2FV0A

Ugl_d88n/dglca-glc-rha-glc
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
377
structure length
377
Chain Sequence
b'MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHNIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Unsaturated glucuronyl hydrolase
publication title Substrate recognition by unsaturated glucuronyl hydrolase from Bacillus sp. GL1
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 149
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.179: Gellan tetrasaccharide unsaturated glucuronosyl hydrolase.
pdb deposition date 2006-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2fv0A00
3WC3A 4CJ1A 4ZH5A 3AFJA 3GZKA 1WU6A 1UG9A 2DRRA 5KKBA 1V7WA 3ACTA 3E73A 3GLYA 1KWFA 1KS8A 1H12A 4FUSA 2GZ6A 3D3IA 3CIHA 4JJJA 2D5JA 2QNOA 2AFAA 3X17A 3H3KA 1AYXA 2OKXA 3QFYA 3WIRA 3W7SA 2F6DA 4J5TA 3TF4A 5M7IA 1XWTA 1KSDA 1FBOA 3QDEA 1H54A 4WVBA 1CEMA 3RX7A 3ANJA 1KSCA 1K72A 1F9DA 1LF6A 2VN7A 3S4BA 1JS4A 1V7XA 2B4FA 4WVCA 2JJBA 5CD2A 4DODA 1WZZA 1FBWA 1L1YA 1XW2A 3A3VA 1G6IA 3ON6A 2Z07A 3VW5A 1FO2A 3T33A 4AYRA 3PMMA 4AYOA 3WIQA 4KTRA 2JF4A 3W5MA 4Q88A 3ACSA 4L6XA 1FMIA 1KRFA 3EZ8A 5CZLA 1FCEA 2RGKA 2NVPA 3S4DA 1G87A 3S4CA 1XWQA 2EADA 3ANKA 1KREA 3WKHA 5DGRA 4WU0A 1V5CA 3QWTA 5MEHA 4CJ0A 2JG0A 1F9OA 1AGMA 3QRYA 2P0VA 1UT9A 1H14A 2XFGA 1GA2A 1LF9A 2AHFA 2DRSA 4ZG8A 4AYQA 5CA3A 3WKFA 4KTPA 1G9JA 3RX5A 3RRSA 2D8LA 1GLMA 3RSYA 3W7WA 1FAEA 4TXTA 5M7YA 1CLCA 2EACA 3ANIA 3QSPA 3RX8A 3E6UA 3QXFA 1DL2A 1IA7A 1FP3A 2WYNA 1IS9A 3QT9A 1TF4A 2FV0A 1NC5A 2CQTA 1X9DA 4L0GA 3WKGA 1GAHA 3QT3A 4CE7A 3W7XA 3RENA 4DOEA 4Z4JA 4TF4A 2EABA 3GT5A 1RQ5A 4AYPA 3H2WA 2RI9A 3EQAA 2CQSA 3QPFA 1FO3A 2VN4A 3S4AA 2RI8A 2YIKA 3WUXA 2DRQA 1ULVA 4Q2BA 2DROA 1DOGA 2FV1A 2A8ZA 2FUZA 2ZBLA 3W7TA 1WU4A 3QXQA 1HCUA 1WU5A 1KFGA 3P2CA 3H7LA 5E2JA 2FBAA 5GW7A 2AHGA 3WKIA 3K11A 3W7UA 1L2AA 2GH4A 1IA6A 4EL8A 1V7VA 3QG0A 2ZZRA 1VD5A 1G9GA 3VXDA 3QFZA 4Z4LA 4XUVA 1NXCA 3W5NA 1KKTA 5GY3A 4WVAA 5DGQA 2EAEA 1GAIA 1V5DA 3WIWA 1H13A
chains in the Genus database with same CATH superfamily
