2FULA

Crystal structure of the c-terminal domain of s. cerevisiae eif5
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
161
Chain Sequence
SPEFVNSELTQLDEYGEWILEQAGEDKENLPSDVELYKKAAELDVLNDPKIGCVLAQCLFDEDIVNEIAEHNAFFTKILVTPEYEKNFMGGIERFLGLEHKDLIPLLPKILVQLYNNDIISEEEIMRFGTKSSKKFVPKEVSKKVRRAAKPFITWLETAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic translation initiation factor 5
publication title Crystal Structure of the C-terminal Domain of S.cerevisiae eIF5
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 59
structure length 161
sequence length 170
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fulA01
1PAQA 1UG3A 4JHKA 3EIJA 1H6KA 2IU1A 2HM8A 2IONA 2KZTA 2VSXE 3D3MA 2I2OA 2NSZA 4CRWA 4CEMA 3FEXA 5ANRA 1N52A 2IOLA 1UW4B 4GMLA 2FULA 3EIQC 4B8AA 4CT4A 1H2UA 2KZTB 1H2VC 2IOSA 3RK6A 1H2TC 3L6AA 2ZU6B 1HU3A 1N54A 4LUNU 4C9BB 2GGFA 4IULA 2VSOE 2RG8A 4GMJA 3FEYA 4B8CB 3JUIA 4JHJA 4B89A
chains in the Genus database with same CATH superfamily
1YMPA 1HG5A 1OXJA 3NQPA 1DNPA 5AYWD 2X6IA 1XGWA 4I1OB 2V0PA 3L6AA 3ONKA 3ZHEB 3TJPA 2J8SD 4IRUA 3TWUA 2L0IA 2DIWA 3MKQB 1TN7A 3AAAC 4O1PA 2A5UA 3CK9A 4EZJA 4ABNA 4AP2A 4HOSA 3UTMA 5EIDA 3MV3B 5HS0A 2DYSE 2ETBA 3FEYA 4AY5A 3C5RA 3BU8A 2XS8A 3CVNA 5EKQD 3UI2A 3ZPJA 4I6GA 4KT6B 1XNFA 2KATA 1FVHA 3GYZA 4HI8A 2I2OA 3AG4E 4XIFA 3ASOE 1HFAA 1RW2A 4LRZA 5JJ6A 3F6QA 1N4SA 4H7YA 2XEHA 3G2SA 2X3MA 1IKND 5D66A 4AV7A 3NOGD 1D8EA 2KCVA 3RJVA 4O1OA 3RO3A 1MHQA 3TXNA 1E7UA 4J7WA 3CHPA 2LXMA 4GTPA 2J49A 5FQ7A 2WXQA 1O1RA 3JCKC 3FUNA 4GCOA 4YDWA 4CZ2D 2AW6A 3TXMA 4LCTA 4I17A 1H6PA 5KJNA 3IBEA 1X5BA 4TUMA 3PRZA 4UQZA 3OTNA 2WXMA 3NF1A 4TV3A 3LY7A 3Q75A 1OUVA 4JVSA 1DC2A 3PNLB 4HOTA 3EU5A 1BPOA 5BNWA 4FULA 1QBQA 4AIFA 3UUXA 3ML9A 3OAWA 3QWPA 2OVFA 4G24A 3E4BA 4FADA 3QNKA 2AXUA 3APCA 2R05A 3V2OA 1EF1C 4EECA 5EILA 2P9PG 3P2BA 2ONDA 4F6RD 5B1BE 2DYRE 1FCHA 4DUIA 5HRYA 2X6FA 3ZNGA 5DBKA 3PE3A 3NZSA 3ZRHA 4PS8A 1NZNA 3PNTB 2KBXA 4TXPA 3PZDA 5B1AE 4BERA 2L0TB 4LG6A 4UI9J 2LSUA 4GTQA 4A63B 2KZTB 3DPYA 2NXPA 4GA2A 4CCAA 5EN5D 2WXNA 4LUNU 4N5QA 4B93B 3PE4A 4WWNA 3BEEA 5H7PA 3SF4A 3V30A 2EQXA 4N39A 3QWWA 5T8IA 3MJWA 4FJYA 2UY1A 1TJFA 5A23A 5CBNA 3ASFA 1NP7A 3OXFA 3B13A 3LDZA 1KT0A 3EJNA 5E75A 4HLEA 3VLDA 3HVEA 4U8YD 3UT7A 1E8XA 1GW6A 4I1MA 2P9IG 4DX2A 4YDYA 4RQIA 4L2LA 2FO1E 2IEJA 1Q2ZA 4RVBA 3NB2A 2FF4A 3PREA 2YNQA 4LNUD 3C72A 3IKOB 2ETAA 1E8ZA 4WNGA 3FH5A 2VSYA 4GMRA 1U2VG 3FTZA 5D2MC 1N0RA 3UM3A 4KZ0A 3KEAA 4HBDA 2WMNA 1NI1A 3OXLA 4Z68A 2VQ2A 1QQEA 2LXLA 2QYJA 3D9NA 3SI5A 3HYMB 5EYPF 2F37A 4U8VD 4EHMA 2R02A 4XKBA 2KXPC 4UUCA 4GPKA 4GZ3A 1TEZA 3VTYA 3BG1B 4HLLA 3JYSA 1MX2A 1MYOA 1N9AA 1D8DA 3TG4A 3ULEG 5ENPD 5BPPA 5CMWA 5AAOA 2E2EA 4OYSA 3D9MA 1BU9A 4AEZC 2MRIA 1BLXB 4LNBA 1W3BA 4JW1A 3I4RB 4EZKA 3R7RA 1E7VA 1HU3A 1OT8A 4APOA 1OWNA 3RIBA 2OEVA 2YINA 3CVWA 2HM8A 3UIOC 3WG7E 2KC7A 3ZN3A 4CDNA 3Q9NC 4B8AA 3KS2A 4ATGA 4I9CA 4A55A 1UJJA 1V54E 1OWMA 3KD7A 5KJKA 4GYYA 5LCWJ 3S7BA 3ZXPA 5D0OD 2WMOA 2C0LA 4TRQA 4KVOA 4N3BA 1OCOE 4CRWA 3FH8A 4CYMD 3MYVA 3FUDA 2BTDA 5J90A 5ANLA 4DJAA 4GTMA 2WXHA 4GB9A 1MX4A 3L13A 3MV2B 4JL0A 2WXKA 5G55A 5LFAA 4RSYA 3ASNE 1AP7A 1Y6IA 1K1BA 3LEWA 3D9PA 3CEQA 4ANXA 5ITZF 3UINC 1HE8A 2FULA 2FEZA 2H6FA 4Q96A 3TWQA 2V4LA 4N5CA 3CVQA 3B7TA 3TWSA 3CKBA 4ILHB 2VJ8A 4K03A 2IQCA 3QAQA 3DSVA 4ZHBA 5G05C 3CVYA 4BFRA 4GA1A 1MJ0A 3RU0A 3QJZA 2XGMA 2DZOA 4J8FA 2BEDA 3FDHA 2IU1A 3MCXA 1NFIE 2MHKA 3T5VA 4FHKA 3LY9A 4G2VA 4G8LA 3ZGQA 2A5EA 4GTTA 3CVLA 1P5QA 3DSSA 4IN3B 5CRUA 3OXGA 4A1SA 5FIOA 3FUMA 2XGOA 3QKYA 4GYOA 3HDXA 4DX6D 3PH0C 1ELKA 1E96B 2PQNA 5CERB 4MRUA 4BETA 4CDRA 5AENA 3TGOA 4J6IA 3QWVA 4JZYA 4J8SA 3MKRA 1VDYA 4JEUA 4L7TA 5LP0A 1IHBA 2P9KG 4ILGA 2WXJA 3PUJA 1N54A 1Z3YA 3ASHA 4U96D 3JQ1A 1HXIA 4LERA 3ZYKA 4HNAD 1WY6A 3G2UA 1PAQA 3U3WA 2KZTA 2X6HA 4G11A 2XCBA 3G2WA 1K8KG 4PUCA 1JCSA 5JMND 2IF4A 2F8YA 3PZ3A 2I1KA 4MBGA 3CHQA 3DEOA 4U7EB 2VYIA 5ENTD 3SGHA 3CQGB 5G04J 2GROB 4I1AA 1SA5A 4DX1A 3FTVA 2L6BA 2Y4UA 1FT2A 2PQRA 3SZ7A 5ENSD 4N2QA 4WNEA 3VLEA 4CT0A 2X6JA 2DVWA 4RG6A 4L1BA 5AIJA 2H6GA 3E32A 3FUKA 3B7BA 2XZTG 4AVXA 1MQSA 2KCKA 1RZ4A 2WXIA 1DCQA 3D9LA 2AXVA 4FJZA 1FPPA 4N2SA 4M7CA 2C0MA 1OY3D 4ACKA 3KSLA 2OEWA 2R2LA 2R5SA 3B7UX 1YYHA 2AVPA 1YCSB 3PDNA 1H6OA 5KBAA 3C3RA 3HXBA 2RD0A 3IHVA 3R9AB 1UG3A 4K5BA 3X2QE 2GRNB 2DWZA 3RRNB 4U95D 3ABME 4KXKB 4GMLA 3B7SA 3N71A 4BSZB 3K9IA 5CCMA 2VSNA 3WXXA 1A5EA 3ZU7B 2ETCA 4HFGA 4C48B 5FINA 2VGYA 5CEAA 2CG2A 4LEUA 2WPVA 1H0AA 2CHZA 3RO2A 5LOZA 2GRPB 3S7JA 3CLJA 2Y4TA 5AARA 3TWRA 3FTWA 5KCMA 1TJCA 5ENRD 3Q9UC 4APFA 1WM5A 4GZ6A 5D0QD 4JD2G 2IONA 3HXDA 1EDUA 4N3CA 3PEUB 4BWRA 2XHEA 3IV0A 3E37A 2GGFA 4HRMB 3Q47B 4UWLA 3FFLA 5CHEE 4JHJA 3D9HA 3ESLA 2ZXWE 3AG1E 3CK8A 4BY6A 4AM9A 2ILRA 1DVPA 4HXIA 5KNGA 3ASGA 