2FULA

Crystal structure of the c-terminal domain of s. cerevisiae eif5
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
161
Chain Sequence
SPEFVNSELTQLDEYGEWILEQAGEDKENLPSDVELYKKAAELDVLNDPKIGCVLAQCLFDEDIVNEIAEHNAFFTKILVTPEYEKNFMGGIERFLGLEHKDLIPLLPKILVQLYNNDIISEEEIMRFGTKSSKKFVPKEVSKKVRRAAKPFITWLETAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the C-terminal Domain of S.cerevisiae eIF5
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5
total genus 59
structure length 161
sequence length 170
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fulA01
3EIQC 3D3MA 4JHJA 4B8CB 1H2VC 4JHKA 4B89A 4GMJA 5ANRA 1H6KA 2GGFA 1PAQA 2ZU6B 2IU1A 3L6AA 4IULA 1HU3A 2RG8A 1N54A 1UG3A 2IONA 3FEYA 2HM8A 3JUIA 4CEMA 3RK6A 4CT4A 2I2OA 2KZTB 4B8AA 2NSZA 2KZTA 4LUNU 1N52A 4C9BB 3EIJA 3FEXA 4GMLA 4CRWA 2IOLA 1UW4B 2IOSA 2VSOE 1H2TC 2VSXE 2FULA 1H2UA
chains in the Genus database with same CATH superfamily
4PS7A 3DSTA 5FQ8A 3URZA 3ZYQA 3PZDA 5T3RA 5G05J 1E7VA 3ZYKA 4GZ6A 2A5EA 2XRZA 3MYVA 1D8EA 3V2OA 4RLYA 1W3BA 3FTVA 2GRPB 4XZ4A 2RFMA 5HI7A 4AIFA 3RRNB 1HG5A 2VQ2A 3UM2A 3LVRE 4J8FA 2YQ8A 3BUAA 1AWCB 4JEUA 5DIZA 4RQIA 3GZ2A 1K1AA 1S70B 3HVEB 4KZ0A 5AJDA 4ANXA 5D2MC 5EIDA 4FJYA 2WMNA 1Z3YA 4Q96A 5JJ6A 3L54A 2UY1A 4X8QA 3D9NA 4JL0A 2FEZA 1HS6A 1N52A 4FA6A 3CKBA 1EDUA 3QK0A 5AYWD 4F1PA 2CFUA 1KT0A 2LSUA 3SI5A 5BT1A 2AXZA 5EDSA 4FULA 5E75A 2WXJA 4L23A 4I6EA 2E0IA 4R7LA 3SQVA 3KD7A 3UIPC 5EYLA 4N5QA 2KXPC 2NYJA 4ACKA 3LJ3A 3PZ2A 1EYHA 3ZHEA 1A17A 1WDYA 4GTPA 4GZCA 4O1PA 5KJMA 2KM4A 2ZGDA 1H2UA 2CG3A 1DCEA 4Z68A 4BT9A 3NOCD 2L0TB 3SFZA 4AEZC 3CHRA 4JVSA 4GYWA 4H7YA 4DK5A 2QYJA 4F1SA 4HOUA 5KNGA 2HE0A 5EX0A 4KYOB 1K8KG 1KLXA 3BEEA 1N4RA 3S7JA 2DBAA 1QBQA 1X81A 3CQGB 3QAQA 3CVYA 4A55A 3T9KA 1S63A 1ELKA 3ABLE 3PVLA 4XI9A 3UT7A 3W9FA 1O1RA 3TXNA 2WQHA 2J08A 3MKRA 3U64A 1NP7A 2IJGX 3CGHA 1QQEA 3OXLA 4CGVA 1Z5SC 5FJYA 2I9CA 2L0IA 1EPUA 1IQRA 4PS8A 4LCTA 5ENRD 3UKUG 4C0MA 1E8YA 4O6FA 4ILIA 3ZW3A 3RU0A 2OV8A 3EU9A 2GRMA 4FP7A 5M72A 2WXRA 3G2UA 2ZIRA 4GMLA 1E96B 3G2WA 3V79K 3Q79A 4TUUA 3EHQA 3D9IA 4G26A 5ENPD 4YDEA 2H6GA 2XPZA 3Q4AB 3GZSA 4IRUA 1PAQA 4HOTA 3RAUA 2FBNA 4IYPA 2CHZA 4LRZA 5LFAA 1UOHA 2P9PG 4K5BA 3Q7FA 1PY1A 4AXHA 4BERA 4L2YA 2GROB 4UWGA 3OAWA 3SFYA 4K5AB 1VDYA 1S0PA 3AG1E 5FTPA 3FTXA 3P1UA 4KBQA 3DEPA 2JEKA 4ZHBA 4I2ZA 1LD7A 4C9BB 3TXMA 3K9IA 3JUEA 5HQ8A 4APOA 4JHJA 3I5PA 2VGXB 3Q47B 1OCOE 3RO3A 3UQ3A 3AG3E 5CMWA 1HE8A 1IYGA 3IXEA 4GTOA 3B13A 4P29A 3BU8A 4BESA 2KBXA 3CKCA 1JCRA 4N39A 5C1DA 3HG0D 2Y4UA 2IOLA 3S7DA 3D9HA 2VJ8A 3PS6A 2XRYA 4G25A 3HXBA 3C98A 2C0MA 4XE0A 2B0OE 4FJZA 4IULA 2DWZA 4EZKA 3UM3A 2P58C 1MZCA 4TV3A 2PL2A 1FCHA 3FEXA 3HHMA 2J9QA 4GZ3A 3DSWA 1G3NB 4OVVA 2LXLA 2Y0BG 4N3BA 2GRLA 3QWVA 1OXJA 2GRRB 5KJNA 1N54A 1DC2A 3NOGD 3FY4A 4UI9K 1TNBA 2L6BA 3RKVA 4WNFA 3FUNA 1P5QA 3APDA 4FHJA 2XS1A 5BW8C 2KCKA 2XZDG 3MX3A 4QQIA 2V0PA 2ETBA 4GA2A 1HU3A 4DX7D 4AJWA 2V5FA 5T4YA 3D9PA 3JYSA 5DBKA 2F0YA 3LXUX 2J49A 4IN3B 5HRYA 3N71A 4DX2A 1HFAA 3FU0A 5KWDA 4DX6D 2P9UG 5J90A 3FH5A 5EILA 3ZRHA 3TAXA 1JCQA 5KJKA 2IEJA 3AJIA 2VYIA 1Y8MA 4ME2A 4JPSA 2X6KA 4RG6A 4C0EA 4J8SA 2PNNA 2EQXA 1K3ZD 5G55A 2LNIA 4H7XA 1NL4A 3FU5A 5ARFA 3SNXA 2XEHA 2VSYA 2LUHA 1TNZA 3FTWA 1JPLA 2VTBB 3TWXA 3VLDA 3SHFA 3VLFA 4ATGA 4D10C 5BUZA 1Y6IA 3P2BA 3J5QB 1HH8A 2H6HA 4XEIG 2XGSA 5LCWJ 3JQ0A 4F7AA 3PZ4A 3CVNA 3CR3A 4EECA 3R9MA 2J07A 3CSTA 4Y6CA 1N9AA 2LAIA 3CK9A 3T8MA 4DPRA 3TGOA 1MX6A 3EUVA 1JWGA 3UTMA 2IOSA 2M63A 5FZQA 3T5XA 1SQMA 2R17C 2JLBA 3ASDA 1PC2A 3BG0B 1HZ4A 1MYOA 3ASGA 3MJWA 1UJKA 4BY6A 2BKGA 2PM6A 1LD8A 3FUFA 2EILE 5A7DB 3I3NA 1D9SA 3Q9NC 1H6KA 1O5MA 1Z3XA 3PE3A 5LOZA 4JEHA 1AP7A 5CBNA 4G24A 4U95D 3NAWA 4YNDA 1TJFA 4DUIA 2ILRA 3TJPA 3Q75A 1NFIE 3QWPA 4F6RD 5IY5E 4U63A 3NQPA 3NZSA 2VTBA 2P9LG 3FHEA 4HRMB 1E8XA 3IHYA 4JD2G 4CDNA 4GMRA 2QFCA 3ULEG 4A3TA 4LNGA 4AVXA 4B8AA 4FU3A 4EPZA 2WXMA 3EDTB 4BWRA 3KAEA 2X6HA 2XEVA 3KEZA 2VGXA 3AS5A 3AU4A 2R03A 3LVQE 2ONDA 3UIOC 4UI9J 4I1OB 4XX5A 3C3OA 4RSYA 1TN6A 3MCXA 3IBEA 3FUKA 2XS8A 4UWLA 4U8YD 1H19A 3L82A 3LCAA 1TR4A 2CHXA 1IHGA 4EZJA 1N94A 3TWSA 1KPSB 3CIAA 3DPYA 3E37A 2CG2A 4O1OA 4CCAA 5FQ6A 3CVQA 4L1BA 3ABME 1H6PA 3CQCB 3PEVB 3EJNA 1OT8A 5AENA 3EHNA 5EX3A 4B89A 2WPVA 3L17A 4J8EA 2FF4A 2X6IA 4HLEA 2WVIA 1K1BA 3T5VA 4GTMA 2WQ6A 1O1SA 4BEPA 4GZ5A 3ZXSA 1Z6TA 3CLJA 1UN8A 4B93B 2ZU6B 2PZIA 1NA0A 3CEQA 1MHQA 3WG7E 4U8VD 1WM5A 2P9NG 5C2YA 3EIJA 1WY6A 3NBNB 4YVQC 2EIKE 1HX8A 3D9MA 1YMPA 3FUIA 2IU1A 1ELWA 3ZN3A 3PUJA 3VTXA 3TWVA 4BT8A 1YCSB 2VSXE 5KJLA 1OCRE 4PUCA 5CCLA 2GRNB 5KBAA 3JQ1A 1N0RA 3IEGA 4ILHB 4BETA 4EBAA 2BEDA 5BV1A 5JHAA 4J8DA 2AXVA 4BX8A 4UQXA 4XKBA 3ASNE 5FQ4A 4WUYA 1MX2A 4E6HA 4L7TA 4GCNA 4GTQA 3MEKA 3SO8A 3E30A 4I43A 5CCMA 3U3WA 1YYHA 4JC8A 2J4BA 4U0SA 