3PZ2B 1R76A 2ONGA 1X81B 4KKIA 5JPMB 2WY8A 2BB5A 1WU6A 3M73A 1N1ZA 1QAZA 1SA5B 3G4DA 3HXEB 1W6JA 5ILKA 3CIHA 4D4BA 1HXAA 2BRWA 4V1SA 2OKXA 3W7SA 2NOJA 3SQCA 4GTPB 3TF4A 1XWTA 3SFXB 3M7CA 3Q79B 4LNBB 1S64B 2E22A 1O5MB 2WINB 3S4BA 1J0MA 5CD2A 3EU5B 1WZZA 5IL8A 2Z07A 3Q78B 1FO2A 1S63B 1N4PB 3PMMA 1CB8A 3EU8A 1N21A 4AYOA 3W5MA 4KTRA 1FT2B 2JF4A 3SDVA 4Q88A 3SDQA 4L6XA 1TNYB 3VSMA 2RGKA 1G87A 3S4CA 2ZISB 1J0NA 1X1HA 4WU0A 3SDUA 4LNGB 3QRYA 1N20A 1OJPA 3HXCB 1QSJA 4YDEB 1UT9A 2AHFA 5CA3A 3D5SA 3N0FA 2D8LA 1GLMA 1N22A 1FAEA 2V3NA 3M02A 2EACA 3EUVB 2IEJB 1IA7A 4OJZA 1GSZA 2WYNA 4C1SA 4L0GA 1N4RB 1GAHA 1O1SB 1N7OA 3PZ3B 1N95B 3KSLB 2ZIRB 4TF4A 3H2WA 1DCEB 2CQSA 2F0YB 1FO3A 3S4AA 4GTMB 4ZH1A 2YIKA 2DRQA 4Q2BA 2DROA 2FV1A 3SAEA 4GTRB 1HCUA 3H7LA 1JCRB 3E80A 5GW7A 4YCRA 2AHGA 3WKIA 4D4AA 1L2AA 1GXMA 5FO8B 3HXDB 3PZ4B 3VSNA 3QG0A 3M71A 1HN0A 3VXDA 5DHIA 1N9AB 4QT9A 1N7RA 3OEDA 4V1RA 5AGDA 2SQCA 3PYBA 4GTTB 4WVAA 1O1RB 1F9GA 1I8QA 2EAEA 3M74A 3M78A 1H13A 3AFLA 1TNBB 4FXKB 1SQCA 4CJ1A 4ZH5A 3AFJA 1N1BA 4F13A 1UG9A 2BRVX 1UMPA 2H6GB 5FO9B 1V7WA 5EATA 1TN8B 1W3YA 4NEIA 5DHKA 4JJJA 1HM2A 2AFAA 3QFYA 3WIRA 4EHMB 1D8EB 1OJNA 3ANJA 3DSXB 2ONHA 1TNUB 2B4FA 4DODA 2H6IB 2JJBA 3M76A 1RWAA 3OXUA 1D8DB 1O6HA 3M01A 2B39A 2PMVA 2WY7A 1FMIA 3EZ8A 3M7LA 2NVPA 5IKAA 5IL3A 1N7NA 1LD7B 3ANKA 4MMHA 4CJ0A 3DSTB 3E30B 5EAUA 1H3BA 3KLSA 4D4CA 3NNBA 4AYQA 3RX5A 3RRSA 3M7BA 3RSYA 4TXTA 2V3PA 5M7YA 1CLCA 3RX8A 3QXFA 1IS9A 3Q75B 3P5RA 1NC5A 3WKGA 5FOBB 4ZRQA 3QT3A 1H3CA 1F1SA 5IK9A 3W7XA 3SDTA 3RENA 3PYAA 3GT5A 2RI9A 1HMWA 4MMIA 3E37B 2RI8A 1LXKA 1DOGA 3G6JB 2E24A 4OK4A 3DSUB 5E2JA 1RWGA 2J5CA 5ILHA 1IA6A 4EL8A 4ZRPA 1VD5A 1G9GA 1JCSB 1N24A 2R2LB 4GTOB 5GZKA 4Z4LA 5ILIA 1NXCA 3W5NA 3E33B 1KKTA 1N94B 4F10A 4OZWA 1GAIA 1RWFA 1V5DA 2BB6A 3GZKA 1HMUA 4FXGB 3M75A 5ILZA 3E73A 3GLYA 1QBQB 5ILYA 4FUSA 2GZ6A 3G4FA 1HZFA 3X17A 3H3KA 1AYXA 2V8IA 2PN5A 4MU9A 4FNVA 2F6DA 4MBGB 1KZPB 1C3DA 1KSDA 3QDEA 4WVBA 2XWJB 1CEMA 3DPYB 3RX7A 1X1JA 4GL3A 1LF6A 2VN7A 1H3AA 1RWHA 1V7XA 3A3VA 1FBWA 1H39A 2WIIB 3VW5A 4FJQA 4YDOB 3T33A 4AYRA 3WIQA 1X1IA 3C72B 3ACSA 1FCEA 3M7EA 1XWQA 1KREA 3M00A 3QWTA 1C82A 1TN6B 2JG0A 1F9OA 4M76A 4LNVA 