1ZB1A 4RLYA 4XEIG 2VTBA 4UQXA 3C98A 3ISMC 4G25A 3U4TA 2KCLA 4G1TA 4E85A 3ML8A 2EILE 4FU3A 5AJDA 2WQHA 4BTAA 2Y1LE 1LF8A 2WXFA 3FTXA 2IOSA 4TUUA 5A7DB 3DEPA 2WQ6A 4JHKA 5CBOA 2NC9A 4EZLA 4DI3A 4JA7A 5CECB 2VGXA 3D9IA 4LNGA 2R17C 1U3DA 3ONLA 2YHCA 2M63A 1LD8A 3J5PA 4YVQC 4GZ5A 2XRYA 3MGBA 4JPSA 4LSZE 4ILIA 3D9JA 1Y8MA 1E8WA 3AG3E 2IOLA 4DI4A 3L54A 3ZEFA 3CR3A 2PZIA 4AXHA 4NIKA 4JB8P 2F8XK 4A3VA 3NAWA 3JUIA 3PZ1A 1PC2A 4U0SA 2IO2C 3L08A 3ZYLA 5JJ7A 2XQ0A 2WM9A 3CSTA 3LCAA 4D10C 3AG2E 5ENQD 4OVVA 4EPZA 2GRMA 1SQMA 2LUHA 3FUJA 3SO8A 2P9UG 1OWPA 4G23A 5BUZA 3Q79A 3LXUX 3ZIMA 1HS6A 3PS6A 2UWJG 1N52A 3QC1A 3PUKA 4CT4A 1QNFA 1O1TA 2EIKE 2FO7A 3AS8A 1U3CA 1SZ9A 5FZQA 2XENA 4WAFA 3ABLE 4J0UA 2AJAA 3Q78A 3ENEA 3Q4AB 4K5CA 2ZGDA 1A17A 2J08A 2XGSA 3TWTA 4UWFA 3L9TA 3C3OA 3EUVA 5EX0A 3B7RL 1NL4A 2L9BA 1DCEA 4UI9C 2XPYA 1WDYA 3RK6A 2XZDG 2QY7A 4MLPA 1BI7B 1OWOA 5HKPA 3LKUA 5AQBA 3UX4A 4I6JA 5KNHD 3MX3A 2BKGA 2LAHA 3CHRA 3ZYQA 3E30A 2XEEA 2Y69E 3ZHEA 3EIQC 4U0UA 2YQ8A 3MKQA 4K0RA 4EQFA 3S2AA 1UN8A 3JQ0A 2Y3AA 2JABA 3CHOA 1KPSB 2YHEA 4QFVA 1N4RA 4C0EA 5JA4D 3CV0A 3ZKJA 1H2VC 2V8SE 1D9SA 3AJIA 3UIPC 3HG0D 4PS7A 4B89A 3LJ3A 3DWLG 3UXGA 2I6HA 3U66A 1FT1A 3CQCB 3Q7FA 5E76A 1Z3XA 3DXMG 3FWVA 3ABKE 3E33A 5FZRA 2A4ZA 1O1SA 3GZSA 3UQ3A 1E8YA 4W9RA 5CMYA 3SHFA 4FC8A 3U64A 1H19A 3O4ZA 4CGVA 3B95A 3J5QB 3DRAA 4OAUC 3CKCA 3ZXSA 4B94A 4HVBA 3I5PA 1ZU2A 1Z5SC 2BUGA 3PVLA 3EHMA 1NA3A 5AQ9A 3LVQE 2WVIA 5J08A 4F7AA 3CHMA 1UOHA 4A1GA 1HZ4A 4CDMA 4O6FA 3T5XA 5CCLA 1X81A 2PNNA 4ANWA 1IXVA 3W9FA 4KBQA 3Q49B 2RKKA 4JXTA 3AU5A 4WNDA 4UWGA 1JCQA 4C0MA 3QB2A 1LTXA 1H6KA 3FUHA 3TG5A 3ZYMA 3FTSA 1Z6TA 3PZ2A 2HO1A 4XKCA 2HE0A 2ZISA 5DIZA 1MZCA 5ARFA 4KVMA 1N95A 3SBSA 2CFUA 2VSOE 3SFYA 3ULYA 4ZFHA 4GAAA 1SZAA 3HXCA 4AY6A 2V4HC 1ELWA 2NYJA 1N94A 2AWIA 1G3NB 1NA0A 5BT1A 4F1SA 4YDEA 2RFMA 3KSQA 4GA0A 4FP7A 4J8YA 4HRLA 3LPZA 1KZOA 3QOUA 2QZAA 3SNXA 4BT9A 4KMOA 2ZIRA 1INZA 3UMVA 2IO3C 4WNFA 1WAO1 2H6HA 4MS6A 2XRZA 2GW1A 4GYWA 3Q7AA 5KJMA 4F53A 1ZBPA 4OAVB 2DCPA 4GTVA 4QQIA 3U9WA 3CK7A 4BSXA 3L17A 2GRLA 3ASDA 3HIZA 3UM1A 4BX9A 2MOWA 3EHRA 3EHNA 3TWXA 3EHQA 2BF0X 2IFUA 2RFAA 5BW8C 2VSXE 2WXGA 3PEVB 1N4PA 4UI9K 4F1PA 1JPLA 4GPMA 2LAIA 3UT4A 2FI7A 3E34A 3APFA 1H2TC 2ZU6B 3DXKG 3EU9A 4U07A 5FWQA 4JEHA 4G8KA 1S64A 4NQ0A 3TWWA 2QC9A 2IY0C 2P9SG 1S0PA 2XCCA 2XS1A 3CHSA 4F3VA 3GW4A 3NBNB 4JHRA 3FTYA 4JA9A 3Q5MA 2OV8A 4AJWA 3DSWA 3HXEA 3O48A 4G26A 3T8KA 3SFXA 4HI9A 1FVFA 1TNUA 3DSUA 5FQ8A 2I1JA 3QDNA 3HRAA 5B3SE 3FEXA 5BXOA 1IQRA 4U63A 2OVBA 2EINE 1HH8A 4V3IA 2I9CA 2JLBA 5FTPA 3R9MA 1QZ2A 5KWDA 3QARA 3ZW3A 2XEVA 4GCNA 3MZLB 3HXFA 4URKA 3TAXA 3UM0A 1BI8B 1TYQG 4HOQA 3SBTB 4N3AA 2CHWA 4X8QA 5FQ6A 1HG2A 3L22A 4Q94A 4NACA 3UM2A 5HQ8A 3FHEA 3BQOA 4DRXE 2WXLA 1N11A 3L82A 2B0OE 2E0IA 4PDXA 3UKUG 2P9NG 2WQ7A 1YA0A 3S7DA 5ANRA 3FU3A 3RAUA 3ZVVA 3ESKA 3C3QA 3BG0B 1N0QA 4KZCA 4DPRA 3QK0A 3VTXA 3V2XA 4CGWA 4NURA 1V55E 2P2CP 3CGHA 1QYMA 4YDOA 2XPZA 4GTSA 4OVUA 1HX8A 3LYAA 1S70B 2NSZA 5G04C 3SD5A 2LSVA 4R7LA 3CVPA 3BUAA 2EIME 3FH7A 2Y0BG 2PM7A 3KAEA 3Q15A 2QFCA 4FLHA 1IYGA 5AQ7A 3PZ4A 4ACLA 1KT1A 1MX6A 4DLQA 4I9EA 4MKTA 4UWKA 3JXJA 1K1AA 3FUEA 3CSFA 4WWPA 1O5MA 2L6JA 5FQ4A 4K5AB 2R59A 3LY8A 4NRHB 3Q73A 2H6IA 4EBAG 2P9LG 3G2TA 4CEMA 4HQDA 5KJLA 4B0ZA 3G2VA 4ANVA 2WXOA 4GZCA 4YVOA 2KM4A 5M72A 4BEPA 5BV1A 1UN9A 1OCRE 1WG0A 2J07A 4XX5A 4GTRA 3UKRG 2LNIA 2V5FA 4DX5D 3RKVA 3FUIA 1JWGA 2OCCE 1IQUA 4XZ4A 3CIAA 1K3ZD 1LD7A 5AN8A 3T9KA 3CVVA 3HHMA 1SVXA 1KZPA 4B8CB 3RRUA 2VGEA 1BD8A 1OCZE 5ENNA 3NOCD 3FP3A 3LS8A 4HRNA 3AS4A 4I2ZA 3KEZA 2EIJE 2V5QC 4XI9A 2Q7FA 4L23A 4TXRA 3ZUVB 1TNZA 5G05J 3UT8A 5C1DA 3CVUA 3SQVA 4I6EA 3DSXA 3L16A 4Y6CA 3VLFA 3AS5A 4WUYA 4HORA 1UW4B 5FJYA 3ULQA 2F0YA 1E90A 4C9BB 4IULA 4KYOB 2MYOA 5T4YA 2LO6A 1L5JA 4I43A 3MEKA 3NZUA 2HYZA 3IEGA 4ANUA 4RG9A 5C2YA 1EPUA 4WWOA 1H2UA 5EDSA 1KLXA 4PS3A 1OWLA 5CEDB 1SW6A 4DX7D 5FT9A 1UJKA 3EIJA 4U04A 5BXUA 1TN8A 2J4DA 2PL2A 2J09A 5HI7A 3AU4A 3DPDA 5FZSA 4BTBA 4A3TA 4GU5A 3D9OA 3TL5A 4L9PA 2AXZA 5ENOD 5JHBA 2VTBB 1AWCB 4FA6A 4YNDA 5EX3A 4H7XA 3I4GA 5AQAA 4GTOA 1SA4A 3TWVA 4FHJA 4M3OA 2IJGX 3R7QA 3IHYA 1S63A 2J4BA 4O60A 1JCRA 2JEKA 3LVRE 3FTUA 4HOUA 3FU6A 3UPVA 3T8MA 3FULA 5CRVA 5IY5E 3FUFA 4BT8A 5AJLA 4J8DA 3FU5A 3SY2A 2XPIA 4UQYA 4BESA 1B89A 3GZ2A 2DZNA 2DBAA 2UY1B 4AOFA 1TNBA 3D9KA 1TNOA 2RG8A 4GMJA 2VGXB 1IHGA 2X6KA 4ATZD 3LJNA 4ME2A 5EIBE 2R03A 4IYPA 3HVEB 3FU0A 1JWFA 3P1UA 4XE0A 2C2LA 3GZ1A 3JXIA 1TN6A 2FBNA 3FY4A 4U0ZA 3APDA 2BKKB 3DSTA 4J8EA 3I3NA 2X38A 3RSEG 4XI0A 4DLOA 1OCCE 3S7FA 2WXPA 5BV0A 4GZDA 5EYLA 4I2WA 2B6CA 1ELRA 1EYHA 3W9GA 3URZA 1HO8A 3EDTB 2OOEA 4PH4B 3D3MA 3SFZA 3V31A 3DBSA 4BX8A 5G2NA 3V79K 4DK5A 4JC8A 4HB5A 2WB2A 1JUQA 1TR4A 2J9QA 2QYUA 5JJTA 4Q69A 2GRRB 2P58C 1HF8A 5ARGA 1TNYA 1PY1A 3RRMB 4EBAA 4E6HA 3IXEA 3MA5A 2GRQB 5JHAA 5LCWC 2ZGGA 4TXQA 5T3RA 5LX8A 3CVXA 2CHXA 1N4QA 3JUEA 5A6CA 4Y6WA 4U8HA 2HR2A 4FLBA 2CG3A 2CFZA 2PM6A 4HS2A 4UWHA 3ZFWA 2WXRA 4P29A 4L2YA
