2FULA

Crystal structure of the c-terminal domain of s. cerevisiae eif5
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
161
Chain Sequence
SPEFVNSELTQLDEYGEWILEQAGEDKENLPSDVELYKKAAELDVLNDPKIGCVLAQCLFDEDIVNEIAEHNAFFTKILVTPEYEKNFMGGIERFLGLEHKDLIPLLPKILVQLYNNDIISEEEIMRFGTKSSKKFVPKEVSKKVRRAAKPFITWLETAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the C-terminal Domain of S.cerevisiae eIF5
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5
total genus 59
structure length 161
sequence length 170
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fulA01
4LUNU 1H2UA 2RG8A 1PAQA 4C9BB 2NSZA 2FULA 2KZTA 2IU1A 3EIJA 4B8CB 4B8AA 4GMLA 3JUIA 3EIQC 4IULA 3RK6A 1UG3A 4CEMA 2VSXE 1H6KA 2GGFA 1UW4B 2IOLA 1N52A 1N54A 3D3MA 4GMJA 2I2OA 2ZU6B 4JHJA 4JHKA 5ANRA 4CT4A 2KZTB 1H2VC 2IONA 3L6AA 2IOSA 3FEYA 1HU3A 1H2TC 4B89A 2HM8A 2VSOE 4CRWA 3FEXA
chains in the Genus database with same CATH superfamily
2XS1A 4ILGA 4G24A 3PEVB 3FP3A 2J49A 2L6JA 5T8IA 3AAAC 3RSEG 1D8EA 3LVRE 4DJAA 1E8ZA 4UWLA 1FT2A 1U2VG 4J8DA 2WXFA 5A23A 4GYYA 4JL0A 5C1DA 3MZLB 3B7BA 2R17C 1JWFA 4U0ZA 3KSQA 2HM8A 3FEXA 3RAUA 4F1SA 1S64A 2M63A 2H6FA 5EIBE 3CQCB 4F6RD 3Q15A 1K1BA 1W3BA 3AU4A 2C0MA 1OY3D 2VGEA 2BEDA 2VSYA 3OAWA 2L9BA 3Q79A 3ESKA 3L82A 3CHMA 3SQVA 1ELRA 3MYVA 4EBAA 3KSLA 3LJ3A 4MRUA 4HS2A 3F6QA 2LXLA 5B1AE 4AIFA 5BNWA 5JJ6A 4G8KA 5ENOD 4ANVA 3TWSA 4AY5A 4C9BB 1DCEA 1V54E 2WXGA 4ATGA 3TWUA 1HX8A 1E7VA 3KD7A 4G1TA 4HOSA 4PDXA 3ZYMA 3B7SA 2DYSE 5CEDB 4ZFHA 2WPVA 2AWIA 4LCTA 3EDTB 3QDNA 5AQBA 4O1PA 1Y6IA 1E8YA 2OV8A 5ITZF 3URZA 3OXLA 2I9CA 3LY9A 5ANRA 3R9MA 3G2VA 5LP0A 1H2VC 5FT9A 3LEWA 5EILA 4NURA 4ZHBA 4GTMA 2IF4A 1LD8A 2CG3A 1TNOA 4RQIA 3FTZA 4JA9A 3FUFA 2Y4UA 1PY1A 3ZYKA 2MOWA 4JHKA 3FTVA 5EX3A 4CDNA 3SF4A 2L0TB 5AN8A 2EIKE 4KXKB 1P5QA 4CRWA 4I17A 4DUIA 5G04C 2FF4A 1BPOA 5HQ8A 3HDXA 5FINA 5ENNA 5LFAA 5EYPF 5JJTA 3BEEA 2UWJG 5AJLA 2VQ2A 2XENA 4J8YA 4G8LA 4UWKA 5EKQD 3RO2A 2CHXA 3MKQB 4GTQA 4BETA 3KAEA 3JUEA 1SZAA 3D9KA 5AARA 3G2TA 5FQ6A 2P2CP 2V4LA 3FU0A 4AVXA 3PUJA 3CHOA 2A4ZA 4A3TA 2XPZA 3CHSA 5KJKA 2P9SG 4LNGA 2YQ8A 4K5BA 4F7AA 2I1JA 5G05C 3SD5A 4DRXE 2WVIA 5KJMA 3MEKA 2XQ0A 3HRAA 3ZEFA 3UPVA 2AXZA 2H6HA 1H6KA 4AM9A 1SQMA 2XGSA 5D0QD 4A63B 3L17A 2F8XK 4BX8A 4G26A 4GTOA 1HFAA 4FJYA 1OXJA 4BSZB 2QY7A 3PUKA 4CDMA 5KJLA 3Q78A 2DIWA 4HOUA 2GRMA 2WMNA 4HB5A 4I6JA 1WG0A 5T3RA 3NF1A 1FVFA 4HBDA 3FUIA 2F37A 4DPRA 3QNKA 5FQ7A 5FZRA 2GW1A 3ZHEB 4GMLA 4NACA 3BG1B 5ENQD 4K03A 3D3MA 3JXJA 3PZ2A 4PUCA 2Y4TA 1H2TC 2OEVA 1E90A 2RD0A 3ENEA 3UXGA 5AAOA 3TG5A 3TWXA 3E4BA 4YDWA 3RRNB 3AU5A 4GAAA 1HZ4A 2EIJE 2PZIA 3OXFA 3NAWA 3ML8A 3T5VA 4APOA 3J5PA 3CV0A 3UT7A 3T9KA 2LUHA 5AQ7A 4RVBA 3GYZA 3ULEG 3ZU7B 5B3SE 3ZKJA 3HVEA 3SZ7A 2J9QA 1V55E 3FULA 3L08A 1OWLA 4N3BA 2XGOA 3DEPA 4HLLA 3JYSA 3KEZA 2XEVA 3FU3A 3Q5MA 1TJFA 3P2BA 4A1GA 4LSZE 3IV0A 4G25A 4C48B 2CHWA 2KM4A 3NB2A 5CHEE 1JCSA 2PM7A 3UM3A 3UIOC 4O6FA 2OVFA 2CFUA 1PC2A 2C2LA 3V2OA 3CVWA 5CRUA 2I6HA 4LG6A 3FDHA 3GZSA 3S7DA 4JHRA 4XX5A 2VYIA 2R2LA 4GTRA 3C3QA 2XCCA 2Y69E 3PS6A 4J7WA 4EZLA 4GZ6A 4JEUA 3FU5A 3EJNA 4RLYA 2ZGGA 3PE4A 4I9EA 3I4RB 3T8MA 4U95D 3LKUA 2WXQA 4L2LA 4P29A 1FPPA 2XPYA 2KCKA 3APDA 2H6IA 1MZCA 3FUJA 5FIOA 4PS7A 2PL2A 2OCCE 3T5XA 2OVBA 4N5CA 3IHYA 4I9CA 4WWOA 4TRQA 2XGMA 3V79K 2CG2A 4YVOA 1HO8A 4HLEA 4BERA 5FJYA 3LXUX 5AYWD 2ZIRA 2VGXA 4CEMA 1HXIA 4ANWA 2MHKA 1OWMA 3BG0B 3FUDA 5AIJA 3LYAA 4KVOA 2V5QC 2EILE 2J4BA 4U07A 5CBNA 2WXNA 4DX7D 3CK8A 2YNQA 4FADA 4B0ZA 3ZN3A 3D9NA 4GCOA 1S63A 3QJZA 3DRAA 3ZPJA 4O60A 2BUGA 2ZU6B 5KCMA 2ETBA 3ZYLA 4JW1A 3RIBA 1TEZA 5EYLA 1U3CA 3DWLG 1MQSA 4N2SA 5EIDA 2ZGDA 1OCZE 2DYRE 3ABLE 2NSZA 4TV3A 3EIJA 2WXHA 4AP2A 2WXMA 1NI1A 4JZYA 3AG2E 3ZHEA 3OTNA 4UI9J 3LCAA 1KZPA 1E96B 5BUZA 2QZAA 3MGBA 3NOCD 2BKKB 3FH5A 2GRQB 4N3AA 3HYMB 3AG1E 1TNBA 3LJNA 4DX2A 3WXXA 1E8WA 3KEAA 4GB9A 5FZQA 4TUMA 4Q69A 5J08A 2Q7FA 4UWHA 4I2ZA 1UJJA 3FU6A 2PNNA 4A55A 2R05A 3AS8A 4WNFA 2X6JA 2Y3AA 2WQ6A 3JXIA 4ME2A 4TXRA 4KYOB 3PZ4A 4YDEA 5D0OD 4JVSA 3Q47B 3CVNA 3PREA 2J8SD 2P9UG 3D9MA 4PH4B 4ACLA 4B94A 3MCXA 1U3DA 2WM9A 1MJ0A 4KT6B 1KT0A 1KZOA 3UUXA 3LS8A 3ONLA 4HI9A 3U66A 4GPKA 4U63A 4JA7A 5KWDA 4LEUA 4DX6D 3ZIMA 3HG0D 3CIAA 1SW6A 2KZTB 4BTAA 4JC8A 4ACKA 4JD2G 4BWRA 1IYGA 4HVBA 2RFAA 4HRLA 5ARGA 4FA6A 3DSXA 4FHKA 3FY4A 2DBAA 2KC7A 2KXPC 1TNYA 2B0OE 3LY8A 3G2UA 4BEPA 1N9AA 2L0IA 4J8FA 3HXFA 4K0RA 3OXGA 3UI2A 4EQFA 1MX2A 1WAO1 1OWPA 4EECA 5FZSA 4I43A 2X6IA 3B13A 4OVVA 3UM0A 3E32A 3CHPA 3NBNB 3IXEA 3CSFA 2HYZA 4CGVA 5AJDA 5LCWJ 4TXPA 3UMVA 1TR4A 1BD8A 3J5QB 1SZ9A 4XZ4A 3PNTB 3LDZA 4Y6CA 3L16A 4RG6A 3GZ2A 2DZOA 2KCVA 4APFA 4MKTA 2LAHA 3U4TA 4EHMA 2CHZA 2X6FA 3VLFA 3ZUVB 4AJWA 4GZDA 2QYUA 4XEIG 2RG8A 3HXBA 4HOQA 4XKBA 1H6PA 4GYOA 4FLHA 3SFYA 4Q96A 3O4ZA 3FTYA 