3TG5A 2R59A 3G2TA 4HORA 3UINC 2E2EA 1H6OA 3SBTB 3ZEFA 3ZGQA 4UUCA 3UKRG 3UT8A 4F53A 2FO7A 5FZSA 4HOQA 2H6IA 4HOSA 2MYOA 3FH7A 5KNHD 1QYMA 5ENSD 2F8YA 3PDNA 4N3AA 2HM8A 1HG2A 4Y6WA 3T8KA 4PDXA 3L22A 3UX4A 3EU5A 4V3IA 3OXGA 1OCZE 2YINA 3RRMB 3RSEG 3Q49B 4LNUD 1WG0A 2NC9A 1U3CA 1E8WA 3CVXA 2X38A 3NB2A 1E8ZA 2KZTA 2P9IG 1V55E 2QC9A 4LEUA 3ESKA 2EIME 2VSOE 3E4BA 3CHOA 4BFRA 4MKTA 2EIJE 2HYZA 4J0UA 4B94A 3O48A 3ASFA 2P9SG 3EHMA 4MLPA 2OOEA 4HLLA 4HB5A 2I1JA 4I6GA 4I6JA 4U0UA 2WQ7A 1SA4A 3JCKC 3CV0A 4ILGA 4FLBA 5KCMA 2ZISA 5LCWC 5ENOD 4GYOA 5AAOA 1INZA 3ESLA 3FTSA 3UUXA 3FU3A 4GPKA 4A3VA 4YDWA 2WM9A 2X6FA 5LX8A 3FTZA 3TL5A 4KT6B 3LS8A 4XI0A 4ATZD 4FC8A 1SA5A 1TNUA 4U7EB 4LG6A 3QB2A 4G8LA 3SBSA 2KZTB 3ZKJA 1DVPA 3PH0C 4UWHA 2VGEA 3ZUVB 1OUVA 5D0OD 5LP0A 4ANVA 4OAVB 2BKKB 4OYSA 2HO1A 3CSFA 3EHRA 3ASOE 4ACLA 4HVBA 4TXPA 4J8YA 4CEMA 1LTXA 1FVHA 2QYUA 4I2WA 1IKND 3PNLB 5CHEE 3AS4A 2V4HC 4FLHA 2HR2A 3CVWA 3CK7A 1HXIA 2UY1B 3ZNGA 4I9EA 3C72A 1IHBA 2WXIA 3KSQA 4CT4A 4WWNA 3MA5A 5JJ7A 1OWMA 4DLOA 3EIQC 3NF1A 2OEVA 1HO8A 2DYSE 4DX5D 1H2VC 3JXIA 2VGYA 4GA1A 3Q5MA 1MJ0A 1SZ9A 1GW6A 3UXGA 3L16A 3ZU7B 1TYQG 4FHKA 3C5RA 3DSSA 5BXOA 3HDXA 5G04J 1FPPA 4WWOA 4A1SA 1OWLA 2BF0X 4LNBA 5G05C 4W9RA 4MBGA 1BI8B 1N11A 3FP3A 3HYMB 3SD5A 2OCCE 5JHBA 3ML8A 3U9WA 3TWTA 4JA7A 4NACA 2Y4TA 2I2OA 3SZ7A 4PH4B 3ASHA 1H2TC 2PQRA 2WXGA 2Y1LE 2FULA 4WAFA 4HI9A 4KZCA 1BPOA 4TXQA 3LEWA 1SVXA 3APFA 4Q94A 2Y69E 3C3RA 3R7RA 2YHCA 4K0RA 4GYYA 3IV0A 2C0LA 2VSNA 1OY3D 4DI3A 2YNQA 2DIWA 3V30A 4AOFA 3MV2B 4ABNA 2WB2A 1ZU2A 2ETAA 2J09A 2IO2C 5BV0A 3LJNA 4GA0A 4B8CB 4BTAA 5CEDB 3MKQB 2A5UA 4HRNA 4U04A 1B89A 3QARA 2V5QC 3Q9UC 2L9BA 2R5SA 1X5BA 3IKOB 5ENNA 4HS2A 2R05A 2A4ZA 3B95A 4K5CA 5FZRA 2ZGGA 4BTBA 5H7PA 1TN7A 3UT4A 3Q78A 3AAAC 5EN5D 4Q69A 3ONLA 1N4PA 3ML9A 3DWLG 3RIBA 3HRAA 3D9JA 3AG2E 2R02A 2OVFA 5EKQD 2FO1E 2RG8A 4UWKA 3AU5A 3KS2A 5AQ9A 5CMYA 3TG4A 1HF8A 2MOWA 4AV7A 3Q15A 3ISMC 4U07A 4DJAA 3Q7AA 2XCCA 3L13A 3HXCA 3U4TA 3FUHA 4G11A 3Q73A 2WXPA 3ULYA 3ZXPA 3E32A 2IY0C 5ANLA 2KATA 5AIJA 2KCLA 4GPMA 2GGFA 2RFAA 3HXDA 2ZXWE 3JXJA 5BPPA 2WXKA 3CHSA 3DXMG 3ZIMA 3ABKE 3QJZA 3FUEA 2CFZA 3AS8A 5ARGA 2X6JA 4CT0A 2J4DA 4K03A 3ZFWA 2WXQA 1TN8A 2Q7FA 1N95A 2AVPA 4PS3A 3VTYA 1TNOA 3DPDA 5FINA 1QNFA 1KT1A 4NIKA 3FWVA 1H0AA 4RG9A 3ENEA 2JABA 3CVUA 3S7FA 4LUNU 3CVVA 2AWIA 4G1TA 1OWNA 1N4QA 3U66A 4GTTA 4JW1A 3QKYA 3DBSA 3ZVVA 3PEUB 4CZ2D 3QC1A 2IF4A 3I4GA 4I1AA 4G23A 2LSVA 4HQDA 5B3SE 4ANUA 3S2AA 5ITZF 1BU9A 3MZLB 4BSXA 3J5PA 4GAAA 2AJAA 2XGMA 2J8SD 1UJJA 3CK8A 4UI9C 5CEAA 1A5EA 3S7BA 1ZBPA 4CDMA 4BX9A 4L2LA 1FT1A 1TNYA 3L08A 3KSLA 4DRXE 4AM9A 3ONKA 4XIFA 4U0ZA 5CRVA 1OCCE 2ETCA 4F3VA 3D9LA 4WNEA 3NZUA 4GTSA 2XGOA 4EBAG 1OWOA 2KCVA 2XPYA 2LXMA 2IONA 5FQ7A 3ZHEB 4J6IA 3CHMA 4YDOA 2H6FA 4HBDA 4LSZE 1E90A 1DNPA 2XQ0A 3TWRA 2PM7A 4HI8A 1WAO1 3UPVA 2DVWA 3D3MA 3B7SA 5JJTA 3G2VA 4GMJA 4E85A 5ANRA 5CBOA 5JMND 2OVBA 3MKQA 1JCSA 5FIOA 3TWQA 3V31A 5BXUA 3CVPA 4U96D 3DRAA 3LKUA 4UQZA 4C48B 4NURA 3FULA 1LF8A 2Y3AA 4TXRA 3BQOA 3UMVA 4HNAD 1ELRA 4WWPA 2WXOA 3E33A 4U8HA 4APFA 1NZNA 4EQFA 2RD0A 2F37A 1MQSA 3L6AA 3QNKA 3E34A 4L9PA 3JUIA 4TRQA 3DEOA 3FTYA 3RO2A 1ZB1A 1L5JA 1NI1A 4O60A 1Q2ZA 4HFGA 1TJCA 3VLEA 3LY7A 1D8DA 3QDNA 2I1KA 3X2QE 4AP2A 5FWQA 3CHQA 2LAHA 3DXKG 5A23A 4GTRA 3PE4A 2F8XK 2R2LA 4GB9A 4UQYA 2NXPA 2XEEA 4A63B 3PZ3A 3UM0A 4CYMD 2YHEA 2DZOA 5AQBA 1U3DA 3TWUA 3FU6A 2FI7A 3MV3B 4NQ0A 5CECB 5B1BE 1NA3A 1JUQA 2GW1A 2LO6A 3PUKA 1YA0A 3SF4A 5B1AE 4QFVA 2KC7A 4J7WA 4AY5A 4BSZB 3FFLA 3GZ1A 2UWJG 4FADA 2I6HA 3I4RB 3DSXA 5ENTD 2IO3C 3B7BA 3LY8A 3HXEA 2B6CA 3D9KA 4KMOA 5AQ7A 2XCBA 4KVOA 3LY9A 3R7QA 1FVFA 1U2VG 3ULQA 3B7UX 4GZDA 5FT9A 1EF1C 4LERA 3DSUA 3QOUA 4WNDA 4DLQA 3SGHA 2WXLA 4JHKA 4I9CA 3OTNA 3F6QA 3IHVA 4GU5A 4N3CA 2DYRE 2DZNA 4GCOA 4HXIA 2CHWA 5A6CA 5HS0A 2WMOA 3PREA 2MHKA 4G2VA 5D66A 3HVEA 5JA4D 3KEAA 3FTUA 4CGWA 2BUGA 4RVBA 4WNGA 1IXVA 4CRWA 3FUMA 3ZYLA 4JZYA 1V54E 5AJLA 4I1MA 1JWFA 4DX1A 2QY7A 2WXNA 2AXUA 3V2XA 4M7CA 4AY6A 2WXFA 5G04C 2EINE 4HRLA 3HXFA 4MS6A 4N2QA 4ZFHA 1E7UA 3CVLA 3WXXA 3FUJA 3W9GA 2NSZA 2P9KG 2XPIA 4UWFA 4URKA 1TEZA 2V8SE 4XKCA 3UI2A 3FUDA 1KZPA 4CDRA 4OAUC 3RK6A 1SW6A 1RW2A 3BG1B 2XENA 4KVMA 2DCPA 3PRZA 2XHEA 1N4SA 5AQAA 1XNFA 3C3QA 4DI4A 1MX4A 2BTDA 4B0ZA 5ENQD 4EHMA 2PQNA 1KZOA 3MGBA 3FEYA 3LYAA 1BLXB 4KXKB 4OVUA 2OEWA 1BD8A 1DCQA 1UW4B 3D9OA 5E76A 3PZ1A 1XGWA 1BI7B 4JHRA 2RKKA 4NRHB 3LPZA 5CERB 2X3MA 3O4ZA 3SY2A 3L9TA 3FDHA 3DSVA 4YVOA 3RRUA 2L6JA 1S64A 5D0QD 3APCA 3RJVA 1UN9A 5BNWA 4JA9A 1QZ2A 3ZPJA 5J08A 4A1GA 1IQUA 2MRIA 4EZLA 2WXHA 4I17A 4ANWA 3SFXA 3GYZA 1OWPA 3PNTB 5AARA 5G2NA 4TUMA 5EIBE 3TWWA 4M3OA 3R9AB 4MRUA 1O1TA 4N5CA 1RZ4A 2QZAA 5HKPA 3B7RL 2C2LA 4JB8P 1UG3A 5EYPF 2V4LA 1N0QA 4G8KA 3UM1A 3B7TA 5CRUA 3ZYMA 1SZAA 3LDZA 3GW4A 2XZTG 3QWWA 4YDYA 3FH8A 3HIZA 3AG4E 4JXTA 5T8IA 4N2SA 4GTVA 3G2SA 5AN8A 2AW6A 3OXFA 2GRQB 2IFUA 3CHPA 2IQCA 2P2CP 1FT2A