chains in the Genus database with same CATH topology
2WXLA 5LFAA 1OWPA 4RSYA 1HG5A 3NQPA 1Y6IA 2E0IA 4G23A 4PDXA 1DNPA 3LEWA 3LXUX 5BUZA 3ZIMA 2WQ7A 1HS6A 1YA0A 3PS6A 3D9PA 3CEQA 2X6IA 5AYWD 2UWJG 1N52A 5ANRA 1HE8A 3S7DA 4ANXA 2FULA 1XGWA 3FU3A 3QC1A 3ZVVA 2FEZA 3ESKA 3PUKA 3BG0B 4I1OB 4CT4A 1QNFA 4Q96A 4KZCA 4DPRA 3QK0A 2V0PA 2V4LA 3L6AA 2FO7A 3AS8A 3CVQA 3ONKA 4N5CA 3TJPA 3VTXA 4IRUA 3B7TA 4CGWA 3CKBA 4NURA 1U3CA 4ILHB 2L0IA 3CGHA 1SZ9A 2VJ8A 2XPZA 2DIWA 3MKQB 4K03A 4OVUA 2IQCA 3QAQA 2A5UA 1HX8A 3CK9A 3LYAA 5G05C 3CVYA 5FZQA 2NSZA 5G04C 3SD5A 4ABNA 4BFRA 2LSVA 4R7LA 4WAFA 4EZJA 3CVPA 4AP2A 4GA1A 4J0UA 3RU0A 4HOSA 3FH7A 3ENEA 3Q4AB 2PM7A 1A17A 3QJZA 3KAEA 3Q15A 2QFCA 3MV3B 4FLHA 2J08A 1IYGA 2XGSA 2XGMA 4UWFA 3FEYA 4ACLA 4AY5A 5EX0A 4J8FA 1KT1A 4DLQA 3CVNA 5EKQD 3ZPJA 4I6GA 4KT6B 3FDHA 1XNFA 2KATA 3B7RL 1FVHA 2IU1A 3GYZA 4I9EA 3MCXA 4MKTA 2I2OA 4UWKA 2L9BA 3FUEA 4XIFA 1HFAA 3CSFA 2MHKA 4WWPA 4UI9C 2L6JA 2XPYA 3T5VA 4LRZA 4FHKA 5FQ4A 5JJ6A 3RK6A 2QY7A 4MLPA 1OWOA 2R59A 3LY8A 4H7YA 3LY9A 3LKUA 4G2VA 4NRHB 3ZGQA 3G2SA 2X3MA 3UX4A 3CVLA 4AV7A 4EBAG 1P5QA 4I6JA 4IN3B 3MX3A 2KCVA 2LAHA 3CHRA 3OXGA 3G2TA 3ZYQA 4A1SA 3FUMA 2XGOA 3RJVA 4CEMA 5KJLA 3ZHEA 3ZHEB 3RO3A 4B0ZA 3QKYA 1MHQA 4GYOA 3EIQC 3TXNA 3G2VA 4ANVA 2WXOA 3HDXA 4U0UA 2YQ8A 3PH0C 3MKQA 4GZCA 1E7UA 2KM4A 3CHPA 4YVOA 5M72A 1ELKA 4K0RA 1E96B 2PQNA 3S2AA 1UN8A 4EQFA 1UN9A 2J49A 3JQ0A 2Y3AA 5BV1A 4MRUA 2J07A 4XX5A 5FQ7A 2WXQA 2LNIA 3CHOA 2V5FA 4CDRA 5AENA 3TGOA 3JCKC 3RKVA 2YHEA 1JWGA 3FUIA 3FUNA 4GCOA 4J6IA 3QWVA 4JZYA 4J8SA 4QFVA 2AW6A 3TXMA 3MKRA 4LCTA 1IQUA 4I17A 4XZ4A 1VDYA 4C0EA 3CIAA 5KJNA 3IBEA 3CV0A 4JEUA 4L7TA 5LP0A 1X5BA 4ILGA 1H2VC 2WXJA 3PRZA 4UQZA 3PUJA 3OTNA 2V8SE 2WXMA 3NF1A 3HHMA 4TV3A 3CVVA 1N54A 1Z3YA 3LY7A 1OUVA 3ASHA 4JVSA 3JQ1A 4B8CB 1HXIA 4LERA 3RRUA 4PS7A 3ZYKA 3PNLB 1WY6A 3G2UA 4B89A 1PAQA 3U3WA 4HOTA 1BPOA 3LJ3A 2KZTA 5BNWA 4FULA 2I6HA 5ENNA 2X6HA 3FP3A 2XCBA 3G2WA 3LS8A 4G11A 3U66A 4AIFA 3CQCB 4PUCA 3UUXA 3ML9A 3OAWA 5E76A 3AS4A 4I2ZA 1Z3XA 3KEZA 3QWPA 2OVFA 2IF4A 4XI9A 4G24A 3E4BA 2I1KA 4FADA 2Q7FA 3FWVA 3CHQA 4L23A 5FZRA 5G05J 2A4ZA 3UT8A 2VYIA 3GZSA 3SGHA 3QNKA 3CQGB 3UQ3A 5G04J 2AXUA 5C1DA 3CVUA 1E8YA 3APCA 4I1AA 4W9RA 5CMYA 1EF1C 4EECA 4I6EA 3FTVA 4FC8A 3SHFA 3U64A 3L16A 4Y6CA 3P2BA 3VLFA 2ONDA 2Y4UA 3AS5A 1H19A 4WUYA 4HORA 1UW4B 3O4ZA 2PQRA 4CGVA 5FJYA 3ULQA 1FCHA 3SZ7A 4N2QA 3CKCA 3ZXSA 2X6FA 4WNEA 3I5PA 1ZU2A 5DBKA 3VLEA 4B94A 4CT0A 2X6JA 3PE3A 3NZSA 4RG6A 1E90A 4L1BA 5AIJA 3ZRHA 4C9BB 2BUGA 4IULA 4KYOB 3FUKA 3PVLA 2LO6A 4PS8A 5T4YA 1NZNA 4AVXA 3EHMA 1MQSA 2KCKA 3PNTB 1NA3A 3PZDA 1L5JA 2WXIA 3MEKA 3D9LA 3LVQE 2AXVA 3NZUA 4I43A 2WVIA 4FJZA 2L0TB 5J08A 2HYZA 4F7AA 3CHMA 3IEGA 4A1GA 4ANUA 4N2SA 4UI9J 2LSUA 2C0MA 4RG9A 4ACKA 1HZ4A 4CDMA 4O6FA 3T5XA 5C2YA 1EPUA 5CCLA 4WWOA 1H2UA 2KZTB 4ANWA 2NXPA 4GA2A 5EDSA 4CCAA 3B7UX 2R5SA 4KBQA 3Q49B 2WXNA 1KLXA 4LUNU 4PS3A 2AVPA 1OWLA 3PDNA 4JXTA 3PE4A 3AU5A 4WNDA 3BEEA 4UWGA 4WWNA 3SF4A 2RD0A 5FT9A 3IHVA 2EQXA 3R9AB 1UJKA 3QB2A 4C0MA 1UG3A 3EIJA 1H6KA 3FUHA 3TG5A 4U04A 4N39A 3ZYMA 3QWWA 3FTSA 5T8IA 1Z6TA 3MJWA 2UY1A 2HO1A 4FJYA 2J4DA 3RRNB 4XKCA 4KXKB 2PL2A 1TJFA 2J09A 5HI7A 5A23A 4GMLA 3B7SA 3N71A 3ASFA 3K9IA 1NP7A 3AU4A 3OXFA 5CCMA 3B13A 2VSNA 3DPDA 5FZSA 3WXXA 5DIZA 4BTBA 3LDZA 4A3TA 4GU5A 1KT0A 3EJNA 3D9OA 5E75A 3TL5A 4HLEA 3VLDA 2AXZA 5ARFA 4KVMA 3SBSA 2CFUA 4HFGA 3HVEA 2VSOE 3UT7A 5JHBA 1E8XA 2VTBB 2VGYA 1GW6A 4YNDA 4I1MA 5EX3A 4FA6A 4GAAA 4H7XA 3I4GA 2CG2A 1SZAA 4AY6A 4LEUA 2WPVA 1ELWA 1H0AA 2AWIA 2CHZA 4L2LA 3RO2A 1NA0A 5BT1A 4FHJA 4F1SA 4M3OA 2IJGX 5LOZA 3IHYA 3R7QA 4GA0A 2J4BA 2JEKA 3S7JA 3CLJA 4FP7A 3LVRE 4RVBA 2Y4TA 3FTUA 3LPZA 3QOUA 3FTWA 4HVBA 5KCMA 4HOUA 1TJCA 2FF4A 3FU6A 3PREA 3UPVA 3SNXA 2YNQA 3T8MA 4KMOA 4BT9A 3IKOB 3FULA 4APFA 1WM5A 4GZ6A 5D0QD 3FUFA 1INZA 4BT8A 2IONA 5AJLA 1E8ZA 4J8DA 3FU5A 3UMVA 4WNFA 1WAO1 4WNGA 1EDUA 3FH5A 2XPIA 4N3CA 4UQYA 4MS6A 1B89A 3PEUB 4BWRA 2GW1A 2VSYA 3GZ2A 4GYWA 2XRZA 5KJMA 2DBAA 2XHEA 2UY1B 3FTZA 3IV0A 4AOFA 4F53A 3D9KA 2GGFA 2RG8A 3Q47B 2VGXB 4GMJA 4UWLA 1IHGA 1ZBPA 4KZ0A 3FFLA 5CHEE 4JHJA 2X6KA 3ESLA 2DCPA 2WMNA 4ME2A 3CK8A 3U9WA 4IYPA 3HVEB 3OXLA 4BY6A 2VQ2A 3CK7A 4AM9A 4BSXA 3FU0A 3L17A 1JWFA 1QQEA 2ILRA 1DVPA 2GRLA 3P1UA 3ASDA 3HIZA 4HXIA 3D9NA 4BX9A 3SI5A 4XE0A 3ASGA 2C2LA 2MOWA 2VTBA 3GZ1A 3EHNA 3HYMB 4UQXA 3C98A 4G25A 2KCLA 2FBNA 4G1TA 4XKBA 2BF0X 3FY4A 3U4TA 4GPKA 2IFUA 4U0ZA 3APDA 4GZ3A 4E85A 5BW8C 1TEZA 3ML8A 2VSXE 3VTYA 2WXGA 3BG1B 3PEVB 4UI9K 4J8EA 1JPLA 3JYSA 4FU3A 3I3NA 2X38A 5AJDA 2LAIA 2WQHA 4XI0A 4DLOA 4BTAA 3S7FA 2WXPA 3UT4A 