2FUG9

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
154
structure length
154
Chain Sequence
YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase chain 1
publication title Structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 29
structure length 154
sequence length 154
chains with identical sequence G, P, Y
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
9 PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fug900
3I9V9 3IAS9 2FUG9 4HEA9 3IAM9
chains in the Genus database with same CATH superfamily
3MM9B 1U8SA 1HI0P 3I0SB 3SFGA 4FF2A 3UD5A 2GVDA 4ZVPB 2RMLA 2FY8A 2C2DA 4EBEA 4IDKA 3TZWA 2D1CA 4TY8A 1S1UB 3MM8A 3SYZA 1U48A 1ZPWX 1AFJA 1TK8A 2FIUA 4OYMA 5IC6B 1S97A 1HWIA 3NMAA 2GGPB 3GIKA 3IG1B 4DX5A 3NCPA 4YN3B 2R9LA 2BE2B 2YX4A 3UNYA 1FXRA 3MECB 3FUYA 1LW2A 4LF2A 1MROB 2IRUA 1YZ6A 4FF3A 2WOMA 2E5IA 3IN5A 5T7LA 3GMGA 5JJBA 3DLBA 5FD1A 5D78A 2VF3A 4RW9A 4DS5A 4DV3J 1Y7PA 4X4UA 1HR0F 4M95A 2OFGX 3DYAA 2DNRA 3F41A 3N0VA 3KK2A 3UN2A 1I3OB 4LIRA 2VQFJ 4A8WA 3BBBA 3KG4A 1IBKF 2N3LA 3ET6B 1MMNA 2E7VA 1JWWA 4YS2A 2IYIA 2DCLA 2D9PA 4YFUA 4R8UA 3MR6A 1QAXA 4J9LA 1T9TA 3P96A 2XB2D 1TV6B 4QBUA 3WX8A 3PO5A 5KFPA 2YKOA 5KFKA 1FD8A 4F3MA 3KLEA 2MQOA 1NNDA 1PJ6A 4PYDA 4KPYA 4QIVA 4MIBA 4KY3A 3UW1A 2BX6A 4O0IA 3M2RB 4P72A 2HRUA 5KFJA 4OHZA 1G4CA 1YJRA 3WDOA 5J2PB 1RYSA 1K1SA 3DLLQ 4WFBQ 4USJC 3RR8A 1SC1B 3KKFA 1KOHA 1N54B 4C3KA 2BJ1A 1DRZA 4IR1A 2HAIA 5B7WA 1GXTA 5E41A 2KZMA 2AKWB 3BYRA 1K0VA 3NCQA 4OYPA 1TZ0A 4LVOP 3NAIA 4KKOB 1KR4A 1UVLA 2X1FA 3HZGA 4MKYA 3BR9A 5KFVA 3ZZTA 3O6QA 1RTIA 4OHVA 1NK0A 4WPAA 4PZVA 2M3DA 3SFUA 3CNQP 4RUHA 2XCPA 4DV5F 5C42A 2H4WB 1Q5VA 1NAQA 4WXWA 2HFOA 4W4MA 2RUGA 1L3VA 3GILA 1LEOA 1D3WA 4P75A 4Z2XA 1KQGB 2R8KA 2W2OP 1NMEB 4NLRA 4YR0A 4ELTA 3I55S 2BJ8A 5M2UA 5F8HA 3TYTA 2ZWPA 2DKOB 2HW3A 2G1HA 1HNWJ 4DPUA 2J6TA 1FX2A 1IN0A 5EX0A 3OVBA 1Y3KA 1XNRF 2VG7A 3MMAA 1RLCL 3R6LB 3TW0A 5DG7A 1M1HA 4DV1J 2MHNA 1JXLA 1LWCB 5DLGA 2CQCA 1S79A 2KZZA 4F0KA 5KFRA 2BV3A 2BYCA 4X64J 1JLAA 2O3DA 3DLGA 1FJ7A 1B7YB 4KGKA 2M2BA 1HPZA 4LR7A 4OX8A 2RQCA 5HJYA 1XC9A 2ZM6J 3M6XA 5DZ6A 2MKHA 3GFYA 3CCWA 1NO8A 1IR1A 2HGNA 3OTEA 3UN5A 2IMWP 4DV6F 2VKZG 2OAUA 3D28A 4EI2A 3MFHA 3MR2A 1UEUA 4PWDA 3UR0A 2COLA 3C16B 3LP0A 4ZCKA 4K0KF 4CQ1A 1YBAA 2POKA 2CXEA 1CJVB 1I94F 5HN0A 3KOAA 2OPQB 2UUAF 4LQ9A 3DHWC 4JI2F 4C0BA 2DISA 2QO3A 3RYLA 4X66F 1HW9A 2PE8A 1SI9A 4LRCA 4WYWA 3DDKA 1RP5A 3Q8PB 2CQ1A 1O0PA 3UQSA 2B4UA 4TVAB 4DR6J 4QWAA 4LSLA 2R4FA 3BSNA 2V2ZA 2YNHB 1TL7A 2AP6A 3K8WA 1LXNA 4DI6A 5RUBA 3QJJA 2IDEA 1O6XA 2DHHA 3V4IB 2FJVA 4Y2IA 1OY8A 3BS9A 3OBIA 5D77A 3EWGA 5E5NA 2QLBB 2RU3A 7AT1B 2PMWA 1U1MA 3NNAA 1VRUB 3H98A 1P1TA 1IKXB 5KT2A 2W24A 4DF4A 3BSAA 1GT8A 4XAKA 1REVA 2XMMA 2E5LJ 4QYZJ 2MQ8A 5K8MA 3K89A 4ECSA 4UOHA 2H5JB 2D41A 2W1BA 3ILLA 1ZOTA 4NMXA 3A4TA 1RHQB 3DLEB 2ROGA 3ITHA 2YH0A 1X5PA 2FZKB 5KG3A 3H5XA 5DRKA 5CYJA 4M5DA 4NLQA 4UT4A 4LF7F 1U45A 5K8NA 1TKZB 1YRUA 2VUGA 3WC0A 5KT7A 2IBOA 4FP9A 2V4JA 4DCPB 2GV1A 4ICLB 2J76E 3FQKA 1VYAA 4OI4A 3VALA 1FRXA 1RWXB 4ECVA 4JI0J 3M8QB 2A18A 3DOMB 4GMKA 1HD0A 3M6WA 2V8GA 4UUXA 3B78A 3MEGA 5C25A 4IUFA 1TQLA 4OI1A 1FKOA 4IDKB 4TY8B 3AD8C 1XN9A 3NGKA 4DF8A 2JLGA 1RT2B 1YITS 4NRTA 3TJ8A 4KHMA 2DNPA 1XEZA 4E2FB 1U09A 5CZXA 4DR7F 3GIRA 3HPOA 3CGIA 3EX7B 4YDDB 3B82A 2QLWA 5A0YB 2CJBA 3TRGA 3UD3P 1RT5B 2G4BA 2V34A 1BD6A 5HVHA 4ZVOB 4WTOB 3P45B 4P73A 5B0BA 3M9OB 3HHEA 1SCJB 2IM1A 5IXUA 2BQ3A 1HHTP 2FVQA 3JYTA 1W7WA 2GIRA 4IFYB 3HI9A 4ES3A 4RW6B 3SV3A 3EDRB 4PR6A 4LVNP 1KQSR 3M8WA 2EG1A 4YP3A 4DUYF 3FCHA 2R2UA 3DXBA 2KVQE 3ETMA 5FLXY 1V5IB 4J9SA 3MMCA 4L72B 1F1BB 2DRBA 2HQCA 1UETA 1RUSA 3M8RA 1M1GA 2Y8YA 2MYFA 2W01A 5ETLA 3FZBA 4DQIA 4Z7YA 1T7PA 3MM7B 3DOKA 5F9NA 3VQSA 3N01A 1OO0B 5DM6Q 4DUZJ 3R7BB 4I56A 2PMHA 1WELA 3R5DA 3LO3A 2ZUGA 5H9FJ 2HS0A 3ENVA 4EO6A 5CHCB 1FRLA 3BSCA 1QLNA 1FCAA 1IWGA 1UL3A 2XI2A 4NCGA 5L46A 5L38A 4M5HA 5DQIA 2VBWA 2MGZB 2R7WA 4LRAA 4QW9A 2KB2A 3NGRA 4IYQA 2F63A 3RB4A 5HJXA 2KI2A 2IRYA 4E98A 4ECQA 4ZVSB 1NPRA 2GW8A 4B9VA 3HP6A 1OWXA 3BZQA 4DN0A 2ZJQQ 4DL7A 2DR8A 5SUHA 1VGYA 2KT3A 3EGWB 2HQDA 2MY8A 3DNCA 1FNXH 1JKHA 2MQNA 4HHUA 5IWAF 4Q2MA 4G1IA 1HBOA 2VKRA 3MDFA 1XR7A 1H2TZ 3KNGA 1WKKA 1FWKA 2B4VA 4H54A 1F2HA 1T95A 5C42B 1PYSB 1VQYA 1NDCA 3MTKA 3Q8UA 1C4CA 4IH7A 2H9ZA 4IH6A 3HK2A 3KXDA 1SQFA 4CI0B 2NCKL 2BQUA 3RAQA 2QYCA 5DDOC 1WHWA 5D4OA 2JLEA 2XLKA 1NZ8A 3SDEB 5AJ3F 1S6PA 2KXHA 2MKKA 2DVIA 8RUCA 2KYXA 4EYIB 1KSPA 4NI2A 2MSSA 2HNZA 4M5IA 1T9YA 2CAJA 1U1PA 1VRTB 2K3KA 4C8LA 2NPFA 4CLPA 2CNOB 3TP2A 3W2VA 2JVRA 3MMAB 3MPDA 4IOCQ 2HBZB 4W92B 6FDRA 4DSKA 2MY7A 3PRBA 1MNEA 2QYGA 2RAQA 3H2UB 3DLGB 2BQRA 3W8PA 5GVQA 1RSCA 1X4CA 2NLWA 3PTWA 2W4CA 4A46A 1DTQA 1DBDA 3EJMA 5IZHA 2JOQA 5KG5A 3HHLB 2DHXA 2M8DB 4NYZA 3CCTA 1FJGF 2OD4A 2CPXA 2FHOB 3L09A 2CNNB 5C5JA 3PR5B 1GMUA 1UAWA 1BE4A 2XZWA 4YB1P 1C1CA 2J6UA 3CDAA 4QWEA 2IMOA 5KFQA 3Q83A 1XJWB 1SKUB 4N7TA 3P8BB 3W9JA 3NOCA 1VLYA 3MF5A 3WZ0A 1DTTA 2DITA 3GYNA 3BF4A 2ZH9A 1QUVA 5K14A 4XO0A 1Z1ZA 4RNMA 3DGPB 2V94A 1PYTA 2HIQA 