3DSVB 5IK0A 1GA2A 2DRSA 4ZG8A 1H36A 4BOJA 1FT1B 3M72A 4KTPA 3WKFA 1G9JA 3NFVA 1RWCA 3CU7A 3W7WA 3E32B 4ONTA 3ANIA 5IKHA 3E6UA 1QQFA 2FUTA 2H6HB 1W6KA 2CQTA 1TNZB 3N0GA 4Z4JA 2EABA 4AYPA 3DRAB 1GXNA 2VN4A 3A0OA 3WUXA 3DSSB 2Q1FA 4D94A 2XWBB 4DI5A 1KFGA 2FBAA 3HXFB 2WDAA 1HM3A 3W7UA 4OZVA 4GAXA 3P5PA 1V7VA 1N4SB 2BRPA 4XUVA 2WCOA 5GY3A 1KZOB 3Q73B 1EGUA 1TNOB 3WC3A 3KQ4A 2X03A 2DRRA 1HX9A 4L9PB 5KKBA 1LXMA 3ACTA 5JPNB 4GTSB 3D5RA 1KWFA 1KS8A 1H12A 3D3IA 2D5JA 2QNOA 2XQWA 2FUQA 4J5TA 3RJ3A 5M7IA 3Q7FB 1FBOA 5IK6A 1H54A 2V8KA 1KSCA 1K72A 1F9DA 5EASA 3E34B 1JS4A 4WVCA 1GXOA 2GOXA 1L1YA 1XW2A 3ON6A 1G6IA 3SDRA 2A73B 1O1TB 5C05A 4GTQB 1KRFA 5CZLA 1OJMA 1NL4B 3S4DA 1N23A 2EADA 4E1YA 1FPPB 5IM1A 3WKHA 5DGRA 1N7PA 1OJOA 3Q7AB 1V5CA 5MEHA 1AGMA 2P0VA 1H14A 1NI1B 2XFGA 3K7XA 5ILJA 1LF9A 1HXGA 1TN7B 1N4QB 5ILDA 4RNQA 1O79A 3QSPA 1DL2A 4GTVB 1FP3A 3QT9A 1TF4A 2FV0A 1GHQA 3KSQB 5FO7B 4BOKA 1X9DA 2G02A 4CE7A 4DOEA 1LTXB 4D4DA 1O6QA 1RQ5A 3DSWB 1N7QA 3HXBB 2V8JA 1HXCA 4KKJA 3EQAA 2H6FB 3QPFA 5JMFA 1MZCB 3M77A 1JCQB 1ULVA 3W7TA 2ZBLA 2A8ZA 2FUZA 2BEDB 4OK2A 1WU4A 3QXQA 2I07B 1WU5A 2G0DA 3P2CA 3E7JA 3LZ9A 2BBCA 1LD8B 3K11A 3SFYB 1H37A 1RW9A 2GH4A 1HV6A 1SA4B 2ZZRA 3QFZA 1O6RA 1H35A 3S9VA 1LOHA 3PZ1B 5DGQA 5JMDA 4LIXA 3WIWA
chains in the Genus database with same CATH topology
3PZ2B 1R76A 4KKIA 1X81B 5JPMB 2WY8A 2BB5A 1WU6A 3M73A 1SA5B 3HXEB 1W6JA 3CIHA 4D4BA 4V1SA 2OKXA 3W7SA 2NOJA 3SQCA 4GTPB 3TF4A 1XWTA 3SFXB 3M7CA 3Q79B 4LNBB 1S64B 1O5MB 2WINB 3S4BA 5CD2A 3EU5B 1WZZA 2Z07A 3Q78B 1FO2A 1S63B 1N4PB 3PMMA 3EU8A 4AYOA 3W5MA 4KTRA 1FT2B 2JF4A 3SDVA 4Q88A 3SDQA 4L6XA 1TNYB 2RGKA 1G87A 3S4CA 2ZISB 4WU0A 3SDUA 4LNGB 3QRYA 3HXCB 1QSJA 4YDEB 1UT9A 2AHFA 5CA3A 3D5SA 2D8LA 1GLMA 1FAEA 2V3NA 2EACA 3EUVB 2IEJB 1IA7A 1GSZA 2WYNA 4C1SA 4L0GA 1N4RB 1GAHA 1O1SB 3PZ3B 1N95B 3KSLB 2ZIRB 4TF4A 3H2WA 1DCEB 2CQSA 2F0YB 1FO3A 3S4AA 4GTMB 4ZH1A 2YIKA 2DRQA 4Q2BA 2DROA 2FV1A 3SAEA 4GTRB 1HCUA 3H7LA 1JCRB 5GW7A 4YCRA 2AHGA 3WKIA 4D4AA 1L2AA 1GXMA 5FO8B 3HXDB 3PZ4B 3QG0A 3M71A 3VXDA 1N9AB 4QT9A 3OEDA 4V1RA 5AGDA 2SQCA 3PYBA 4GTTB 4WVAA 1O1RB 2EAEA 3M74A 