 5GTHC 5J9BA 5ECPB 1X4OA 4EJTA 3M8EA 2JSZA 2GSRA 2Y48A 1MJAA 1QHHD 2X6WA 2Y69H 1RRJA 1JFUA 2LYCA 2R92J 1Z67A 3KLOA 2ECCA 1HW2A 2HSMA 4O7HA 4EKZA 3TMOA 3HOTA 4DEJA 1WJ5A 4LMYA 1M3JA 2A2SA 2EZKA 4QPOA 1VQ5I 2X48A 1HSTA 4WX9A 3DKWA 3EURA 1JTYA 4OIQF 3LFUA 1VF4A 3ABUA 2LK2A 3C18A 4N0ZA 2CV0A 2BY0A 3WD6A 4D73B 2MYGA 1X9SB 2F48A 2ISZA 3SZTA 3AY8A 3HHHA 4BHPA 4WXHA 2AB6A 2KHPA 5ECIB 1TP9A 1O4XA 1FOHA 4K7NA 2OPTA 2BJXA 3DXJF 3LSRA 2EIJH 3NAUA 1D3YA 3K1MA 2DK8A 2VKEA 3L7WA 1A8YA 4JX4A 3OYCA 4M6YA 1SJIA 4HX7A 3U6VA 3J7YJ 3KPHA 3G1MA 4MFEA 4HRIA 4LLNA 2H8LA 5B7CA 4E8HA 4EVMA 3CSHA 2L3DA 4UB6C 1R5PA 5HFKA 5F64A 2V9PA 5J1YA 5IT9Z 1Z9CA 5J4VA 4IN0A 3Q5FA 4LITA 3EPZA 3FHZA 2OACA 3E6DA 3ME8A 4RB2C 2Z1DA 1M3IA 5F0GA 1UFMA 2RUFA 4MZCA 2HSHA 3MAKA 2I9HA 5IT3A 4IX7A 2PQ8A 1XCCA 2E7WA 3KE2A 5EZHA 2M45A 2DJIA 2LRDA 2CFOA 2O7KA 3LMMA 2M7BA 4JOMA 2GS3A 3E3VA 2CSOA 4RAZA 5CQGA 2R4VA 4J2FA 4ZL7A 4MJAA 2BXYA 4EJVA 3REOA 2R5YA 4KNYA 3NRVA 3GLLA 4FX0A 2HTJA 1MDIA 4UY8I 4PTSA 1LFPA 1KGSA 1O57A 3GFMA 5B1AH 1G0TA 3LEFA 5DAKA 4NAXA 3A4CA 1OYWA 3LSGA 1T2KA 4O5RA 1O8XA 2K9NA 3V8LA 1EH8A 1AWCA 2IBDA 5H5QA 4HI7A 4HNVA 1YZXA 1I3AA 5E1XA 2CQNA 5L3DA 2OE1A 1TBXA 3US3A 3QAGA 2FU4A 3JSOA 3LGCA 2OU2A 4S0HB 1OJLA 5EYRA 2F5DA 5JLWA 3ZFLA 1SK2A 4USSA 1Y8RB 4PSXA 3M1GA 2PX9A 3SYTA 4TXVA 4XM3A 5D6FA 1B72A 3SFIA 4CCJA 1AIUA 3VI7A 3FXJA 1RK4A 2R7QA 3GKMA 2E71A 1EZKA 5ILUA 1YJ9I 1SFUA 2D1HA 2YSRA 3I58A 2IGOA 3WTVC 1TT0A 1QQIA 3DV8A 3WU1B 4YAPA 2EQRA 2MH9A 1U87A 1W7PB 1SD8A 1SENA 5HLHA 4EXJA 1U0JA 2I10A 2GIZA 4WF4A 4JK1X 2JADA 2CZ2A 1BR1A 1R4NB 1O7FA 3B6AA 4F7ZA 1HNBA 2B1KA 2IGNA 2L4AA 2B63J 4HJ2A 4ZL8A 3TKRA 1H89C 4KSOA 2LF7A 3GTLJ 4N0BA 4MP4A 2FD5A 3OIPA 5AIQA 2RQPA 1MBGA 1T8IA 4POLA 1B9NA 5EY6A 3RKQA 5GAHJ 3QDNA 3TOUA 1HQCA 3HVSA 4WR4A 1M9BA 1ZG1A 4KN4X 3BTLA 3K4LA 1UCRA 1SD7A 3GA4A 4ZZDA 1QPMA 1MH4A 4U0VA 4U87A 