1TELA 4LSLB 1U1KA 4JYAF 4CRJA 4E0DA 3HHNB 1J5EJ 3NP5A 4AXIA 2Q3PA 1TL7B 1T3NA 2DXFA 2JRSA 2NUUG 1NPPA 2IPOB 3P4UB 4KBIA 1WJ9A 1B99A 3FRYA 3D67A 3QAEA 3OL8A 1S0MA 1RT7B 3IR6B 3V6HA 3BO4A 1LWXA 3HJVA 1FXDA 1Q16B 3G4SS 2C1EB 2HVEA 3EUNA 4XDCA 1AYEA 4OJGA 3CO0P 2KHCA 2WVBA 5HATA 5D4LA 4UY85 4USWA 4ZLJA 1FHTA 3HMJG 1HNIA 4DPTA 2MZ1A 4U8YA 4F50A 1F3VA 2R7TA 4W98A 2FJXA 2BANB 3UCGA 1W2IA 2J9EA 2IFXA 2OFHX 3H59A 4DXLA 1P8GA 4N8OA 2YNFB 5KFIA 1SUQB 4KO0A 3V6DB 4DV4J 4R5PA 1DLOB 3VAKA 4YR2A 1X9MA 4MJKA 1XIQA 3LA0A 2H65B 2SXLA 3GTYX 3I5CA 2HSEB 2OGUA 4WFYA 2OTLS 1GQEA 1S6QA 5JUMA 4H4OB 4L3KA 3LWMA 2CJYB 3Q8SB 1MN7A 4AYBD 2UVWA 2KN4A 4FDFA 4USUA 4KR0B 1SL1A 3VAGA 4DV0F 1NHUA 3TVYA 4GC6A 2OD6A 4ES1A 1X9SA 2GJIA 2VIHA 3M32A 5F41A 4MFBA 3M2UB 1WG1A 1HIYA 3CMES 3MUTP 1BQMB 4K50A 4DU7A 1SQEA 1VQMS 1D8ZA 5L1LA 2CJAA 4QR1A 4FYDA 1QY7A 2HGLA 3P49B 2B4OA 2V50A 5F8JA 3MM6B 4N8NA 4A8MP 2BUNA 2QRRA 4K5SA 3JYTB 4B9LA 3BBCA 2VC0A 3W66A 4QIWD 2OLWA 3BREA 4PEOA 1FKPA 4DL0C 2O5DA 3SMZA 4X62J 3EVMA 2HBRB 3GSIA 2G2YA 4C8ZA 4UUWA 4TNOA 1NHVA 3NOGA 4OHWA 4RUBA 2VB6A 1FWLA 2ZBQA 5B0CA 3KHHA 3HHDA 4BS2A 2J7UA 5LM7E 1V3SA 4AQYJ 3QYYA 3QJPA 1RHUB 4NEZA 3ILIA 2M4MA 2AWZA 1FESA 5HLFA 4JI6F 4RX6A 3QPIA 2ZJPQ 3FSXA 4G6VB 4OZ2A 4PG7A 4P10A 2VBYA 3KG0A 2H4YB 5FLXU 4MYUA 2QEXS 2YH1A 1K44A 3G8TA 3H2VE 3THVA 2LEAA 3V81A 2ASYA 1T94A 2IYGA 2OSRA 4ZKAA 4NCGB 2BE7D 4NXNF 5HMXA 5GADU 2M88A 4O0NA 3IA0A 1Y00A 1C0TA 3HHKA 3ZFVA 3POTA 4KH1B 2J0QD 3LQVA 2ZDPA 2IBKA 3HD2A 3R6GB 4LF1A 5KFMA 2RRBA 3PW0A 4C3MA 5AXNA 3C66A 4ZITA 4UOCA 5ETTA 2ILZA 2W8KA 4A8KA 2KG1A 3H2LA 1O51A 5HP1A 3QT5A 4UZBA 4AL5A 1JKHB 4NLSA 2KXNB 3OSPA 3BO3A 3CF5Q 4TU8A 3T41A 5KG0A 3G6VA 1AZSA 2RILA 4PPDA 3KJVB 1FNMA 3MCOA 1VQOS 2MZTA 4CLFA 4JV1A 1UZHA 1T9WA 1GXUA 3QRQA 3UD4P 1HNXF 2WW4A 3Q0AA 3MM5A 2MTLA 2E66A 5KT6A 3D0HE 2YQ0A 1KONA 3HX9A 2G0IA 3R5JB 1WF1A 5LJ5Y 2ADBA 1ZYQA 1FRHA 1GMVA 2MB0B 3OHBA 3WIVA 3HVWA 4ILRA 4Q0BB 1MN9A 2V4QA 4B9MA 3FFIB 3PO4A 1NHKL 3G6XA 4DBQA 2XYHB 4DR2J 4NI2B 2HNZB 2CJ9A 2BXJA 3M6UA 2MSTA 3PYFA 1S77D 1BXNA 3UVJB 4LREA 3SQGA 1RHKB 1LFPA 1RJJA 1FWPA 1UA1A 4RU2A 1KOOA 3U7JA 3OHAA 4WXOA 2VU5A 3FMBA 2I8EA 3PKMA 2UXDF 3VHQA 4CLLA 3W61A 1S76D 1T3OA 4PCQA 1UPPA 5HQ8A 3HCXA 5F9LA 2UUBF 3VAIA 3I31A 2W2MP 3M05A 1RHRB 1DTQB 5GADI 4FS1A 2JC1A 4FYXB 4CM2A 3FEZA 2N3OA 2BM0A 1XTZA 2WBMA 3MR5A 1H2UX 3G8SA 3MEEB 2UXBJ 2LQ5A 2ZKTA 4I2PA 1ACMB 2AYBA 3T3FA 2XTJP 1BMQB 3GG0A 2VICA 1RCXB 4ECTA 3A8IA 1U1RA 1NJZA 4HT5A 5DDRC 1C1CB 1HI8A 3J7YU 4Y2MA 4J9NA 2HHHF 3M30A 1IKYA 4C11B 1B7FA 4FYYB 1IR2A 1RDRA 4QWBA 3QBCA 4BWJA 2LP4A 4V1Ak 1YK9A 2DHGA 4HTJA 1K0TA 1Q7YT 5I3QA 4LF6F 1HWJA 3KK1B 5JVGQ 2OJ3A 2DY9A 4ED2A 4ZPCA 5SZTA 3KK3A 3QO9A 1WG5A 3PV8A 3AHPA 2ZC4A 2BBEA 4PUOB 1TKDA 1RBAA 1S9EA 4RW8B 1CVJA 3O44A 4NASA 2F4VF 3O2IA 4ZCIA 1JLEA 4PXBA 3BB5A 2HURA 3US5A 4B3MF 2EBGA 3GLJA 2AV5A 5FDLB 3OJSA 2WAQD 5ETPA 3TVKA 3CCJS 2FHKA 2R8IA 1Q8IA 2QA2A 1QTMA 2VG6B 3W64A 1EKRA 5IS2A 1WC4A 2HQGA 2KG0A 1HNIB 1H7WA 3Q24A 2GX8A 3EZ5A 1EP4A 1HL6A 2F4FA 1IR0A 1Y11A 1HQUB 3MD1A 2LEBA 3S6EA 5F3TA 4Q7AA 3VZIA 4USTA 3KTQA 4I7FB 4Q2LA 3GZ7A 3NNCA 4F4ZA 2ROPA 2L9NA 2IJFA 1QUPA 4KO0B 3I82A 1FEEA 5LOQA 3MCMA 3J7YI 4R5PB 4LF8J 4DCJB 3KLHB 2AEFA 4F2RA 4HI2A 4G1PA 3IRXA 2YX7A 3TEGA 2XY5A 2ZDOA 3HD1A 4DSLA 4Y6IA 3GV5B 4GVLA 2CQIA 4F67A 4F26A 1FX4A 4WKRA 4RNFA 3D6MB 3CXCR 1NDPA 2WSCC 3VAJA 1RWOB 4ZPBA 5IQ6A 2JEJA 4C4WA 4NLOA 3PIPQ 3U1LA 1FRKA 1MLAA 4U6PA 4DQPA 1IBLF 1UWBB 2I5JA 1N6QA 4ETXA 4I68A 4U7UD 2GHPA 2EFNA 2K8GA 3ZNJ1 2VBZA 4DL3A 3U02A 1LW0B 4CNYA 3DFEA 3ENWA 4RKUC 2UVRA 5ETSA 5F3ZA 3K8VA 1XBWA 1JJCB 2HHUA 4CLZA 1SB6A 3AOAA 5EUHA 3BKTA 4V19X 5MLCV 3D4JA 4FS2A 3DRRA 5A2QU 1B4SA 3VAFA 3ENAA 1XR6A 2MMYA 3GB0A 5BYRA 3HDSA 1IKVB 2GO8A 2RKIA 2PIIA 2GS8A 1SJ3P 2XHCA 3NAHA 1VQNS 5LXRA 3TANA 1VI7A 3CB4A 3MURP 4XK8C 3PKYA 3LPYA 2J0WA 3W1YC 1C0UB 1YQHA 3PYEA 1I5OB 3ZTRA 2PO4A 5HQMA 3HKZD 3TAMA 1S49A 1UFLA 2R7SA 2UVUA 1QDUB 3D3BJ 5KG1A 5KG4A 1MWZA 1FT8A 4OHXA 2HRTA 7FDRA 1N5QA 4AL6A 4J90A 3DMJA 3PJ9A 1N5YB 2WB4A 3GE9A 2YBVA 5E3AA 1ICEB 1FRJA 4WP8A 1ULRA 2CUYA 1TK5A 3C6TB 2FVSA 1VQPS 4C0OC 2WB1D 3C15A 4DL6A 3UDVA 1YG0A 3POTB 4CT8A 3ETOA 4IKAA 1GNKA 1NPKA 2HHPA 3CJ8A 3IWNC 3EXYA 1YSJA 2ATCB 5GAGU 2DR6A 2IVYA 3KLIA 4JI1F 2L9WA 3I6PA 3R8YA 2E1RA 4ED5A 1TAUA 1U1OA 5LJ3Y 2L41A 2RT3A 1N88A 2DRDA 1AZSB 1YVFA 3PIOQ 4DQRA 3AD7C 1NJXA 1KFSA 2FYXA 3LP1A 1E6YB 3LWLA 2EKNA 2EFQA 3MAAB 3KJNB 4EZ6A 2XS2A 2X51A 3T1YF 1F5AA 3FBFA 5THWA 3W60A 4P7TA 2PN6A 3PHEA 2HHTA 3TA0A 3Q2TC 4MK9A 1JX4A 1IKWA 1NSPA 4NLPA 3TUPA 1SJ4P 3D54A 2B6AB 1VFJA 4IFVA 4USVA 4WK1A 3CDUA 4R25A 3G82A 3EPIA 1JLFA 2CQGA 2FLPA 4OYIA 2VDIA 5A76A 2YXLA 1NKBA 3D6TB 2AYEA 5LSLA 4NCBA 1EETA 4WBFA 3I9V9 2VOPA 1CJTA 3CJRA 2AJFE 4P7VA 3KJFB 2M52A 2LXFA 1R6YA 2JC0A 2H48B 2AYGA 4P9SA 1QSLA 1GFWB 3D0GE 3GJRB 2VOOA 2DY1A 1CG2A 2GIFA 3IWLA 4DPXA 2F9DA 3H40A 4IRKA 2J8AA 4KHPJ 2C2KB 1RISA 5J2MA 4I2PB 1MG7A 5GAGI 4PQUA 1NEEA 2BJ3A 2IC3B 3FEXB 1IQTA 2PI4A 2DGUA 2IM3A 3K5NA 1YRTA 4LSNA 2NXCA 5EDWA 1ZAVA 4EBCA 4EK2A 