chains in the Genus database with same CATH topology
4GAAA 5J90A 4PS7A 5FQ8A 3CHOA 3URZA 4MKTA 3ZYQA 3PZDA 5T3RA 3FH5A 4BFRA 5G05J 2HYZA 1E7VA 2XGMA 3ZYKA 4GZ6A 2XRZA 4J0UA 1UJJA 3CK8A 4B94A 3MYVA 3ZRHA 3TAXA 4UI9C 3O48A 3S7BA 1ZBPA 3ASFA 4CDMA 3EHMA 4BX9A 1W3BA 3FTVA 4L2LA 4MLPA 5KJKA 4XZ4A 2OOEA 3L08A 5HI7A 4AIFA 2I1JA 3RRNB 2VYIA 4I6GA 1HG5A 4I6JA 1Y8MA 4ME2A 4JPSA 4U0UA 2VQ2A 4AM9A 2WQ7A 3ONKA 4XIFA 4U0ZA 3LVRE 4F3VA 2X6KA 4RG6A 4J8FA 3JCKC 4C0EA 2YQ8A 3D9LA 3CV0A 4J8SA 4WNEA 4ILGA 2EQXA 3NZUA 5G55A 2XGOA 4FLBA 1OWOA 2LNIA 4H7XA 5KCMA 2KCVA 4JEUA 5DIZA 4EBAG 3FU5A 5LCWC 2XPYA 5ARFA 4GYOA 3SNXA 1INZA 2IONA 5FQ7A 3ESLA 3FTSA 3ZHEB 3GZ2A 2VSYA 3HVEB 4KZ0A 3UUXA 5AJDA 3FU3A 4J6IA 3CHMA 4A3VA 4ANXA 4GPKA 3FTWA 1JPLA 1E90A 2WM9A 2X6FA 5LX8A 1DNPA 4FJYA 2XQ0A 3FTZA 2VTBB 2PM7A 3VLDA 1WAO1 3UPVA 2WMNA 3D3MA 1Z3YA 4Q96A 4KT6B 5JJ6A 3B7SA 3LS8A 4XI0A 3SHFA 3TL5A 5JJTA 3G2VA 3L54A 4GMJA 5ANRA 4E85A 4FC8A 2OVBA 3MKQA 2UY1A 3VLFA 3CVPA 3LKUA 4UQZA 3D9NA 4ATGA 4NURA 4D10C 5BUZA 3FULA 4JL0A 1LF8A 1Y6IA 3P2BA 2Y3AA 1HH8A 3QB2A 2FEZA 1HS6A 3UMVA 3SBSA 2KZTB 2XGSA 1ELRA 4WWPA 1DVPA 1N52A 3PH0C 4UWHA 4FA6A 5LCWJ 3CKBA 3JQ0A 1EDUA 2WXOA 3QK0A 1OUVA 4U8HA 5D0OD 4APFA 4F7AA 5LP0A 4ANVA 3CVNA 3CR3A 5AYWD 4EECA 1NZNA 4OYSA 4EQFA 2CFUA 1KT0A 2HO1A 2LSUA 2RD0A 3SI5A 3CSFA 5BT1A 2J07A 2AXZA 3L6AA 3CSTA 1MQSA 5EDSA 3QNKA 4Y6CA 4FULA 4ACLA 4HVBA 2LAIA 5E75A 3CK9A 3JUIA 3T8MA 2WXJA 4TRQA 1FVHA 3FTYA 4L23A 4CEMA 4DPRA 4I2WA 3RO2A 3TGOA 4I6EA 1JWGA 1L5JA 2E0IA 4R7LA 3KD7A 2IOSA 3PNLB 5CHEE 3AS4A 2M63A 5FZQA 3T5XA 4FLHA 1SQMA 2HR2A 4HFGA 4ACKA 3CK7A 3CVWA 1TJCA 1HXIA 2R17C 2UY1B 3VLEA 4I9EA 2JLBA 3LY7A 3LJ3A 3QDNA 3ASDA 1PC2A 3BG0B 2I1KA 1EYHA 3ZHEA 4AP2A 1A17A 5FWQA 3CHQA 1HZ4A 2LAHA 4GZCA 2WXIA 5A23A 4CT4A 3ASGA 3MJWA 1UJKA 4WWNA 5KJMA 4BY6A 3PE4A 3MA5A 2PM6A 5JJ7A 2KM4A 3FUFA 1OWMA 4GB9A 4DLOA 4UQYA 2NXPA 3EIQC 3NF1A 1H2UA 2CG3A 1HO8A 1H2VC 4BT9A 5A7DB 3I3NA 1H6KA 1Z3XA 2L0TB 3PE3A 2YHEA 5LOZA 2VGYA 4JEHA 4G24A 3Q5MA 4GA1A 1SZ9A 1U3DA 3SFZA 4AEZC 3CHRA 3FU6A 4YNDA 1TJFA 1GW6A 3L16A 4JVSA 2ILRA 4FHKA 2FI7A 3MV3B 3TJPA 4NQ0A 4GYWA 3HDXA 5G04J 4H7YA 4WWOA 1NA3A 1OWLA 3QWPA 1JUQA 4A1SA 4U63A 4DK5A 3NQPA 4F1SA 2BF0X 4HOUA 2GW1A 2LO6A 3PUKA 3NZSA 1YA0A 3SF4A 5EX0A 2VTBA 4KYOB 5G05C 1KLXA 3BEEA 3FHEA 4W9RA 1E8XA 3SD5A 3HYMB 3FP3A 3IHYA 4CDNA 3S7JA 5JHBA 4QFVA 2DBAA 2KC7A 3CQGB 3ML8A 3U9WA 4AY5A 2QFCA 3FFLA 3GZ1A 4A3TA 2UWJG 3QAQA 4JA7A 4AVXA 3CVYA 4A55A 4FADA 4NACA 2Y4TA 2I2OA 4B8AA 1ELKA 4FU3A 4EPZA 3SZ7A 4PH4B 2WXMA 2I6HA 3I4RB 3EDTB 3ASHA 3PVLA 4XI9A 3UT7A 1H2TC 2PQRA 2WXGA 4BWRA 3LY8A 2FULA 3KAEA 2X6HA 2XEVA 2WQHA 3D9KA 4WAFA 3TXNA 3KEZA 4KMOA 2VGXA 2J08A 3AS5A 3AU4A 3MKRA 3U64A 2XCBA 1NP7A 3LVQE 2ONDA 4KZCA 4KVOA 1BPOA 2IJGX 4UI9J 3CGHA 3LY9A 1QQEA 3LEWA 3OXLA 4CGVA 3R7QA 4I1OB 1FVFA 4XX5A 5FJYA 4RSYA 3ULQA 3APFA 3MCXA 3B7UX 2I9CA 2L0IA 4Q94A 4GZDA 3IBEA 5FT9A 1EF1C 3FUKA 1EPUA 4LERA 1IQRA 4PS8A 3R7RA 3QOUA 4WNDA 4DLQA 4LCTA 2YHCA 4K0RA 3SGHA 4GYYA 4C0MA 1E8YA 3IV0A 4UWLA 4O6FA 2C0LA 2VSNA 2WXLA 4ILIA 4JHKA 4I9CA 3ZW3A 3OTNA 1H19A 3IHVA 4GU5A 4N3CA 4DI3A 4GCOA 4HXIA 2CHWA 5A6CA 3LCAA 3RU0A 2WMOA 2CHXA 1IHGA 2MHKA 3PREA 2OV8A 4G2VA 3HVEA 2YNQA 4EZJA 3CIAA 2GRMA 3FTUA 4FP7A 4CGWA 2DIWA 5M72A 2CG2A 2BUGA 4AOFA 3MV2B 4RVBA 2WXRA 4ABNA 4CCAA 2WB2A 5FQ6A 1ZU2A 2J09A 4WNGA 3G2UA 3CVQA 4GMLA 4L1BA 1E96B 3G2WA 3FUMA 4CRWA 4TUUA 3ZYLA 3D9IA 5BV0A 4G26A 3CQCB 4JZYA 3PEVB 3EJNA 5AJLA 4GA0A 4I1MA 4B8CB 1JWFA 4BTAA 5AENA 3EHNA 2QY7A 2A5UA 2WXNA 3MKQB 2AXUA 2XPZA 3GZSA 3Q4AB 4IRUA 5EX3A 4B89A 2WPVA 4U04A 1B89A 2WXFA 1PAQA 5G04C 4AY6A 3QARA 3L17A 4MS6A 4HOTA 4J8EA 2FF4A 2FBNA 2X6IA 4HLEA 4N2QA 4IYPA 2CHZA 4LRZA 2L9BA 2WVIA 5LFAA 2R5SA 1X5BA 3IKOB 1E7UA 3CVLA 3WXXA 5ENNA 3T5VA 4HS2A 2WQ6A 3FUJA 2NSZA 2XPIA 1PY1A 4UWFA 2A4ZA 4GZ5A 3ZXSA 4AXHA 4URKA 1TEZA 1Z6TA 4L2YA 5FZRA 2V8SE 3CLJA 4BTBA 4UWGA 1UN8A 3OAWA 4XKCA 2ZU6B 3FUDA 2PZIA 1NA0A 3UT4A 1VDYA 1S0PA 3CEQA 1MHQA 5FTPA 3FTXA 3P1UA 4CDRA 4Q69A 4KBQA 1WM5A 3RK6A 3ONLA 2JEKA 3ML9A 5C2YA 3BG1B 4I2ZA 3RIBA 4KVMA 2DCPA 3PRZA 3EIJA 2XHEA 3TXMA 3K9IA 4C9BB 1WY6A 3D9JA 1XNFA 5HQ8A 4YVQC 4DI4A 2BTDA 4APOA 4JHJA 4B0ZA 1HX8A 3D9MA 3I5PA 2OVFA 5EKQD 3FUIA 2IU1A 2PQNA 2VGXB 1ELWA 3Q47B 3RO3A 2RG8A 3MGBA 3UQ3A 4UWKA 3ZN3A 3FEYA 3LYAA 3PUJA 5CMWA 3AU5A 3KS2A 1HE8A 5CMYA 3TG4A 3VTXA 4KXKB 4OVUA 1IYGA 4BT8A 1HF8A 1UW4B 2MOWA 2VSXE 4AV7A 3D9OA 3Q15A 5E76A 5KJLA 1XGWA 4PUCA 4U07A 4JHRA 4DJAA 4NRHB 5CCLA 2XCCA 3LPZA 3L13A 3B13A 3JQ1A 4P29A 2X3MA 3O4ZA 3FDHA 3U4TA 3CKCA 4YVOA 3FUHA 4G11A 3IEGA 4ILHB 4EBAA 3RRUA 2L6JA 5BV1A 5JHAA 4J8DA 2AXVA 2WXPA 4N39A 5C1DA 