5BV0A 1LF8A 2FI7A 2WXFA 3FTXA 3TG4A 2IOSA 4GZDA 3APFA 1H2TC 4I2WA 2ZU6B 1EYHA 1ELRA 4TUUA 5BPPA 4U07A 5FWQA 5A7DB 3URZA 4JEHA 1HO8A 3EDTB 5CMWA 2E2EA 4NQ0A 4OYSA 2WQ6A 2OOEA 4JHKA 4PH4B 1S0PA 2XCCA 3D3MA 3SFZA 3CHSA 4F3VA 3D9MA 3DBSA 3GW4A 2NC9A 4AEZC 4EZLA 4BX8A 5G2NA 2MRIA 4DI3A 4JHRA 3FTYA 4JA7A 4DK5A 4JA9A 3Q5MA 4JC8A 1W3BA 2VGXA 4JW1A 2WB2A 1JUQA 2OV8A 3D9IA 2R17C 2J9QA 1U3DA 3I4RB 3ONLA 4EZKA 2YHCA 3R7RA 1E7VA 2M63A 4AJWA 1HU3A 4YVQC 4GZ5A 5JJTA 4Q69A 3O48A 2XRYA 3MGBA 4G26A 4JPSA 1OWNA 4APOA 1FVFA 2P58C 5FQ8A 3RIBA 2I1JA 2YINA 1HF8A 3CVWA 3QDNA 2HM8A 4ILIA 3D9JA 5ARGA 2KC7A 1Y8MA 1E8WA 1PY1A 3FEXA 2IOLA 3ZN3A 1IQRA 3L54A 4U63A 3RRMB 2OVBA 4CDNA 3ZEFA 4DI4A 3CR3A 2PZIA 4B8AA 4AXHA 1HH8A 3KS2A 4V3IA 4ATGA 4EBAA 2I9CA 2JLBA 4I9CA 4A55A 5FTPA 4E6HA 1QZ2A 1UJJA 1OWMA 3QARA 4A3VA 3ZW3A 3KD7A 5KJKA 4GYYA 5LCWJ 3S7BA 2XEVA 5D0OD 3MA5A 4GCNA 3MZLB 3JUIA 1PC2A 4URKA 2WMOA 5JHAA 2C0LA 3TAXA 4TRQA 4U0SA 4KVOA 5LCWC 3L08A 4N3BA 5T3RA 4HOQA 3ZYLA 5LX8A 3SBTB 5JJ7A 3CVXA 2CHXA 4N3AA 2XQ0A 4CRWA 3FH8A 2CHWA 2WM9A 3CSTA 3MYVA 5A6CA 3FUDA 3LCAA 4D10C 4Y6WA 2BTDA 4U8HA 5FQ6A 5J90A 5ANLA 1HG2A 3L22A 2HR2A 4FLBA 2CG3A 2CFZA 4OVVA 4Q94A 2GRMA 4EPZA 4NACA 1SQMA 2PM6A 4HS2A 4DJAA 2WXHA 4GB9A 3FUJA 4UWHA 3ZFWA 5HQ8A 2WXRA 3FHEA 3L13A 3MV2B 4JL0A 2WXKA 4P29A 4L2YA 5G55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAQ A;  1UG3 A;  4JHK A;  3EIJ A;  1H6K A;  2IU1 A;  2HM8 A;  2ION A;  2KZT A;  2VSX E;  3D3M A;  2I2O A;  2NSZ A;  4CRW A;  4CEM A;  3FEX A;  5ANR A;  1N52 A;  2IOL A;  1UW4 B;  4GML A;  2FUL A;  3EIQ C;  4B8A A;  4CT4 A;  1H2U A;  2KZT B;  1H2V C;  2IOS A;  3RK6 A;  1H2T C;  3L6A A;  2ZU6 B;  1HU3 A;  1N54 A;  4LUN U;  4C9B B;  2GGF A;  4IUL A;  2VSO E;  2RG8 A;  4GMJ A;  3FEY A;  4B8C B;  3JUI A;  4JHJ A;  4B89 A; 
#chains in the Genus database with same CATH topology
 1YMP A;  1HG5 A;  1OXJ A;  3NQP A;  1DNP A;  5AYW D;  2X6I A;  1XGW A;  4I1O B;  2V0P A;  3L6A A;  3ONK A;  3ZHE B;  3TJP A;  2J8S D;  4IRU A;  3TWU A;  2L0I A;  2DIW A;  3MKQ B;  1TN7 A;  3AAA C;  4O1P A;  2A5U A;  3CK9 A;  4EZJ A;  4ABN A;  4AP2 A;  4HOS A;  3UTM A;  5EID A;  3MV3 B;  5HS0 A;  2DYS E;  2ETB A;  3FEY A;  4AY5 A;  3C5R A;  3BU8 A;  2XS8 A;  3CVN A;  5EKQ D;  3UI2 A;  3ZPJ A;  4I6G A;  4KT6 B;  1XNF A;  2KAT A;  1FVH A;  3GYZ A;  4HI8 A;  2I2O A;  3AG4 E;  4XIF A;  3ASO E;  1HFA A;  1RW2 A;  4LRZ A;  5JJ6 A;  3F6Q A;  1N4S A;  4H7Y A;  2XEH A;  3G2S A;  2X3M A;  1IKN D;  5D66 A;  4AV7 A;  3NOG D;  1D8E A;  2KCV A;  3RJV A;  4O1O A;  3RO3 A;  1MHQ A;  3TXN A;  1E7U A;  4J7W A;  3CHP A;  2LXM A;  4GTP A;  2J49 A;  5FQ7 A;  2WXQ A;  1O1R A;  3JCK C;  3FUN A;  4GCO A;  4YDW A;  4CZ2 D;  2AW6 A;  3TXM A;  4LCT A;  4I17 A;  1H6P A;  5KJN A;  3IBE A;  1X5B A;  4TUM A;  3PRZ A;  4UQZ A;  3OTN A;  2WXM A;  3NF1 A;  4TV3 A;  3LY7 A;  3Q75 A;  1OUV A;  4JVS A;  1DC2 A;  3PNL B;  4HOT A;  3EU5 A;  1BPO A;  5BNW A;  4FUL A;  1QBQ A;  4AIF A;  3UUX A;  3ML9 A;  3OAW A;  3QWP A;  2OVF A;  4G24 A;  3E4B A;  4FAD A;  3QNK A;  2AXU A;  3APC A;  2R05 A;  3V2O A;  1EF1 C;  4EEC A;  5EIL A;  2P9P G;  3P2B A;  2OND A;  4F6R D;  5B1B E;  2DYR E;  1FCH A;  4DUI A;  5HRY A;  2X6F A;  3ZNG A;  5DBK A;  3PE3 A;  3NZS A;  3ZRH A;  4PS8 A;  1NZN A;  3PNT B;  2KBX A;  4TXP A;  3PZD A;  5B1A E;  4BER A;  2L0T B;  4LG6 A;  4UI9 J;  2LSU A;  4GTQ A;  4A63 B;  2KZT B;  3DPY A;  2NXP A;  4GA2 A;  4CCA A;  5EN5 D;  2WXN A;  4LUN U;  4N5Q A;  4B93 B;  3PE4 A;  4WWN A;  3BEE A;  5H7P A;  3SF4 A;  3V30 A;  2EQX A;  4N39 A;  3QWW A;  5T8I A;  3MJW A;  4FJY A;  2UY1 A;  1TJF A;  5A23 A;  5CBN A;  3ASF A;  1NP7 A;  3OXF A;  3B13 A;  3LDZ A;  1KT0 A;  3EJN A;  5E75 A;  4HLE A;  3VLD A;  3HVE A;  4U8Y D;  3UT7 A;  1E8X A;  1GW6 A;  4I1M A;  2P9I G;  4DX2 A;  4YDY A;  4RQI A;  4L2L A;  2FO1 E;  2IEJ A;  1Q2Z A;  4RVB A;  3NB2 A;  2FF4 A;  3PRE A;  2YNQ A;  4LNU D;  3C72 A;  3IKO B;  2ETA A;  1E8Z A;  4WNG A;  3FH5 A;  2VSY A;  4GMR A;  1U2V G;  3FTZ A;  5D2M C;  1N0R A;  3UM3 A;  4KZ0 A;  3KEA A;  4HBD A;  2WMN A;  1NI1 A;  3OXL A;  4Z68 A;  2VQ2 A;  1QQE A;  2LXL A;  2QYJ A;  3D9N A;  3SI5 A;  3HYM B;  5EYP F;  2F37 A;  4U8V D;  4EHM A;  2R02 A;  4XKB A;  2KXP C;  4UUC A;  4GPK A;  4GZ3 A;  1TEZ A;  3VTY A;  3BG1 B;  4HLL A;  3JYS A;  1MX2 A;  1MYO A;  1N9A A;  1D8D A;  3TG4 A;  3ULE G;  5ENP D;  5BPP A;  5CMW A;  5AAO A;  2E2E A;  4OYS A;  3D9M A;  1BU9 A;  4AEZ C;  2MRI A;  1BLX B;  4LNB A;  1W3B A;  4JW1 A;  3I4R B;  4EZK A;  3R7R A;  1E7V A;  1HU3 A;  1OT8 A;  4APO A;  1OWN A;  3RIB A;  2OEV A;  2YIN A;  3CVW A;  2HM8 A;  3UIO C;  3WG7 E;  2KC7 A;  3ZN3 A;  4CDN A;  3Q9N C;  4B8A A;  3KS2 A;  4ATG A;  4I9C A;  4A55 A;  1UJJ A;  1V54 E;  