2E9RX 3R2DJ 1NB7A 2GA7A 2MQPA 2JX2A 2WCXA 3OTDA 2VL1A 2R7XA 5A8KB 1VJWA 3T1HF 4I2QA 2ILYA 2UV8G 5E3PA 5HMYA 1KHWA 2V8PA 3GR1A 2K7JA 1JB0C 2RS8A 2UVVA 3ZXWA 4JV5F 1WOSA 2YNGA 2VG5A 3OW2R 1URRA 1Q81T 3RB3A 4DV2F 2YX1A 3QSYB 2GNKA 3OLBA 3ZNUA 1RAAB 5BR8F 4ZP9A 3KK3B 3QO9B 4ED0A 3K2YA 2C2NA 2OEKA 3QMQA 1RKJA 4X65F 1YJ7A 1JLBB 1TL3A 2YY3A 5EWGA 2ZH4A 1S0NA 5JVHQ 3IWXA 2C3UA 4AL7A 1U2FA 1B3TA 2EC0A 3I4HX 5AE3A 4P2FA 1NK7A 3QLHA 1S0VA 3LW5C 4P74A 5J2QA 4OZ0A 1WKLA 2HYIB 3GIJA 1Q8BA 4A47A 3C14A 3OQ2A 4OX9J 1FJCA 1GMWA 3IR7B 3BBFA 4CO0A 4EU0A 4YOEA 2XO7A 1EP4B 4B3RJ 3O1LA 3AH6A 3OR1B 1XERA 1XMOF 3SSQA 4N56A 3U1NA 4U7UK 2C3MA 1G3OA 2ZNYA 4ZLNA 4WE1B 4NA2A 2AGQA 2MJUA 2CG8A 3AAWB 2D74B 3PW7A 4LF4F 4MMOA 5KFXA 5KFBA 2OSQA 3MHYA 2KRRA 4WJBA 2ZOGA 3CPWR 2ALYB 4CLWA 1MU2A 2FY1A 3IRXB 1HARA 1FDDA 3GFHA 1R0AA 1Q8LA 2BACA 2FJWA 1I1GA 3PM9A 1PSDA 1X4HA 2IAJA 4OJHA 1SKWA 3M1VB 2H5IB 3I4PA 2FHJD 4KB7A 3RBXA 3FEYB 1KQFB 4CH1A 1CC8A 4K8RA 2MQQA 1N34J 1X4GA 1U1LA 3T5HA 3ZZ0A 1KVIA 4OZ3A 2Z56B 2AF6A 5H1SV 4KPCA 1M5PC 4IG0A 2PT0A 4ES2A 2CVEA 3PEHA 2K1RA 4JI7F 1MWQA 1PAUB 3F0NA 2OPRA 3Q8QB 4MKAA 4D3HA 1Q4RA 4QR0A 3ZZYA 5LMUF 3DRXA 3CJKA 2LDIA 4JI5F 4C8YA 2LXIA 1X8DA 3O3LA 4P2MA 3KHRA 3NBPA 2EC2A 1T05A 5KFAA 3FKBA 3D5MA 2EG2A 3T9ZA 2EFPA 1Q82T 1Z4UA 1I51B 4I67A 3G87A 4ZP8A 2OEMA 1GXLA 1S1TA 4OZ1A 3CJQA 2W2QP 3HFZB 5AE2A 4TYBA 1LFWA 3LH2S 4EBDA 1KDNA 1E6VA 4ZDNA 2JSXA 3JSRA 4G1QA 1VQ6S 4OZ5A 5F8NA 3DI6B 3R1LA 2DH9A 3CW2C 2F8HA 4WFXA 1UZDA 2MEWA 3TAMB 4L3NA 2B9XA 5F8LA 2D3ZA 1KBRA 9RUBA 1JMTA 1S9FA 2BJ7A 4PG8A 2F7VA 4TLQA 1GX6A 2FJAB 4XDDA 3IMQJ 5HROA 3KMQA 5IQQA 2R8JA 1DZ5A 4LFAF 1RT4B 4I0WA 2L9DA 2FQQB 4MK7A 4DSJA 3FZ2A 1JNZB 2V69A 3QNWB 3OLAA 2RQMA 2CPIA 1W26A 2W7PA 2JWNA 3QT8A 1YLXA 1KD1T 5CH7B 3IS9B 3KLIB 2J8SA 1WDDA 4MTPA 2HS3A 2NR0A 2YKNA 2ZBIA 4WIQA 4IRCA 4QW8A 4F4XA 3IO1A 2R7VA 1SL2A 2NZ4A 1M5OC 3X3UA 3FBCA 3HSZA 3NG8A 3LF0A 1FI4A 4HTIA 3AOBA 4ATNA 4QIGA 3TQEA 2G9OA 4XIUA 3O8WA 4O4RA 1J2VA 1HHQA 2H54B 2DNOA 3ULHA 3MGJA 4C97A 4RR5A 2H5EA 3E2EA 4N76A 3T5LA 1RAOA 3FK4A 2HNDB 1SIWB 2CVIA 1NKEA 1S1WA 1S4FA 2RJZA 3G82B 3GQCA 1KFDA 3CSKA 1RTDA 4GKKJ 1GAOA 2YWGA 4DS4A 2HFNA 2XYGB 3CIMA 1PKUA 2QJ3A 4HACA 4YY3J 3H7HB 5IOLA 3CJ0A 1S1VA 1TVRB 2GHWA 4NZ7A 1URNA 3HSGA 4MT1A 1HWKA 3BGRA 2W9AA 2Z30B 3SQOP 4I6YA 2D7SA 1VQKS 3RRKA 3CC4S 4UW2A 3PFOA 4CLTA 3OXFA 1HQEA 1RT3B 3HVTB 3S1TA 1CJTB 1YIJS 2VA2A 1Y0HA 4ZVUB 2HWIA 4ECRA 2DD8S 3KLFA 2RDDA 4CO1A 5I3UA 1R27B 2CPFA 2VH7A 1R3NA 2QA1A 2PEBA 1EZZB 3OTOJ 1U6FA 2HHXA 3SIPB 4FVCA 3KG1A 1QAJA 3AODA 1YX2A 3HVRA 1XWLA 1WF2A 1EKSA 1GTHA 4F04B 2GVZB 3MEDA 4PQUB 3BDEA 1NCLA 3BYPA 3MUVP 2C22A 2JL9A 5CYQA 2ZWOA 1MSWD 1S12A 3LGHA 2BMBA 4L6V3 4RPFA 3PACA 4TU7A 1VQ9S 2MKCA 4J9UE 3HFVA 1U1QA 2ZH7A 3EMTA 2QGFB 2YNIA 1PJ7A 2XBPA 3CE8A 2MKIA 1A0OB 3TVZA 4I2QB 3FCVA 3J7ZT 2AJ4A 3QGIA 1N56A 5KG6A 4OI2A 2B5JB 2HK3A 4CNZA 2R2TA 4ZPAA 2MHEA 1NK6A 4IOAQ 4JV0A 1DHMA 1PC4A 4C8NA 5J1EB 1HNVA 3VGVA 2V9KA 4IG3B 3G86A 1U7LA 1U0HA 2CADA 1X5SA 5DG9A 4N77A 4J5OA 5U47A 4LJMA 4Q8FA 1N0UA 2HNYA 4DHVA 5G0RA 2CJQA 4EUVA 3FBEA 1UVKA 3CJSA 3MD3A 1FRMA 3DRPA 4DX6A 3M8PA 3OL9A 2EW9A 2WK4A 5K9FA 3DOLB 2EWHA 4KC5A 4GKJJ 5GMEA 5IM0B 4F3OA 3QSIA 1LNQA 4USMA 3HT0A 4FKXA 1RWMB 2KFZA 4AUKA 2KVIA 4FNHA 5J2QB 3EVOA 2DNHA 1RWPB 3UDCA 2DR9A 4ZVEA 4LBHA 2CDRB 1PCAA 4R0EA 2OUGA 3MMBA 3MZIA 2YPZA 5G4DA 2Q79A 1OQ3A 1RT1A 1BGXT 5DQGA 4GRSA 4AXJA 1UPMB 3JXOA 2F8MA 3BV8A 3K0JA 4PWWA 3LUYA 4JI4F 5A8RA 1ZAWA 3SEOA 4KGMA 4U8VA 3RU0A 1HHSA 4XTTA 5KFSA 1A6LA 1JLCB 1FXLA 3OV7A 1MU2B 2Q66A 3OUYA 4QYZK 4MH8A 1TL4A 3CULA 2RF2B 1N36F 4NLVA 4B02A 2FVCA 1SPBP 5KFZA 1KLMA 1DARA 2YKQA 4CTAA 3AB4B 4F4AA 2Z57B 3BGOP 4FXDA 4ZP7A 5L1IA 4DFMA 1U1NA 1L3KA 2DHSA 2RDJA 3DCAA 4UQTA 1CULA 4TKTA 1HR0J 4DU8A 2R2SA 1JXEA 2ZOMA 2K1RB 4ED6A 4CO4A 2QMWA 4FNIA 1N5SA 5C24A 1X4AA 4DFPA 2F5GA 5A6WA 2XNRA 4DR3F 2QL5B 3PW2A 1IBKJ 4JI3F 3W62A 1VIOA 3J7A1 3GIMA 4DUTA 1VC0A 1F3FA 3M8YA 5LSRA 3PVXA 3NBPB 1SBRA 3PYDA 4B3SF 2QA4G 2F1FA 3A3OB 1W25A 4DR1F 3R7SB 2KM8C 3K57A 5I42B 3KHGA 3KLGA 3C8YA 4HVZA 4M5JA 1UEVA 1OPIA 5IT0A 2GJ2A 3I87A 2W9BA 1JLQB 1FFSB 4DSFA 2B0GA 3GP9A 2IHR1 3GV8B 3OJUA 2QLXA 4PG4A 1RLDA 4C9DA 5KOXA 3W2WB 4RW4A 2HVDA 2HRYA 4WFAQ 4CCHA 4BHQA 4GC7A 4NOHA 3QRRA 3I5AA 3IAS9 1XMQF 1G2EA 3V6JA 2GAGC 4PQAA 2Z4PA 1HYSB 1FNOA 5F8MA 1NH7A 4ZLLA 1X9WA 3QIPA 3R27A 1V6HA 3UN3A 3D3CJ 3FQLA 2Y1IA 1HWLA 5GMKa 3CD0A 3R7NB 1JLGA 2J0SD 2HWTA 1RZMA 2N82B 4DV5J 5GAEU 2OPPA 4EZ9A 4UY8T 3C6UB 2PA3A 2ZE2A 3H20A 4K59A 2YQ1A 2KDOA 2YTCA 1AUSL 3NGSA 5KFTA 4WK3A 1SVDA 4IR9A 3C46A 1AUDA 1R0BG 2YKNB 2ZUAA 2RH3A 5A8WB 5H9FK 4NZ0A 5D3GB 4FN5A 2E5JA 5KG2A 2O1PA 1EJ7L 4Y2KA 2DXDA 2FGOA 2JEFA 2AD9A 1WWHA 3QT6A 3GJQB 3RB6A 4ZVRB 4S0MA 1XNRJ 1SC4B 3THPA 2ROEA 2AW0A 4WP9A 2Z2YB 4NLGA 4A48A 1X60A 2QT7A 2ZH2A 2HFUA 3JTPA 2LQ8A 3JSMA 2BABA 3WHIA 3L9ZA 4HR2A 1RWWB 3OR2B 1KNZA 1RAJA 3ZZOA 1CSJA 4LFBF 4HACB 5I4MA 3M9NB 4JI8F 2DGOA 3DC2A 4DV6J 1ZA2B 3VTIA 4ZVGA 3A8KA 1YWXA 2LVWA 4KYZA 1AROP 2V2VA 2FJBB 1WEZA 2XM3A 4K0KJ 4MIAA 2XI3A 3FBBA 