3B95A 1OCOE 2GRNB 3V30A 2MYOA 3S7FA 4F3VA 3QB2A 4TUUA 3CR3A 3ASGA 4GMRA 3KS2A 4MLPA 1HG2A 1HE8A 3TJPA 2EIME 1MHQA 4IULA 3FTXA 2XRYA 3TXMA 5G05J 3I4GA 4I6EA 1EF1C 3BQOA 3BU8A 2E2EA 2JLBA 3C3RA 3S2AA 4WWNA 1B89A 5LX8A 3GW4A 3SFXA 2IU1A 3FUNA 5BPPA 3TWQA 4K5CA 5FTPA 2FI7A 2AVPA 4GYWA 5ARFA 2P58C 4Z68A 1OCCE 2F0YA 4U0SA 1RZ4A 1KLXA 3Q9UC 5BV0A 5KNGA 1NL4A 3EHQA 4NQ0A 3C98A 3DSVA 3NZUA 1H19A 3QWVA 4FULA 3ZVVA 4N2QA 5E75A 4U8YD 3DXMG 3MV2B 4EZKA 2MRIA 3ASHA 4L1BA 4IRUA 1QQEA 3LY7A 5B1BE 4MS6A 4B93B 3WG7E 5JHAA 4I6GA 4I1OB 3DSTA 1NZNA 1NA3A 4XI9A 3G2SA 5CECB 3RO3A 5ANLA 2NXPA 3Q49B 1LF8A 2J4DA 3ABKE 4EBAG 2P9NG 4OYSA 2IO2C 4DK5A 3UM2A 3B7RL 4U04A 5FQ4A 1GW6A 3UQ3A 2X6KA 2OOEA 1TN7A 4H7XA 4J0UA 2LNIA 4GZ5A 1OCRE 3EU5A 3U3WA 3E34A 3ASDA 5HKPA 4BT9A 4A1SA 4U8VD 4BY6A 3UINC 2IOSA 2XEHA 3N71A 4DX5D 4LRZA 1IQRA 2P9LG 3IEGA 3Q7FA 4BX9A 4V3IA 4UWFA 3DXKG 3ISMC 4LERA 3HIZA 2IJGX 2PQNA 1HG5A 4HFGA 2P9KG 3B7UX 1Y8MA 2V5FA 4K5AB 4JEHA 2GRLA 2VSNA 2LAIA 2IONA 3ASOE 3APCA 1Z3YA 5E76A 3TWVA 4FP7A 4UUCA 3ESLA 4RSYA 3ASNE 4AY6A 1UW4B 3PZDA 1Z6TA 3ZXPA 1S0PA 2RFMA 3SBSA 5KNHD 3DPYA 3ASFA 1OT8A 2FO7A 2XS8A 4GZCA 3ABME 2BTDA 4DLQA 1N0RA 2PQRA 2B6CA 5BV1A 2X3MA 4J6IA 2J08A 3TG4A 2QFCA 5KJNA 1IQUA 4XE0A 2HR2A 3AG3E 4A3VA 2RKKA 4JPSA 3D9IA 3PZ3A 5HI7A 4I1AA 1LD7A 3D9OA 2A5EA 2HE0A 3HXEA 2IO3C 4FU3A 4MBGA 1TNZA 3P1UA 2WB2A 2GROB 3FWVA 3DPDA 4WNGA 5EN5D 1NP7A 2WQ7A 3LVQE 4UQZA 4ILHB 4I1MA 4KZ0A 4F1PA 5M72A 4WNDA 2Y1LE 3CVLA 5ENTD 4KVMA 1TN8A 2XZTG 5JJ7A 2AXVA 2WXLA 4U96D 4BESA 2IEJA 2P9PG 2XPIA 1NFIE 5A7DB 1O1RA 4FHJA 4GPMA 4UI9K 1N4QA 2H6GA 4ANXA 2V0PA 1SVXA 2R5SA 3CLJA 3ZGQA 2AJAA 3CK9A 4GU5A 1JCQA 2R03A 4URKA 3NQPA 2AW6A 2ZXWE 3DSSA 2XHEA 3V31A 3TAXA 2WXRA 4H7YA 3HVEB 1DNPA 1RW2A 4F53A 1EYHA 3S7JA 4HQDA 4ATZD 4M7CA 4DI3A 3FTWA 3SNXA 3MKRA 5FQ8A 3CEQA 1YA0A 4E6HA 3CVPA 5KBAA 5H7PA 1BI8B 5JHBA 1TYQG 4N5QA 1AWCB 3CKCA 4HRMB 3RK6A 3JQ1A 4IN3B 1YCSB 4GZ3A 1AP7A 5CRVA 4DX1A 3R7QA 4FC8A 1VDYA 3TWTA 2XZDG 3QARA 2Y0BG 4L9PA 2KCLA 4L2YA 3UKRG 1ELWA 5J90A 2KZTA 1UOHA 3VTXA 3L13A 4UQXA 2P9IG 3ML9A 3UT8A 1UN8A 1JUQA 2X38A 1K8KG 3UX4A 2FO1E 2VGYA 3JQ0A 4GA2A 3C3OA 3CKBA 4PS3A 1Z5SC 4OAVB 4IYPA 5D66A 3MKQA 1Q2ZA 1X5BA 1DC2A 2VSXE 4HI8A 4U8HA 2QC9A 5JMND 2V8SE 2X6HA 2J09A 4JB8P 4J8EA 4WUYA 2ETAA 4CT0A 3U64A 2ZISA 4XI0A 3E33A 4HXIA 2DCPA 1IXVA 3QWPA 3DEOA 4U0UA 4RG9A 3UT4A 2BF0X 1HF8A 4G11A 3SBTB 3Q7AA 3FEYA 2DVWA 3W9FA 3CHRA 2NYJA 1FCHA 1N4PA 1UJKA 3HHMA 1MX4A 3SGHA 5T4YA 2DWZA 1D9SA 4HRNA 3CVXA 3B7TA 2FBNA 3EHNA 1OWNA 3PRZA 1TJCA 3FFLA 4J8SA 1EDUA 2WXOA 1ELKA 4TXQA 3E37A 2V4HC 3ZNGA 2KATA 1OUVA 2I1KA 1BU9A 1N94A 3CGHA 3NOGD 3QKYA 1G3NB 4GA0A 4QFVA 1WDYA 2IFUA 5CMYA 3PH0C 4FJZA 3Q73A 4BTBA 2LSVA 3LPZA 3SFZA 3GZ1A 1WY6A 4W9RA 5ENSD 3RJVA 2XEEA 2IY0C 4C0EA 3CVUA 2E0IA 1N11A 4KBQA 1FT1A 1Z3XA 5C2YA 3PE3A 3C5RA 3QWWA 2VSOE 4U7EB 2GRPB 4EZJA 1TN6A 3G2WA 3UM1A 5CBOA 2DZNA 4AXHA 4AV7A 2JEKA 3ZYQA 4G2VA 4N39A 2VTBB 4XIFA 3FTSA 3TWWA 2ILRA 3CVVA 3TWRA 3SHFA 3QK0A 2OEWA 3QC1A 1K1AA 1UN9A 1E8XA 2AXUA 2UY1A 4PS8A 3ULQA 2ONDA 4D10C 5CMWA 1MX6A 4Q94A 3EU9A 4GTVA 4XKCA 3RRMB 4ANUA 4X8QA 1H6OA 3EIQC 1SA5A 1QYMA 4JXTA 1OWOA 1ZU2A 1EPUA 1N4RA 4HORA 3FUEA 3D9JA 1IHBA 5AQ9A 5EDSA 3W9GA 2WXJA 3RU0A 2XRZA 3PNLB 4BSXA 3X2QE 2YINA 4LNBA 2J07A 3R7RA 1H0AA 1O1TA 5CERB 4CDRA 1YYHA 3AS4A 5EX0A 5G2NA 4C0MA 2WQHA 3QOUA 5BT1A 5G55A 1N95A 4DLOA 5HS0A 3MX3A 3S7BA 1L5JA 2GRRB 4G23A 4CCAA 2NC9A 2C0LA 3DSUA 5CCMA 3TL5A 3VLDA 2VTBA 4Y6WA 3VTYA 5IY5E 2XCBA 3IKOB 3FHEA 4LUNU 5ENPD 3HXDA 5D2MC 2CFZA 2HO1A 3CVQA 1XGWA 1A17A 4YVQC 1N52A 2IOLA 3QAQA 1NA0A 3SO8A 4GTTA 4GTPA 3JCKC 3CHQA 5DIZA 1QNFA 2QYJA 2PM6A 3I5PA 2R59A 1X81A 4QQIA 1A5EA 3L54A 4GA1A 3FH8A 3FTUA 1N4SA 1XNFA 3NZSA 3AS5A 3ONKA 3ZFWA 2WXIA 3JUIA 1BLXB 3D9HA 2I2OA 3D9PA 5HRYA 3IHVA 4YDYA 3FUMA 1ZB1A 2L6BA 2YHEA 3PZ1A 4B8CB 4WAFA 4AOFA 2LXMA 1IKND 3PDNA 4GMJA 3SY2A 1N0QA 1YMPA 1MYOA 3FUHA 3PVLA 3ULYA 5A6CA 1H2UA 4UQYA 2VGXB 4NIKA 2FULA 3Q9NC 3C72A 2BKGA 5G04J 4OAUC 3RKVA 5CCLA 3L22A 1N54A 3K9IA 3EUVA 3FUKA 3L6AA 3IBEA 3CSTA 3BUAA 1JWGA 2FEZA 3FH7A 2EINE 2UY1B 5JA4D 3L9TA 4ILIA 1O5MA 3RRUA 3CQGB 1QBQA 4GTSA 4DI4A 1KPSB 4B8AA 5BW8C 5BXOA 3ZRHA 3T8KA 3UIPC 4UWGA 1SA4A 1FVHA 3U9WA 2WXPA 3CK7A 3APFA 4CT4A 2IQCA 4AEZC 2YHCA 3UTMA 2R02A 1HU3A 4M3OA 4HOTA 2WMOA 4CZ2D 3HXCA 4HNAD 4BT8A 3MJWA 4FLBA 1HS6A 3O48A 2ETCA 1K3ZD 3D9LA 2LSUA 5DBKA 4JHJA 3AG4E 3E30A 4WWPA 3VLEA 4OVUA 4YNDA 3SI5A 1S70B 1DVPA 1ZBPA 3R9AB 4GCNA 3PEUB 2GGFA 5LOZA 3ZXSA 2F8YA 1O1SA 3CVYA 3TGOA 4L7TA 1LTXA 1JCRA 1IHGA 4CYMD 3I3NA 5AENA 1PAQA 1E7UA 4ABNA 3Q4AB 1UG3A 5AQAA 4LNUD 4N3CA 3EHMA 4L23A 4YDOA 3UKUG 4I2WA 2WXKA 1DCQA 2A5UA 4KMOA 1WM5A 5LCWC 5BXUA 1QZ2A 1TNUA 1HH8A 5ENRD 5FWQA 3DSWA 3Q75A 5CEAA 2KBXA 2EQXA 4BFRA 3TXNA 4EPZA 4B89A 4KZCA 4E85A 3EHRA 2VJ8A 4O1OA 3DBSA 2JABA 4CGWA 3AJIA 4UI9C 1KT1A 3V2XA 1INZA 4NRHB 4WNEA 2LO6A 3MV3B 1JPLA 1BI7B 1D8DA 4R7LA 3MA5A 3ZW3A