3JTHA 4PGTA 2LTPA 3H92A 3ZPLA 4JP0A 2L2OA 5E8IA 4V1Ag 1GVJA 1ZYQB 2EK5A 1IN6A 2A2PA 2C3TA 2YPMA 4A6DA 2Y0SN 17GSA 1ZOFA 1MW7A 2EFNA 1UA5A 1B8XA 2F6CA 1OCTC 1XOAA 3FZ9A 2H01A 2OQGA 3WGDA 4RI6A 2IA2A 3LA3A 2WV0A 1O3TA 2YU9J 1T0FC 1C72A 2XPDA 5CYVA 2O03A 3BJ5A 4I98B 4XLPF 2GQQA 2YZUA 2LMDA 2XV4S 1GT0C 1ON1A 2X0LA 5IMCA 2F51A 3C8EA 3KX2A 5L3FA 2V1XA 3PGTA 4EIPA 4ILFA 3ZMKA 5IOXA 1TNSA 2B9SA 1V4RA 3OIOA 1F6MC 2OZUA 3LOCA 3SEQA 1FAAA 2DOEA 1MMGA 4MJEA 2ELKA 4F92B 4LA1A 4X43A 5G5EA 1BA5A 1M2BA 2LKUA 3GV1A 1B6AA 2DMNA 5DCHA 3VI5A 4ESJA 4E4HA 3TUEA 4OAZA 2X8HA 1LE8B 2VCVA 5F8BA 1SKWB 2OE3A 2NS0A 4PNGA 2X8CA 4ML1A 2FHEA 3UJ1A 1D5VA 2NS7A 4R1HA 2AHQA 4K6XA 2ZNYA 2CW7A 4ZYHA 1LVKA 2MABA 1K0AA 5ABRA 2LQOA 5J8CA 1T56A 3TO9A 4WWCA 2HPMA 4E70A 5JWQB 3ONQA 3HUGB 4RM3A 3JRDA 1FNNA 3CXGA 3GLXA 3QPHA 5D6EA 3HXSA 2I4AA 3VPRA 1B48A 2PVOC 4EATA 1FC3A 1A6IA 3EYYA 4DQ2A 18GSA 1S9HA 1J2XA 2MZCA 2VL2A 3FZ4A 4EGYA 4K9ZA 3D1NI 2K18A 2JUGA 1TW9A 2HU9A 4HAMA 3ZCOA 3L0HA 4POBA 2EILH 2DMUA 1XCVA 2KISA 5EPFA 1YQAA 2DJ2A 3DBRB 4J57E 3TKSA 3IHQA 2HXOA 3J7AO 2A4VA 1X1CA 4TR1A 1IZ1A 2GM4A 4V1Ap 1O7UA 2R7DA 2H74A 4DYQA 2W7NA 2R7SA 3D22A 2O89A 3ERMA 4YIRX 2BBYA 4FTHA 3JR9A 3ERGA 3KP5A 2QYOA 5CRDA 1OR7C 3KCMA 2E60A 2JZRA 4DSSB 4G8XA 1LNWA 1OFCX 5K5QA 3FR6A 2LDUA 4M3EA 4IZZA 2V6CA 1T3BA 2A3SA 3G1LA 5FJ8J 3LQQA 1RQMA 2B7JA 4F2IA 3F6DA 5B66C 1NH3A 1UHSA 3OYJA 3M8FA 3ZP5A 3QAWA 4FT8A 2VM2A 3G2BA 3SWLA 4DZJA 1FOKA 4JE1A 2DA2A 5E59A 2C1YA 2IEKA 2P5QA 1K4TA 4XORA 1LU4A 1B9MA 2HT9A 5IT9K 3VWBA 2NVTJ 5DUIA 3HIFA 4XRSA 4BIKA 4A3FJ 1K3LA 4D7MA 4E7ZA 3LAJA 1OCCH 3PQKA 4G9YA 3FMWA 2O7OA 3HYIA 2R0CA 2DW4A 2X64A 2KP6A 1BIBA 1ETQA 4Y3OA 4WCGA 2EFWA 1SFOJ 2DYRH 1D0ZA 2FQ4A 4A3KJ 4KCAA 3BG6A 3PH9A 1Z6NA 2OA4A 4PGGA 2RGVA 3E6BA 2Z2SB 5IP7J 4DIQA 2V32A 1P92A 1BI0A 20GSA 4HDUA 3HJPA 3FXQA 3F9UA 1AA7A 1A2JA 2F5FA 2FOWA 2MLGA 3H5RA 