4LT6A 1CS4B 1KWMA 3N6MA 1PIEA 4O44B 3KLFB 1NK8A 1I94J 2OTJS 5I3UB 1S72S 2UUAJ 1TP7A 2CA9A 4ED3A 1T0TV 1H74A 3N5BA 2F3JA 1UFKA 3W3SA 4JI2J 4HH0A 2FVPA 1QVGR 3IM9A 4X66J 1VQ8S 1VBZA 1PILA 2CQBA 4KIAA 4DLEA 2ZH8A 1RWKB 5CYQB 4YHHF 1C2PA 1GEHA 1EIYB 3WC2A 5BYSA 3DM2B 1QE1A 1PGZA 2VA3A 4RNOA 4A8YA 1N33F 4EEYA 1R31A 2J6SA 4CIOA 2QA4S 1NBEB 3KYLA 2AGPA 1SH3A 1K9MT 2B8QA 2JHEA 5H9EJ 4XPEA 4N5SA 2PC6A 4M1KA 1IBMF 5HBMA 1QTNB 3TZXA 1TL1A 2XSJB 2LKZA 4L74A 3ZTOA 1A7GE 5G0RB 2W2NP 4QPXA 4NXMF 5ITHA 4B08A 3NL0A 3E01B 3UNGC 3I0RB 3DRPB 1Q1KA 4PKDB 4DZ6A 2YKMA 2ZH6A 2PGCA 2LFVA 4X4SA 2CWKA 1VRQC 5T14A 3EM1A 4LF7J 3K5OA 2XMVA 4MIWA 4MKBA 4LF5J 1HBMB 2CQ0A 4KAIA 4ZPWR 2A6OA 1S1XA 2PI5A 2HS4A 2A10A 2IY5B 1RTHA 2FC8A 4RW7B 3ISZA 1OSCA 4CDIA 2MJNA 5KFLA 3R2CJ 2WZ1A 3SCKE 2X1BA 2U2FA 3FJ2A 1AT1B 4LBPA 2HFVA 2G0JA 4LF5F 1RT6A 2E5GA 2JH3A 3VVTA 2DGVA 3PX4A 2NPIA 2N7CA 3I0SA 2GMHA 4KE5A 2BA9A 3KFWX 4OI3A 2YKAA 1AFIA 3U27A 1GMWD 3DGVA 4EO8A 1OPZA 4DR7J 4F2SA 2GVDB 3V2UC 4PAAA 3VV2B 2GGPA 1Q95G 3GPAA 1VR6A 1PO6A 4D3GA 3MM8B 2BE2A 3MECA 3NWRA 2FC9A 1KLMB 1MROA 3MWBA 2BW7A 4CTAB 1RAHB 2UXCF 3HFKA 2DNGA 2ZITA 4M5MA 2R7OA 1FTRA 2DGTA 2GAHC 1LW2B 1TUWA 1CULB 3UCUP 1M5HA 3AQOA 4A8FA 4ELUA 2WOMB 2CQHA 4DUYJ 2R8HA 2DXEA 5T7LB 4J91A 2QC3A 4RW9B 4MK8A 2GQCA 3LP2A 2VJUA 2AQ4A 4M94A 1IM4A 3DXSX 2N4CA 2E1AA 4BC9A 3DYAB 3PCOB 3GJSB 3KK2B 1JK9B 3Q8VA 1R43A 4OI6A 1RAFB 1M5VC 1VHFA 1YBUA 2ZVIA 1X7VA 2G1DA 1NK4A 5IV4A 2XLJA 1WHYA 1VK8A 4R8UB 4J9MA 2FUG9 2JLFA 1ZBTA 2QTWA 3M2RA 4X4VA 3J7Z5 3GJTB 3KLEB 1G6BA 5B0GA 4F0MA 2ZNZA 4B3TF 1L5UA 2RUSA 2DGWA 5J2PA 4RUAA 4C3LA 1VOMA 4Q5VA 4IH5A 3T6JA 1XMBA 2BJ9A 3BM7A 2XO6A 4LMZA 3LALA 2GCFA 3NNHA 3QIPB 2RSQA 4KKOA 2DR5A 2MPUA 5CCLA 3NS7B 1VCTA 2WSEC 5IWAJ 1ZM9A 5K5MA 2K2PA 2CIMA 1NJWA 2B56A 4LF9F 4OYBA 2DO0A 2ERRA 1XNQF 3UDLA 4DMZA 1U49A 2KU7A 1UFWA 3A3PB 2PFDA 3G2XA 1RTIB 9ATCB 5M2PA 1DQAA 2FD2A 2BRLA 2MLZA 3T1AA 3UDEA 2NSCA 5B0EA 4HEA9 3BKFA 1PBUA 1U4BA 1S10A 5AJ3J 3CCMS 1NRKA 3MI7X 4LBIA 1XK8A 3DU6A 4FYWB 4FVMA 1JNRB 2YPYA 4CLYA 2CNLB 1RXOB 1WF0A 5KFWA 1BWVA 2KYZA 3E8OA 4GVBA 2Q1LA 1Y9OA 2NYHA 3UPFA 2W2PP 3ICLA 4P2XA 3LAMA 5DS7A 2NSBA 1LWCA 4Y28C 1KC8T 4K4ZA 2XSFA 1RCOB 4A4JA 1WHXA 4DFJA 4K4VA 2ABYA 3D0IE 1H7XA 1CLFA 2VG7B 3CEDA 4DV7F 3RB0A 3PYGA 1FK9A 3PXGa 1LQ9A 4F4KA 4H4KC 2MZJA 3IRWP 2UUWA 2Y8WA 3OSNA 1TUGB 2XCAA 3R5BA 3VZHA 2VQEF 2QL7B 3RW7A 1JLAB 2QV6A 6AT1B 2GIQA 4DR4F 1HPZB 1NUEA 1FJGJ 4DN9A 5BJRA 1N8RT 3TA1A 2XEXA 1T9XA 4HL9A 3OFGA 3M9MB 2BJEA 3KDNA 2PD1A 2XGQA 3UWTA 1CJVA 3AQPA 1RACB 1Q8KA 2OPQA 1FDAA 2K7KA 1SXLA 2EBEA 4PWDB 1ZM2A 4O3QA 1U2RA 2UUCF 3LP0B 2ZBCA 4NLYA 4G3IA 4ERDA 2KJWA 4DPYA 1FRIA 1K47A 5CQGA 3A8JA 1RWUA 1UJ4A 3JB9k 4XPCA 2L3MA 1DFDA 1S5ZA 4JYAJ 1N5TA 1N32F 2WVEA 1WC5A 2YNHA 1OS5A 2EFVA 3RTVA 2HHVA 1UJ5A 2JEIA 3BR8A 3IGNA 2FPHX 1CQMA 3V4IA 2BKNA 3L7OA 1NXIA 2HHQA 2RHQB 4RWWA 4K2XA 3LAKA 3TNVA 2NS1B 1VBXA 4WF9Q 2RB7A 1IKXA 2DNNA 1HNZF 3CTRA 1FERA 2MKSA 1N0VC 1D9DA 3DLKA 2AZ3A 4UTGA 2YWWA 4Y2CA 5AE1A 2FZGB 5E3QA 2X3GA 3M8SA 2PDAA 3Q8YA 4ED1A 3L95X 1VQSA 1X0FA 1QJHA 3BH7B 5EX3A 3W7BA 5CCMA 5ETVA 4GO7X 3DLEA 1OY9A 5K8PA 3B8HA 3CWJA 1REVB 4WYLA 3I9ZA 4FPIA 4U96A 1MW7A 3TAPA 3IC1A 1U6ZA 5LMNF 2ZVSA 1FE4A 2OMLA 2M7SA 4KQZA 3QFWA 1TKZA 2WONA 1T02A 4X4QA 1JXVA 3VCDA 3FGVA 3BN4A 5ETNA 1BY9A 3GYXB 4QWCA 1VJQA 3L7UA 2VDHA 4ENOA 4RBVA 4ICLA 3NY0A 4FYVB 3ITHB 4X84A 3D6HB 3M2VA 4M5DB 2AIRB 2BZ2A 4DL5A 1YJUA 3QRPA 1RT6B 2HEKA 4KFBA 4DR5F 2MXYA 5LT5A 2RRNA 1LWFA 4C98A 3ZO7A 3M8QA 3N4WA 5IT9Y 3DOMA 2V4JB 5DLFA 4OYWA 1NK9A 3CT9A 2UU9F 4HHJA 4RNHA 1BLUA 2FHJA 2VHGA 1OSDA 2QE5A 2ZHOA 1S7IA 2XY6A 3Q23A 5DGBA 4M5GA 4DV0J 3VVUA 4LQ3A 1RT2A 1HD1A 1VQLS 3W5XA 3R9LA 1KTVA 3MEGB 1YGYA 5C25B 1WDTA 1R8PA 3H0PA 5DJBA 5D4PA 1HW8A 1FKOB 5A0YA 2P8IA 4O3NA 5E3CA 2DO4A 2C3YA 2P9GA 1RT5A 5A2QY 4I69A 4J9VA 1AB8A 1RBOB 4ZJOA 3MPYA 1UTAA 4YUDA 2BKPA 1VC6A 2HHSA 2KFYA 1V3ZA 1S59A 5F0WA 4IFYA 3MR3A 4RW6A 5FIIA 4EYHB 5L1JA 1RE1B 1RABB 3T5JA 3OVSA 3W9IA 3UE2A 4NCAA 3EE3A 1VC5A 2BE9B 1VS3A 1Q79A 1RB0A 2HK2A 2DPJA 3I56S 2FHMA 1WOPA 3LP2B 1YJNS 4DV3F 2AX1A 1YKWA 2YKPA 3I96A 2XC9A 1NDKA 4HH1A 1H73A 4A8QA 3W63A 5T41A 2FDNA 2VQFF 2IA6A 3K7RA 3MM7A 1RAGB 4NMLA 3MMCB 4EFAC 1U47A 4TN2A 4JI6J 2HKEA 2ZBRA 3MMJA 2J9DE 3DLJA 5KAKA 2BW2A 4BC7A 5J1NA 3DOKB 1D1UA 3Q89A 2KT5A 5KOWA 1V5VA 2HQ3A 1X5OA 2H3EB 1Q7LB 3J81j 2Y0SD 1R0CB 3AY0A 1H3DA 2DNQA 4QJVA 5KFDA 4NXNJ 3HJFA 2KKHA 2MGZA 3M4XA 4USIA 1PC5A 3TAQA 3PHTA 3I32A 1VQ7S 2QG9B 3E51A 1PJ5A 3ZZPA 4ZOSA 3BDPA 2QSWA 2NZCA 2HZAA 4ER8A 2DYAA 2BDPA 2Y1LB 1WHVA 1BC6A 1NK5A 2QFIA 3JS9A 2DIVA 4NYPA 4LR9A 3L7PA 4ZK7M 3RJMB 1Y5NB 3VF0B 1KVJA 3KDOA 3CC2S 4M5NA 4L76A 2B8PA 1U0SA 2OO4A 2HIYA 5E2QA 4RJVA 4DSEA 1MMLA 1HNXJ 3ELHA 3QQCD 1M1KT 3TUJC 3CO9A 1HBOB 1YDLA 2OHDA 5DGAA 2D3OR 2ZHAA 3CMAS 1F60B 5B0AA 3RRHA 1VBKA 4ZVHA 4HDGA 4QYRA 3HVAA 3SDEA 4QWDA 5HSPA 3NWGA 4X4PA 2WVFA 2EEYA 3TA2A 2HVIA 1CJKA 2QX0A 3HSJA 1VRTA 3R5GA 4GVBB 1S99A 1S6PB 2MQMA 4OJ3A 4Z7CA 1Q0NA 3UFCX 3R5AA 1J5OA 4DSIA 3JSBA 4J9QA 1HNWF 2BRKA 1U26A 1FD2A 