chains in the Genus database with same CATH topology
1NA3A 4EZJA 4ILGA 3G2WA 3LKUA 4XI9A 3G2SA 4G24A 2WXQA 4L2LA 4P29A 2XPYA 3APDA 2KCKA 3PEVB 3FP3A 2J49A 3RO3A 5ANLA 4AXHA 3FUJA 4AV7A 2NXPA 2JEKA 2L6JA 5T8IA 4PS7A 3ZYQA 3Q49B 2PL2A 1LF8A 3T5XA 2J4DA 2OVBA 4N5CA 3IHYA 4I9CA 4OYSA 4WWOA 4EBAG 4G2VA 4TRQA 4N39A 2XGMA 4DK5A 2VTBB 3LVRE 4DJAA 1E8ZA 4UWLA 3B7RL 4XIFA 4U04A 5FQ4A 1GW6A 3UQ3A 2X6KA 2CG2A 4YVOA 1HO8A 2OOEA 4H7XA 4J8DA 4J0UA 2LNIA 4GZ5A 4HLEA 2WXFA 3FTSA 5A23A 3CVVA 2ILRA 5FJYA 4GYYA 3U3WA 3LXUX 4JL0A 3SHFA 5AYWD 3ASDA 4BT9A 4A1SA 3QK0A 5C1DA 2VGXA 3MZLB 3QC1A 4CEMA 1HXIA 4BY6A 4ANWA 1UN9A 2MHKA 1E8XA 1OWMA 2AXUA 2UY1A 3BG0B 3FUDA 2IOSA 3N71A 4PS8A 2R17C 3ULQA 4LRZA 1JWFA 5AIJA 4U0ZA 2ONDA 3LYAA 4KVOA 1IQRA 2J4BA 3IEGA 4D10C 2HM8A 4U07A 5CMWA 3FEXA 4BX9A 4V3IA 4Q94A 2WXNA 4UWFA 4XKCA 4F1SA 3CK8A 2YNQA 4FADA 4LERA 2M63A 3HIZA 3RRMB 4B0ZA 4ANUA 3ZN3A 2IJGX 2PQNA 1HG5A 4HFGA 3D9NA 4GCOA 3EIQC 3QJZA 4JXTA 3B7UX 1Y8MA 2V5FA 4JEHA 1OWOA 2GRLA 3CQCB 3ZPJA 1ZU2A 1EPUA 2BUGA 3Q15A 2VSNA 4HORA 2ZU6B 3FUEA 1W3BA 2LAIA 2IONA 3D9JA 3AU4A 5KCMA 3ZYLA 4JW1A 2C0MA 3RIBA 1TEZA 1U3CA 3APCA 1Z3YA 1MQSA 5E76A 5EDSA 2WXJA 3RU0A 4N2SA 2XRZA 2VSYA 3OAWA 4FP7A 3PNLB 2L9BA 2NSZA 4BSXA 4TV3A 3EIJA 3ESKA 2YINA 2J07A 2WXHA 3R7RA 1H0AA 3ESLA 4AP2A 3CHMA 2WXMA 4RSYA 4AY6A 4CDRA 1UW4B 3PZDA 4JZYA 1Z6TA 1ELRA 1S0PA 3MYVA 3SBSA 4EBAA 3ZHEA 3AS4A 3LJ3A 3OTNA 4MRUA 5EX0A 4UI9J 3LCAA 5G2NA 3ASFA 4HS2A 2FO7A 4C0MA 2WQHA 1E96B 3QOUA 5BUZA 4AIFA 4GZCA 5BT1A 5G55A 4DLOA 3MGBA 5BNWA 5JJ6A 3FH5A 3MX3A 4ANVA 4N3AA 3HYMB 3S7BA 1L5JA 4AY5A 4G23A 4C9BB 2BTDA 2WXGA 4CCAA 4DLQA 2NC9A 4ATGA 3WXXA 2C0LA 1E8WA 1HX8A 1E7VA 2PQRA 5CCMA 3TL5A 5BV1A 3KD7A 2X3MA 4J6IA 2J08A 4G1TA 4HOSA 3TG4A 4PDXA 3ZYMA 2QFCA 5KJNA 4GB9A 3VLDA 2VTBA 3B7SA 5FZQA 1IQUA 4Y6WA 4XE0A 2HR2A 4Q69A 4A3VA 3VTYA 5J08A 2WPVA 2AWIA 2XCBA 3EDTB 2Q7FA 3IKOB 4LCTA 3FHEA 3QDNA 4JPSA 4LUNU 4UWHA 4I2ZA 3D9IA 1Y6IA 1UJJA 3FU6A 2CFZA 4A55A 3AS8A 5HI7A 1E8YA 2OV8A 4I1AA 4WNFA 2HO1A 3D9OA 3CVQA 2X6JA 1XGWA 3URZA 3OXLA 1A17A 2Y3AA 2I9CA 4YVQC 3LY9A 2WQ6A 1N52A 2IOLA 3QAQA 4ME2A 4FU3A 1NA0A 4KYOB 5ANRA 3G2VA 1H2VC 3P1UA 5D0OD 5FT9A 3LEWA 5LP0A 3FWVA 2WB2A 4NURA 4JVSA 3DPDA 4WNGA 3Q47B 3CVNA 2IF4A 1NP7A 3JCKC 2WQ7A 2CG3A 3LVQE 3PREA 3CHQA 4UQZA 4ILHB 4I1MA 4KZ0A 5M72A 3FTZA 3D9MA 4JA9A 4WNDA 3FUFA 4PH4B 2Y4UA 1QNFA 5DIZA 1PY1A 4ACLA 3ZYKA 3CVLA 4KVMA 4B94A 3MCXA 2MOWA 2PM6A 4JHKA 5JJ7A 1U3DA 3FTVA 2WM9A 5EX3A 3I5PA 4CDNA 3SF4A 2R59A 4KT6B 2AXVA 2L0TB 1KT0A 2WXLA 3UUXA 4KXKB 1P5QA 4CRWA 3L54A 3LS8A 4I17A 3ONLA 4GA1A 3FH8A 3FTUA 5G04C 3U66A 2FF4A 1XNFA 2XPIA 1BPOA 4GPKA 5HQ8A 3HDXA 5ENNA 3NZSA 5A7DB 3AS5A 4FHJA 3ONKA 3ZFWA 4UI9K 2WXIA 3JUIA 5LFAA 4U63A 4JA7A 4LEUA 3ZIMA 5JJTA 3BEEA 3CIAA 2I2OA 3D9PA 2V0PA 4ANXA 2UWJG 3IHVA 2KZTB 4BTAA 4JC8A 5AJLA 2VQ2A 3FUMA 4ACKA 2R5SA 4BWRA 1IYGA 3CLJA 4UWKA 5EKQD 3RO2A 3ZGQA 3CK9A 4GU5A 2CHXA 3MKQB 4HVBA 3KAEA 4URKA 3NQPA 2AW6A 5ARGA 2XHEA 1SZAA 4FA6A 3TAXA 2WXRA 3D9KA 4H7YA 2YHEA 3G2TA 4FHKA 5FQ6A 4B8CB 2V4LA 4WAFA 3FY4A 2DBAA 3HVEB 3FU0A 4AOFA 4AVXA 3PUJA 2KC7A 1DNPA 3PDNA 3CHOA 4GMJA 3LY8A 4F53A 1EYHA 2A4ZA 3G2UA 3S7JA 4A3TA 2XPZA 2L0IA 3CHSA 4J8FA 4K0RA 3FUHA 3PVLA 4DI3A 5KJKA 3OXGA 2YQ8A 3FTWA 3MKRA 5FQ8A 3SNXA 4F7AA 2I1JA 3CEQA 1YA0A 5G05C 3SD5A 4E6HA 5A6CA 1H2UA 2WVIA 4UQYA 5KJMA 3CVPA 2VGXB 4EQFA 2FULA 1WAO1 1OWPA 3MEKA 5JHBA 3CKCA 2XQ0A 5G04J 3ZEFA 4EECA 5FZSA 3RK6A 2AXZA 4I43A 3RKVA 5CCLA 2X6IA 3JQ1A 3UPVA 1H6KA 4IN3B 3L22A 4AM9A 1SQMA 1N54A 2XGSA 4GZ3A 3K9IA 3B13A 5D0QD 4OVVA 3L17A 3FUKA 3L6AA 3CHPA 3IBEA 3CSTA 3CSFA 2HYZA 4CGVA 5AJDA 5LCWJ 3R7QA 1JWGA 2FEZA 3FH7A 1VDYA 4FC8A 3UMVA 4BX8A 2UY1B 4G26A 1HFAA 4FJYA 4ILIA 1SZ9A 3QARA 4XZ4A 3CQGB 3PNTB 3RRUA 3LDZA 4Y6CA 2KCLA 4L2YA 1ELWA 3L16A 4DI4A 2KZTA 5J90A 2QY7A 4B8AA 3PUKA 3GZ2A 2KCVA 3L13A 4RG6A 5BW8C 3VTXA 4CDMA 4UQXA 5KJLA 3ZRHA 2DIWA 4UWGA 4APFA 1FVHA 3U9WA 4HOUA 2WXPA 3ML9A 4MKTA 3UT8A 2GRMA 2LAHA 3CK7A 1UN8A 3APFA 4CT4A 2WMNA 3U4TA 2IQCA 4AEZC 4I6JA 2CHZA 1JUQA 2X6FA 2YHCA 3VLFA 5T3RA 4AJWA 1HU3A 2X38A 4GZDA 3UX4A 4M3OA 3NF1A 4HOTA 2WMOA 1FVFA 2VGYA 3FUIA 3JQ0A 2RG8A 4BT8A 4GA2A 4HOQA 4XKBA 4DPRA 3CKBA 4GYOA 3MJWA 3QNKA 5FQ7A 4PS3A 5FZRA 2GW1A 4FLBA 1HS6A 4IYPA 3MKQA 3O48A 4FLHA 4GMLA 3ZHEB 4NACA 1X5BA 3BG1B 3D9LA 2VSXE 4K03A 4Q96A 4U8HA 3D3MA 3O4ZA 2LSUA 5DBKA 4JHJA 3FTYA 2V8SE 2X6HA 2J09A 4PUCA 4WWPA 2Y4TA 4J8EA 4WUYA 3S7FA 1H2TC 4F3VA 1E90A 3QB2A 2RD0A 4TUUA 3CR3A 3ENEA 3U64A 4CT0A 3VLEA 3ASGA 3KS2A 4MLPA 1HG2A 4OVUA 4XI0A 4YNDA 1HE8A 3TG5A 3SI5A 3TJPA 1DVPA 4HXIA 1ZBPA 3E4BA 2DCPA 1MHQA 3R9AB 4IULA 3FTXA 2XRYA 3QWPA 4GCNA 3RRNB 