3M78A 1H13A 1TNBB 4FXKB 1SQCA 4CJ1A 4ZH5A 3AFJA 1UG9A 1UMPA 2H6GB 5FO9B 1V7WA 1TN8B 4JJJA 2AFAA 3QFYA 3WIRA 4EHMB 1D8EB 3ANJA 3DSXB 1TNUB 2B4FA 4DODA 2H6IB 3M76A 2JJBA 3OXUA 1D8DB 1O6HA 2B39A 2PMVA 2WY7A 1FMIA 3EZ8A 3M7LA 2NVPA 1LD7B 3ANKA 4CJ0A 3DSTB 3E30B 1H3BA 3KLSA 4D4CA 4AYQA 3RX5A 3RRSA 3M7BA 3RSYA 4TXTA 2V3PA 5M7YA 1CLCA 3RX8A 3QXFA 1IS9A 3Q75B 3P5RA 1NC5A 3WKGA 5FOBB 4ZRQA 3QT3A 1H3CA 3W7XA 3SDTA 3RENA 3PYAA 3GT5A 2RI9A 3E37B 2RI8A 1DOGA 3G6JB 3DSUB 5E2JA 1IA6A 4EL8A 4ZRPA 1VD5A 1G9GA 1JCSB 2R2LB 4GTOB 5GZKA 4Z4LA 1NXCA 3W5NA 3E33B 1KKTA 1N94B 1GAIA 1V5DA 2BB6A 3GZKA 4FXGB 3M75A 3E73A 3GLYA 1QBQB 4FUSA 2GZ6A 1HZFA 3X17A 3H3KA 1AYXA 2V8IA 2PN5A 4MU9A 2F6DA 4MBGB 1KZPB 1C3DA 1KSDA 3QDEA 4WVBA 2XWJB 1CEMA 3DPYB 3RX7A 4GL3A 1LF6A 2VN7A 1H3AA 1V7XA 3A3VA 1FBWA 1H39A 2WIIB 3VW5A 4YDOB 3T33A 4AYRA 3WIQA 3C72B 3ACSA 1FCEA 3M7EA 1XWQA 1KREA 3QWTA 1TN6B 2JG0A 1F9OA 4M76A 4LNVA 3DSVB 1GA2A 2DRSA 4ZG8A 1H36A 4BOJA 1FT1B 3M72A 4KTPA 3WKFA 1G9JA 3CU7A 3W7WA 3E32B 4ONTA 3ANIA 3E6UA 1QQFA 2H6HB 1W6KA 2CQTA 1TNZB 4Z4JA 2EABA 4AYPA 3DRAB 1GXNA 2VN4A 3WUXA 3DSSB 4D94A 2XWBB 1KFGA 2FBAA 3HXFB 3W7UA 3P5PA 1V7VA 1N4SB 4XUVA 5GY3A 1KZOB 3Q73B 1TNOB 3WC3A 3KQ4A 2DRRA 4L9PB 5KKBA 3ACTA 5JPNB 4GTSB 3D5RA 1KWFA 1KS8A 1H12A 3D3IA 2D5JA 2QNOA 2XQWA 4J5TA 3RJ3A 5M7IA 3Q7FB 1FBOA 1H54A 2V8KA 1KSCA 1K72A 1F9DA 3E34B 1JS4A 4WVCA 1GXOA 2GOXA 1L1YA 1XW2A 3ON6A 1G6IA 3SDRA 2A73B 1O1TB 4GTQB 1KRFA 5CZLA 1NL4B 3S4DA 2EADA 1FPPB 3WKHA 5DGRA 3Q7AB 1V5CA 5MEHA 1AGMA 2P0VA 1H14A 1NI1B 2XFGA 3K7XA 1LF9A 1TN7B 1N4QB 1O79A 3QSPA 1DL2A 4GTVB 1FP3A 3QT9A 1TF4A 2FV0A 1GHQA 3KSQB 5FO7B 4BOKA 1X9DA 2G02A 4CE7A 4DOEA 1LTXB 4D4DA 1O6QA 1RQ5A 3DSWB 3HXBB 2V8JA 4KKJA 3QPFA 2H6FB 3EQAA 1MZCB 3M77A 1JCQB 1ULVA 3W7TA 2ZBLA 2A8ZA 2FUZA 2BEDB 1WU4A 3QXQA 2I07B 1WU5A 2G0DA 3P2CA 2BBCA 1LD8B 3K11A 3SFYB 1H37A 2GH4A 1SA4B 2ZZRA 3QFZA 1O6RA 1H35A 3S9VA 3PZ1B 5DGQA 4LIXA 3WIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WC3 A;  4CJ1 A;  4ZH5 A;  3AFJ A;  3GZK A;  1WU6 A;  1UG9 A;  2DRR A;  5KKB A;  1V7W A;  3ACT A;  3E73 A;  3GLY A;  1KWF A;  1KS8 A;  1H12 A;  