1OWM A;  3KD7 A;  5KJK A;  4GYY A;  5LCW J;  3S7B A;  3ZXP A;  5D0O D;  2WMO A;  2C0L A;  4TRQ A;  4KVO A;  4N3B A;  1OCO E;  4CRW A;  3FH8 A;  4CYM D;  3MYV A;  3FUD A;  2BTD A;  5J90 A;  5ANL A;  4DJA A;  4GTM A;  2WXH A;  4GB9 A;  1MX4 A;  3L13 A;  3MV2 B;  4JL0 A;  2WXK A;  5G55 A;  5LFA A;  4RSY A;  3ASN E;  1AP7 A;  1Y6I A;  1K1B A;  3LEW A;  3D9P A;  3CEQ A;  4ANX A;  5ITZ F;  3UIN C;  1HE8 A;  2FUL A;  2FEZ A;  2H6F A;  4Q96 A;  3TWQ A;  2V4L A;  4N5C A;  3CVQ A;  3B7T A;  3TWS A;  3CKB A;  4ILH B;  2VJ8 A;  4K03 A;  2IQC A;  3QAQ A;  3DSV A;  4ZHB A;  5G05 C;  3CVY A;  4BFR A;  4GA1 A;  1MJ0 A;  3RU0 A;  3QJZ A;  2XGM A;  2DZO A;  4J8F A;  2BED A;  3FDH A;  2IU1 A;  3MCX A;  1NFI E;  2MHK A;  3T5V A;  4FHK A;  3LY9 A;  4G2V A;  4G8L A;  3ZGQ A;  2A5E A;  4GTT A;  3CVL A;  1P5Q A;  3DSS A;  4IN3 B;  5CRU A;  3OXG A;  4A1S A;  5FIO A;  3FUM A;  2XGO A;  3QKY A;  4GYO A;  3HDX A;  4DX6 D;  3PH0 C;  1ELK A;  1E96 B;  2PQN A;  5CER B;  4MRU A;  4BET A;  4CDR A;  5AEN A;  3TGO A;  4J6I A;  3QWV A;  4JZY A;  4J8S A;  3MKR A;  1VDY A;  4JEU A;  4L7T A;  5LP0 A;  1IHB A;  2P9K G;  4ILG A;  2WXJ A;  3PUJ A;  1N54 A;  1Z3Y A;  3ASH A;  4U96 D;  3JQ1 A;  1HXI A;  4LER A;  3ZYK A;  4HNA D;  1WY6 A;  3G2U A;  1PAQ A;  3U3W A;  2KZT A;  2X6H A;  4G11 A;  2XCB A;  3G2W A;  1K8K G;  4PUC A;  1JCS A;  5JMN D;  2IF4 A;  2F8Y A;  3PZ3 A;  2I1K A;  4MBG A;  3CHQ A;  3DEO A;  4U7E B;  2VYI A;  5ENT D;  3SGH A;  3CQG B;  5G04 J;  2GRO B;  4I1A A;  1SA5 A;  4DX1 A;  3FTV A;  2L6B A;  2Y4U A;  1FT2 A;  2PQR A;  3SZ7 A;  5ENS D;  4N2Q A;  4WNE A;  3VLE A;  4CT0 A;  2X6J A;  2DVW A;  4RG6 A;  4L1B A;  5AIJ A;  2H6G A;  3E32 A;  3FUK A;  3B7B A;  2XZT G;  4AVX A;  1MQS A;  2KCK A;  1RZ4 A;  2WXI A;  1DCQ A;  3D9L A;  2AXV A;  4FJZ A;  1FPP A;  4N2S A;  4M7C A;  2C0M A;  1OY3 D;  4ACK A;  3KSL A;  2OEW A;  2R2L A;  2R5S A;  3B7U X;  1YYH A;  2AVP A;  1YCS B;  3PDN A;  1H6O A;  5KBA A;  3C3R A;  3HXB A;  2RD0 A;  3IHV A;  3R9A B;  1UG3 A;  4K5B A;  3X2Q E;  2GRN B;  2DWZ A;  3RRN B;  4U95 D;  3ABM E;  4KXK B;  4GML A;  3B7S A;  3N71 A;  4BSZ B;  3K9I A;  5CCM A;  2VSN A;  3WXX A;  1A5E A;  3ZU7 B;  2ETC A;  4HFG A;  4C48 B;  5FIN A;  2VGY A;  5CEA A;  2CG2 A;  4LEU A;  2WPV A;  1H0A A;  2CHZ A;  3RO2 A;  5LOZ A;  2GRP B;  3S7J A;  3CLJ A;  2Y4T A;  5AAR A;  3TWR A;  3FTW A;  5KCM A;  1TJC A;  5ENR D;  3Q9U C;  4APF A;  1WM5 A;  4GZ6 A;  5D0Q D;  4JD2 G;  2ION A;  3HXD A;  1EDU A;  4N3C A;  3PEU B;  4BWR A;  2XHE A;  3IV0 A;  3E37 A;  2GGF A;  4HRM B;  3Q47 B;  4UWL A;  3FFL A;  5CHE E;  4JHJ A;  3D9H A;  3ESL A;  2ZXW E;  3AG1 E;  3CK8 A;  4BY6 A;  4AM9 A;  2ILR A;  1DVP A;  4HXI A;  5KNG A;  3ASG A;  1ZB1 A;  4RLY A;  4XEI G;  2VTB A;  4UQX A;  3C98 A;  3ISM C;  4G25 A;  3U4T A;  2KCL A;  4G1T A;  4E85 A;  3ML8 A;  2EIL E;  4FU3 A;  5AJD A;  2WQH A;  4BTA A;  2Y1L E;  1LF8 A;  2WXF A;  3FTX A;  2IOS A;  4TUU A;  5A7D B;  3DEP A;  2WQ6 A;  4JHK A;  5CBO A;  2NC9 A;  4EZL A;  4DI3 A;  4JA7 A;  5CEC B;  2VGX A;  3D9I A;  4LNG A;  2R17 C;  1U3D A;  3ONL A;  2YHC A;  2M63 A;  1LD8 A;  3J5P A;  4YVQ C;  4GZ5 A;  2XRY A;  3MGB A;  4JPS A;  4LSZ E;  4ILI A;  3D9J A;  1Y8M A;  1E8W A;  3AG3 E;  2IOL A;  4DI4 A;  3L54 A;  3ZEF A;  3CR3 A;  2PZI A;  4AXH A;  4NIK A;  4JB8 P;  2F8X K;  4A3V A;  3NAW A;  3JUI A;  3PZ1 A;  1PC2 A;  4U0S A;  2IO2 C;  3L08 A;  3ZYL A;  5JJ7 A;  2XQ0 A;  2WM9 A;  3CST A;  3LCA A;  4D10 C;  3AG2 E;  5ENQ D;  4OVV A;  4EPZ A;  2GRM A;  1SQM A;  2LUH A;  3FUJ A;  3SO8 A;  2P9U G;  1OWP A;  4G23 A;  5BUZ A;  3Q79 A;  3LXU X;  3ZIM A;  1HS6 A;  3PS6 A;  2UWJ G;  1N52 A;  3QC1 A;  3PUK A;  4CT4 A;  1QNF A;  1O1T A;  2EIK E;  2FO7 A;  3AS8 A;  1U3C A;  1SZ9 A;  5FZQ A;  2XEN A;  4WAF A;  3ABL E;  4J0U A;  2AJA A;  3Q78 A;  3ENE A;  3Q4A B;  4K5C A;  2ZGD A;  1A17 A;  2J08 A;  2XGS A;  3TWT A;  4UWF A;  3L9T A;  3C3O A;  3EUV A;  5EX0 A;  3B7R L;  1NL4 A;  2L9B A;  1DCE A;  4UI9 C;  2XPY A;  1WDY A;  3RK6 A;  2XZD G;  2QY7 A;  4MLP A;  1BI7 B;  1OWO A;  5HKP A;  3LKU A;  5AQB A;  3UX4 A;  4I6J A;  5KNH D;  3MX3 A;  2BKG A;  2LAH A;  3CHR A;  3ZYQ A;  3E30 A;  2XEE A;  2Y69 E;  3ZHE A;  3EIQ C;  4U0U A;  2YQ8 A;  3MKQ A;  4K0R A;  4EQF A;  3S2A A;  1UN8 A;  3JQ0 A;  2Y3A A;  2JAB A;  3CHO A;  1KPS B;  2YHE A;  4QFV A;  1N4R A;  4C0E A;  5JA4 D;  3CV0 A;  3ZKJ A;  1H2V C;  2V8S E;  1D9S A;  3AJI A;  3UIP C;  3HG0 D;  4PS7 A;  4B89 A;  3LJ3 A;  3DWL G;  3UXG A;  2I6H A;  3U66 A;  1FT1 A;  3CQC B;  3Q7F A;  5E76 A;  1Z3X A;  3DXM G;  3FWV A;  3ABK E;  3E33 A;  5FZR A;  2A4Z A;  1O1S A;  3GZS A;  3UQ3 A;  1E8Y A;  4W9R A;  5CMY A;  3SHF A;  4FC8 A;  3U64 A;  1H19 A;  3O4Z A;  4CGV A;  3B95 A;  3J5Q