3AU5A 3PEUB 2GGFA 4GAAA 3TXMA 5LOZA 3ZXSA 4U0UA 5G05J 4RG9A 3I4GA 1HZ4A 4I6EA 2PZIA 1EF1C 3OXFA 3UT4A 2BF0X 1HF8A 2E2EA 2JLBA 4G11A 3TGOA 3SBTB 3CVYA 3S2AA 4WWNA 3ML8A 3FEYA 1B89A 4L7TA 1IHGA 3CHRA 3T5VA 4APOA 5LX8A 3I3NA 5AENA 1PAQA 3CV0A 3UT7A 1FCHA 3GW4A 1E7UA 1UJKA 4ABNA 3HHMA 3GYZA 4RVBA 2IU1A 3FUNA 3SGHA 5T4YA 3Q4AB 5BPPA 3HVEA 3SZ7A 2J9QA 5FTPA 3CVXA 3FULA 3L08A 1UG3A 3B7TA 1OWLA 2FBNA 1OWNA 3EHNA 4N3CA 3EHMA 4L23A 2FI7A 2AVPA 3PRZA 1TJCA 4N3BA 2XGOA 3FFLA 4GYWA 5ARFA 4I2WA 2WXKA 4J8SA 1EDUA 2WXOA 3JYSA 2P58C 3KEZA 4U0SA 2XEVA 1ELKA 3FU3A 1KLXA 3Q5MA 2A5UA 1TJFA 3P2BA 1WM5A 4KMOA 4A1GA 5LCWC 2KATA 3IV0A 1OUVA 5BV0A 4G25A 2I1KA 2CHWA 2KM4A 1QZ2A 5CHEE 3CGHA 1HH8A 2PM7A 3QKYA 4NQ0A 3C98A 4O6FA 4GA0A 2OVFA 1H19A 2CFUA 2IFUA 3NZUA 3QWVA 4QFVA 5FWQA 4FULA 5CMYA 1PC2A 3ZVVA 3PH0C 4N2QA 4FJZA 2C2LA 2EQXA 3CVWA 4BTBA 4BFRA 2LSVA 3TXNA 5E75A 4EPZA 4B89A 4KZCA 2I6HA 3LPZA 3SFZA 4E85A 2VJ8A 3GZ1A 3FDHA 3DBSA 3GZSA 3MV2B 3S7DA 1WY6A 4JHRA 4W9RA 4XX5A 2VYIA 4EZKA 2MRIA 3ASHA 4L1BA 4IRUA 4CGWA 1QQEA 3LY7A 3RJVA 2XCCA 4C0EA 3CVUA 4UI9C 1KT1A 2E0IA 1INZA 3PS6A 4NRHB 4EZLA 4WNEA 2LO6A 4KBQA 4MS6A 4GZ6A 4JEUA 3MV3B 1JPLA 3FU5A 1Z3XA 3EJNA 5JHAA 3PE4A 4I6GA 5C2YA 4I1OB 3PE3A 4R7LA 4I9EA 3I4RB 3MA5A 3QWWA 2VSOE 3T8MA 3ZW3A 1NZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUN U;  1H2U A;  2RG8 A;  1PAQ A;  4C9B B;  2NSZ A;  2FUL A;  2KZT A;  2IU1 A;  3EIJ A;  4B8C B;  4B8A A;  4GML A;  3JUI A;  3EIQ C;  4IUL A;  3RK6 A;  1UG3 A;  4CEM A;  2VSX E;  1H6K A;  2GGF A;  1UW4 B;  2IOL A;  1N52 A;  1N54 A;  3D3M A;  4GMJ A;  2I2O A;  2ZU6 B;  4JHJ A;  4JHK A;  5ANR A;  4CT4 A;  2KZT B;  1H2V C;  2ION A;  3L6A A;  2IOS A;  3FEY A;  1HU3 A;  1H2T C;  4B89 A;  2HM8 A;  2VSO E;  4CRW A;  3FEX A; 
#chains in the Genus database with same CATH topology
 2XS1 A;  4ILG A;  4G24 A;  3PEV B;  3FP3 A;  2J49 A;  2L6J A;  5T8I A;  3AAA C;  3RSE G;  1D8E A;  3LVR E;  4DJA A;  1E8Z A;  4UWL A;  1FT2 A;  1U2V G;  4J8D A;  2WXF A;  5A23 A;  4GYY A;  4JL0 A;  5C1D A;  3MZL B;  3B7B A;  2R17 C;  1JWF A;  4U0Z A;  3KSQ A;  2HM8 A;  3FEX A;  3RAU A;  4F1S A;  1S64 A;  2M63 A;  2H6F A;  5EIB E;  3CQC B;  4F6R D;  3Q15 A;  1K1B A;  1W3B A;  3AU4 A;  2C0M A;  1OY3 D;  2VGE A;  2BED A;  2VSY A;  3OAW A;  2L9B A;  3Q79 A;  3ESK A;  3L82 A;  3CHM A;  3SQV A;  1ELR A;  3MYV A;  4EBA A;  3KSL A;  3LJ3 A;  4MRU A;  4HS2 A;  3F6Q A;  2LXL A;  5B1A E;  4AIF A;  5BNW A;  5JJ6 A;  4G8K A;  5ENO D;  4ANV A;  3TWS A;  4AY5 A;  4C9B B;  1DCE A;  1V54 E;  2WXG A;  4ATG A;  3TWU A;  1HX8 A;  1E7V A;  3KD7 A;  4G1T A;  4HOS A;  4PDX A;  3ZYM A;  3B7S A;  2DYS E;  5CED B;  4ZFH A;  2WPV A;  2AWI A;  4LCT A;  3EDT B;  3QDN A;  5AQB A;  4O1P A;  1Y6I A;  1E8Y A;  2OV8 A;  5ITZ F;  3URZ A;  3OXL A;  2I9C A;  3LY9 A;  5ANR A;  3R9M A;  3G2V A;  5LP0 A;  1H2V C;  5FT9 A;  3LEW A;  5EIL A;  4NUR A;  4ZHB A;  4GTM A;  2IF4 A;  1LD8 A;  2CG3 A;  1TNO A;  4RQI A;  3FTZ A;  4JA9 A;  3FUF A;  2Y4U A;  1PY1 A;  3ZYK A;  2MOW A;  4JHK A;  3FTV A;  5EX3 A;  4CDN A;  3SF4 A;  2L0T B;  5AN8 A;  2EIK E;  4KXK B;  1P5Q A;  4CRW A;  4I17 A;  4DUI A;  5G04 C;  2FF4 A;  1BPO A;  5HQ8 A;  3HDX A;  5FIN A;  5ENN A;  5LFA A;  5EYP F;  5JJT A;  3BEE A;  2UWJ G;  5AJL A;  2VQ2 A;  2XEN A;  4J8Y A;  4G8L A;  4UWK A;  5EKQ D;  3RO2 A;  2CHX A;  3MKQ B;  4GTQ A;  4BET A;  3KAE A;  3JUE A;  1SZA A;  3D9K A;  5AAR A;  3G2T A;  5FQ6 A;  2P2C P;  2V4L A;  3FU0 A;  4AVX A;  3PUJ A;  3CHO A;  2A4Z A;  4A3T A;  2XPZ A;  3CHS A;  5KJK A;  2P9S G;  4LNG A;  2YQ8 A;  4K5B A;  4F7A A;  2I1J A;  5G05 C;  3SD5 A;  4DRX E;  2WVI A;  5KJM A;  3MEK A;  2XQ0 A;  3HRA A;  3ZEF A;  3UPV A;  2AXZ A;  2H6H A;  1H6K A;  4AM9 A;  1SQM A;  2XGS A;  5D0Q D;  4A63 B;  3L17 A;  2F8X K;  4BX8 A;  4G26 A;  4GTO A;  1HFA A;  4FJY A;  1OXJ A;  4BSZ B;  2QY7 A;  3PUK A;  4CDM A;  5KJL A;  3Q78 A;  2DIW A;  4HOU A;  2GRM A;  2WMN A;  4HB5 A;  4I6J A;  1WG0 A;  5T3R A;  3NF1 A;  1FVF A;  4HBD A;  3FUI A;  2F37 A;  4DPR A;  3QNK A;  5FQ7 A;  5FZR A;  2GW1 A;  3ZHE B;  4GML A;  4NAC A;  3BG1 B;  5ENQ D;  4K03 A;  3D3M A;  3JXJ A;  3PZ2 A;  4PUC A;  2Y4T A;  1H2T C;  2OEV A;  1E90 A;  2RD0 A;  3ENE A;  3UXG A;  5AAO A;  3TG5 A;  3TWX A;  3E4B A;  4YDW A;  3RRN B;  3AU5 A;  4GAA A;  1HZ4 A;  2EIJ E;  2PZI A;  3OXF A;  3NAW A;  3ML8 A;  3T5V A;  4APO A;  3J5P A;  3CV0 A;  3UT7 A;  3T9K A;  2LUH A;  5AQ7 A;  4RVB A;  3GYZ A;  3ULE G;  3ZU7 B;  5B3S E;  3ZKJ A;  3HVE A;  3SZ7 A;  2J9Q A;  1V55 E;  3FUL A;  3L08 A;  1OWL A;  4N3B A;  2XGO A;  3DEP A;  4HLL A;  3JYS A;  3KEZ A;  2XEV A;  3FU3 A;  3Q5M A;  1TJF A;  3P2B A;  4A1G A;  4LSZ E;  3IV0 A;  4G25 A;  4C48 B;  2CHW A;  2KM4 A;  3NB2 A;  5CHE