5D0QD 3APCA 3RJVA 4UQXA 4BX8A 1UN9A 4XKBA 2Y4UA 2IOLA 3S7DA 2VJ8A 5BNWA 5FQ4A 3PS6A 4WUYA 2XRYA 5ANLA 4JA9A 1QZ2A 4G25A 3ZPJA 2KATA 4E6HA 4L7TA 5J08A 3C98A 1IQUA 2MRIA 4GCNA 4A1GA 5AIJA 4EZLA 2WXHA 2C0MA 3MEKA 4XE0A 4I17A 4ANWA 4I43A 5CCMA 2KCLA 3U3WA 2GGFA 3GYZA 4FJZA 4IULA 2J4BA 4JC8A 4U0SA 2R59A 3TG5A 4EZKA 3G2TA 5BPPA 4HORA 1OWPA 2WXKA 3PNTB 3CHSA 2E2EA 2P58C 5G2NA 4TV3A 3ZIMA 3SBTB 3QJZA 2PL2A 3FUEA 2CFZA 3ZEFA 1FCHA 3AS8A 2X6JA 5ARGA 3ZGQA 4CT0A 4M3OA 3FEXA 2J4DA 4K03A 3R9AB 3HHMA 2J9QA 3ZFWA 2WXQA 4MRUA 2Q7FA 3UT8A 4GZ3A 4F53A 4N5CA 2FO7A 2AVPA 4HOQA 5FZSA 4OVVA 4HOSA 3B7RL 4PS3A 4N3BA 3FH7A 2GRLA 3VTYA 3DPDA 3QWVA 1QNFA 3PDNA 2C2LA 1KT1A 5KJNA 1N54A 4N3AA 1UG3A 2V4LA 2HM8A 3FWVA 1HG2A 1H0AA 4RG9A 4Y6WA 3ENEA 3FY4A 3CVUA 4UI9K 4PDXA 3S7FA 4LUNU 3CVVA 3L22A 3UX4A 2AWIA 4G1TA 1OWNA 3U66A 3B7TA 3RKVA 3ZYMA 4V3IA 1SZAA 4WNFA 3FUNA 4JW1A 1P5QA 3APDA 3OXGA 3QKYA 4FHJA 5BW8C 2KCKA 3DBSA 3ZVVA 3MX3A 3PEUB 2YINA 3RRMB 2V0PA 3LDZA 3GW4A 3QC1A 3Q49B 4GA2A 2NC9A 1U3CA 1E8WA 2IF4A 3I4GA 3CVXA 1HU3A 3QWWA 4AJWA 2V5FA 3FH8A 4I1AA 5T4YA 2X38A 4G23A 2LSVA 3D9PA 3JYSA 3HIZA 4JXTA 1E8ZA 5T8IA 4N2SA 4ANUA 3S2AA 5DBKA 3G2SA 2KZTA 3LXUX 2J49A 2AW6A 3OXFA 4IN3B 4LEUA 3ESKA 3N71A 2VSOE 2IFUA 3CHPA 2IQCA 3MZLB 4BSXA 1HFAA 3E4BA 3FU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIQ C;  3D3M A;  4JHJ A;  4B8C B;  1H2V C;  4JHK A;  4B89 A;  4GMJ A;  5ANR A;  1H6K A;  2GGF A;  1PAQ A;  2ZU6 B;  2IU1 A;  3L6A A;  4IUL A;  1HU3 A;  2RG8 A;  1N54 A;  1UG3 A;  2ION A;  3FEY A;  2HM8 A;  3JUI A;  4CEM A;  3RK6 A;  4CT4 A;  2I2O A;  2KZT B;  4B8A A;  2NSZ A;  2KZT A;  4LUN U;  1N52 A;  4C9B B;  3EIJ A;  3FEX A;  4GML A;  4CRW A;  2IOL A;  1UW4 B;  2IOS A;  2VSO E;  1H2T C;  2VSX E;  2FUL A;  1H2U A; 
#chains in the Genus database with same CATH topology
 4PS7 A;  3DST A;  5FQ8 A;  3URZ A;  3ZYQ A;  3PZD A;  5T3R A;  5G05 J;  1E7V A;  3ZYK A;  4GZ6 A;  2A5E A;  2XRZ A;  3MYV A;  1D8E A;  3V2O A;  4RLY A;  1W3B A;  3FTV A;  2GRP B;  4XZ4 A;  2RFM A;  5HI7 A;  4AIF A;  3RRN B;  1HG5 A;  2VQ2 A;  3UM2 A;  3LVR E;  4J8F A;  2YQ8 A;  3BUA A;  1AWC B;  4JEU A;  5DIZ A;  4RQI A;  3GZ2 A;  1K1A A;  1S70 B;  3HVE B;  4KZ0 A;  5AJD A;  4ANX A;  5D2M C;  5EID A;  4FJY A;  2WMN A;  1Z3Y A;  4Q96 A;  5JJ6 A;  3L54 A;  2UY1 A;  4X8Q A;  3D9N A;  4JL0 A;  2FEZ A;  1HS6 A;  1N52 A;  4FA6 A;  3CKB A;  1EDU A;  3QK0 A;  5AYW D;  4F1P A;  2CFU A;  1KT0 A;  2LSU A;  3SI5 A;  5BT1 A;  2AXZ A;  5EDS A;  4FUL A;  5E75 A;  2WXJ A;  4L23 A;  4I6E A;  2E0I A;  4R7L A;  3SQV A;  3KD7 A;  3UIP C;  5EYL A;  4N5Q A;  2KXP C;  2NYJ A;  4ACK A;  3LJ3 A;  3PZ2 A;  1EYH A;  3ZHE A;  1A17 A;  1WDY A;  4GTP A;  4GZC A;  4O1P A;  5KJM A;  2KM4 A;  2ZGD A;  1H2U A;  2CG3 A;  1DCE A;  4Z68 A;  4BT9 A;  3NOC D;  2L0T B;  3SFZ A;  4AEZ C;  3CHR A;  4JVS A;  4GYW A;  4H7Y A;  4DK5 A;  2QYJ A;  4F1S A;  4HOU A;  5KNG A;  2HE0 A;  5EX0 A;  4KYO B;  1K8K G;  1KLX A;  3BEE A;  1N4R A;  3S7J A;  2DBA A;  1QBQ A;  1X81 A;  3CQG B;  3QAQ A;  3CVY A;  4A55 A;  3T9K A;  1S63 A;  1ELK A;  3ABL E;  3PVL A;  4XI9 A;  3UT7 A;  3W9F A;  1O1R A;  3TXN A;  2WQH A;  2J08 A;  3MKR A;  3U64 A;  1NP7 A;  2IJG X;  3CGH A;  1QQE A;  3OXL A;  4CGV A;  1Z5S C;  5FJY A;  2I9C A;  2L0I A;  1EPU A;  1IQR A;  4PS8 A;  4LCT A;  5ENR D;  3UKU G;  4C0M A;  1E8Y A;  4O6F A;  4ILI A;  3ZW3 A;  3RU0 A;  2OV8 A;  3EU9 A;  2GRM A;  4FP7 A;  5M72 A;  2WXR A;  3G2U A;  2ZIR A;  4GML A;  1E96 B;  3G2W A;  3V79 K;  3Q79 A;  4TUU A;  3EHQ A;  3D9I A;  4G26 A;  5ENP D;  4YDE A;  2H6G A;  2XPZ A;  3Q4A B;  3GZS A;  4IRU A;  1PAQ A;  4HOT A;  3RAU A;  2FBN A;  4IYP A;  2CHZ A;  4LRZ A;  5LFA A;  1UOH A;  2P9P G;  4K5B A;  3Q7F A;  1PY1 A;  4AXH A;  4BER A;  4L2Y A;  2GRO B;  4UWG A;  3OAW A;  3SFY A;  4K5A B;  1VDY A;  1S0P A;  3AG1 E;  5FTP A;  3FTX A;  3P1U A;  4KBQ A;  3DEP A;  2JEK A;  4ZHB A;  4I2Z A;  1LD7 A;  4C9B B;  3TXM A;  3K9I A;  3JUE A;  5HQ8 A;  4APO A;  4JHJ A;  3I5P A;  2VGX B;  3Q47 B;  1OCO E;  3RO3 A;  3UQ3 A;  3AG3 E;  5CMW A;  1HE8 A;  1IYG A;  3IXE A;  4GTO A;  3B13 A;  4P29 A;  3BU8 A;  4BES A;  2KBX A;  3CKC A;  1JCR A;  4N39 A;  5C1D A;  3HG0 D;  2Y4U A;  2IOL A;  3S7D A;  3D9H A;  2VJ8 A;  3PS6 A;  2XRY A;  4G25 A;  3HXB A;  3C98 A;  2C0M A;  4XE0 A;  2B0O E;  4FJZ A;  4IUL A;  2DWZ A;  4EZK A;  3UM3 A;  2P58 C;  1MZC A;  4TV3 A;  2PL2 A;  1FCH A;  3FEX A;  3HHM A;  2J9Q A;  4GZ3 A;  3DSW A;  1G3N B;  4OVV A;  2LXL A;  2Y0B G;  4N3B A;  2GRL A;  3QWV A;  1OXJ A;  2GRR B;  5KJN A;  1N54 A;  1DC2 A;  3NOG D;  3FY4 A;  4UI9 K;  1TNB A;  2L6B A;  3RKV A;  4WNF A;  3FUN A;  1P5Q A;  3APD A;  4FHJ A;  2XS1 A;  5BW8 C;  2KCK A;  2XZD G;  3MX3 A;  4QQI A;  2V0P