B;  3DRA A;  4OAU C;  3CKC A;  3ZXS A;  4B94 A;  4HVB A;  3I5P A;  1ZU2 A;  1Z5S C;  2BUG A;  3PVL A;  3EHM A;  1NA3 A;  5AQ9 A;  3LVQ E;  2WVI A;  5J08 A;  4F7A A;  3CHM A;  1UOH A;  4A1G A;  1HZ4 A;  4CDM A;  4O6F A;  3T5X A;  5CCL A;  1X81 A;  2PNN A;  4ANW A;  1IXV A;  3W9F A;  4KBQ A;  3Q49 B;  2RKK A;  4JXT A;  3AU5 A;  4WND A;  4UWG A;  1JCQ A;  4C0M A;  3QB2 A;  1LTX A;  1H6K A;  3FUH A;  3TG5 A;  3ZYM A;  3FTS A;  1Z6T A;  3PZ2 A;  2HO1 A;  4XKC A;  2HE0 A;  2ZIS A;  5DIZ A;  1MZC A;  5ARF A;  4KVM A;  1N95 A;  3SBS A;  2CFU A;  2VSO E;  3SFY A;  3ULY A;  4ZFH A;  4GAA A;  1SZA A;  3HXC A;  4AY6 A;  2V4H C;  1ELW A;  2NYJ A;  1N94 A;  2AWI A;  1G3N B;  1NA0 A;  5BT1 A;  4F1S A;  4YDE A;  2RFM A;  3KSQ A;  4GA0 A;  4FP7 A;  4J8Y A;  4HRL A;  3LPZ A;  1KZO A;  3QOU A;  2QZA A;  3SNX A;  4BT9 A;  4KMO A;  2ZIR A;  1INZ A;  3UMV A;  2IO3 C;  4WNF A;  1WAO 1;  2H6H A;  4MS6 A;  2XRZ A;  2GW1 A;  4GYW A;  3Q7A A;  5KJM A;  4F53 A;  1ZBP A;  4OAV B;  2DCP A;  4GTV A;  4QQI A;  3U9W A;  3CK7 A;  4BSX A;  3L17 A;  2GRL A;  3ASD A;  3HIZ A;  3UM1 A;  4BX9 A;  2MOW A;  3EHR A;  3EHN A;  3TWX A;  3EHQ A;  2BF0 X;  2IFU A;  2RFA A;  5BW8 C;  2VSX E;  2WXG A;  3PEV B;  1N4P A;  4UI9 K;  4F1P A;  1JPL A;  4GPM A;  2LAI A;  3UT4 A;  2FI7 A;  3E34 A;  3APF A;  1H2T C;  2ZU6 B;  3DXK G;  3EU9 A;  4U07 A;  5FWQ A;  4JEH A;  4G8K A;  1S64 A;  4NQ0 A;  3TWW A;  2QC9 A;  2IY0 C;  2P9S G;  1S0P A;  2XCC A;  2XS1 A;  3CHS A;  4F3V A;  3GW4 A;  3NBN B;  4JHR A;  3FTY A;  4JA9 A;  3Q5M A;  2OV8 A;  4AJW A;  3DSW A;  3HXE A;  3O48 A;  4G26 A;  3T8K A;  3SFX A;  4HI9 A;  1FVF A;  1TNU A;  3DSU A;  5FQ8 A;  2I1J A;  3QDN A;  3HRA A;  5B3S E;  3FEX A;  5BXO A;  1IQR A;  4U63 A;  2OVB A;  2EIN E;  1HH8 A;  4V3I A;  2I9C A;  2JLB A;  5FTP A;  3R9M A;  1QZ2 A;  5KWD A;  3QAR A;  3ZW3 A;  2XEV A;  4GCN A;  3MZL B;  3HXF A;  4URK A;  3TAX A;  3UM0 A;  1BI8 B;  1TYQ G;  4HOQ A;  3SBT B;  4N3A A;  2CHW A;  4X8Q A;  5FQ6 A;  1HG2 A;  3L22 A;  4Q94 A;  4NAC A;  3UM2 A;  5HQ8 A;  3FHE A;  3BQO A;  4DRX E;  2WXL A;  1N11 A;  3L82 A;  2B0O E;  2E0I A;  4PDX A;  3UKU G;  2P9N G;  2WQ7 A;  1YA0 A;  3S7D A;  5ANR A;  3FU3 A;  3RAU A;  3ZVV A;  3ESK A;  3C3Q A;  3BG0 B;  1N0Q A;  4KZC A;  4DPR A;  3QK0 A;  3VTX A;  3V2X A;  4CGW A;  4NUR A;  1V55 E;  2P2C P;  3CGH A;  1QYM A;  4YDO A;  2XPZ A;  4GTS A;  4OVU A;  1HX8 A;  3LYA A;  1S70 B;  2NSZ A;  5G04 C;  3SD5 A;  2LSV A;  4R7L A;  3CVP A;  3BUA A;  2EIM E;  3FH7 A;  2Y0B G;  2PM7 A;  3KAE A;  3Q15 A;  2QFC A;  4FLH A;  1IYG A;  5AQ7 A;  3PZ4 A;  4ACL A;  1KT1 A;  1MX6 A;  4DLQ A;  4I9E A;  4MKT A;  4UWK A;  3JXJ A;  1K1A A;  3FUE A;  3CSF A;  4WWP A;  1O5M A;  2L6J A;  5FQ4 A;  4K5A B;  2R59 A;  3LY8 A;  4NRH B;  3Q73 A;  2H6I A;  4EBA G;  2P9L G;  3G2T A;  4CEM A;  4HQD A;  5KJL A;  4B0Z A;  3G2V A;  4ANV A;  2WXO A;  4GZC A;  4YVO A;  2KM4 A;  5M72 A;  4BEP A;  5BV1 A;  1UN9 A;  1OCR E;  1WG0 A;  2J07 A;  4XX5 A;  4GTR A;  3UKR G;  2LNI A;  2V5F A;  4DX5 D;  3RKV A;  3FUI A;  1JWG A;  2OCC E;  1IQU A;  4XZ4 A;  3CIA A;  1K3Z D;  1LD7 A;  5AN8 A;  3T9K A;  3CVV A;  3HHM A;  1SVX A;  1KZP A;  4B8C B;  3RRU A;  2VGE A;  1BD8 A;  1OCZ E;  5ENN A;  3NOC D;  3FP3 A;  3LS8 A;  4HRN A;  3AS4 A;  4I2Z A;  3KEZ A;  2EIJ E;  2V5Q C;  4XI9 A;  2Q7F A;  4L23 A;  4TXR A;  3ZUV B;  1TNZ A;  5G05 J;  3UT8 A;  5C1D A;  3CVU A;  3SQV A;  4I6E A;  3DSX A;  3L16 A;  4Y6C A;  3VLF A;  3AS5 A;  4WUY A;  4HOR A;  1UW4 B;  5FJY A;  3ULQ A;  2F0Y A;  1E90 A;  4C9B B;  4IUL A;  4KYO B;  2MYO A;  5T4Y A;  2LO6 A;  1L5J A;  4I43 A;  3MEK A;  3NZU A;  2HYZ A;  3IEG A;  4ANU A;  4RG9 A;  5C2Y A;  1EPU A;  4WWO A;  1H2U A;  5EDS A;  1KLX A;  4PS3 A;  1OWL A;  5CED B;  1SW6 A;  4DX7 D;  5FT9 A;  1UJK A;  3EIJ A;  4U04 A;  5BXU A;  1TN8 A;  2J4D A;  2PL2 A;  2J09 A;  5HI7 A;  3AU4 A;  3DPD A;  5FZS A;  4BTB A;  4A3T A;  4GU5 A;  3D9O A;  3TL5 A;  4L9P A;  2AXZ A;  5ENO D;  5JHB A;  2VTB B;  1AWC B;  4FA6 A;  4YND A;  5EX3 A;  4H7X A;  3I4G A;  5AQA A;  4GTO A;  1SA4 A;  3TWV A;  4FHJ A;  4M3O A;  2IJG X;  3R7Q A;  3IHY A;  1S63 A;  2J4B A;  4O60 A;  1JCR A;  2JEK A;  3LVR E;  3FTU A;  4HOU A;  3FU6 A;  3UPV A;  3T8M A;  3FUL A;  5CRV A;  5IY5 E;  3FUF A;  4BT8 A;  5AJL A;  4J8D A;  3FU5 A;  3SY2 A;  2XPI A;  4UQY A;  4BES A;  1B89 A;  3GZ2 A;  2DZN A;  2DBA A;  2UY1 B;  4AOF A;  1TNB A;  3D9K A;  1TNO A;  2RG8 A;  4GMJ A;  2VGX B;  1IHG A;  2X6K A;  4ATZ D;  3LJN A;  4ME2 A;  5EIB E;  2R03 A;  4IYP A;  3HVE B;  3FU0 A;  1JWF A;  3P1U A;  4XE0 A;  2C2L A;  3GZ1 A;  3JXI A;  1TN6 A;  2FBN A;  3FY4 A;  4U0Z A;  3APD A;  2BKK B;  3DST A;  4J8E A;  3I3N A;  2X38 A;  3RSE G;  4XI0 A;  4DLO A;  1OCC E;  3S7F A;  2WXP A;  5BV0 A;  4GZD A;  5EYL A;  4I2W A;  2B6C A;  1ELR A;  1EYH A;  3W9G A;  3URZ A;  1HO8 A;  3EDT B;  2OOE A;  4PH4 B;  3D3M A;  3SFZ A;  3V31 A;  3DBS A;  4BX8 A;  5G2N A;  3V79 K;  4DK5 A;  4JC8 A;  4HB5 A;  2WB2 A;  1JUQ A;  1TR4 A;  2J9Q A;  2QYU A;  5JJT A;  4Q69 A;  2GRR B;  2P58 C;  1HF8 A;  5ARG A;  1TNY A;  1PY1 A;  3RRM B;  4EBA A;  4E6H A;  3IXE A;  3MA5 A;  2GRQ B;  5JHA A;  5LCW C;  2ZGG A;  4TXQ A;  5T3R A;  5LX8 A;  3CVX A;  2CHX A;  1N4Q A;  3JUE A;  5A6C A;  4Y6W A;  4U8H A;  2HR2 A;  4FLB A;  2CG3 A;  2CFZ A;  2PM6 A;  4HS2 A;  4UWH A;  3ZFW A;  2WXR A;  4P29 A;  4L2Y A; 