4FUS A;  2GZ6 A;  3D3I A;  3CIH A;  4JJJ A;  2D5J A;  2QNO A;  2AFA A;  3X17 A;  3H3K A;  1AYX A;  2OKX A;  3QFY A;  3WIR A;  3W7S A;  2F6D A;  4J5T A;  3TF4 A;  5M7I A;  1XWT A;  1KSD A;  1FBO A;  3QDE A;  1H54 A;  4WVB A;  1CEM A;  3RX7 A;  3ANJ A;  1KSC A;  1K72 A;  1F9D A;  1LF6 A;  2VN7 A;  3S4B A;  1JS4 A;  1V7X A;  2B4F A;  4WVC A;  2JJB A;  5CD2 A;  4DOD A;  1WZZ A;  1FBW A;  1L1Y A;  1XW2 A;  3A3V A;  1G6I A;  3ON6 A;  2Z07 A;  3VW5 A;  1FO2 A;  3T33 A;  4AYR A;  3PMM A;  4AYO A;  3WIQ A;  4KTR A;  2JF4 A;  3W5M A;  4Q88 A;  3ACS A;  4L6X A;  1FMI A;  1KRF A;  3EZ8 A;  5CZL A;  1FCE A;  2RGK A;  2NVP A;  3S4D A;  1G87 A;  3S4C A;  1XWQ A;  2EAD A;  3ANK A;  1KRE A;  3WKH A;  5DGR A;  4WU0 A;  1V5C A;  3QWT A;  5MEH A;  4CJ0 A;  2JG0 A;  1F9O A;  1AGM A;  3QRY A;  2P0V A;  1UT9 A;  1H14 A;  2XFG A;  1GA2 A;  1LF9 A;  2AHF A;  2DRS A;  4ZG8 A;  4AYQ A;  5CA3 A;  3WKF A;  4KTP A;  1G9J A;  3RX5 A;  3RRS A;  2D8L A;  1GLM A;  3RSY A;  3W7W A;  1FAE A;  4TXT A;  5M7Y A;  1CLC A;  2EAC A;  3ANI A;  3QSP A;  3RX8 A;  3E6U A;  3QXF A;  1DL2 A;  1IA7 A;  1FP3 A;  2WYN A;  1IS9 A;  3QT9 A;  1TF4 A;  2FV0 A;  1NC5 A;  2CQT A;  1X9D A;  4L0G A;  3WKG A;  1GAH A;  3QT3 A;  4CE7 A;  3W7X A;  3REN A;  4DOE A;  4Z4J A;  4TF4 A;  2EAB A;  3GT5 A;  1RQ5 A;  4AYP A;  3H2W A;  2RI9 A;  3EQA A;  2CQS A;  3QPF A;  1FO3 A;  2VN4 A;  3S4A A;  2RI8 A;  2YIK A;  3WUX A;  2DRQ A;  1ULV A;  4Q2B A;  2DRO A;  1DOG A;  2FV1 A;  2A8Z A;  2FUZ A;  2ZBL A;  3W7T A;  1WU4 A;  3QXQ A;  1HCU A;  1WU5 A;  1KFG A;  3P2C A;  3H7L A;  5E2J A;  2FBA A;  5GW7 A;  2AHG A;  3WKI A;  3K11 A;  3W7U A;  1L2A A;  2GH4 A;  1IA6 A;  4EL8 A;  1V7V A;  3QG0 A;  2ZZR A;  1VD5 A;  1G9G A;  3VXD A;  3QFZ A;  4Z4L A;  4XUV A;  1NXC A;  3W5N A;  1KKT A;  5GY3 A;  4WVA A;  5DGQ A;  2EAE A;  1GAI A;  1V5D A;  3WIW A;  1H13 A; 
#chains in the Genus database with same CATH topology