E;  1JCS A;  2PM7 A;  3UM3 A;  3UIO C;  4O6F A;  2OVF A;  2CFU A;  1PC2 A;  2C2L A;  3V2O A;  3CVW A;  5CRU A;  2I6H A;  4LG6 A;  3FDH A;  3GZS A;  3S7D A;  4JHR A;  4XX5 A;  2VYI A;  2R2L A;  4GTR A;  3C3Q A;  2XCC A;  2Y69 E;  3PS6 A;  4J7W A;  4EZL A;  4GZ6 A;  4JEU A;  3FU5 A;  3EJN A;  4RLY A;  2ZGG A;  3PE4 A;  4I9E A;  3I4R B;  3T8M A;  4U95 D;  3LKU A;  2WXQ A;  4L2L A;  4P29 A;  1FPP A;  2XPY A;  2KCK A;  3APD A;  2H6I A;  1MZC A;  3FUJ A;  5FIO A;  4PS7 A;  2PL2 A;  2OCC E;  3T5X A;  2OVB A;  4N5C A;  3IHY A;  4I9C A;  4WWO A;  4TRQ A;  2XGM A;  3V79 K;  2CG2 A;  4YVO A;  1HO8 A;  4HLE A;  4BER A;  5FJY A;  3LXU X;  5AYW D;  2ZIR A;  2VGX A;  4CEM A;  1HXI A;  4ANW A;  2MHK A;  1OWM A;  3BG0 B;  3FUD A;  5AIJ A;  3LYA A;  4KVO A;  2V5Q C;  2EIL E;  2J4B A;  4U07 A;  5CBN A;  2WXN A;  4DX7 D;  3CK8 A;  2YNQ A;  4FAD A;  4B0Z A;  3ZN3 A;  3D9N A;  4GCO A;  1S63 A;  3QJZ A;  3DRA A;  3ZPJ A;  4O60 A;  2BUG A;  2ZU6 B;  5KCM A;  2ETB A;  3ZYL A;  4JW1 A;  3RIB A;  1TEZ A;  5EYL A;  1U3C A;  3DWL G;  1MQS A;  4N2S A;  5EID A;  2ZGD A;  1OCZ E;  2DYR E;  3ABL E;  2NSZ A;  4TV3 A;  3EIJ A;  2WXH A;  4AP2 A;  2WXM A;  1NI1 A;  4JZY A;  3AG2 E;  3ZHE A;  3OTN A;  4UI9 J;  3LCA A;  1KZP A;  1E96 B;  5BUZ A;  2QZA A;  3MGB A;  3NOC D;  2BKK B;  3FH5 A;  2GRQ B;  4N3A A;  3HYM B;  3AG1 E;  1TNB A;  3LJN A;  4DX2 A;  3WXX A;  1E8W A;  3KEA A;  4GB9 A;  5FZQ A;  4TUM A;  4Q69 A;  5J08 A;  2Q7F A;  4UWH A;  4I2Z A;  1UJJ A;  3FU6 A;  2PNN A;  4A55 A;  2R05 A;  3AS8 A;  4WNF A;  2X6J A;  2Y3A A;  2WQ6 A;  3JXI A;  4ME2 A;  4TXR A;  4KYO B;  3PZ4 A;  4YDE A;  5D0O D;  4JVS A;  3Q47 B;  3CVN A;  3PRE A;  2J8S D;  2P9U G;  3D9M A;  4PH4 B;  4ACL A;  4B94 A;  3MCX A;  1U3D A;  2WM9 A;  1MJ0 A;  4KT6 B;  1KT0 A;  1KZO A;  3UUX A;  3LS8 A;  3ONL A;  4HI9 A;  3U66 A;  4GPK A;  4U63 A;  4JA7 A;  5KWD A;  4LEU A;  4DX6 D;  3ZIM A;  3HG0 D;  3CIA A;  1SW6 A;  2KZT B;  4BTA A;  4JC8 A;  4ACK A;  4JD2 G;  4BWR A;  1IYG A;  4HVB A;  2RFA A;  4HRL A;  5ARG A;  4FA6 A;  3DSX A;  4FHK A;  3FY4 A;  2DBA A;  2KC7 A;  2KXP C;  1TNY A;  2B0O E;  3LY8 A;  3G2U A;  4BEP A;  1N9A A;  2L0I A;  4J8F A;  3HXF A;  4K0R A;  3OXG A;  3UI2 A;  4EQF A;  1MX2 A;  1WAO 1;  1OWP A;  4EEC A;  5FZS A;  4I43 A;  2X6I A;  3B13 A;  4OVV A;  3UM0 A;  3E32 A;  3CHP A;  3NBN B;  3IXE A;  3CSF A;  2HYZ A;  4CGV A;  5AJD A;  5LCW J;  4TXP A;  3UMV A;  1TR4 A;  1BD8 A;  3J5Q B;  1SZ9 A;  4XZ4 A;  3PNT B;  3LDZ A;  4Y6C A;  3L16 A;  4RG6 A;  3GZ2 A;  2DZO A;  2KCV A;  4APF A;  4MKT A;  2LAH A;  3U4T A;  4EHM A;  2CHZ A;  2X6F A;  3VLF A;  3ZUV B;  4AJW A;  4GZD A;  2QYU A;  4XEI G;  2RG8 A;  3HXB A;  4HOQ A;  4XKB A;  1H6P A;  4GYO A;  4FLH A;  3SFY A;  4Q96 A;  3O4Z A;  3FTY A;  3B95 A;  1OCO E;  2GRN B;  3V30 A;  2MYO A;  3S7F A;  4F3V A;  3QB2 A;  4TUU A;  3CR3 A;  3ASG A;  4GMR A;  3KS2 A;  4MLP A;  1HG2 A;  1HE8 A;  3TJP A;  2EIM E;  1MHQ A;  4IUL A;  3FTX A;  2XRY A;  3TXM A;  5G05 J;  3I4G A;  4I6E A;  1EF1 C;  3BQO A;  3BU8 A;  2E2E A;  2JLB A;  3C3R A;  3S2A A;  4WWN A;  1B89 A;  5LX8 A;  3GW4 A;  3SFX A;  2IU1 A;  3FUN A;  5BPP A;  3TWQ A;  4K5C A;  5FTP A;  2FI7 A;  2AVP A;  4GYW A;  5ARF A;  2P58 C;  4Z68 A;  1OCC E;  2F0Y A;  4U0S A;  1RZ4 A;  1KLX A;  3Q9U C;  5BV0 A;  5KNG A;  1NL4 A;  3EHQ A;  4NQ0 A;  3C98 A;  3DSV A;  3NZU A;  1H19 A;  3QWV A;  4FUL A;  3ZVV A;  4N2Q A;  5E75 A;  4U8Y D;  3DXM G;  3MV2 B;  4EZK A;  2MRI A;  3ASH A;  4L1B A;  4IRU A;  1QQE A;  3LY7 A;  5B1B E;  4MS6 A;  4B93 B;  3WG7 E;  5JHA A;  4I6G A;  4I1O B;  3DST A;  1NZN A;  1NA3 A;  4XI9 A;  3G2S A;  5CEC B;  3RO3 A;  5ANL A;  2NXP A;  3Q49 B;  1LF8 A;  2J4D A;  3ABK E;  4EBA G;  2P9N G;  4OYS A;  2IO2 C;  4DK5 A;  3UM2 A;  3B7R L;  4U04 A;  5FQ4 A;  1GW6 A;  3UQ3 A;  2X6K A;  2OOE A;  1TN7 A;  4H7X A;  4J0U A;  2LNI A;  4GZ5 A;  1OCR E;  3EU5 A;  3U3W A;  3E34 A;  3ASD A;  5HKP A;  4BT9 A;  4A1S A;  4U8V D;  4BY6 A;  3UIN C;  2IOS A;  2XEH A;  3N71 A;  4DX5 D;  4LRZ A;  1IQR A;  2P9L G;  3IEG A;  3Q7F A;  4BX9 A;  4V3I A;  4UWF A;  3DXK G;  3ISM C;  4LER A;  3HIZ A;  2IJG X;  2PQN A;  1HG5 A;  4HFG A;  2P9K G;  3B7U X;  1Y8M A;  2V5F A;  4K5A B;  4JEH A;  2GRL A;  2VSN A;  2LAI A;  2ION A;  3ASO E;  3APC A;  1Z3Y A;  5E76 A;  3TWV A;  4FP7 A;  4UUC A;  3ESL A;  4RSY A;  3ASN E;  4AY6 A;  1UW4 B;  3PZD A;  1Z6T A;  3ZXP A;  1S0P A;  2RFM A;  3SBS A;  5KNH D;  3DPY A;  3ASF A;  1OT8 A;  2FO7 A;  2XS8 A;  4GZC A;  3ABM E;  2BTD A;  4DLQ A;  1N0R A;  2PQR A;  2B6C A;  5BV1 A;  2X3M A;  4J6I A;  2J08 A;  3TG4 A;  2QFC A;  5KJN A;  1IQU A;  4XE0 A;  2HR2 A;  3AG3 E;  4A3V A;  2RKK A;  4JPS A;  3D9I A;  3PZ3 A;  5HI7 A;  4I1A A;  1LD7 A;  