A;  2ETB A;  4GA2 A;  1HU3 A;  4DX7 D;  4AJW A;  2V5F A;  5T4Y A;  3D9P A;  3JYS A;  5DBK A;  2F0Y A;  3LXU X;  2J49 A;  4IN3 B;  5HRY A;  3N71 A;  4DX2 A;  1HFA A;  3FU0 A;  5KWD A;  4DX6 D;  2P9U G;  5J90 A;  3FH5 A;  5EIL A;  3ZRH A;  3TAX A;  1JCQ A;  5KJK A;  2IEJ A;  3AJI A;  2VYI A;  1Y8M A;  4ME2 A;  4JPS A;  2X6K A;  4RG6 A;  4C0E A;  4J8S A;  2PNN A;  2EQX A;  1K3Z D;  5G55 A;  2LNI A;  4H7X A;  1NL4 A;  3FU5 A;  5ARF A;  3SNX A;  2XEH A;  2VSY A;  2LUH A;  1TNZ A;  3FTW A;  1JPL A;  2VTB B;  3TWX A;  3VLD A;  3SHF A;  3VLF A;  4ATG A;  4D10 C;  5BUZ A;  1Y6I A;  3P2B A;  3J5Q B;  1HH8 A;  2H6H A;  4XEI G;  2XGS A;  5LCW J;  3JQ0 A;  4F7A A;  3PZ4 A;  3CVN A;  3CR3 A;  4EEC A;  3R9M A;  2J07 A;  3CST A;  4Y6C A;  1N9A A;  2LAI A;  3CK9 A;  3T8M A;  4DPR A;  3TGO A;  1MX6 A;  3EUV A;  1JWG A;  3UTM A;  2IOS A;  2M63 A;  5FZQ A;  3T5X A;  1SQM A;  2R17 C;  2JLB A;  3ASD A;  1PC2 A;  3BG0 B;  1HZ4 A;  1MYO A;  3ASG A;  3MJW A;  1UJK A;  4BY6 A;  2BKG A;  2PM6 A;  1LD8 A;  3FUF A;  2EIL E;  5A7D B;  3I3N A;  1D9S A;  3Q9N C;  1H6K A;  1O5M A;  1Z3X A;  3PE3 A;  5LOZ A;  4JEH A;  1AP7 A;  5CBN A;  4G24 A;  4U95 D;  3NAW A;  4YND A;  1TJF A;  4DUI A;  2ILR A;  3TJP A;  3Q75 A;  1NFI E;  3QWP A;  4F6R D;  5IY5 E;  4U63 A;  3NQP A;  3NZS A;  2VTB A;  2P9L G;  3FHE A;  4HRM B;  1E8X A;  3IHY A;  4JD2 G;  4CDN A;  4GMR A;  2QFC A;  3ULE G;  4A3T A;  4LNG A;  4AVX A;  4B8A A;  4FU3 A;  4EPZ A;  2WXM A;  3EDT B;  4BWR A;  3KAE A;  2X6H A;  2XEV A;  3KEZ A;  2VGX A;  3AS5 A;  3AU4 A;  2R03 A;  3LVQ E;  2OND A;  3UIO C;  4UI9 J;  4I1O B;  4XX5 A;  3C3O A;  4RSY A;  1TN6 A;  3MCX A;  3IBE A;  3FUK A;  2XS8 A;  4UWL A;  4U8Y D;  1H19 A;  3L82 A;  3LCA A;  1TR4 A;  2CHX A;  1IHG A;  4EZJ A;  1N94 A;  3TWS A;  1KPS B;  3CIA A;  3DPY A;  3E37 A;  2CG2 A;  4O1O A;  4CCA A;  5FQ6 A;  3CVQ A;  4L1B A;  3ABM E;  1H6P A;  3CQC B;  3PEV B;  3EJN A;  1OT8 A;  5AEN A;  3EHN A;  5EX3 A;  4B89 A;  2WPV A;  3L17 A;  4J8E A;  2FF4 A;  2X6I A;  4HLE A;  2WVI A;  1K1B A;  3T5V A;  4GTM A;  2WQ6 A;  1O1S A;  4BEP A;  4GZ5 A;  3ZXS A;  1Z6T A;  3CLJ A;  1UN8 A;  4B93 B;  2ZU6 B;  2PZI A;  1NA0 A;  3CEQ A;  1MHQ A;  3WG7 E;  4U8V D;  1WM5 A;  2P9N G;  5C2Y A;  3EIJ A;  1WY6 A;  3NBN B;  4YVQ C;  2EIK E;  1HX8 A;  3D9M A;  1YMP A;  3FUI A;  2IU1 A;  1ELW A;  3ZN3 A;  3PUJ A;  3VTX A;  3TWV A;  4BT8 A;  1YCS B;  2VSX E;  5KJL A;  1OCR E;  4PUC A;  5CCL A;  2GRN B;  5KBA A;  3JQ1 A;  1N0R A;  3IEG A;  4ILH B;  4BET A;  4EBA A;  2BED A;  5BV1 A;  5JHA A;  4J8D A;  2AXV A;  4BX8 A;  4UQX A;  4XKB A;  3ASN E;  5FQ4 A;  4WUY A;  1MX2 A;  4E6H A;  4L7T A;  4GCN A;  4GTQ A;  3MEK A;  3SO8 A;  3E30 A;  4I43 A;  5CCM A;  3U3W A;  1YYH A;  4JC8 A;  2J4B A;  4U0S A;  3TG5 A;  2R59 A;  3G2T A;  4HOR A;  3UIN C;  2E2E A;  1H6O A;  3SBT B;  3ZEF A;  3ZGQ A;  4UUC A;  3UKR G;  3UT8 A;  4F53 A;  2FO7 A;  5FZS A;  4HOQ A;  2H6I A;  4HOS A;  2MYO A;  3FH7 A;  5KNH D;  1QYM A;  5ENS D;  2F8Y A;  3PDN A;  4N3A A;  2HM8 A;  1HG2 A;  4Y6W A;  3T8K A;  4PDX A;  3L22 A;  3UX4 A;  3EU5 A;  4V3I A;  3OXG A;  1OCZ E;  2YIN A;  3RRM B;  3RSE G;  3Q49 B;  4LNU D;  1WG0 A;  2NC9 A;  1U3C A;  1E8W A;  3CVX A;  2X38 A;  3NB2 A;  1E8Z A;  2KZT A;  2P9I G;  1V55 E;  2QC9 A;  4LEU A;  3ESK A;  2EIM E;  2VSO E;  3E4B A;  3CHO A;  4BFR A;  4MKT A;  2EIJ E;  2HYZ A;  4J0U A;  4B94 A;  3O48 A;  3ASF A;  2P9S G;  3EHM A;  4MLP A;  2OOE A;  4HLL A;  4HB5 A;  2I1J A;  4I6G A;  4I6J A;  4U0U A;  2WQ7 A;  1SA4 A;  3JCK C;  3CV0 A;  4ILG A;  4FLB A;  5KCM A;  2ZIS A;  5LCW C;  5ENO D;  4GYO A;  5AAO A;  1INZ A;  3ESL A;  3FTS A;  3UUX A;  3FU3 A;  4GPK A;  4A3V A;  4YDW A;  2WM9 A;  2X6F A;  5LX8 A;  3FTZ A;  3TL5 A;  4KT6 B;  3LS8 A;  4XI0 A;  4ATZ D;  4FC8 A;  1SA5 A;  1TNU A;  4U7E B;  4LG6 A;  3QB2 A;  4G8L A;  3SBS A;  2KZT B;  3ZKJ A;  1DVP A;  3PH0 C;  4UWH A;  2VGE A;  3ZUV B;  1OUV A;  5D0O D;  5LP0 A;  4ANV A;  4OAV B;  2BKK B;  4OYS A;  2HO1 A;  3CSF A;  3EHR A;  3ASO E;  4ACL A;  4HVB A;  4TXP A;  4J8Y A;  4CEM A;  1LTX A;  1FVH A;  2QYU A;  4I2W A;  1IKN D;  3PNL B;  5CHE E;  3AS4 A;  2V4H C;  4FLH A;  2HR2 A;  3CVW A;  3CK7 A;  1HXI A;  2UY1 B;  3ZNG A;  4I9E A;  3C72 A;  1IHB A;  2WXI A;  3KSQ A;  4CT4 A;  4WWN A;  3MA5 A;  5JJ7 A;  1OWM A;  4DLO A;  3EIQ C;  3NF1 A;  2OEV A;  1HO8 A;  2DYS E;  4DX5 D;  1H2V C;  3JXI A;  2VGY A;  4GA1 A;  3Q5M A;  1MJ0 A;  1SZ9 A;  1GW6 A;  3UXG A;  3L16 A;  3ZU7 B;  1TYQ G;  4FHK A;  3C5R A;  3DSS A;  5BXO A;  3HDX A;  5G04 J;  1FPP A;  4WWO A;  4A1S A;  1OWL A;  2BF0 X;  4LNB A;  5G05 C;  4W9R A;  4MBG A;  1BI8 B;  1N11 A;  3FP3 A;  3HYM B;  3SD5 A;  2OCC E;  5JHB A;  3ML8 A;  3U9W A;  3TWT A;  