2U1AA 2UXDJ 4DX7A 1NSAA 3O5TB 1FK9B 3W2VB 3CJ4A 1M0SA 4W90B 4B9SA 4DV1F 2UUBJ 2HLTA 1WI6A 2NXNA 2IVMA 3RR7A 2BEFA 3SI8A 4A8SA 2GZOA 3NRBA 4X64F 1R7IA 2QN6B 3HHLA 4WFZA 3EVWA 3OD2A 1JIHA 3IAM9 4KRWA 2ZM6F 1CBKA 4O4GA 4C6AA 1IWAA 3LPEA 3DRSA 4PYAA 1UVNA 5K20B 3DDNA 2IDLA 1UEKA 1U6BA 3DDIA 4Q43A 2E1CA 4ANCA 2HHHJ 3KUEA 3ZZZA 3OXLA 4C0HA 3CD6S 2DR7A 1RI7A 8AT1B 5D6GA 1P6TA 4X4RA 4OI0A 3EGZA 3DN9A 4LRBA 2KO1A 2B9EA 1UMJA 4LF6J 1ZM4A 4DPOA 4TXSA 3OFFA 3DGPA 3B4DA 3BJYA 5GAHU 1BQNA 1DTTB 4ILLA 3UCZP 1YZ7A 3DRYA 2HMIA 3ILOA 5K14B 1XR5A 2NXEA 2A2CA 3CJ2A 3CMQA 2E1MC 1H0HB 1U24A 3PX0A 4DR6F 2I2YA 1RT7A 4NLTA 2F4VJ 3BGUA 2AJQA 2X7IA 4JUZA 4B3MJ 4YQWA 3N6LA 1VDHA 4IO1A 2BM1A 2IA0A 3DLKB 1H72C 2GMLA 4ZPVR 2RU9A 3J81Y 1IJEB 1Y5IB 1EAYC 4ZHRA 3F73A 2Y1JA 2DH7A 2X1AA 3ONQA 3G96A 4URQU 1REGX 1TR0A 3TJ9A 1UW9A 1G1XA 3AT1B 3OL7A 3MCNA 2BANA 3VR1A 2E5LF 3KLVA 3KHLA 1F0XA 3R5CA 3IGVA 2VPYB 3TEHB 5ETRA 2YNFA 2V68A 3PFEA 4WU2A 1ZZFA 2WONB 3NLCA 1SUQA 3V6DA 4C48A 1DLOA 3M2VB 4X4TA 2XG8A 3MPUB 3C3LA 5KTQA 4KFBB 4KSEB 3OL6A 1LWFB 2F9JA 1U2CA 2XZDB 4H4OA 2ZZMA 4RZRA 3RGIA 3QFHA 2LQJA 4RO0A 1WACA 1QM9A 4DX8H 4O3SA 4C8KA 4JI0F 3AXMA 1S6QB 1AW0A 2YVSA 1IBLJ 5GAHI 1HA1A 2D9OA 4X4OA 1OJ4A 3M2UA 3FDSA 3NGDA 2GMJA 1S4EA 4FF1A 1BQMA 4URGA 4UOGA 4NLUA 2E9TA 5IT9U 1A9NB 3BQ1A 3A3NB 3M32B 4MFBB 3PX6A 3MM6A 3W65A 4WU3A 1IBCB 5L9XA 2Y0BB 3LANA 4ECYA 8ATCB 3EPGA 4Q44A 1RWVB 2ZH5A 1K73T 4P71A 4K5RA 2C2RA 1TKXA 3H42A 2HQIA 5AT1B 2G13A 3CCZA 3G6YA 1FKPB 4DLGA 2VASA 2B43A 2XYPB 1F2GA 5ETKA 3V5RA 3HKWA 4B9UA 1SJ1A 2XY7A 2APOA 1UVJA 2JZ5A 4ANDA 3UI3A 1DURA 1Y5LB 1S7HA 2V8HA 4DQQA 1VIXA 4BLGA 2YWFA 2Z8QA 3TQ1A 1W2BR 1SIZA 2QSFA 5KFYA 4EMDA 4OQJA 3DHXA 5CD4H 1ZTTA 1RAEB 4ECUA 1J27A 2D69A 2XMTA 4DUZF 5HLFB 2UZAA 5CXTA 4JP8A 1FVQA 3OPKA 2V8VA 3FSIA 2RIJA 2R8GA 2IRXA 3IXQA 1F9HA 2CNKB 5GMDA 4K4YA 1IUJA 4IQXA 1H98A 3V81B 2YQ3A 3IBCB 5D0HA 1ROFA 5DQHA 2W9CA 5BYQA 4DFKA 1CEZA 4JI1J 2J7WA 3AFGA 2XULA 1FDBA 1ZH5A 1C0TB 4J37A 4CO3A 4YMEA 1FFGB 3MFIA 3MXHP 1B64A 2E5HA 4F02A 1LWEA 5L1KA 4A8OA 2DIUA 4F4WA 3SZ2A 1HBUA 2QMUB 3KJVA 1WNEA 1CJUA 4C7QA 1PAEX 1TKTA 5HP1B 4BWMA 1X5TA 2HZCA 2KT2A 4PABA 2EKYA 2W8LA 1VQ4S 2Z2ZA 3T1YJ 3K5MA 2XWYA 4B17A 4WIIA 2VFTA 2UP1A 4QIEA 1S6OA 1VBYA 1NSQA 2CWXA 1KKHA 2IVFB 1EB0A 3D9BA 2DHAA 5EGYA 5F0UA 4Q0BA 3QGHA 4I6AA 3FFIA 2GQQA 3MM5B 3CIZA 4H4MA 4CO5A 3PZPA 5B0DA 3TOQA 3U1MA 1CJKB 2ATLA 1HI1A 1DQ8A 3TZZA 5KT4A 3UVJA 5KFEA 3QATA 2VPZB 3PY8A 4NLXA 3KJQB 1J5OB 4YB5A 3PR4A 1F5BA 4NX9A 3SQGB 3WQPA 4Y00A 2WTFA 2R7UA 4LRFA 3D6FB 4CM0A 2P9EA 4F4YA 3PEJA 4AE5A 2FTRA 2LU2A 1OY6A 2W25A 1WC6A 3MEEA 2IIHA 3R97A 3H4DA 2WHOA 3K5PA 1FO1A 4O4GB 3NMRA 2XNQA 3DRSB 1EARA 1JQGA 4OMFG 5KFFA 2CKWA 4CYUA 2YWEA 5BXIA 4OYAA 4B3OA 1WC3A 4Y2AA 2JDJA 3JTNA 1H2VZ 2E1PA 1NM2A 5AXLA 3W5YA 4C11A 5C7PA 3EZOA 2DJWA 2LA6A 2HZVA 3T1HJ 3Q8RB 5CZVA 2M8HA 5B0FA 2CQ4A 3M30B 1IKYB 5EWEA 3KK1A 4JV5J 4FXVA 4NA3A 1ELOA 2DNZA 1SC6A 3KWMA 2QLFB 4DV2J 2CZ4A 1BQNB 5BR8J 2CJKA 1RTZA 5D15A 4DL2A 1N52B 1VMBA 2HMIB 2IJRA 3QZ7A 4PUOA 3OXGA 7FD1A 4X65J 3GSDA 1TAQA 4DOZA 4RW8A 2DEIA 4O23A 3T19A 1J5EF 3VGTA 4DEZA 2A0FB 5FDLA 4NPOA 5J2NA 3BKUA 3QGGA 3H5YA 2R3VA 3QJLA 1S9EB 1HLWA 4J9PA 1Q5YA 5B09A 3S01A 2B51A 2VG6A 1JLEB 3AA9A 3AB2B 2HVZA 3JQKA 3RUBL 2K06A 2J9CA 4RU9A 5LL6d 1LK5A 4ZHRB 2Y9HA 1YRXA 1HQUA 1SJQA 2LYVA 1B70B 2FJDB 4J9KA 1XMOJ 2CRLA 1FKAF 2N4DA 2E9ZA 2VBXA 2I0XA 2RS2A 4I7FA 1FDNA 1WKJA 5CAAA 5LSOA 2B7CB 4LF4J 4F25A 1JJ4A 4OJ1A 4OHYA 3J81U 3KLHA 2V0NA 4TQRA 3SSSA 5IFMA 2AGOA 2P6SA 1F6TA 4LUBA 3X1LB 4NL5A 3MPWA 4DJBA 2CQPA 3D2WA 3EZUA 2DNKA 5E3RA 4N47A 1IQZA 3D1QA 3QT7A 1SH0A 4DV4F 5KT3A 1BHNA 5FJ4A 4RLEA 5D8HB 4CLSA 3EGNA 4QCLA 2RRAA 2W7OA 1NU4A 4TQSA 4OYXA 4U95A 5C2GA 2F40A 4RUCA 1UWBA 4ZCMA 4U7CA 3PW5A 2RQKA 4CH7A 3SBMA 2CFXA 3PG9A 3AJ1A 2NYIA 2P5VA 1LW0A 4JI7J 4ZMMA 2EK1A 2JNJA 1KN6A 2I5JB 3GIIA 1N6QB 4TY9A 4YB7A 5LMUJ 4P2SA 1D0EA 2DT9A 2ZBPA 4JI5J 2HG4A 3W9HA 2N7YA 5HAOA 3T6BA 2KM8B 1HFEL 1TMMA 4OZJA 2FLLA 2M0GB 1KTQA 1QAIA 4K4TA 2MZQA 5KFHA 4KGVB 3RAMA 2DB1A 4HI1A 1S6UA 1IKVA 4I6WA 1R6VA 5CABA 2XHWA 1TKXB 2AHOB 3N5FA 4DZDA 4O3RA 3DRRB 2XS5A 4YEAA 2HBYB 3KMSA 4RBTA 3Q22A 3ZC4A 2GO9A 1KEKA 4X62F 1ZZNA 2G0CA 1C0UA 3EICA 2RKIB 3SCIE 1WEYA 2EFOA 2Z2LA 3ENQA 4RNNA 4RL1A 3H25A 2C42A 2KFNA 3D7SB 1AXQA 3HXMA 1TU0B 2I1RA 4Q8EA 4AQYF 2Y3YA 4FPRA 1N5YA 4FBUA 2HAFA 1BWEA 1EX8A 2XMUA 4LFAJ 4ZPTR 3RBDA 5CA5A 4ANEA 3C6TA 4KV8A 1T03A 2V6AA 2Q6CA 3GU0A 3DMJB 4F36A 2D3O1 2JFKA 4JV2A 5IC4B 5L9NA 1FVSA 2W9CB 4PXEA 4ETZA 3A1YG 5HI7A 2CPHA 5HVFA 3C15B 1WEXA 1UKUA 2G2ZA 2VFUA 2GJFA 2B4PA 3MAHA 3GCWP 3TWZA 1LWEB 4Y34A 5A6PA 4X2BA 5JXSA 1LV5A 4ZVQB 1HBUB 4RWXA 3IBWA 2HFZA 1CJUB 1TKTB 1YJVA 3TO8A 2UV8A 1E6YA 4MYTA 3PJXA 5KFNA 4K4UA 1LOUA 3CUNA 4G65A 3MAAA 4OYOA 3QZ8A 3M6VA 4LR8A 2CQDA 3FCWA 2LEPA 2AJ0A 1CPZA 5CD4A 3WX4A 4NYOA 4WP3A 3LP1B 4JB8B 2D3UA 2B6AA 4H4KA 2X3DA 3R3TA 4H4MB 5KFCA 4I64A 1BQXA 1ZS6A 1ZETA 3W5ZA 5KFUA 2DGXA 1IKWB 2DGQA 4HDHA 4IFVB 5DM7Q 4DR2F 2CDQA 3M7VA 5E0OA 3ZZUA 3ILJA 4Y0FA 3K58A 2JJ4D 1Q53A 1JLFB 