3D9O A;  2A5E A;  2HE0 A;  3HXE A;  2IO3 C;  4FU3 A;  4MBG A;  1TNZ A;  3P1U A;  2WB2 A;  2GRO B;  3FWV A;  3DPD A;  4WNG A;  5EN5 D;  1NP7 A;  2WQ7 A;  3LVQ E;  4UQZ A;  4ILH B;  4I1M A;  4KZ0 A;  4F1P A;  5M72 A;  4WND A;  2Y1L E;  3CVL A;  5ENT D;  4KVM A;  1TN8 A;  2XZT G;  5JJ7 A;  2AXV A;  2WXL A;  4U96 D;  4BES A;  2IEJ A;  2P9P G;  2XPI A;  1NFI E;  5A7D B;  1O1R A;  4FHJ A;  4GPM A;  4UI9 K;  1N4Q A;  2H6G A;  4ANX A;  2V0P A;  1SVX A;  2R5S A;  3CLJ A;  3ZGQ A;  2AJA A;  3CK9 A;  4GU5 A;  1JCQ A;  2R03 A;  4URK A;  3NQP A;  2AW6 A;  2ZXW E;  3DSS A;  2XHE A;  3V31 A;  3TAX A;  2WXR A;  4H7Y A;  3HVE B;  1DNP A;  1RW2 A;  4F53 A;  1EYH A;  3S7J A;  4HQD A;  4ATZ D;  4M7C A;  4DI3 A;  3FTW A;  3SNX A;  3MKR A;  5FQ8 A;  3CEQ A;  1YA0 A;  4E6H A;  3CVP A;  5KBA A;  5H7P A;  1BI8 B;  5JHB A;  1TYQ G;  4N5Q A;  1AWC B;  3CKC A;  4HRM B;  3RK6 A;  3JQ1 A;  4IN3 B;  1YCS B;  4GZ3 A;  1AP7 A;  5CRV A;  4DX1 A;  3R7Q A;  4FC8 A;  1VDY A;  3TWT A;  2XZD G;  3QAR A;  2Y0B G;  4L9P A;  2KCL A;  4L2Y A;  3UKR G;  1ELW A;  5J90 A;  2KZT A;  1UOH A;  3VTX A;  3L13 A;  4UQX A;  2P9I G;  3ML9 A;  3UT8 A;  1UN8 A;  1JUQ A;  2X38 A;  1K8K G;  3UX4 A;  2FO1 E;  2VGY A;  3JQ0 A;  4GA2 A;  3C3O A;  3CKB A;  4PS3 A;  1Z5S C;  4OAV B;  4IYP A;  5D66 A;  3MKQ A;  1Q2Z A;  1X5B A;  1DC2 A;  2VSX E;  4HI8 A;  4U8H A;  2QC9 A;  5JMN D;  2V8S E;  2X6H A;  2J09 A;  4JB8 P;  4J8E A;  4WUY A;  2ETA A;  4CT0 A;  3U64 A;  2ZIS A;  4XI0 A;  3E33 A;  4HXI A;  2DCP A;  1IXV A;  3QWP A;  3DEO A;  4U0U A;  4RG9 A;  3UT4 A;  2BF0 X;  1HF8 A;  4G11 A;  3SBT B;  3Q7A A;  3FEY A;  2DVW A;  3W9F A;  3CHR A;  2NYJ A;  1FCH A;  1N4P A;  1UJK A;  3HHM A;  1MX4 A;  3SGH A;  5T4Y A;  2DWZ A;  1D9S A;  4HRN A;  3CVX A;  3B7T A;  2FBN A;  3EHN A;  1OWN A;  3PRZ A;  1TJC A;  3FFL A;  4J8S A;  1EDU A;  2WXO A;  1ELK A;  4TXQ A;  3E37 A;  2V4H C;  3ZNG A;  2KAT A;  1OUV A;  2I1K A;  1BU9 A;  1N94 A;  3CGH A;  3NOG D;  3QKY A;  1G3N B;  4GA0 A;  4QFV A;  1WDY A;  2IFU A;  5CMY A;  3PH0 C;  4FJZ A;  3Q73 A;  4BTB A;  2LSV A;  3LPZ A;  3SFZ A;  3GZ1 A;  1WY6 A;  4W9R A;  5ENS D;  3RJV A;  2XEE A;  2IY0 C;  4C0E A;  3CVU A;  2E0I A;  1N11 A;  4KBQ A;  1FT1 A;  1Z3X A;  5C2Y A;  3PE3 A;  3C5R A;  3QWW A;  2VSO E;  4U7E B;  2GRP B;  4EZJ A;  1TN6 A;  3G2W A;  3UM1 A;  5CBO A;  2DZN A;  4AXH A;  4AV7 A;  2JEK A;  3ZYQ A;  4G2V A;  4N39 A;  2VTB B;  4XIF A;  3FTS A;  3TWW A;  2ILR A;  3CVV A;  3TWR A;  3SHF A;  3QK0 A;  2OEW A;  3QC1 A;  1K1A A;  1UN9 A;  1E8X A;  2AXU A;  2UY1 A;  4PS8 A;  3ULQ A;  2OND A;  4D10 C;  5CMW A;  1MX6 A;  4Q94 A;  3EU9 A;  4GTV A;  4XKC A;  3RRM B;  4ANU A;  4X8Q A;  1H6O A;  3EIQ C;  1SA5 A;  1QYM A;  4JXT A;  1OWO A;  1ZU2 A;  1EPU A;  1N4R A;  4HOR A;  3FUE A;  3D9J A;  1IHB A;  5AQ9 A;  5EDS A;  3W9G A;  2WXJ A;  3RU0 A;  2XRZ A;  3PNL B;  4BSX A;  3X2Q E;  2YIN A;  4LNB A;  2J07 A;  3R7R A;  1H0A A;  1O1T A;  5CER B;  4CDR A;  1YYH A;  3AS4 A;  5EX0 A;  5G2N A;  4C0M A;  2WQH A;  3QOU A;  5BT1 A;  5G55 A;  1N95 A;  4DLO A;  5HS0 A;  3MX3 A;  3S7B A;  1L5J A;  2GRR B;  4G23 A;  4CCA A;  2NC9 A;  2C0L A;  3DSU A;  5CCM A;  3TL5 A;  3VLD A;  2VTB A;  4Y6W A;  3VTY A;  5IY5 E;  2XCB A;  3IKO B;  3FHE A;  4LUN U;  5ENP D;  3HXD A;  5D2M C;  2CFZ A;  2HO1 A;  3CVQ A;  1XGW A;  1A17 A;  4YVQ C;  1N52 A;  2IOL A;  3QAQ A;  1NA0 A;  3SO8 A;  4GTT A;  4GTP A;  3JCK C;  3CHQ A;  5DIZ A;  1QNF A;  2QYJ A;  2PM6 A;  3I5P A;  2R59 A;  1X81 A;  4QQI A;  1A5E A;  3L54 A;  4GA1 A;  3FH8 A;  3FTU A;  1N4S A;  1XNF A;  3NZS A;  3AS5 A;  3ONK A;  3ZFW A;  2WXI A;  3JUI A;  1BLX B;  3D9H A;  2I2O A;  3D9P A;  5HRY A;  3IHV A;  4YDY A;  3FUM A;  1ZB1 A;  2L6B A;  2YHE A;  3PZ1 A;  4B8C B;  4WAF A;  4AOF A;  2LXM A;  1IKN D;  3PDN A;  4GMJ A;  3SY2 A;  1N0Q A;  1YMP A;  1MYO A;  3FUH A;  3PVL A;  3ULY A;  5A6C A;  1H2U A;  4UQY A;  2VGX B;  4NIK A;  2FUL A;  3Q9N C;  3C72 A;  2BKG A;  5G04 J;  4OAU C;  3RKV A;  5CCL A;  3L22 A;  1N54 A;  3K9I A;  3EUV A;  3FUK A;  3L6A A;  3IBE A;  3CST A;  3BUA A;  1JWG A;  2FEZ A;  3FH7 A;  2EIN E;  2UY1 B;  5JA4 D;  3L9T A;  4ILI A;  1O5M A;  3RRU A;  3CQG B;  1QBQ A;  4GTS A;  4DI4 A;  1KPS B;  4B8A A;  5BW8 C;  5BXO A;  3ZRH A;  3T8K A;  3UIP C;  4UWG A;  1SA4 A;  1FVH A;  3U9W A;  2WXP A;  3CK7 A;  3APF A;  4CT4 A;  2IQC A;  4AEZ C;  2YHC A;  3UTM A;  2R02 A;  1HU3 A;  4M3O A;  4HOT A;  2WMO A;  4CZ2 D;  3HXC A;  4HNA D;  4BT8 A;  3MJW A;  4FLB A;  1HS6 A;  3O48 A;  2ETC A;  1K3Z D;  3D9L A;  2LSU A;  5DBK A;  4JHJ A;  3AG4 E;  3E30 A;  4WWP A;  3VLE A;  4OVU A;  4YND A;  3SI5 A;  1S70 B;  1DVP A;  1ZBP A;  3R9A B;  4GCN A;  3PEU B;  2GGF A;  5LOZ A;  3ZXS A;  2F8Y A;  1O1S A;  3CVY A;  3TGO A;  4L7T A;  1LTX A;  1JCR A;  1IHG A;  4CYM D;  3I3N A;  5AEN A;  1PAQ A;  1E7U A;  4ABN A;  3Q4A B;  1UG3 A;  5AQA A;  4LNU D;  4N3C A;  3EHM A;  4L23 A;  4YDO A;  3UKU G;  4I2W A;  2WXK A;  1DCQ A;  2A5U A;  4KMO A;  1WM5 A;  5LCW C;  5BXU A;  1QZ2 A;  1TNU A;  1HH8 A;  5ENR D;  5FWQ A;  3DSW A;  3Q75 A;  5CEA A;  2KBX A;  2EQX A;  4BFR A;  3TXN A;  4EPZ A;  4B89 A;  4KZC A;  4E85 A;  3EHR A;  2VJ8 A;  4O1O A;  3DBS A;  2JAB A;  4CGW A;  3AJI A;  4UI9 C;  1KT1 A;  3V2X A;  1INZ A;  4NRH B;  4WNE A;  2LO6 A;  3MV3 B;  1JPL A;  1BI7 B;  1D8D A;  4R7L A;  3MA5 A;  3ZW3 A; 