 3PZ2 B;  1R76 A;  2ONG A;  1X81 B;  4KKI A;  5JPM B;  2WY8 A;  2BB5 A;  1WU6 A;  3M73 A;  1N1Z A;  1QAZ A;  1SA5 B;  3G4D A;  3HXE B;  1W6J A;  5ILK A;  3CIH A;  4D4B A;  1HXA A;  2BRW A;  4V1S A;  2OKX A;  3W7S A;  2NOJ A;  3SQC A;  4GTP B;  3TF4 A;  1XWT A;  3SFX B;  3M7C A;  3Q79 B;  4LNB B;  1S64 B;  2E22 A;  1O5M B;  2WIN B;  3S4B A;  1J0M A;  5CD2 A;  3EU5 B;  1WZZ A;  5IL8 A;  2Z07 A;  3Q78 B;  1FO2 A;  1S63 B;  1N4P B;  3PMM A;  1CB8 A;  3EU8 A;  1N21 A;  4AYO A;  3W5M A;  4KTR A;  1FT2 B;  2JF4 A;  3SDV A;  4Q88 A;  3SDQ A;  4L6X A;  1TNY B;  3VSM A;  2RGK A;  1G87 A;  3S4C A;  2ZIS B;  1J0N A;  1X1H A;  4WU0 A;  3SDU A;  4LNG B;  3QRY A;  1N20 A;  1OJP A;  3HXC B;  1QSJ A;  4YDE B;  1UT9 A;  2AHF A;  5CA3 A;  3D5S A;  3N0F A;  2D8L A;  1GLM A;  1N22 A;  1FAE A;  2V3N A;  3M02 A;  2EAC A;  3EUV B;  2IEJ B;  1IA7 A;  4OJZ A;  1GSZ A;  2WYN A;  4C1S A;  4L0G A;  1N4R B;  1GAH A;  1O1S B;  1N7O A;  3PZ3 B;  1N95 B;  3KSL B;  2ZIR B;  4TF4 A;  3H2W A;  1DCE B;  2CQS A;  2F0Y B;  1FO3 A;  3S4A A;  4GTM B;  4ZH1 A;  2YIK A;  2DRQ A;  4Q2B A;  2DRO A;  2FV1 A;  3SAE A;  4GTR B;  1HCU A;  3H7L A;  1JCR B;  3E80 A;  5GW7 A;  4YCR A;  2AHG A;  3WKI A;  4D4A A;  1L2A A;  1GXM A;  5FO8 B;  3HXD B;  3PZ4 B;  3VSN A;  3QG0 A;  3M71 A;  1HN0 A;  3VXD A;  5DHI A;  1N9A B;  4QT9 A;  1N7R A;  3OED A;  4V1R A;  5AGD A;  2SQC A;  3PYB A;  4GTT B;  4WVA A;  1O1R B;  1F9G A;  1I8Q A;  2EAE A;  3M74 A;  3M78 A;  1H13 A;  3AFL A;  1TNB B;  4FXK B;  1SQC A;  4CJ1 A;  4ZH5 A;  3AFJ A;  1N1B A;  4F13 A;  1UG9 A;  2BRV X;  1UMP A;  2H6G B;  5FO9 B;  1V7W A;  5EAT A;  1TN8 B;  1W3Y A;  4NEI A;  5DHK A;  4JJJ A;  1HM2 A;  2AFA A;  3QFY A;  3WIR A;  4EHM B;  1D8E B;  1OJN A;  3ANJ A;  3DSX B;  2ONH A;  1TNU B;  2B4F A;  4DOD A;  2H6I B;  2JJB A;  3M76 A;  1RWA A;  3OXU A;  1D8D B;  1O6H A;  3M01 A;  2B39 A;  2PMV A;  2WY7 A;  1FMI A;  3EZ8 A;  3M7L A;  2NVP A;  5IKA A;  5IL3 A;  1N7N A;  1LD7 B;  3ANK A;  4MMH A;  4CJ0 A;  3DST B;  3E30 B;  5EAU A;  1H3B A;  3KLS A;  4D4C A;  3NNB A;  4AYQ A;  3RX5 A;  3RRS A;  3M7B A;  3RSY A;  4TXT A;  2V3P A;  5M7Y A;  1CLC A;  3RX8 A;  3QXF A;  1IS9 A;  3Q75 B;  3P5R A;  1NC5 A;  3WKG A;  5FOB B;  4ZRQ A;  3QT3 A;  1H3C A;  1F1S A;  5IK9 A;  3W7X A;  3SDT A;  3REN A;  3PYA