2XMJA 5ETMA 2RHSB 4OIXA 3W8GA 2VODA 2LA4A 1YJ9S 1Y4ZB 2L08A 3WIUA 3OFEA 2IM0A 1X31C 2Q6BA 4OLPA 4K4WA 3JAMY 5EWFA 2Z2MA 2ZZTA 1EETB 3PW4A 2ZKUA 1B0VA 1YHQS 2C2MB 3THTA 2CYYA 3TX0A 2AMCB 2H1YA 3OFHA 1DJ0A 3Q2SC 4CWBA 2J9DA 3L4BC 4PXDA 5K8OA 2JEGA 1B0TA 2IC3A 1U25A 6FD1A 1DQ9A 4CYUB 2V4RA 4B3OB 3ZTPA 2V2KA 4OL8A 5J2MB 3RBZA 2UXBF 1NDLA 5J1PA 3HHLD 3HHLC 2DGSA 4CLKA 1RA6A 1D9FA 5A8KA 4QQBA 4ID5A 1H38A 1Y10A 3NEKA 4LSNB 5DO2A 3TUIC 1V9OA 3CCQS 4M63A 3CVKA 4QPTA 2AEJA 2OI2A 2BR0A 2UUTA 1S57A 1N48A 2ASDA 4BBYA 5HVGA 4PPZA 2LECA 4QU6A 4N41A 2FB0A 2YNGB 2VG5B 2AJ1A 1JLBA 3VAMA 3R1HA 1GX5A 2W4PA 3ZTSA 2FLOA 4PG5A 2ACYA 2M5YA 2DRAA 5DZ7A 2WVDA 2A3JA 1P9QC 2E29A 3NGUA 3K17A 5J2NB 1SJFA 4NEYA 1TL3B 1D09B 4ZVFA 4HHHA 3FSYA 4PG6A 3K5LA 2E7XA 1S48A 3CDEA 1OIAA 3QLHB 2GHVC 4MAKA 1VISA 3CDBA 2IJNA 3OR1A 4EGLA 3H90A 3P5BP 3PNIA 1UCNA 1B0PA 2LLZA 2ZD1A 1PBAA 4B9TA 3C14B 1RHJB 1AA1B 3SSRA 4WE1A 3CCUS 1XQIA 2LQBA 4I1TA 4ED4A 1RKIA 2P6TA 4C2MA 5H9EK 4JI4J 3RZAA 4NLDA 1YJWS 3IM8A 4UOFA 5C2CA 5EN1A 1HKAA 5D4NA 1V3RA 2KHDA 2H51B 4PXCA 1FA0A 3MUMP 2KL8A 2A6MA 2FVRA 3FNNA 2WRMA 5D0EA 2AEMA 4OLOA 3S7RA 3HZEA 1N36J 1FTCA 3FC9A 1Y3JA 3IR5B 4LF8F 1UA0A 3ADAC 1SQGA 1VLOA 1OMSA 1SJRA 5JMNA 3M1VA 4ZVTB 1ITPA 3V6KA 4R0JA 2VONA 2DNMA 1R0AB 3EGVA 3FVYA 4O3PA 1O5JA 4IRDA 3HM9A 1DY3A 2MDAA 4K4XA 3D1HA 3DU5A 2CZ9A 2IAJB 5L39A 4JBCA 3TUZC 3TJAA 5ETQA 4YR3A 4ED7A 1NH8A 1YJTA 4ZIVA 3BN7A 2V9WA 2PA8D 4NE9C 4F3QA 4DR3J 2NUHA 2PEHA 4OYZA 4JI3J 3JTOA 4IG0B 2MQLA 2C2EA 1ZAXA 4F0HA 2GFFA 2HHWA 4USKA 2DNLA 4TYAA 4B3SJ 3HLUA 2OPRB 2NQPA 1KVKA 2KH9A 1UW4A 2VZ9A 4ZA1A 4DR1J 1RBLA 4DQSA 2LXUA 3NS5A 4LSZB 3MCSA 3CJKB 4HLBA 1APSA 1MMDA 1X4DA 4ZJLA 1QD1A 2C2ZB 1WORA 1LXJA 1X4BA 1T05B 1WTFA 2Y1RI 2QIFA 4CT9A 3C19A 1M5KC 3KNAA 3MAQA 3BPDA 3DI6A 2KTQA 1S1TB 4FBTA 1RGVA 1RTJA 4M5LA 1SKRA 4ELVA 1X4EA 1GK8A 1XMQJ 1E6VB 3A8EA 1K8AT 1ZA1B 4G1QB 2XLIA 3BSOA 4ZLPA 3PDNA 3NCRA 2VV5A 3BEGB 3H5UA 1RT4A 1FF2A 2MKYA 4KTQA 2QMXA 2Q43A 3P5TL 4KV8B 1T03B 3ZTQA 1U02A 1Q78A 2CPYA 4KGZB 1T9VA 4HYKA 4UQGA 1RQ0A 2EFGA 4ZN3A 2Z58B 2MLYA 5HROB 4DG1A 2FJEB 1QSSA 3EDQB 3RRGA 2C3OA 4Y65A 3IS9A 4NLWA 1GH8A 1C1BA 1UWAA 2V5HG 2DH8A 2A1BA 1FE0A 2MZRA 2VPXB 2M70A 4WWSA 1HWUA 1S9GA 2XWXA 4CH0S 4X4NA 3AXKA 3SCJE 4ILMA 3N28A 3LTOA 2R42A 3G71S 1WTBA 4B9NA 1R8HA 4J9RA 2NXJA 3CJ5A 3IFEA 2HVHA 2GC8A 3NXZA 1SKSA 2OKQA 2W4DA 2HNDA 3G8QA 3CDWA 3VGSA 3M8ZA 5DDPC 5E33A 4ED8A 3C2PA 4LFBJ 4FF4A 1U8WA 2CQ3A 4ZN1A 3J7AN 4JI8J 1TVRA 1S1WB 1T11A 4U67Q 2VC1A 2OIHA 1KLNA 3TARA 1RTDB 3VQTA 1OQ6A 4LFCJ 1RWNB 1RADB 5CYMA 3J80Y 1RT3A 3HVTA 2WSFC 2C2OB 2GQ2A 4KH0B 3DLHA 2RD5C 1S1VB 3P3DA 2X1GA 2C28A 3DKDA 1ZTWA 3ISND 3BGRB 3ISNC 2P9CA 3D68A 2AYMA 1S0OA 2ZFHA 4LFCF 2ZHBA 2HLUA 4Q45A 4DWIA 3NKYA 1HQEB 2I6WA 2OPSA 1TFYA 2C3PA 3RBEA 3AOCA 4KT0C 1HBNA 3H4BA 2HFSA 2GVZA 3AD9C 5HL7Q 2R7RA 3LGNA 4C8OA 3V4MA 2A2DA 1OYEA 2O67A 1IM6A 1JJHA 1FJEB 4KHPF 2EVZA 2E44A 1L3UA 4YHHJ 2V2QA 2HGMA 1QAYA 5GAEI 3T9NA 5MAOA 1D9AA 1KQKA 1IXKA 1SH2A 2WVCA 2ZJRQ 1QSYA 4ECZA 5I3PA 3MEDB 4M8LA 1Z2ZA 2QL9B 2XMKA 1N33J 2VJVA 3JAMU 1RU2A 1FFWB 2ZH3A 4ID5B 3QAUA 2VFSA 4WKYA 1UVIA 1K1QA 2CPDA 2FGCA 2RVJA 1L3TA 2B5JA 2EK6A 4FKYA 4OX6A 4C8MA 4UF4A 1NLKL 1F9EB 2CQ2A 2LDYA 4OZNA 5J1EA 2YNIB 1IBMJ 3VGUA 4IG3A 1P9YA 2WBRA 2O66A 4ITSA 4UZCA 3BO2A 3MEKA 2KJVA 1TTHB 1RU1A 2EI5A 3JSYA 4NXMJ 1HNVB 2RNEA 3RG6A 4PRFA 4TU9A 3S8SA 4AD6A 3GONA 1U0HB 2ZC3A 1YTYA 3DOLA 2MZSA 4WZMA 2OMOA 4NA1A 2CPJA 3MOZA 4Y3CA 2HNYB 5IM0A 4NRUA 1F9FA 2WW8A 1X0PA 1TFWA 1SV5A 3MR7A 5AXKA 3M8PB 2XMAA 4V19J 2RE1A 2R7QA 4IOBA 4AFFA 3UO0A 1RK8A 2BKOA 3G6ES 4K4SA 2BOPA 1BUXA 1T8EA 4WFNQ 3F56A 5LXYA 1NKCA 5IT4A 2RDIA 2I38A 2B9WA 2B9YA 2KXFA 2ZD1B 5HMWA 5ADZA 4KJIA 5HK4A 4OX9F 3N9UC 1YI2S 3EXCX 1T9UA 3MMBB 2Z0GA 4TLRA 4B3RF 1RHMB 4ZPDA 4URSA 4ZP6A 5DETA 2LU1A 3SXLA 1HMVA 1RT1B 1P27B 3KUHA 2QZ8A 4QIFA 3MM9A 5F8IA 1JLCA 1FEHA 3OTCA 1C4AA 1LK7A 3GR0A 2R2RA 1N4LA 4CO2A 2AU0A 1O8BA 2P2CB 3GFZA 2OP5A 5A8RB 5AXMA 1S1UA 3SV4A 3OTBA 2RF2A 1WC1A 1WD6A 4P6QA 2M9KA 1RA7A 3CD5A 2G2OA 5L8RC 4JOUA 1F5CA 4CZCA 2FZCB 2UXCJ 3BPSP 3OUYB 1WOOA 3AA8A 5E7OB 4QOTA 3VAHA 3IG1A 1Q86T 5DDQC 3HULA 3LGMA 1M90T 1PG5B 2ACMA 3AJDA 2KRBA 1SC3B 3CCSS 4LRDA 2ZOFA 3MTJA 2BVZA 2AJ2A 3JQMA 1N34F 2LCWA 4YB6A 2F65A 3Q86A 2DNYA 2VD3A 2HWHA 5KT5A 1QVFR 3RW6A 4CP5A 5EHHA 2K3IA 4P52A 5C24B 1EQ0A 3JQJA 1M5SA 1ZM3A 3A12A 3ET6A 3BH6B 5I42A 3B4MA 4PWUA 3TZYA 4OX7A 1NJIT 3T5KA 4BCAA 1WUUA 4FXWA 4LIWA 1TV6A 3D66A 2XGPA 1JLQA 2ZZNA 1CQNA 2XQCA 3KLGB 3MOJB 5D0RA 4B3TJ 3W2WA 3HT3A 4AT1B 1R89A 1RTJB 4OZLA 3MPVA 2W9BB 5IV3A 3H5SA 2V63A 2OELA 3FRZA 2EPIA 1HYSA 3N79A 3TX8A 5HMZA 4RW4B 1N5VA 5ETOA 3BQ0A 1WSVA 4J9OA 4L75A 1NJYA 4IQMA 1PYOB 1CC7A 2VFRA 3UR3C 3RAXA 1L3SA 2ALZA 1WI8A 3BGLA 4LF9J 5D0GA 4RBUA 1XNQJ 2RQ4A 3QGPA 2JVOA 4KGXB 2YWKA 3I5BA 4DG1B 3EYZA 3C6UA 3GV7B 1KRPA 3NGTA 5KG7A 1HQ2A 1C1BB 4ZS6A 4E8UA 2L48A 3GCXP 1JLGB 3BQ2A 2VPWB 2OPPB 4F8RA 4Z37A 4CLUA 5A8WA 2ZE2B 3TI0A 2YWHA 5D3GA 1H6KX 1TK0A 1DAXA 1OYDA 1S9GB 5KFOA 2AX0A 4WCEQ 3K59A 5B08A 1VK3A 4OV1A 3GG1A 