#chains in the Genus database with same CATH homology
 2WXL A;  5LFA A;  1OWP A;  4RSY A;  1HG5 A;  3NQP A;  1Y6I A;  2E0I A;  4G23 A;  4PDX A;  1DNP A;  3LEW A;  3LXU X;  5BUZ A;  3ZIM A;  2WQ7 A;  1HS6 A;  1YA0 A;  3PS6 A;  3D9P A;  3CEQ A;  2X6I A;  5AYW D;  2UWJ G;  1N52 A;  5ANR A;  1HE8 A;  3S7D A;  4ANX A;  2FUL A;  1XGW A;  3FU3 A;  3QC1 A;  3ZVV A;  2FEZ A;  3ESK A;  3PUK A;  3BG0 B;  4I1O B;  4CT4 A;  1QNF A;  4Q96 A;  4KZC A;  4DPR A;  3QK0 A;  2V0P A;  2V4L A;  3L6A A;  2FO7 A;  3AS8 A;  3CVQ A;  3ONK A;  4N5C A;  3TJP A;  3VTX A;  4IRU A;  3B7T A;  4CGW A;  3CKB A;  4NUR A;  1U3C A;  4ILH B;  2L0I A;  3CGH A;  1SZ9 A;  2VJ8 A;  2XPZ A;  2DIW A;  3MKQ B;  4K03 A;  4OVU A;  2IQC A;  3QAQ A;  2A5U A;  1HX8 A;  3CK9 A;  3LYA A;  5G05 C;  3CVY A;  5FZQ A;  2NSZ A;  5G04 C;  3SD5 A;  4ABN A;  4BFR A;  2LSV A;  4R7L A;  4WAF A;  4EZJ A;  3CVP A;  4AP2 A;  4GA1 A;  4J0U A;  3RU0 A;  4HOS A;  3FH7 A;  3ENE A;  3Q4A B;  2PM7 A;  1A17 A;  3QJZ A;  3KAE A;  3Q15 A;  2QFC A;  3MV3 B;  4FLH A;  2J08 A;  1IYG A;  2XGS A;  2XGM A;  4UWF A;  3FEY A;  4ACL A;  4AY5 A;  5EX0 A;  4J8F A;  1KT1 A;  4DLQ A;  3CVN A;  5EKQ D;  3ZPJ A;  4I6G A;  4KT6 B;  3FDH A;  1XNF A;  2KAT A;  3B7R L;  1FVH A;  2IU1 A;  3GYZ A;  4I9E A;  3MCX A;  4MKT A;  2I2O A;  4UWK A;  2L9B A;  3FUE A;  4XIF A;  1HFA A;  3CSF A;  2MHK A;  4WWP A;  4UI9 C;  2L6J A;  2XPY A;  3T5V A;  4LRZ A;  4FHK A;  5FQ4 A;  5JJ6 A;  3RK6 A;  2QY7 A;  4MLP A;  1OWO A;  2R59 A;  3LY8 A;  4H7Y A;  3LY9 A;  3LKU A;  4G2V A;  4NRH B;  3ZGQ A;  3G2S A;  2X3M A;  3UX4 A;  3CVL A;  4AV7 A;  4EBA G;  1P5Q A;  4I6J A;  4IN3 B;  3MX3 A;  2KCV A;  2LAH A;  3CHR A;  3OXG A;  3G2T A;  3ZYQ A;  4A1S A;  3FUM A;  2XGO A;  3RJV A;  4CEM A;  5KJL A;  3ZHE A;  3ZHE B;  3RO3 A;  4B0Z A;  3QKY A;  1MHQ A;  4GYO A;  3EIQ C;  3TXN A;  3G2V A;  4ANV A;  2WXO A;  3HDX A;  4U0U A;  2YQ8 A;  3PH0 C;  3MKQ A;  4GZC A;  1E7U A;  2KM4 A;  3CHP A;  4YVO A;  5M72 A;  1ELK A;  4K0R A;  1E96 B;  2PQN A;  3S2A A;  1UN8 A;  4EQF A;  1UN9 A;  2J49 A;  3JQ0 A;  2Y3A A;  5BV1 A;  4MRU A;  2J07 A;  4XX5 A;  5FQ7 A;  2WXQ A;  2LNI A;  3CHO A;  2V5F A;  4CDR A;  5AEN A;  3TGO A;  3JCK C;  3RKV A;  2YHE A;  1JWG A;  3FUI A;  3FUN A;  4GCO A;  4J6I A;  3QWV A;  4JZY A;  4J8S A;  4QFV A;  2AW6 A;  3TXM A;  3MKR A;  4LCT A;  1IQU A;  4I17 A;  4XZ4 A;  1VDY A;  4C0E A;  3CIA A;  5KJN A;  3IBE A;  3CV0 A;  4JEU A;  4L7T A;  5LP0 A;  1X5B A;  4ILG A;  1H2V C;  2WXJ A;  3PRZ A;  4UQZ A;  3PUJ A;  3OTN A;  2V8S E;  2WXM A;  3NF1 A;  3HHM A;  4TV3 A;  3CVV A;  1N54 A;  1Z3Y A;  3LY7 A;  1OUV A;  3ASH A;  4JVS A;  3JQ1 A;  4B8C B;  1HXI A;  4LER A;  3RRU A;  4PS7 A;  3ZYK A;  3PNL B;  1WY6 A;  3G2U A;  4B89 A;  1PAQ A;  3U3W A;  4HOT A;  1BPO A;  3LJ3 A;  2KZT A;  5BNW A;  4FUL A;  2I6H A;  5ENN A;  2X6H A;  3FP3 A;  2XCB A;  3G2W A;  3LS8 A;  4G11 A;  3U66 A;  4AIF A;  3CQC B;  4PUC A;  3UUX A;  3ML9 A;  3OAW A;  5E76 A;  3AS4 A;  4I2Z A;  1Z3X A;  3KEZ A;  3QWP A;  2OVF A;  2IF4 A;  4XI9 A;  4G24 A;  3E4B A;  2I1K A;  4FAD A;  2Q7F A;  3FWV A;  3CHQ A;  4L23 A;  5FZR A;  5G05 J;  2A4Z A;  3UT8 A;  2VYI A;  3GZS A;  3SGH A;  3QNK A;  3CQG B;  3UQ3 A;  5G04 J;  2AXU A;  5C1D A;  3CVU A;  1E8Y A;  3APC A;  4I1A A;  4W9R A;  5CMY A;  1EF1 C;  4EEC A;  4I6E A;  3FTV A;  4FC8 A;  3SHF A;  3U64 A;  3L16 A;  4Y6C A;  3P2B A;  3VLF A;  2OND A;  2Y4U A;  3AS5 A;  1H19 A;  4WUY A;  4HOR A;  1UW4 B;  3O4Z A;  2PQR A;  4CGV A;  5FJY A;  3ULQ A;  1FCH A;  3SZ7 A;  4N2Q A;  3CKC A;  3ZXS A;  2X6F A;  4WNE A;  3I5P A;  1ZU2 A;  5DBK A;  3VLE A;  4B94 A;  4CT0 A;  2X6J A;  3PE3 A;  3NZS A;  4RG6 A;  1E90 A;  4L1B A;  5AIJ A;  3ZRH A;  4C9B B;  2BUG A;  4IUL A;  4KYO B;  3FUK A;  3PVL A;  2LO6 A;  4PS8 A;  5T4Y A;  1NZN A;  4AVX A;  3EHM A;  1MQS A;  2KCK A;  3PNT B;  1NA3 A;  3PZD A;  1L5J A;  2WXI A;  3MEK A;  3D9L A;  3LVQ E;  2AXV A;  3NZU A;  4I43 A;  2WVI A;  4FJZ A;  2L0T B;  5J08 A;  2HYZ A;  4F7A A;  3CHM A;  3IEG A;  4A1G A;  4ANU A;  4N2S A;  4UI9 J;  2LSU A;  2C0M A;  4RG9 A;  4ACK A;  1HZ4 