3GURA 1XGNA 3VYTB 1M2DA 2H76A 2P0WA 3FEUA 2L01A 3UVTA 3ZRDA 4XSXF 3WODF 1OYIA 4HX8A 2CS3A 3O8GA 2QA1A 4L9TA 3TDUC 1R7HA 5ID2A 4LLRA 2HKOA 2PBIA 2WV1A 4EUYA 2MW8A 1B4AA 2XKPA 4KN7X 5FGMA 4BBRJ 3K6GA 5CO3A 2LKPA 2ZO4A 3P9KA 1K4SA 2H6XA 3FBIB 4XN0A 1TU8A 4PUSA 4G6DA 4IQJA 3BR2A 2QSGX 3GUSA 2WAQA 1BW5A 1T33A 3V8JA 2BMXA 3MQ0A 4BH9A 2XSJC 4ENKA 6GSTA 3BROA 3L78A 2AAWA 3DIEA 1R1VA 4PDKA 4ZDLA 2YZHA 4RM2A 2W4SA 3M1EA 4EM1A 3A01A 2PN8A 5CRHA 3HG9A 4OWRB 2PMZA 2FSWA 5L3GA 3ERWA 4GF0A 4YQVA 5AONA 1MZBA 1AQXA 4E7KA 1VF2A 1R9TJ 5EEAA 4CY6A 3P9IA 4WXDA 3L1PA 4L0WA 1GSUA 4F9ZA 1F2EA 3HSFA 5H6RA 5FD6A 2BW3B 1XD7A 4YH2A 4XTSA 3MFKA 4RAFA 4GYGA 4WKWA 2YJ7A 13GSA 1R26A 2D45A 4OMVA 4OCEA 3S2DJ 1IUFA 3FWEA 1UZCA 4LL4B 2NVYJ 4GGGA 2O87A 3WGXA 4AVZA 2VJJA 4IW9A 4ECJA 4MA9A 2LC2A 2PMZN 1WKMA 3GHAA 5HQPA 4NB5A 1GUHA 1EF4A 3PSIA 2ISYA 3IC8A 2W85A 3TQNA 4XS1A 5ECQB 1MJBA 2DU9A 3BTCA 5CQEA 1JT0A 4GLTA 4HNUA 1CGPA 4BACA 2UV1A 3KH7A 4LL1B 1FO5A 2R7WA 1SD9A 3I4PA 1ZR2A 4LB6B 2I8DA 2WAFA 3C2HA 5D5XB 1Z5YE 1Z7PA 3FW2A 3HKRA 4MPFA 5GSSA 2M30A 1APLC 1HNAA 2CMPA 2QQ8A 3ULQB 3BR0A 4ESBA 1BI2A 4Q5SF 1Z6RA 5FLVA 1KQ8A 2CUEA 4JR6A 3LXZA 3GTPJ 4D1QA 5J1UA 4JQFA 4XLHA 3K70D 1ERUA 1QK8A 2Y0MA 4V2GA 3CCQI 2UUZA 2STWA 2QBYA 3VSKA 2JQ7A 2I81A 1TWGJ 2R5GA 2O8VB 4K7IA 1W5CC 4KE3A 3S15J 1V54H 2XKOA 3RIRA 3DXBA 3BJAA 3WU2C 4KDXA 1U5TB 3ZN1A 1YY7A 5FHIA 5B1BH 4XCSA 2C0DA 5LGNA 5CVJA 4XKWA 2CX3A 3IC7A 3K69A 1U78A 4BVYA 2OJED 1RKTA 4MFDA 3F0CA 2OV7A 3H35A 1XTAA 2BY1A 3D5LA 3K2ZA 3K4KA 2CV2A 3DVWA 4JR4A 4ZB6A 5KN1A 5IIZA 5J9CA 5DAKB 2R37A 1V5FA 3FYGA 1P4XA 5TISC 2HLSA 2XC2A 3OYAA 4YRVA 4BS9A 2WGRA 3L4NA 1T8EB 3PM1A 3TO7A 1YQ1A 1FOWA 1MBEA 1OYYA 2KP1A 3LNQA 5A4WA 1YE9A 1ERVA 3KGKA 2FMYA 3H1CA 4KAEA 2XHKA 3FK6A 2DMMA 4I8BA 4BL7B 3R2QA 2H72A 9ANTA 2PMUA 1GUKA 4WBRD 3DYRA 1B72B 3VWVA 3VDXA 3KXOA 3EC3A 5TGTA 2IFQB 2HQAA 