4JA7 A;  4NAC A;  2Y4T A;  2I2O A;  3SZ7 A;  4PH4 B;  3ASH A;  1H2T C;  2PQR A;  2WXG A;  2Y1L E;  2FUL A;  4WAF A;  4HI9 A;  4KZC A;  1BPO A;  4TXQ A;  3LEW A;  1SVX A;  3APF A;  4Q94 A;  2Y69 E;  3C3R A;  3R7R A;  2YHC A;  4K0R A;  4GYY A;  3IV0 A;  2C0L A;  2VSN A;  1OY3 D;  4DI3 A;  2YNQ A;  2DIW A;  3V30 A;  4AOF A;  3MV2 B;  4ABN A;  2WB2 A;  1ZU2 A;  2ETA A;  2J09 A;  2IO2 C;  5BV0 A;  3LJN A;  4GA0 A;  4B8C B;  4BTA A;  5CED B;  3MKQ B;  2A5U A;  4HRN A;  4U04 A;  1B89 A;  3QAR A;  2V5Q C;  3Q9U C;  2L9B A;  2R5S A;  1X5B A;  3IKO B;  5ENN A;  4HS2 A;  2R05 A;  2A4Z A;  3B95 A;  4K5C A;  5FZR A;  2ZGG A;  4BTB A;  5H7P A;  1TN7 A;  3UT4 A;  3Q78 A;  3AAA C;  5EN5 D;  4Q69 A;  3ONL A;  1N4P A;  3ML9 A;  3DWL G;  3RIB A;  3HRA A;  3D9J A;  3AG2 E;  2R02 A;  2OVF A;  5EKQ D;  2FO1 E;  2RG8 A;  4UWK A;  3AU5 A;  3KS2 A;  5AQ9 A;  5CMY A;  3TG4 A;  1HF8 A;  2MOW A;  4AV7 A;  3Q15 A;  3ISM C;  4U07 A;  4DJA A;  3Q7A A;  2XCC A;  3L13 A;  3HXC A;  3U4T A;  3FUH A;  4G11 A;  3Q73 A;  2WXP A;  3ULY A;  3ZXP A;  3E32 A;  2IY0 C;  5ANL A;  2KAT A;  5AIJ A;  2KCL A;  4GPM A;  2GGF A;  2RFA A;  3HXD A;  2ZXW E;  3JXJ A;  5BPP A;  2WXK A;  3CHS A;  3DXM G;  3ZIM A;  3ABK E;  3QJZ A;  3FUE A;  2CFZ A;  3AS8 A;  5ARG A;  2X6J A;  4CT0 A;  2J4D A;  4K03 A;  3ZFW A;  2WXQ A;  1TN8 A;  2Q7F A;  1N95 A;  2AVP A;  4PS3 A;  3VTY A;  1TNO A;  3DPD A;  5FIN A;  1QNF A;  1KT1 A;  4NIK A;  3FWV A;  1H0A A;  4RG9 A;  3ENE A;  2JAB A;  3CVU A;  3S7F A;  4LUN U;  3CVV A;  2AWI A;  4G1T A;  1OWN A;  1N4Q A;  3U66 A;  4GTT A;  4JW1 A;  3QKY A;  3DBS A;  3ZVV A;  3PEU B;  4CZ2 D;  3QC1 A;  2IF4 A;  3I4G A;  4I1A A;  4G23 A;  2LSV A;  4HQD A;  5B3S E;  4ANU A;  3S2A A;  5ITZ F;  1BU9 A;  3MZL B;  4BSX A;  3J5P A;  4GAA A;  2AJA A;  2XGM A;  2J8S D;  1UJJ A;  3CK8 A;  4UI9 C;  5CEA A;  1A5E A;  3S7B A;  1ZBP A;  4CDM A;  4BX9 A;  4L2L A;  1FT1 A;  1TNY A;  3L08 A;  3KSL A;  4DRX E;  4AM9 A;  3ONK A;  4XIF A;  4U0Z A;  5CRV A;  1OCC E;  2ETC A;  4F3V A;  3D9L A;  4WNE A;  3NZU A;  4GTS A;  2XGO A;  4EBA G;  1OWO A;  2KCV A;  2XPY A;  2LXM A;  2ION A;  5FQ7 A;  3ZHE B;  4J6I A;  3CHM A;  4YDO A;  2H6F A;  4HBD A;  4LSZ E;  1E90 A;  1DNP A;  2XQ0 A;  3TWR A;  2PM7 A;  4HI8 A;  1WAO 1;  3UPV A;  2DVW A;  3D3M A;  3B7S A;  5JJT A;  3G2V A;  4GMJ A;  4E85 A;  5ANR A;  5CBO A;  5JMN D;  2OVB A;  3MKQ A;  1JCS A;  5FIO A;  3TWQ A;  3V31 A;  5BXU A;  3CVP A;  4U96 D;  3DRA A;  3LKU A;  4UQZ A;  4C48 B;  4NUR A;  3FUL A;  1LF8 A;  2Y3A A;  4TXR A;  3BQO A;  3UMV A;  4HNA D;  1ELR A;  4WWP A;  2WXO A;  3E33 A;  4U8H A;  4APF A;  1NZN A;  4EQF A;  2RD0 A;  2F37 A;  1MQS A;  3L6A A;  3QNK A;  3E34 A;  4L9P A;  3JUI A;  4TRQ A;  3DEO A;  3FTY A;  3RO2 A;  1ZB1 A;  1L5J A;  1NI1 A;  4O60 A;  1Q2Z A;  4HFG A;  1TJC A;  3VLE A;  3LY7 A;  1D8D A;  3QDN A;  2I1K A;  3X2Q E;  4AP2 A;  5FWQ A;  3CHQ A;  2LAH A;  3DXK G;  5A23 A;  4GTR A;  3PE4 A;  2F8X K;  2R2L A;  4GB9 A;  4UQY A;  2NXP A;  2XEE A;  4A63 B;  3PZ3 A;  3UM0 A;  4CYM D;  2YHE A;  2DZO A;  5AQB A;  1U3D A;  3TWU A;  3FU6 A;  2FI7 A;  3MV3 B;  4NQ0 A;  5CEC B;  5B1B E;  1NA3 A;  1JUQ A;  2GW1 A;  2LO6 A;  3PUK A;  1YA0 A;  3SF4 A;  5B1A E;  4QFV A;  2KC7 A;  4J7W A;  4AY5 A;  4BSZ B;  3FFL A;  3GZ1 A;  2UWJ G;  4FAD A;  2I6H A;  3I4R B;  3DSX A;  5ENT D;  2IO3 C;  3B7B A;  3LY8 A;  3HXE A;  2B6C A;  3D9K A;  4KMO A;  5AQ7 A;  2XCB A;  4KVO A;  3LY9 A;  3R7Q A;  1FVF A;  1U2V G;  3ULQ A;  3B7U X;  4GZD A;  5FT9 A;  1EF1 C;  4LER A;  3DSU A;  3QOU A;  4WND A;  4DLQ A;  3SGH A;  2WXL A;  4JHK A;  4I9C A;  3OTN A;  3F6Q A;  3IHV A;  4GU5 A;  4N3C A;  2DYR E;  2DZN A;  4GCO A;  4HXI A;  2CHW A;  5A6C A;  5HS0 A;  2WMO A;  3PRE A;  2MHK A;  4G2V A;  5D66 A;  3HVE A;  5JA4 D;  3KEA A;  3FTU A;  4CGW A;  2BUG A;  4RVB A;  4WNG A;  1IXV A;  4CRW A;  3FUM A;  3ZYL A;  4JZY A;  1V54 E;  5AJL A;  4I1M A;  1JWF A;  4DX1 A;  2QY7 A;  2WXN A;  2AXU A;  3V2X A;  4M7C A;  4AY6 A;  2WXF A;  5G04 C;  2EIN E;  4HRL A;  3HXF A;  4MS6 A;  4N2Q A;  4ZFH A;  1E7U A;  3CVL A;  3WXX A;  3FUJ A;  3W9G A;  2NSZ A;  2P9K G;  2XPI A;  4UWF A;  4URK A;  1TEZ A;  2V8S E;  4XKC A;  3UI2 A;  3FUD A;  1KZP A;  4CDR A;  4OAU C;  3RK6 A;  1SW6 A;  1RW2 A;  3BG1 B;  2XEN A;  4KVM A;  2DCP A;  3PRZ A;  2XHE A;  1N4S A;  5AQA A;  1XNF A;  3C3Q A;  4DI4 A;  1MX4 A;  2BTD A;  4B0Z A;  5ENQ D;  4EHM A;  2PQN A;  1KZO A;  3MGB A;  3FEY A;  3LYA A;  1BLX B;  4KXK B;  4OVU A;  2OEW A;  1BD8 A;  1DCQ A;  1UW4 B;  3D9O A;  5E76 A;  3PZ1 A;  1XGW A;  1BI7 B;  4JHR A;  2RKK A;  4NRH B;  3LPZ A;  5CER B;  2X3M A;  3O4Z A;  3SY2 A;  3L9T A;  3FDH A;  3DSV A;  4YVO A;  3RRU A;  2L6J A;  1S64 A;  5D0Q D;  3APC A;  3RJV A;  1UN9 A;  5BNW A;  4JA9 A;  1QZ2 A;  3ZPJ A;  5J08 A;  4A1G A;  1IQU A;  2MRI A;  4EZL A;  2WXH A;  4I17 A;  4ANW A;  3SFX A;  3GYZ A;  1OWP A;  3PNT B;  5AAR A;  5G2N A;  4TUM A;  5EIB E;  3TWW A;  4M3O A;  3R9A B;  4MRU A;  1O1T A;  4N5C A;  1RZ4 A;  2QZA A;  5HKP A;  3B7R L;  2C2L A;  4JB8 P;  1UG3 A;  5EYP F;  2V4L A;  1N0Q A;  4G8K A;  3UM1 A;  3B7T A;  5CRU A;  3ZYM A;  1SZA A;  3LDZ A;  3GW4 A;  2XZT G;  3QWW A;  4YDY A;  3FH8 A;  3HIZ A;  3AG4 E;  4JXT A;  5T8I A;  4N2S A;  4GTV A;  3G2S A;  5AN8 A;  2AW6 A;  3OXF A;  2GRQ B;  2IFU A;  3CHP A;  2IQC A;  2P2C P;  1FT2 A; 