4KHRA 1P1LA 1JJ2R 1NSKL 3CCVS 4NZ6A 3OT9A 4WZQA 1EQMA 5F8GA 5DG8A 4HT7A 2E7WA 1R8BA 3B6BA 2PMZD 1YBTA 3TR5A 2MLXA 2MKJA 1UJ6A 4DV7J 5HANA 4MKVA 2J0XA 3OR2A 4O3OA 4HKQA 2DBBA 3QIDA 4DPWA 3HF5A 2F8EX 4DDFA 2VQEJ 2O01C 3LOUA 3JSMB 2QLJB 4I4BA 1IVZA 4DR4J 2OEJA 4QZVB 1WSRA 2XMWA 5HO4A 4DCOB 2NREA 3CCLS 4NWBA 4GKKF 2I9SA 5CYMB 1IJFB 4YY3F 3PJWA 1CS4A 4ECXA 4O44A 4WTYA 2JFDA 2B3TB 1UP1A 4A8XA 4BDPA 4FZVA 2EXUA 1NZAA 3PRDA 3C16A 1D8YA 2BJDA 2UUCJ 5M2RA 2OPSB 2OH2A 1G7CB 2HPUA 1R8CA 2BOAA 1HBNB 2W7AA 3GWCA 3GYGA 2V8DA 2XZTB 3OTOF 2PSZA 3HO1A 2J7KA 3CJTA 3J80U 1ZPVA 3VWSA 3AJ2A 4K2JA 2CJXB 2ZH1A 4K7QA 1N32J 3ZZRA 2LQ9A 4QR2A 1R8AA 1VHIA 2AT1B 4DL4A 3DM2A 3OVAA 1VQ5S 4ZIWA 2NXUA 1I6JA 2DPIA 3QWUA 3IBFB 2CPZA 4ECWA 2CPEA 1WG4A 1NB2A 1QE1B 1EHWA 2CZVC 1KHVA 1TL5A 3CD7A 4QU7A 1RYRA 2DTJA 1TMJA 3N6NA 1KP6A 2VFVA 4L73A 4OV6A 4YDXA 3SCLE 2ZEJA 2DEJA 1HNZJ 2XSJA 4GO5X 4ALZA 1KS2A 1LKZA 2HBQB 1GTEA 1TUVA 3GFXA 2CG4A 1VRUA 1RAIB 3PRVA 3QWPA 4OFZA 4IO9Q 3F44A 3CCES 5HBMB 2DK2A 4J7CA 1TL1B 2HQFA 3E01A 2AZ1A 3CJ3A 3I0RA 2XS7A 3CCRS 3L3CA 3CC7S 3WBZA 3FMWA 1MWYA 2QFJA 3H8YA 5LMNJ 1SV5B 4ID8A 1HBMA 3A13A 2J5AA 4EWTA 5KFGA 4RW7A 2YKMB 2IM2A 4GKJF 3IP0A 4ZJQA 1UVMA 2ADCA 2LMIA 3E3XA 1SL0A 4DR5J 3HSDA 4USHA 1S1XB 4F7VA 4U9RA 1RTHB 3NS6A 4M5KA 2ASLA 3B54A 2FLNA 4ZCLA 1Z2LA 5HQLA 2UU9J 1WC0A 2ASJA 3D1OA 3P6YC 1X4FA 3BGFA 2PFFB 2DCUB 3KUGA 2V67A 1HMVB 3G9CA 2B7BB
chains in the Genus database with same CATH topology
4F2RA 3MM9B 4DJBA 2CQPA 4HI2A 3D2WA 4OI3A 3EZUA 2DNKA 2YKAA 3IRXA 4G1PA 1U8SA 2YX7A 5E3RA 4N47A 1IQZA 3U27A 3D1QA 1HI0P 1AFIA 3I0SB 3SFGA 1SH0A 2XY5A 4FF2A 2ZDOA 4DV4F 4DSLA 5KT3A 4Y6IA 2RMLA 3GV5B 2C2DA 4EBEA 5FJ4A 2CQIA 4F67A 4IDKA 4F26A 2D1CA 4TY8A 4EO8A 4RLEA 5D8HB 1OPZA 3EGNA 4QCLA 1S1UB 4F2SA 2RRAA 4WKRA 3MM8A 3SYZA 2W7OA 1NU4A 4TQSA 3V2UC 4RNFA 1U48A 3CXCR 1ZPWX 2WSCC 3VAJA 2F40A 2GGPA 4ZPBA 4RUCA 1AFJA 1UWBA 1PO6A 4ZCMA 4D3GA 5IQ6A 2FIUA 4U7CA 1TK8A 2JEJA 4C4WA 3PW5A 3MM8B 4NLOA 1S97A 1HWIA 3PIPQ 3U1LA 2RQKA 2BE2A 4CH7A 1FRKA 3NMAA 3MECA 2CFXA 2FC9A 2GGPB 4U6PA 1KLMB 1IBLF 3GIKA 4DQPA 1UWBB 3IG1B 1MROA 3AJ1A 3MWBA 2I5JA 4CTAB 1N6QA 2NYIA 2P5VA 3NCPA 4ETXA 4I68A 2UXCF 2R9LA 1LW0A 2GHPA 2BE2B 2YX4A 3HFKA 1FXRA 3MECB 2DNGA 4ZMMA 2EK1A 2EFNA 2ZITA 2K8GA 1KN6A 1LW2A 2VBZA 1MROB 2I5JB 3GIIA 4DL3A 1N6QB 2R7OA 2IRUA 3U02A 4FF3A 4TY9A 2WOMA 2E5IA 1LW0B 4CNYA 3DFEA 1FTRA 4YB7A 2DGTA 3ENWA 4RKUC 2UVRA 4P2SA 1D0EA 3IN5A 5T7LA 5F3ZA 1LW2B 2DT9A 3K8VA 3GMGA 1XBWA 2HG4A 5JJBA 3DLBA 3UCUP 1M5HA 3AQOA 5FD1A 4A8FA 2HHUA 5D78A 2N7YA 3T6BA 1SB6A 2WOMB 4RW9A 2CQHA 4ELUA 5EUHA 2KM8B 2R8HA 4DS5A 1HFEL 5T7LB 1Y7PA 4X4UA 1HR0F 4M95A 4OZJA 4RW9B 4V19X 5MLCV 2OFGX 2FLLA 2M0GB 3DYAA 2DNRA 1KTQA 4MK8A 4FS2A 2GQCA 3F41A 2MZQA 3LP2A 3N0VA 4K4TA 2AQ4A 1QAIA 4M94A 3KK2A 5KFHA 4LIRA 1IM4A 3DRRA 3DXSX 2N4CA 3RAMA 2DB1A 4HI1A 4A8WA 1S6UA 1IKVA 4I6WA 3VAFA 2E1AA 1XR6A 3KG4A 2XHWA 4BC9A 3DYAB 2MMYA 1IBKF 1TKXB 2N3LA 1MMNA 3GB0A 3N5FA 3KK2B 4O3RA 3DRRB 1JK9B 5BYRA 1JWWA 3HDSA 1R43A 2XS5A 2IYIA 1IKVB 4YEAA 2DCLA 2GO8A 2RKIA 4OI6A 2PIIA 2D9PA 4YFUA 4R8UA 3MR6A 3KMSA 1QAXA 4RBTA 3Q22A 3ZC4A 1SJ3P 1M5VC 2GO9A 1VHFA 1KEKA 4X62F 3NAHA 1ZZNA 4J9LA 1X7VA 2G0CA 1VQNS 5LXRA 1C0UA 3TANA 2G1DA 1NK4A 3P96A 2XLJA 2RKIB 3SCIE 1TV6B 2XB2D 4QBUA 1VI7A 3CB4A 1WHYA 3MURP 1VK8A 1WEYA 4XK8C 4R8UB 3PKYA 3PO5A 2EFOA 3LPYA 2J0WA 5KFPA 2YKOA 5KFKA 2Z2LA 1FD8A 4F3MA 3ENQA 4J9MA 1C0UB 3KLEA 2FUG9 1YQHA 2MQOA 2JLFA 4RNNA 1NNDA 1ZBTA 4KPYA 2PO4A 3H25A 4QIVA 3HKZD 4MIBA 3M2RA 4X4VA 3J7Z5 2C42A 2KFNA 3UW1A 3TAMA 1AXQA 3KLEB 1S49A 1UFLA 3HXMA 1G6BA 2UVUA 4O0IA 2I1RA 5B0GA 2R7SA 4Q8EA 4AQYF 2ZNZA 5KG1A 3M2RB 5KG4A 1L5UA 4FPRA 4B3TF 1N5YA 2DGWA 2HRUA 1MWZA 4FBUA 1FT8A 4OHXA 5J2PA 1BWEA 7FDRA 5KFJA 2XMUA 4OHZA 4RUAA 4ZPTR 3RBDA 5CA5A 1N5QA 4AL6A 4C3LA 3DMJA 1VOMA 1N5YB 2WB4A 3GE9A 1YJRA 3C6TA 3WDOA 5J2PB 4Q5VA 1RYSA 1K1SA 5E3AA 4KV8A 4IH5A 3DLLQ 1FRJA 1T03A 3T6JA 4WFBQ 2Q6CA 4USJC 1ULRA 3RR8A 1XMBA 3DMJB 3BM7A 4LMZA 1TK5A 3LALA 3C6TB 2JFKA 3KKFA 1KOHA 1N54B 4C3KA 2FVSA 2GCFA 1VQPS 4JV2A 3NNHA 3QIPB 4C0OC 1DRZA 4IR1A 5L9NA 2WB1D 2RSQA 2HAIA 4KKOA 5B7WA 2DR5A 1GXTA 2MPUA 5CCLA 4DL6A 1YG0A 5E41A 2KZMA 1FVSA 3POTB 4CT8A 3ETOA 2WSEC 4PXEA 2W9CB 1ZM9A 5K5MA 1K0VA 3NCQA 4ETZA 4IKAA 3A1YG 5HI7A 2K2PA 2CPHA 1TZ0A 1GNKA 2HHPA 4LVOP 2CIMA 3NAIA 4KKOB 1KR4A 1UVLA 2X1FA 3IWNC 3EXYA 3HZGA 1YSJA 3BR9A 4MKYA 1WEXA 2B56A 5KFVA 1NJWA 4LF9F 3ZZTA 1UKUA 2DO0A 5GAGU 2ERRA 2IVYA 3O6QA 1XNQF 2VFUA 3KLIA 4JI1F 3UDLA 2L9WA 1RTIA 2B4PA 3I6PA 4OHVA 1NK0A 3MAHA 2E1RA 4DMZA 4ED5A 1LWEB 4Y34A 1U49A 1TAUA 1U1OA 5A6PA 2KU7A 2M3DA 5LJ3Y 2L41A 2RT3A 3SFUA 4X2BA 1UFWA 5JXSA 1LV5A 1HBUB 1N88A 4RWXA 3IBWA 2HFZA 1RTIB 4RUHA 2XCPA 1TKTB 1DQAA 1YJVA 5M2PA 4DV5F 3TO8A 2FD2A 2UV8A 2BRLA 5C42A 3T1AA 1E6YA 4MYTA 3PJXA 5KFNA 4K4UA 1LOUA 1NAQA 2NSCA 1YVFA 4WXWA 3CUNA 5B0EA 3PIOQ 4HEA9 4DQRA 2HFOA 1NJXA 2RUGA 1L3VA 1KFSA 1U4BA 3QZ8A 3M6VA 1S10A 3LP1A 1E6YB 3LWLA 3GILA 2CQDA 3CCMS 2LEPA 1NRKA 2AJ0A 3MI7X 2EFQA 1D3WA 1XK8A 1CPZA 3DU6A 3WX4A 4NYOA 4Z2XA 