A;  3GT5 A;  2RI9 A;  1HMW A;  4MMI A;  3E37 B;  2RI8 A;  1LXK A;  1DOG A;  3G6J B;  2E24 A;  4OK4 A;  3DSU B;  5E2J A;  1RWG A;  2J5C A;  5ILH A;  1IA6 A;  4EL8 A;  4ZRP A;  1VD5 A;  1G9G A;  1JCS B;  1N24 A;  2R2L B;  4GTO B;  5GZK A;  4Z4L A;  5ILI A;  1NXC A;  3W5N A;  3E33 B;  1KKT A;  1N94 B;  4F10 A;  4OZW A;  1GAI A;  1RWF A;  1V5D A;  2BB6 A;  3GZK A;  1HMU A;  4FXG B;  3M75 A;  5ILZ A;  3E73 A;  3GLY A;  1QBQ B;  5ILY A;  4FUS A;  2GZ6 A;  3G4F A;  1HZF A;  3X17 A;  3H3K A;  1AYX A;  2V8I A;  2PN5 A;  4MU9 A;  4FNV A;  2F6D A;  4MBG B;  1KZP B;  1C3D A;  1KSD A;  3QDE A;  4WVB A;  2XWJ B;  1CEM A;  3DPY B;  3RX7 A;  1X1J A;  4GL3 A;  1LF6 A;  2VN7 A;  1H3A A;  1RWH A;  1V7X A;  3A3V A;  1FBW A;  1H39 A;  2WII B;  3VW5 A;  4FJQ A;  4YDO B;  3T33 A;  4AYR A;  3WIQ A;  1X1I A;  3C72 B;  3ACS A;  1FCE A;  3M7E A;  1XWQ A;  1KRE A;  3M00 A;  3QWT A;  1C82 A;  1TN6 B;  2JG0 A;  1F9O A;  4M76 A;  4LNV A;  3DSV B;  5IK0 A;  1GA2 A;  2DRS A;  4ZG8 A;  1H36 A;  4BOJ A;  1FT1 B;  3M72 A;  4KTP A;  3WKF A;  1G9J A;  3NFV A;  1RWC A;  3CU7 A;  3W7W A;  3E32 B;  4ONT A;  3ANI A;  5IKH A;  3E6U A;  1QQF A;  2FUT A;  2H6H B;  1W6K A;  2CQT A;  1TNZ B;  3N0G A;  4Z4J A;  2EAB A;  4AYP A;  3DRA B;  1GXN A;  2VN4 A;  3A0O A;  3WUX A;  3DSS B;  2Q1F A;  4D94 A;  2XWB B;  4DI5 A;  1KFG A;  2FBA A;  3HXF B;  2WDA A;  1HM3 A;  3W7U A;  4OZV A;  4GAX A;  3P5P A;  1V7V A;  1N4S B;  2BRP A;  4XUV A;  2WCO A;  5GY3 A;  1KZO B;  3Q73 B;  1EGU A;  1TNO B;  3WC3 A;  3KQ4 A;  2X03 A;  2DRR A;  1HX9 A;  4L9P B;  5KKB A;  1LXM A;  3ACT A;  5JPN B;  4GTS B;  3D5R A;  1KWF A;  1KS8 A;  1H12 A;  3D3I A;  2D5J A;  2QNO A;  2XQW A;  2FUQ A;  4J5T A;  3RJ3 A;  5M7I A;  3Q7F B;  1FBO A;  5IK6 A;  1H54 A;  2V8K A;  1KSC A;  1K72 A;  1F9D A;  5EAS A;  3E34 B;  1JS4 A;  4WVC A;  1GXO A;  2GOX A;  1L1Y A;  1XW2 A;  3ON6 A;  1G6I A;  3SDR A;  2A73 B;  1O1T B;  5C05 A;  4GTQ B;  1KRF A;  5CZL A;  1OJM A;  1NL4 B;  3S4D A;  1N23 A;  2EAD A;  4E1Y A;  1FPP B;  5IM1 A;  3WKH A;  5DGR A;  1N7P A;  1OJO A;  3Q7A B;  1V5C A;  5MEH A;  1AGM A;  2P0V A;  