#chains in the Genus database with same CATH homology
 1NA3 A;  4EZJ A;  4ILG A;  3G2W A;  3LKU A;  4XI9 A;  3G2S A;  4G24 A;  2WXQ A;  4L2L A;  4P29 A;  2XPY A;  3APD A;  2KCK A;  3PEV B;  3FP3 A;  2J49 A;  3RO3 A;  5ANL A;  4AXH A;  3FUJ A;  4AV7 A;  2NXP A;  2JEK A;  2L6J A;  5T8I A;  4PS7 A;  3ZYQ A;  3Q49 B;  2PL2 A;  1LF8 A;  3T5X A;  2J4D A;  2OVB A;  4N5C A;  3IHY A;  4I9C A;  4OYS A;  4WWO A;  4EBA G;  4G2V A;  4TRQ A;  4N39 A;  2XGM A;  4DK5 A;  2VTB B;  3LVR E;  4DJA A;  1E8Z A;  4UWL A;  3B7R L;  4XIF A;  4U04 A;  5FQ4 A;  1GW6 A;  3UQ3 A;  2X6K A;  2CG2 A;  4YVO A;  1HO8 A;  2OOE A;  4H7X A;  4J8D A;  4J0U A;  2LNI A;  4GZ5 A;  4HLE A;  2WXF A;  3FTS A;  5A23 A;  3CVV A;  2ILR A;  5FJY A;  4GYY A;  3U3W A;  3LXU X;  4JL0 A;  3SHF A;  5AYW D;  3ASD A;  4BT9 A;  4A1S A;  3QK0 A;  5C1D A;  2VGX A;  3MZL B;  3QC1 A;  4CEM A;  1HXI A;  4BY6 A;  4ANW A;  1UN9 A;  2MHK A;  1E8X A;  1OWM A;  2AXU A;  2UY1 A;  3BG0 B;  3FUD A;  2IOS A;  3N71 A;  4PS8 A;  2R17 C;  3ULQ A;  4LRZ A;  1JWF A;  5AIJ A;  4U0Z A;  2OND A;  3LYA A;  4KVO A;  1IQR A;  2J4B A;  3IEG A;  4D10 C;  2HM8 A;  4U07 A;  5CMW A;  3FEX A;  4BX9 A;  4V3I A;  4Q94 A;  2WXN A;  4UWF A;  4XKC A;  4F1S A;  3CK8 A;  2YNQ A;  4FAD A;  4LER A;  2M63 A;  3HIZ A;  3RRM B;  4B0Z A;  4ANU A;  3ZN3 A;  2IJG X;  2PQN A;  1HG5 A;  4HFG A;  3D9N A;  4GCO A;  3EIQ C;  3QJZ A;  4JXT A;  3B7U X;  1Y8M A;  2V5F A;  4JEH A;  1OWO A;  2GRL A;  3CQC B;  3ZPJ A;  1ZU2 A;  1EPU A;  2BUG A;  3Q15 A;  2VSN A;  4HOR A;  2ZU6 B;  3FUE A;  1W3B A;  2LAI A;  2ION A;  3D9J A;  3AU4 A;  5KCM A;  3ZYL A;  4JW1 A;  2C0M A;  3RIB A;  1TEZ A;  1U3C A;  3APC A;  1Z3Y A;  1MQS A;  5E76 A;  5EDS A;  2WXJ A;  3RU0 A;  4N2S A;  2XRZ A;  2VSY A;  3OAW A;  4FP7 A;  3PNL B;  2L9B A;  2NSZ A;  4BSX A;  4TV3 A;  3EIJ A;  3ESK A;  2YIN A;  2J07 A;  2WXH A;  3R7R A;  1H0A A;  3ESL A;  4AP2 A;  3CHM A;  2WXM A;  4RSY A;  4AY6 A;  4CDR A;  1UW4 B;  3PZD A;  4JZY A;  1Z6T A;  1ELR A;  1S0P A;  3MYV A;  3SBS A;  4EBA A;  3ZHE A;  3AS4 A;  3LJ3 A;  3OTN A;  4MRU A;  5EX0 A;  4UI9 J;  3LCA A;  5G2N A;  3ASF A;  4HS2 A;  2FO7 A;  4C0M A;  2WQH A;  1E96 B;  3QOU A;  5BUZ A;  4AIF A;  4GZC A;  5BT1 A;  5G55 A;  4DLO A;  3MGB A;  5BNW A;  5JJ6 A;  3FH5 A;  3MX3 A;  4ANV A;  4N3A A;  3HYM B;  3S7B A;  1L5J A;  4AY5 A;  4G23 A;  4C9B B;  2BTD A;  2WXG A;  4CCA A;  4DLQ A;  2NC9 A;  4ATG A;  3WXX A;  2C0L A;  1E8W A;  1HX8 A;  1E7V A;  2PQR A;  5CCM A;  3TL5 A;  5BV1 A;  3KD7 A;  2X3M A;  4J6I A;  2J08 A;  4G1T A;  4HOS A;  3TG4 A;  4PDX A;  3ZYM A;  2QFC A;  5KJN A;  4GB9 A;  3VLD A;  2VTB A;  3B7S A;  5FZQ A;  1IQU A;  4Y6W A;  4XE0 A;  2HR2 A;  4Q69 A;  4A3V A;  3VTY A;  5J08 A;  2WPV A;  2AWI A;  2XCB A;  3EDT B;  2Q7F A;  3IKO B;  4LCT A;  3FHE A;  3QDN A;  4JPS A;  4LUN U;  4UWH A;  4I2Z A;  3D9I A;  1Y6I A;  1UJJ A;  3FU6 A;  2CFZ A;  4A55 A;  3AS8 A;  5HI7 A;  1E8Y A;  2OV8 A;  4I1A A;  4WNF A;  2HO1 A;  3D9O A;  3CVQ A;  2X6J A;  1XGW A;  3URZ A;  3OXL A;  1A17 A;  2Y3A A;  2I9C A;  4YVQ C;  3LY9 A;  2WQ6 A;  1N52 A;  2IOL A;  3QAQ A;  4ME2 A;  4FU3 A;  1NA0 A;  4KYO B;  5ANR A;  3G2V A;  1H2V C;  3P1U A;  5D0O D;  5FT9 A;  3LEW A;  5LP0 A;  3FWV A;  2WB2 A;  4NUR A;  4JVS A;  3DPD A;  4WNG A;  3Q47 B;  3CVN A;  2IF4 A;  1NP7 A;  3JCK C;  2WQ7 A;  2CG3 A;  3LVQ E;  3PRE A;  3CHQ A;  4UQZ A;  4ILH B;  4I1M A;  4KZ0 A;  5M72 A;  3FTZ A;  3D9M A;  4JA9 A;  4WND A;  3FUF A;  4PH4 B;  2Y4U A;  1QNF A;  5DIZ A;  1PY1 A;  4ACL A;  3ZYK A;  3CVL A;  4KVM A;  4B94 A;  3MCX A;  2MOW A;  2PM6 A;  4JHK A;  5JJ7 A;  1U3D A;  3FTV A;  2WM9 A;  5EX3 A;  3I5P A;  4CDN A;  3SF4 A;  2R59 A;  4KT6 B;  2AXV A;  2L0T B;  1KT0 A;  2WXL A;  3UUX A;  4KXK B;  1P5Q A;  4CRW A;  3L54 A;  3LS8 A;  4I17 A;  3ONL A;  4GA1 A;  3FH8 A;  3FTU A;  5G04 C;  3U66 A;  2FF4 A;  1XNF A;  2XPI A;  1BPO A;  4GPK A;  5HQ8 A;  3HDX A;  5ENN A;  3NZS A;  5A7D B;  3AS5 A;  4FHJ A;  3ONK A;  3ZFW A;  4UI9 K;  2WXI A;  3JUI A;  5LFA A;  4U63 A;  4JA7 A;  4LEU A;  3ZIM A;  5JJT A;  3BEE A;  3CIA A;  2I2O A;  3D9P A;  