#chains in the Genus database with same CATH homology
 4GAA A;  5J90 A;  4PS7 A;  5FQ8 A;  3CHO A;  3URZ A;  4MKT A;  3ZYQ A;  3PZD A;  5T3R A;  3FH5 A;  4BFR A;  5G05 J;  2HYZ A;  1E7V A;  2XGM A;  3ZYK A;  4GZ6 A;  2XRZ A;  4J0U A;  1UJJ A;  3CK8 A;  4B94 A;  3MYV A;  3ZRH A;  3TAX A;  4UI9 C;  3O48 A;  3S7B A;  1ZBP A;  3ASF A;  4CDM A;  3EHM A;  4BX9 A;  1W3B A;  3FTV A;  4L2L A;  4MLP A;  5KJK A;  4XZ4 A;  2OOE A;  3L08 A;  5HI7 A;  4AIF A;  2I1J A;  3RRN B;  2VYI A;  4I6G A;  1HG5 A;  4I6J A;  1Y8M A;  4ME2 A;  4JPS A;  4U0U A;  2VQ2 A;  4AM9 A;  2WQ7 A;  3ONK A;  4XIF A;  4U0Z A;  3LVR E;  4F3V A;  2X6K A;  4RG6 A;  4J8F A;  3JCK C;  4C0E A;  2YQ8 A;  3D9L A;  3CV0 A;  4J8S A;  4WNE A;  4ILG A;  2EQX A;  3NZU A;  5G55 A;  2XGO A;  4FLB A;  1OWO A;  2LNI A;  4H7X A;  5KCM A;  2KCV A;  4JEU A;  5DIZ A;  4EBA G;  3FU5 A;  5LCW C;  2XPY A;  5ARF A;  4GYO A;  3SNX A;  1INZ A;  2ION A;  5FQ7 A;  3ESL A;  3FTS A;  3ZHE B;  3GZ2 A;  2VSY A;  3HVE B;  4KZ0 A;  3UUX A;  5AJD A;  3FU3 A;  4J6I A;  3CHM A;  4A3V A;  4ANX A;  4GPK A;  3FTW A;  1JPL A;  1E90 A;  2WM9 A;  2X6F A;  5LX8 A;  1DNP A;  4FJY A;  2XQ0 A;  3FTZ A;  2VTB B;  2PM7 A;  3VLD A;  1WAO 1;  3UPV A;  2WMN A;  3D3M A;  1Z3Y A;  4Q96 A;  4KT6 B;  5JJ6 A;  3B7S A;  3LS8 A;  4XI0 A;  3SHF A;  3TL5 A;  5JJT A;  3G2V A;  3L54 A;  4GMJ A;  5ANR A;  4E85 A;  4FC8 A;  2OVB A;  3MKQ A;  2UY1 A;  3VLF A;  3CVP A;  3LKU A;  4UQZ A;  3D9N A;  4ATG A;  4NUR A;  4D10 C;  5BUZ A;  3FUL A;  4JL0 A;  1LF8 A;  1Y6I A;  3P2B A;  2Y3A A;  1HH8 A;  3QB2 A;  2FEZ A;  1HS6 A;  3UMV A;  3SBS A;  2KZT B;  2XGS A;  1ELR A;  4WWP A;  1DVP A;  1N52 A;  3PH0 C;  4UWH A;  4FA6 A;  5LCW J;  3CKB A;  3JQ0 A;  1EDU A;  2WXO A;  3QK0 A;  1OUV A;  4U8H A;  5D0O D;  4APF A;  4F7A A;  5LP0 A;  4ANV A;  3CVN A;  3CR3 A;  5AYW D;  4EEC A;  1NZN A;  4OYS A;  4EQF A;  2CFU A;  1KT0 A;  2HO1 A;  2LSU A;  2RD0 A;  3SI5 A;  3CSF A;  5BT1 A;  2J07 A;  2AXZ A;  3L6A A;  3CST A;  1MQS A;  5EDS A;  3QNK A;  4Y6C A;  4FUL A;  4ACL A;  4HVB A;  2LAI A;  5E75 A;  3CK9 A;  3JUI A;  3T8M A;  2WXJ A;  4TRQ A;  1FVH A;  3FTY A;  4L23 A;  4CEM A;  4DPR A;  4I2W A;  3RO2 A;  3TGO A;  4I6E A;  1JWG A;  1L5J A;  2E0I A;  4R7L A;  3KD7 A;  2IOS A;  3PNL B;  5CHE E;  3AS4 A;  2M63 A;  5FZQ A;  3T5X A;  4FLH A;  1SQM A;  2HR2 A;  4HFG A;  4ACK A;  3CK7 A;  3CVW A;  1TJC A;  1HXI A;  2R17 C;  2UY1 B;  3VLE A;  4I9E A;  2JLB A;  3LY7 A;  3LJ3 A;  3QDN A;  3ASD A;  1PC2 A;  3BG0 B;  2I1K A;  1EYH A;  3ZHE A;  4AP2 A;  1A17 A;  5FWQ A;  3CHQ A;  1HZ4 A;  2LAH A;  4GZC A;  2WXI A;  5A23 A;  4CT4 A;  3ASG A;  3MJW A;  1UJK A;  4WWN A;  5KJM A;  4BY6 A;  3PE4 A;  3MA5 A;  2PM6 A;  5JJ7 A;  2KM4 A;  3FUF A;  1OWM A;  4GB9 A;  4DLO A;  4UQY A;  2NXP A;  3EIQ C;  3NF1 A;  1H2U A;  2CG3 A;  1HO8 A;  1H2V C;  4BT9 A;  5A7D B;  3I3N A;  1H6K A;  1Z3X A;  2L0T B;  3PE3 A;  2YHE A;  5LOZ A;  2VGY A;  4JEH A;  4G24 A;  3Q5M A;  4GA1 A;  1SZ9 A;  1U3D A;  3SFZ A;  4AEZ C;  3CHR A;  3FU6 A;  4YND A;  1TJF A;  1GW6 A;  3L16 A;  4JVS A;  2ILR A;  4FHK A;  2FI7 A;  3MV3 B;  3TJP A;  4NQ0 A;  4GYW A;  3HDX A;  5G04 J;  4H7Y A;  4WWO A;  1NA3 A;  1OWL A;  3QWP A;  1JUQ A;  4A1S A;  4U63 A;  4DK5 A;  3NQP A;  4F1S A;  2BF0 X;  4HOU A;  2GW1 A;  2LO6 A;  3PUK A;  3NZS A;  1YA0 A;  3SF4 A;  5EX0 A;  2VTB A;  4KYO B;  5G05 C;  1KLX A;  3BEE A;  3FHE A;  4W9R A;  1E8X A;  3SD5 A;  3HYM B;  3FP3 A;  3IHY A;  4CDN A;  3S7J A;  5JHB A;  4QFV A;  2DBA A;  2KC7 A;  3CQG B;  3ML8 A;  3U9W A;  4AY5 A;  2QFC A;  3FFL A;  3GZ1 A;  4A3T A;  2UWJ G;  3QAQ A;  4JA7 A;  4AVX A;  3CVY A;  4A55 A;  4FAD A;  4NAC A;  2Y4T A;  2I2O A;  4B8A A;  1ELK A;  4FU3 A;  4EPZ A;  3SZ7 A;  4PH4 B;  2WXM A;  2I6H A;  3I4R B;  3EDT B;  3ASH A;  3PVL A;  4XI9 A;  3UT7 A;  1H2T C;  2PQR A;  2WXG A;  4BWR A;  3LY8 A;  2FUL A;  3KAE A;  2X6H A;  2XEV A;  2WQH A;  3D9K A;  4WAF A;  3TXN A;  3KEZ A;  4KMO A;  2VGX A;  2J08 A;  3AS5 A;  3AU4 A;  3MKR A;  3U64 A;  2XCB A;  1NP7 A;  3LVQ E;  2OND A;  4KZC A;  4KVO A;  1BPO A;  2IJG X;  4UI9 J;  3CGH A;  