A;  4CDM A;  4O6F A;  3T5X A;  5C2Y A;  1EPU A;  5CCL A;  4WWO A;  1H2U A;  2KZT B;  4ANW A;  2NXP A;  4GA2 A;  5EDS A;  4CCA A;  3B7U X;  2R5S A;  4KBQ A;  3Q49 B;  2WXN A;  1KLX A;  4LUN U;  4PS3 A;  2AVP A;  1OWL A;  3PDN A;  4JXT A;  3PE4 A;  3AU5 A;  4WND A;  3BEE A;  4UWG A;  4WWN A;  3SF4 A;  2RD0 A;  5FT9 A;  3IHV A;  2EQX A;  3R9A B;  1UJK A;  3QB2 A;  4C0M A;  1UG3 A;  3EIJ A;  1H6K A;  3FUH A;  3TG5 A;  4U04 A;  4N39 A;  3ZYM A;  3QWW A;  3FTS A;  5T8I A;  1Z6T A;  3MJW A;  2UY1 A;  2HO1 A;  4FJY A;  2J4D A;  3RRN B;  4XKC A;  4KXK B;  2PL2 A;  1TJF A;  2J09 A;  5HI7 A;  5A23 A;  4GML A;  3B7S A;  3N71 A;  3ASF A;  3K9I A;  1NP7 A;  3AU4 A;  3OXF A;  5CCM A;  3B13 A;  2VSN A;  3DPD A;  5FZS A;  3WXX A;  5DIZ A;  4BTB A;  3LDZ A;  4A3T A;  4GU5 A;  1KT0 A;  3EJN A;  3D9O A;  5E75 A;  3TL5 A;  4HLE A;  3VLD A;  2AXZ A;  5ARF A;  4KVM A;  3SBS A;  2CFU A;  4HFG A;  3HVE A;  2VSO E;  3UT7 A;  5JHB A;  1E8X A;  2VTB B;  2VGY A;  1GW6 A;  4YND A;  4I1M A;  5EX3 A;  4FA6 A;  4GAA A;  4H7X A;  3I4G A;  2CG2 A;  1SZA A;  4AY6 A;  4LEU A;  2WPV A;  1ELW A;  1H0A A;  2AWI A;  2CHZ A;  4L2L A;  3RO2 A;  1NA0 A;  5BT1 A;  4FHJ A;  4F1S A;  4M3O A;  2IJG X;  5LOZ A;  3IHY A;  3R7Q A;  4GA0 A;  2J4B A;  2JEK A;  3S7J A;  3CLJ A;  4FP7 A;  3LVR E;  4RVB A;  2Y4T A;  3FTU A;  3LPZ A;  3QOU A;  3FTW A;  4HVB A;  5KCM A;  4HOU A;  1TJC A;  2FF4 A;  3FU6 A;  3PRE A;  3UPV A;  3SNX A;  2YNQ A;  3T8M A;  4KMO A;  4BT9 A;  3IKO B;  3FUL A;  4APF A;  1WM5 A;  4GZ6 A;  5D0Q D;  3FUF A;  1INZ A;  4BT8 A;  2ION A;  5AJL A;  1E8Z A;  4J8D A;  3FU5 A;  3UMV A;  4WNF A;  1WAO 1;  4WNG A;  1EDU A;  3FH5 A;  2XPI A;  4N3C A;  4UQY A;  4MS6 A;  1B89 A;  3PEU B;  4BWR A;  2GW1 A;  2VSY A;  3GZ2 A;  4GYW A;  2XRZ A;  5KJM A;  2DBA A;  2XHE A;  2UY1 B;  3FTZ A;  3IV0 A;  4AOF A;  4F53 A;  3D9K A;  2GGF A;  2RG8 A;  3Q47 B;  2VGX B;  4GMJ A;  4UWL A;  1IHG A;  1ZBP A;  4KZ0 A;  3FFL A;  5CHE E;  4JHJ A;  2X6K A;  3ESL A;  2DCP A;  2WMN A;  4ME2 A;  3CK8 A;  3U9W A;  4IYP A;  3HVE B;  3OXL A;  4BY6 A;  2VQ2 A;  3CK7 A;  4AM9 A;  4BSX A;  3FU0 A;  3L17 A;  1JWF A;  1QQE A;  2ILR A;  1DVP A;  2GRL A;  3P1U A;  3ASD A;  3HIZ A;  4HXI A;  3D9N A;  4BX9 A;  3SI5 A;  4XE0 A;  3ASG A;  2C2L A;  2MOW A;  2VTB A;  3GZ1 A;  3EHN A;  3HYM B;  4UQX A;  3C98 A;  4G25 A;  2KCL A;  2FBN A;  4G1T A;  4XKB A;  2BF0 X;  3FY4 A;  3U4T A;  4GPK A;  2IFU A;  4U0Z A;  3APD A;  4GZ3 A;  4E85 A;  5BW8 C;  1TEZ A;  3ML8 A;  2VSX E;  3VTY A;  2WXG A;  3BG1 B;  3PEV B;  4UI9 K;  4J8E A;  1JPL A;  3JYS A;  4FU3 A;  3I3N A;  2X38 A;  5AJD A;  2LAI A;  2WQH A;  4XI0 A;  4DLO A;  4BTA A;  3S7F A;  2WXP A;  3UT4 A;  5BV0 A;  1LF8 A;  2FI7 A;  2WXF A;  3FTX A;  3TG4 A;  2IOS A;  4GZD A;  3APF A;  1H2T C;  4I2W A;  2ZU6 B;  1EYH A;  1ELR A;  4TUU A;  5BPP A;  4U07 A;  5FWQ A;  5A7D B;  3URZ A;  4JEH A;  1HO8 A;  3EDT B;  5CMW A;  2E2E A;  4NQ0 A;  4OYS A;  2WQ6 A;  2OOE A;  4JHK A;  4PH4 B;  1S0P A;  2XCC A;  3D3M A;  3SFZ A;  3CHS A;  4F3V A;  3D9M A;  3DBS A;  3GW4 A;  2NC9 A;  4AEZ C;  4EZL A;  4BX8 A;  5G2N A;  2MRI A;  4DI3 A;  4JHR A;  3FTY A;  4JA7 A;  4DK5 A;  4JA9 A;  3Q5M A;  4JC8 A;  1W3B A;  2VGX A;  4JW1 A;  2WB2 A;  1JUQ A;  2OV8 A;  3D9I A;  2R17 C;  2J9Q A;  1U3D A;  3I4R B;  3ONL A;  4EZK A;  2YHC A;  3R7R A;  1E7V A;  2M63 A;  4AJW A;  1HU3 A;  4YVQ C;  4GZ5 A;  5JJT A;  4Q69 A;  3O48 A;  2XRY A;  3MGB A;  4G26 A;  4JPS A;  1OWN A;  4APO A;  1FVF A;  2P58 C;  5FQ8 A;  3RIB A;  2I1J A;  2YIN A;  1HF8 A;  3CVW A;  3QDN A;  2HM8 A;  4ILI A;  3D9J A;  5ARG A;  2KC7 A;  1Y8M A;  1E8W A;  1PY1 A;  3FEX A;  2IOL A;  3ZN3 A;  1IQR A;  3L54 A;  4U63 A;  3RRM B;  2OVB A;  4CDN A;  3ZEF A;  4DI4 A;  3CR3 A;  2PZI A;  4B8A A;  4AXH A;  1HH8 A;  3KS2 A;  4V3I A;  4ATG A;  4EBA A;  2I9C A;  2JLB A;  4I9C A;  4A55 A;  5FTP A;  4E6H A;  1QZ2 A;  1UJJ A;  1OWM A;  3QAR A;  4A3V A;  3ZW3 A;  3KD7 A;  5KJK A;  4GYY A;  5LCW J;  3S7B A;  2XEV A;  5D0O D;  3MA5 A;  4GCN A;  3MZL B;  3JUI A;  1PC2 A;  4URK A;  2WMO A;  5JHA A;  2C0L A;  3TAX A;  4TRQ A;  4U0S A;  4KVO A;  5LCW C;  3L08 A;  4N3B A;  5T3R A;  4HOQ A;  3ZYL A;  5LX8 A;  3SBT B;  5JJ7 A;  3CVX A;  2CHX A;  4N3A A;  2XQ0 A;  4CRW A;  3FH8 A;  2CHW A;  2WM9 A;  3CST A;  3MYV A;  5A6C A;  3FUD A;  3LCA A;  4D10 C;  4Y6W A;  2BTD A;  4U8H A;  5FQ6 A;  5J90 A;  5ANL A;  1HG2 A;  3L22 A;  2HR2 A;  4FLB A;  2CG3 A;  2CFZ A;  4OVV A;  4Q94 A;  2GRM A;  4EPZ A;  4NAC A;  1SQM A;  2PM6 A;  4HS2 A;  4DJA A;  2WXH A;  4GB9 A;  3FUJ A;  4UWH A;  3ZFW A;  5HQ8 A;  2WXR A;  3FHE A;  3L13 A;  3MV2 B;  4JL0 A;  2WXK A;  4P29 A;  4L2Y A;  5G55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...