2V0P A;  4ANX A;  2UWJ G;  3IHV A;  2KZT B;  4BTA A;  4JC8 A;  5AJL A;  2VQ2 A;  3FUM A;  4ACK A;  2R5S A;  4BWR A;  1IYG A;  3CLJ A;  4UWK A;  5EKQ D;  3RO2 A;  3ZGQ A;  3CK9 A;  4GU5 A;  2CHX A;  3MKQ B;  4HVB A;  3KAE A;  4URK A;  3NQP A;  2AW6 A;  5ARG A;  2XHE A;  1SZA A;  4FA6 A;  3TAX A;  2WXR A;  3D9K A;  4H7Y A;  2YHE A;  3G2T A;  4FHK A;  5FQ6 A;  4B8C B;  2V4L A;  4WAF A;  3FY4 A;  2DBA A;  3HVE B;  3FU0 A;  4AOF A;  4AVX A;  3PUJ A;  2KC7 A;  1DNP A;  3PDN A;  3CHO A;  4GMJ A;  3LY8 A;  4F53 A;  1EYH A;  2A4Z A;  3G2U A;  3S7J A;  4A3T A;  2XPZ A;  2L0I A;  3CHS A;  4J8F A;  4K0R A;  3FUH A;  3PVL A;  4DI3 A;  5KJK A;  3OXG A;  2YQ8 A;  3FTW A;  3MKR A;  5FQ8 A;  3SNX A;  4F7A A;  2I1J A;  3CEQ A;  1YA0 A;  5G05 C;  3SD5 A;  4E6H A;  5A6C A;  1H2U A;  2WVI A;  4UQY A;  5KJM A;  3CVP A;  2VGX B;  4EQF A;  2FUL A;  1WAO 1;  1OWP A;  3MEK A;  5JHB A;  3CKC A;  2XQ0 A;  5G04 J;  3ZEF A;  4EEC A;  5FZS A;  3RK6 A;  2AXZ A;  4I43 A;  3RKV A;  5CCL A;  2X6I A;  3JQ1 A;  3UPV A;  1H6K A;  4IN3 B;  3L22 A;  4AM9 A;  1SQM A;  1N54 A;  2XGS A;  4GZ3 A;  3K9I A;  3B13 A;  5D0Q D;  4OVV A;  3L17 A;  3FUK A;  3L6A A;  3CHP A;  3IBE A;  3CST A;  3CSF A;  2HYZ A;  4CGV A;  5AJD A;  5LCW J;  3R7Q A;  1JWG A;  2FEZ A;  3FH7 A;  1VDY A;  4FC8 A;  3UMV A;  4BX8 A;  2UY1 B;  4G26 A;  1HFA A;  4FJY A;  4ILI A;  1SZ9 A;  3QAR A;  4XZ4 A;  3CQG B;  3PNT B;  3RRU A;  3LDZ A;  4Y6C A;  2KCL A;  4L2Y A;  1ELW A;  3L16 A;  4DI4 A;  2KZT A;  5J90 A;  2QY7 A;  4B8A A;  3PUK A;  3GZ2 A;  2KCV A;  3L13 A;  4RG6 A;  5BW8 C;  3VTX A;  4CDM A;  4UQX A;  5KJL A;  3ZRH A;  2DIW A;  4UWG A;  4APF A;  1FVH A;  3U9W A;  4HOU A;  2WXP A;  3ML9 A;  4MKT A;  3UT8 A;  2GRM A;  2LAH A;  3CK7 A;  1UN8 A;  3APF A;  4CT4 A;  2WMN A;  3U4T A;  2IQC A;  4AEZ C;  4I6J A;  2CHZ A;  1JUQ A;  2X6F A;  2YHC A;  3VLF A;  5T3R A;  4AJW A;  1HU3 A;  2X38 A;  4GZD A;  3UX4 A;  4M3O A;  3NF1 A;  4HOT A;  2WMO A;  1FVF A;  2VGY A;  3FUI A;  3JQ0 A;  2RG8 A;  4BT8 A;  4GA2 A;  4HOQ A;  4XKB A;  4DPR A;  3CKB A;  4GYO A;  3MJW A;  3QNK A;  5FQ7 A;  4PS3 A;  5FZR A;  2GW1 A;  4FLB A;  1HS6 A;  4IYP A;  3MKQ A;  3O48 A;  4FLH A;  4GML A;  3ZHE B;  4NAC A;  1X5B A;  3BG1 B;  3D9L A;  2VSX E;  4K03 A;  4Q96 A;  4U8H A;  3D3M A;  3O4Z A;  2LSU A;  5DBK A;  4JHJ A;  3FTY A;  2V8S E;  2X6H A;  2J09 A;  4PUC A;  4WWP A;  2Y4T A;  4J8E A;  4WUY A;  3S7F A;  1H2T C;  4F3V A;  1E90 A;  3QB2 A;  2RD0 A;  4TUU A;  3CR3 A;  3ENE A;  3U64 A;  4CT0 A;  3VLE A;  3ASG A;  3KS2 A;  4MLP A;  1HG2 A;  4OVU A;  4XI0 A;  4YND A;  1HE8 A;  3TG5 A;  3SI5 A;  3TJP A;  1DVP A;  4HXI A;  1ZBP A;  3E4B A;  2DCP A;  1MHQ A;  3R9A B;  4IUL A;  3FTX A;  2XRY A;  3QWP A;  4GCN A;  3RRN B;  3AU5 A;  3PEU B;  2GGF A;  4GAA A;  3TXM A;  5LOZ A;  3ZXS A;  4U0U A;  5G05 J;  4RG9 A;  3I4G A;  1HZ4 A;  4I6E A;  2PZI A;  1EF1 C;  3OXF A;  3UT4 A;  2BF0 X;  1HF8 A;  2E2E A;  2JLB A;  4G11 A;  3TGO A;  3SBT B;  3CVY A;  3S2A A;  4WWN A;  3ML8 A;  3FEY A;  1B89 A;  4L7T A;  1IHG A;  3CHR A;  3T5V A;  4APO A;  5LX8 A;  3I3N A;  5AEN A;  1PAQ A;  3CV0 A;  3UT7 A;  1FCH A;  3GW4 A;  1E7U A;  1UJK A;  4ABN A;  3HHM A;  3GYZ A;  4RVB A;  2IU1 A;  3FUN A;  3SGH A;  5T4Y A;  3Q4A B;  5BPP A;  3HVE A;  3SZ7 A;  2J9Q A;  5FTP A;  3CVX A;  3FUL A;  3L08 A;  1UG3 A;  3B7T A;  1OWL A;  2FBN A;  1OWN A;  3EHN A;  4N3C A;  3EHM A;  4L23 A;  2FI7 A;  2AVP A;  3PRZ A;  1TJC A;  4N3B A;  2XGO A;  3FFL A;  4GYW A;  5ARF A;  4I2W A;  2WXK A;  4J8S A;  1EDU A;  2WXO A;  3JYS A;  2P58 C;  3KEZ A;  4U0S A;  2XEV A;  1ELK A;  3FU3 A;  1KLX A;  3Q5M A;  2A5U A;  1TJF A;  3P2B A;  1WM5 A;  4KMO A;  4A1G A;  5LCW C;  2KAT A;  3IV0 A;  1OUV A;  5BV0 A;  4G25 A;  2I1K A;  2CHW A;  2KM4 A;  1QZ2 A;  5CHE E;  3CGH A;  1HH8 A;  2PM7 A;  3QKY A;  4NQ0 A;  3C98 A;  4O6F A;  4GA0 A;  2OVF A;  1H19 A;  2CFU A;  2IFU A;  3NZU A;  3QWV A;  4QFV A;  5FWQ A;  4FUL A;  5CMY A;  1PC2 A;  3ZVV A;  3PH0 C;  4N2Q A;  4FJZ A;  2C2L A;  2EQX A;  3CVW A;  4BTB A;  4BFR A;  2LSV A;  3TXN A;  5E75 A;  4EPZ A;  4B89 A;  4KZC A;  2I6H A;  3LPZ A;  3SFZ A;  4E85 A;  2VJ8 A;  3GZ1 A;  3FDH A;  3DBS A;  3GZS A;  3MV2 B;  3S7D A;  1WY6 A;  4JHR A;  4W9R A;  4XX5 A;  2VYI A;  4EZK A;  2MRI A;  3ASH A;  4L1B A;  4IRU A;  4CGW A;  1QQE A;  3LY7 A;  3RJV A;  2XCC A;  4C0E A;  3CVU A;  4UI9 C;  1KT1 A;  2E0I A;  1INZ A;  3PS6 A;  4NRH B;  4EZL A;  4WNE A;  2LO6 A;  4KBQ A;  4MS6 A;  4GZ6 A;  4JEU A;  3MV3 B;  1JPL A;  3FU5 A;  1Z3X A;  3EJN A;  5JHA A;  3PE4 A;  4I6G A;  5C2Y A;  4I1O B;  3PE3 A;  4R7L A;  4I9E A;  3I4R B;  3MA5 A;  3QWW A;  2VSO E;  3T8M A;  3ZW3 A;  1NZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...