1KQGB 4FVMA 1JNRB 2R8KA 4EZ6A 2XS2A 2X51A 3T1YF 1F5AA 4NLRA 3LP1B 4YR0A 1WF0A 4ELTA 3I55S 5THWA 2D3UA 5M2UA 5KFWA 4P7TA 3TYTA 2B6AA 5F8HA 2KYZA 3E8OA 4H4KA 2Q1LA 3R3TA 2PN6A 3PHEA 2HHTA 1Y9OA 3TA0A 3UPFA 3Q2TC 4H4MB 3ICLA 4MK9A 1JX4A 1IKWA 3LAMA 5KFCA 4NLPA 1SJ4P 4I64A 3D54A 2B6AB 1BQXA 2HW3A 1VFJA 5DS7A 4IFVA 2J6TA 1ZETA 2NSBA 1IN0A 5KFUA 5EX0A 4WK1A 2DGXA 3CDUA 1IKWB 1LWCA 4R25A 3OVBA 4Y28C 1Y3KA 1KC8T 1XNRF 2DGQA 4K4ZA 2VG7A 2XSFA 4HDHA 3MMAA 4IFVB 4A4JA 3EPIA 3TW0A 1WHXA 5DG7A 4DFJA 4K4VA 2ABYA 5DM7Q 2MHNA 3D0IE 1JXLA 1LWCB 1JLFA 1H7XA 2CQGA 5DLGA 1CLFA 2FLPA 4DR2F 2CDQA 2VG7B 2CQCA 3CEDA 4DV7F 3RB0A 1S79A 1FK9A 2KZZA 3PXGa 5E0OA 5KFRA 3ZZUA 1LQ9A 4F4KA 4Y0FA 1NKBA 2BV3A 2BYCA 4H4KC 3K58A 2JJ4D 1JLAA 1Q53A 2MZJA 1JLFB 2O3DA 2UUWA 2XMJA 3DLGA 3IRWP 1FJ7A 3OSNA 4OIXA 2XCAA 3R5BA 4KGKA 2M2BA 1HPZA 3VZHA 2VODA 4OX8A 2VQEF 3RW7A 2LA4A 2RQCA 2AYEA 1YJ9S 1XC9A 1JLAB 1Y4ZB 2QV6A 5LSLA 2L08A 4NCBA 1EETA 2GIQA 3M6XA 4DR4F 3OFEA 3I9V9 2VOPA 2MKHA 1HPZB 3GFYA 2AJFE 2IM0A 4OLPA 2Q6BA 4P7VA 4K4WA 4DN9A 3CCWA 5BJRA 2M52A 1NO8A 2LXFA 1R6YA 3JAMY 2JC0A 5EWFA 1N8RT 2Z2MA 1EETB 2HGNA 3TA1A 2ZKUA 3PW4A 2AYGA 3OTEA 1QSLA 2XEXA 4HL9A 2IMWP 4DV6F 1B0VA 3D0GE 2VKZG 3OFGA 1YHQS 2OAUA 3D28A 3THTA 3M9MB 2CYYA 3MFHA 2VOOA 3MR2A 2BJEA 1CG2A 1UEUA 2PD1A 3IWLA 2XGQA 3UWTA 3OFHA 2F9DA 4PWDA 3H40A 1DJ0A 2J8AA 3UR0A 3Q2SC 4IRKA 2COLA 3AQPA 2J9DA 3LP0A 4ZCKA 4PXDA 2OPQA 4K0KF 4CQ1A 1FDAA 5K8OA 2JEGA 1B0TA 2K7KA 2IC3A 1SXLA 1RISA 2EBEA 1U25A 1YBAA 2POKA 5J2MA 4PWDB 4I2PB 6FD1A 1DQ9A 1ZM2A 4O3QA 5GAGI 4PQUA 1U2RA 1I94F 5HN0A 3KOAA 2V4RA 3LP0B 2UUCF 1NEEA 2OPQB 2ZBCA 2UUAF 4NLYA 4B3OB 2IC3B 4LQ9A 2V2KA 3FEXB 4OL8A 5J2MB 1IQTA 4G3IA 2PI4A 2UXBF 2DGUA 4ERDA 2IM3A 3K5NA 1YRTA 5J1PA 3DHWC 3HHLD 2KJWA 3HHLC 1FRIA 4LSNA 4JI2F 2DGSA 5EDWA 5CQGA 1ZAVA 1RA6A 4C0BA 1D9FA 4EBCA 5A8KA 2E9RX 2DISA 4QQBA 1RWUA 1UJ4A 4ID5A 3JB9k 1H38A 2QO3A 4XPCA 2L3MA 2GA7A 4LSNB 3RYLA 1NB7A 5DO2A 4X66F 3TUIC 2JX2A 2MQPA 2WCXA 1V9OA 1DFDA 1HW9A 3OTDA 2PE8A 1N5TA 2VL1A 2R7XA 1N32F 3CCQS 5A8KB 1SI9A 4WYWA 1VJWA 3T1HF 4I2QA 3DDKA 1RP5A 2YNHA 2ILYA 1OS5A 2UV8G 4M63A 5E3PA 1KHWA 2CQ1A 1O0PA 5HMYA 3UQSA 3Q8PB 2B4UA 2EFVA 3RTVA 2HHVA 3CVKA 4QWAA 4LSLA 2R4FA 3GR1A 1UJ5A 4QPTA 2K7JA 2JEIA 3BR8A 3BSNA 3IGNA 2FPHX 1CQMA 3V4IA 1JB0C 2YNHB 2RS8A 2AP6A 2BR0A 3L7OA 3K8WA 2UUTA 1N48A 1LXNA 2ASDA 2UVVA 3QJJA 4JV5F 2HHQA 2YNGA 2VG5A 3OW2R 4RWWA 3V4IB 4BBYA 1URRA 4K2XA 4Y2IA 2FJVA 4PPZA 2LECA 1Q81T 3RB3A 3BS9A 4DV2F 3LAKA 3TNVA 2NS1B 1VBXA 3OBIA 2YX1A 4QU6A 2GNKA 5D77A 3OLBA 4N41A 5BR8F 4WF9Q 2FB0A 2YNGB 5E5NA 4ZP9A 3KK3B 3QO9B 2RB7A 2AJ1A 1JLBA 2VG5B 2RU3A 3VAMA 4ED0A 3R1HA 3K2YA 1GX5A 1U1MA 2W4PA 1IKXA 2FLOA 3NNAA 2DNNA 1VRUB 3QMQA 3CTRA 1HNZF 4PG5A 1FERA 2ACYA 2M5YA 2MKSA 4X65F 1RKJA 2DRAA 1N0VC 3H98A 1D9DA 1JLBB 1P1TA 1TL3A 2YY3A 3DLKA 2A3JA 5EWGA 1P9QC 2ZH4A 2E29A 1IKXB 1S0NA 5KT2A 4Y2CA 2W24A 5J2NB 3IWXA 5JVHQ 4DF4A 5AE1A 1SJFA 2C3UA 4AL7A 1U2FA 5E3QA 2X3GA 1TL3B 2PDAA 3M8SA 3BSAA 1GT8A 3L95X 4ZVFA 4ED1A 2EC0A 4XAKA 3FSYA 1VQSA 1X0FA 1QJHA 1REVA 2XMMA 3I4HX 5AE3A 4QYZJ 4PG6A 3K5LA 2E7XA 5EX3A 5K8MA 1NK7A 3QLHA 3W7BA 5CCMA 1S48A 1S0VA 4ECSA 3CDEA 4GO7X 3LW5C 2D41A 3DLEA 5J2QA 1OIAA 5K8PA 3B8HA 3CWJA 1ZOTA 4OZ0A 1REVB 4WYLA 2HYIB 3I9ZA 3GIJA 3QLHB 1Q8BA 1MW7A 3TAPA 2GHVC 3IC1A 4MAKA 1U6ZA 4A47A 2ZVSA 3CDBA 1FE4A 3DLEB 3OQ2A 2ROGA 5LMNF 2IJNA 3OR1A 2OMLA 1FJCA 4EGLA 2M7SA 4KQZA 3ITHA 3IR7B 1TKZA 3PNIA 2YH0A 2LLZA 1B0PA 1X5PA 2WONA 1T02A 2ZD1A 5DRKA 5KG3A 4CO0A 3VCDA 4EU0A 1EP4B 3FGVA 3BN4A 4M5DA 4NLQA 5CYJA 1BY9A 2XO7A 4B9TA 3GYXB 4LF7F 4QWCA 3O1LA 3AH6A 3OR1B 4RBVA 4ICLA 3SSRA 1U45A 4WE1A 1XERA 5K8NA 1XMOF 3ITHB 3SSQA 4N56A 1TKZB 1YRUA 2LQBA 3CCUS 2VUGA 4X84A 4I1TA 3U1NA 3WC0A 3M2VA 5KT7A 1RKIA 4M5DB 4U7UK 2IBOA 2P6TA 4FP9A 2BZ2A 2C3MA 1G3OA 2ZNYA 4C2MA 4DL5A 1YJUA 2V4JA 3RZAA 2GV1A 1RT6B 4ICLB 4NLDA 4KFBA 4WE1B 1YJWS 4NA2A 4DR5F 2MXYA 2AGQA 2J76E 2MJUA 5LT5A 3FQKA 2RRNA 1LWFA 4C98A 3M8QA 3N4WA 3AAWB 5EN1A 2D74B 3PW7A 5D4NA 5IT9Y 4OI4A 4LF4F 3DOMA 1V3RA 3VALA 2KHDA 2V4JB 5DLFA 4PXCA 1FRXA 4MMOA 1FA0A 1NK9A 3CT9A 5KFXA 3MUMP 4ECVA 2UU9F 4HHJA 3M8QB 2FVRA 2A18A 4RNHA 5KFBA 3FNNA 1BLUA 2FHJA 2OSQA 2WRMA 3MHYA 1OSDA 2QE5A 4OLOA 2KRRA 4GMKA 1HD0A 4WJBA 2ZHOA 2ZOGA 2V8GA 3M6WA 4UUXA 3CPWR 1MU2A 3S7RA 3Q23A 2XY6A 5DGBA 2FY1A 3HZEA 3IRXB 1FTCA 3B78A 3MEGA 4LQ3A 1RT2A 1HARA 5C25A 1Y3JA 3IR5B 1FDDA 4IUFA 1UA0A 4LF8F 1TQLA 3GFHA 1HD1A 1R0AA 4OI1A 1VQLS 1FKOA 4IDKB 1Q8LA 4TY8B 1SJRA 1XN9A 3NGKA 4DF8A 2JLGA 2BACA 1KTVA 3MEGB 1YGYA 1RT2B 5C25B 3M1VA 1YITS 4NRTA 2FJWA 1I1GA 3V6KA 4R0JA 2VONA 2DNMA 4KHMA 1R8PA 2DNPA 1R0AB 5DJBA 3PM9A 1HW8A 5D4PA 1XEZA 1FKOB 3FVYA 4O3PA 1PSDA 1X4HA 1O5JA 1U09A 2IAJA 5CZXA 4IRDA 5A0YA 4DR7F 3HM9A 4OJHA 4O3NA 1SKWA 2MDAA 3M1VB 3HPOA 5E3CA 4K4XA 2DO4A 2C3YA 2P9GA 1RT5A 3I4PA 3CGIA 2FHJD 4KB7A 5A2QY 3D1HA 3FEYB 4I69A 1KQFB 3EX7B 3DU5A 4YDDB 4CH1A 3B82A 2QLWA 2IAJB 1CC8A 5A0YB 5L39A 2CJBA 4JBCA 3TRGA 2MQQA 1X4GA 3TUZC 3UD3P 1U1LA 3MPYA 3T5HA 1RT5B 3ZZ0A 4YR3A 1KVIA 4ED7A 2AF6A 1NH8A 5H1SV