4ZYAA 3H9QA 3PNTA 4P55A 4MEXF 1B4PA 1XGSA 2OF7A 1XX5A 2E7PA 1Z9HA 3IE3A 1G59A 4NDLA 3V1WA 2LJRA 3TRQA 5EL8A 1BJZA 2EZHA 1W36C 22GSA 1VZ0A 4KJZA 1PVEA 1TRVA 3T0YA 3VLNA 3CJNA 1GSQA 5BPIA 4OINF 3FXMA 4XQFA 1R1TA 2MC3A 2K8VA 4Q48A 5IPAA 5EGOA 2H1LA 4M74A 2HOTA 3BD2A 2L7KA 2JT1A 4IBPA 1MBFA 1W7PD 4RB3C 2BYVE 5FKNA 1STZA 4MH3A 4O5QA 4ASNA 2YX4A 4XOPA 2OKAA 2NXNB 1OMIA
chains in the Genus database with same CATH topology
3S3OA 4FYUA 4XRAA 1BR4A 1ACVA 2EIRA 4D9JA 2F8FA 1G7EA 2HFDA 4OAYA 5INYA 3LYPA 3PUBA 1Y25A 5DJMA 3MD2A 1K0CA 4IQAA 3KIJA 4PXOA 2IXSA 2E5NA 4TR3A 2VD0A 5CPRB 1ERDA 2GSSA 2LV3A 3A3TA 4XLFA 1M2AA 4ZXGA 1NW2A 4HDEA 4DBRA 4IS0A 3D6IA 5B8AA 3LQ7A 2K8SA 4CCMA 2HSYA 3N9JA 2LRCA 3KMOA 5H5RA 1TI1A 4V2NA 4OCFA 2VAFA 2WRTA 3P8WA 2WZ9A 3F4RA 1S3DA 2ES7A 4G19A 3V42A 4PFPA 3CTGA 4IP1A 4CW9A 4OFMA 1SL2B 1KEBA 2HI7A 3CP8A 1M0UA 2M72A 2TIRA 3W8SA 2B6MA 3KTBA 1AW9A 2LY2A 4GQFA 4K5SA 2O5RA 3HZ8A 7GSSA 2AQEA 4ML6A 4K2DA 4RI7A 2X4AA 4CZCA 3F3QA 1ZYNA 2HNLA 4CCNA 2V41A 4FH8A 12GSA 4WETA 4RQRA 2M7AA 2HPIA 1OC8A 5JCGA 4PNFA 3GSTA 1VF1A 1QQ2A 2VJIA 3Q19A 2KLXA 1PN9A 2VIMA 14GSA 3CRUA 4K0GA 3DKSA 2IPAA 3OYBA 3QAVA 2X85A 2W1OA 2HZEA 3MDKA 3FDYA 3K4NA 5ECMB 3H0DA 2ALBA 4CCLA 1WFXA 4EDZA 1BAYA 2H66A 1DE1A 5IMAA 5ECOB 3UMAA 1FOVA 4X1UA 4XKBA 1QFNA 1DP3A 1PJRA 4BVYB 1X1AA 2K9MA 3SZGA 2IJYA 4PJJA 5KHDA 2VPLA 1Z7RA 1Z6MA 2W00A 1VGLA 3IK9A 4LIVA 3L9UA 2CZ3A 5LD2C 5ENUA 3E0JB 3MNGA 4ID0A 1AAZA 2GQKA 4XLCA 1MDJA 1A24A 1TK0B 2MMNA 1DSBA 16GSA 1K6YA 4ZL9A 1SJ6A 1GSYA 3H5AA 2ZNMA 4Z2RA 4MDCA 2GLRA 1E6BA 2NDOA 5HR3A 1THOA 3PNYA 1EOGA 2VKHA 2XDVA 3IP4B 4MCUA 2N5FA 3D5RC 4KF9A 2XF5A 2H1DA 2E5ZA 4O5UA 2GT5A 1T7PB 1J09A 1GLNA 4B47A 3UNGC 3EUKL 2PGTA 5KCMA 5HVQC 3OS2A 3RHCA 4QL9A 3ZMLA 3BLYA 4ZTFA 4J56E 2ZSHB 3LSKA 4CCOA 2PJRA 1T4YA 3KEBA 3W3CA 3W2AA 4AYBA 1SL0B 2MYSA 2LJAA 2IS4A 4BXFA 2HVQA 1Z21A 2MMZA