3LY9 A;  1QQE A;  3LEW A;  3OXL A;  4CGV A;  3R7Q A;  4I1O B;  1FVF A;  4XX5 A;  5FJY A;  4RSY A;  3ULQ A;  3APF A;  3MCX A;  3B7U X;  2I9C A;  2L0I A;  4Q94 A;  4GZD A;  3IBE A;  5FT9 A;  1EF1 C;  3FUK A;  1EPU A;  4LER A;  1IQR A;  4PS8 A;  3R7R A;  3QOU A;  4WND A;  4DLQ A;  4LCT A;  2YHC A;  4K0R A;  3SGH A;  4GYY A;  4C0M A;  1E8Y A;  3IV0 A;  4UWL A;  4O6F A;  2C0L A;  2VSN A;  2WXL A;  4ILI A;  4JHK A;  4I9C A;  3ZW3 A;  3OTN A;  1H19 A;  3IHV A;  4GU5 A;  4N3C A;  4DI3 A;  4GCO A;  4HXI A;  2CHW A;  5A6C A;  3LCA A;  3RU0 A;  2WMO A;  2CHX A;  1IHG A;  2MHK A;  3PRE A;  2OV8 A;  4G2V A;  3HVE A;  2YNQ A;  4EZJ A;  3CIA A;  2GRM A;  3FTU A;  4FP7 A;  4CGW A;  2DIW A;  5M72 A;  2CG2 A;  2BUG A;  4AOF A;  3MV2 B;  4RVB A;  2WXR A;  4ABN A;  4CCA A;  2WB2 A;  5FQ6 A;  1ZU2 A;  2J09 A;  4WNG A;  3G2U A;  3CVQ A;  4GML A;  4L1B A;  1E96 B;  3G2W A;  3FUM A;  4CRW A;  4TUU A;  3ZYL A;  3D9I A;  5BV0 A;  4G26 A;  3CQC B;  4JZY A;  3PEV B;  3EJN A;  5AJL A;  4GA0 A;  4I1M A;  4B8C B;  1JWF A;  4BTA A;  5AEN A;  3EHN A;  2QY7 A;  2A5U A;  2WXN A;  3MKQ B;  2AXU A;  2XPZ A;  3GZS A;  3Q4A B;  4IRU A;  5EX3 A;  4B89 A;  2WPV A;  4U04 A;  1B89 A;  2WXF A;  1PAQ A;  5G04 C;  4AY6 A;  3QAR A;  3L17 A;  4MS6 A;  4HOT A;  4J8E A;  2FF4 A;  2FBN A;  2X6I A;  4HLE A;  4N2Q A;  4IYP A;  2CHZ A;  4LRZ A;  2L9B A;  2WVI A;  5LFA A;  2R5S A;  1X5B A;  3IKO B;  1E7U A;  3CVL A;  3WXX A;  5ENN A;  3T5V A;  4HS2 A;  2WQ6 A;  3FUJ A;  2NSZ A;  2XPI A;  1PY1 A;  4UWF A;  2A4Z A;  4GZ5 A;  3ZXS A;  4AXH A;  4URK A;  1TEZ A;  1Z6T A;  4L2Y A;  5FZR A;  2V8S E;  3CLJ A;  4BTB A;  4UWG A;  1UN8 A;  3OAW A;  4XKC A;  2ZU6 B;  3FUD A;  2PZI A;  1NA0 A;  3UT4 A;  1VDY A;  1S0P A;  3CEQ A;  1MHQ A;  5FTP A;  3FTX A;  3P1U A;  4CDR A;  4Q69 A;  4KBQ A;  1WM5 A;  3RK6 A;  3ONL A;  2JEK A;  3ML9 A;  5C2Y A;  3BG1 B;  4I2Z A;  3RIB A;  4KVM A;  2DCP A;  3PRZ A;  3EIJ A;  2XHE A;  3TXM A;  3K9I A;  4C9B B;  1WY6 A;  3D9J A;  1XNF A;  5HQ8 A;  4YVQ C;  4DI4 A;  2BTD A;  4APO A;  4JHJ A;  4B0Z A;  1HX8 A;  3D9M A;  3I5P A;  2OVF A;  5EKQ D;  3FUI A;  2IU1 A;  2PQN A;  2VGX B;  1ELW A;  3Q47 B;  3RO3 A;  2RG8 A;  3MGB A;  3UQ3 A;  4UWK A;  3ZN3 A;  3FEY A;  3LYA A;  3PUJ A;  5CMW A;  3AU5 A;  3KS2 A;  1HE8 A;  5CMY A;  3TG4 A;  3VTX A;  4KXK B;  4OVU A;  1IYG A;  4BT8 A;  1HF8 A;  1UW4 B;  2MOW A;  2VSX E;  4AV7 A;  3D9O A;  3Q15 A;  5E76 A;  5KJL A;  1XGW A;  4PUC A;  4U07 A;  4JHR A;  4DJA A;  4NRH B;  5CCL A;  2XCC A;  3LPZ A;  3L13 A;  3B13 A;  3JQ1 A;  4P29 A;  2X3M A;  3O4Z A;  3FDH A;  3U4T A;  3CKC A;  4YVO A;  3FUH A;  4G11 A;  3IEG A;  4ILH B;  4EBA A;  3RRU A;  2L6J A;  5BV1 A;  5JHA A;  4J8D A;  2AXV A;  2WXP A;  4N39 A;  5C1D A;  5D0Q D;  3APC A;  3RJV A;  4UQX A;  4BX8 A;  1UN9 A;  4XKB A;  2Y4U A;  2IOL A;  3S7D A;  2VJ8 A;  5BNW A;  5FQ4 A;  3PS6 A;  4WUY A;  2XRY A;  5ANL A;  4JA9 A;  1QZ2 A;  4G25 A;  3ZPJ A;  2KAT A;  4E6H A;  4L7T A;  5J08 A;  3C98 A;  1IQU A;  2MRI A;  4GCN A;  4A1G A;  5AIJ A;  4EZL A;  2WXH A;  2C0M A;  3MEK A;  4XE0 A;  4I17 A;  4ANW A;  4I43 A;  5CCM A;  2KCL A;  3U3W A;  2GGF A;  3GYZ A;  4FJZ A;  4IUL A;  2J4B A;  4JC8 A;  4U0S A;  2R59 A;  3TG5 A;  4EZK A;  3G2T A;  5BPP A;  4HOR A;  1OWP A;  2WXK A;  3PNT B;  3CHS A;  2E2E A;  2P58 C;  5G2N A;  4TV3 A;  3ZIM A;  3SBT B;  3QJZ A;  2PL2 A;  3FUE A;  2CFZ A;  3ZEF A;  1FCH A;  3AS8 A;  2X6J A;  5ARG A;  3ZGQ A;  4CT0 A;  4M3O A;  3FEX A;  2J4D A;  4K03 A;  3R9A B;  3HHM A;  2J9Q A;  3ZFW A;  2WXQ A;  4MRU A;  2Q7F A;  3UT8 A;  4GZ3 A;  4F53 A;  4N5C A;  2FO7 A;  2AVP A;  4HOQ A;  5FZS A;  4OVV A;  4HOS A;  3B7R L;  4PS3 A;  4N3B A;  3FH7 A;  2GRL A;  3VTY A;  3DPD A;  3QWV A;  1QNF A;  3PDN A;  2C2L A;  1KT1 A;  5KJN A;  1N54 A;  4N3A A;  1UG3 A;  2V4L A;  2HM8 A;  3FWV A;  1HG2 A;  1H0A A;  4RG9 A;  4Y6W A;  3ENE A;  3FY4 A;  3CVU A;  4UI9 K;  4PDX A;  3S7F A;  4LUN U;  3CVV A;  3L22 A;  3UX4 A;  2AWI A;  4G1T A;  1OWN A;  3U66 A;  3B7T A;  3RKV A;  3ZYM A;  4V3I A;  1SZA A;  4WNF A;  3FUN A;  4JW1 A;  1P5Q A;  3APD A;  3OXG A;  3QKY A;  4FHJ A;  5BW8 C;  2KCK A;  3DBS A;  3ZVV A;  3MX3 A;  3PEU B;  2YIN A;  3RRM B;  2V0P A;  3LDZ A;  3GW4 A;  3QC1 A;  3Q49 B;  4GA2 A;  2NC9 A;  1U3C A;  1E8W A;  2IF4 A;  3I4G A;  3CVX A;  1HU3 A;  3QWW A;  4AJW A;  2V5F A;  3FH8 A;  4I1A A;  5T4Y A;  2X38 A;  4G23 A;  2LSV A;  3D9P A;  3JYS A;  3HIZ A;  4JXT A;  1E8Z A;  5T8I A;  4N2S A;  4ANU A;  3S2A A;  5DBK A;  3G2S A;  2KZT A;  3LXU X;  2J49 A;  2AW6 A;  3OXF A;  4IN3 B;  4LEU A;  3ESK A;  3N71 A;  2VSO E;  2IFU A;  3CHP A;  2IQC A;  3MZL B;  4BSX A;  1HFA A;  3E4B A;  3FU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...