1H14 A;  1NI1 B;  2XFG A;  3K7X A;  5ILJ A;  1LF9 A;  1HXG A;  1TN7 B;  1N4Q B;  5ILD A;  4RNQ A;  1O79 A;  3QSP A;  1DL2 A;  4GTV B;  1FP3 A;  3QT9 A;  1TF4 A;  2FV0 A;  1GHQ A;  3KSQ B;  5FO7 B;  4BOK A;  1X9D A;  2G02 A;  4CE7 A;  4DOE A;  1LTX B;  4D4D A;  1O6Q A;  1RQ5 A;  3DSW B;  1N7Q A;  3HXB B;  2V8J A;  1HXC A;  4KKJ A;  3EQA A;  2H6F B;  3QPF A;  5JMF A;  1MZC B;  3M77 A;  1JCQ B;  1ULV A;  3W7T A;  2ZBL A;  2A8Z A;  2FUZ A;  2BED B;  4OK2 A;  1WU4 A;  3QXQ A;  2I07 B;  1WU5 A;  2G0D A;  3P2C A;  3E7J A;  3LZ9 A;  2BBC A;  1LD8 B;  3K11 A;  3SFY B;  1H37 A;  1RW9 A;  2GH4 A;  1HV6 A;  1SA4 B;  2ZZR A;  3QFZ A;  1O6R A;  1H35 A;  3S9V A;  1LOH A;  3PZ1 B;  5DGQ A;  5JMD A;  4LIX A;  3WIW A; 
#chains in the Genus database with same CATH homology
 3PZ2 B;  1R76 A;  4KKI A;  1X81 B;  5JPM B;  2WY8 A;  2BB5 A;  1WU6 A;  3M73 A;  1SA5 B;  3HXE B;  1W6J A;  3CIH A;  4D4B A;  4V1S A;  2OKX A;  3W7S A;  2NOJ A;  3SQC A;  4GTP B;  3TF4 A;  1XWT A;  3SFX B;  3M7C A;  3Q79 B;  4LNB B;  1S64 B;  1O5M B;  2WIN B;  3S4B A;  5CD2 A;  3EU5 B;  1WZZ A;  2Z07 A;  3Q78 B;  1FO2 A;  1S63 B;  1N4P B;  3PMM A;  3EU8 A;  4AYO A;  3W5M A;  4KTR A;  1FT2 B;  2JF4 A;  3SDV A;  4Q88 A;  3SDQ A;  4L6X A;  1TNY B;  2RGK A;  1G87 A;  3S4C A;  2ZIS B;  4WU0 A;  3SDU A;  4LNG B;  3QRY A;  3HXC B;  1QSJ A;  4YDE B;  1UT9 A;  2AHF A;  5CA3 A;  3D5S A;  2D8L A;  1GLM A;  1FAE A;  2V3N A;  2EAC A;  3EUV B;  2IEJ B;  1IA7 A;  1GSZ A;  2WYN A;  4C1S A;  4L0G A;  1N4R B;  1GAH A;  1O1S B;  3PZ3 B;  1N95 B;  3KSL B;  2ZIR B;  4TF4 A;  3H2W A;  1DCE B;  2CQS A;  2F0Y B;  1FO3 A;  3S4A A;  4GTM B;  4ZH1 A;  2YIK A;  2DRQ A;  4Q2B A;  2DRO A;  2FV1 A;  3SAE A;  4GTR B;  1HCU A;  3H7L A;  1JCR B;  5GW7 A;  4YCR A;  2AHG A;  3WKI A;  4D4A A;  1L2A A;  1GXM A;  5FO8 B;  3HXD B;  3PZ4 B;  3QG0 A;  3M71 A;  3VXD A;  1N9A B;  4QT9 A;  3OED A;  4V1R A;  5AGD A;  2SQC A;  3PYB A;  4GTT B;  4WVA A;  1O1R B;  2EAE A;  3M74 A;  3M78 A;  1H13 A;  1TNB B;  4FXK B;  1SQC A;  4CJ1 A;  4ZH5 A;  3AFJ A;  1UG9 A;  1UMP A;  2H6G B;  5FO9 B;  1V7W A;  1TN8 B;  4JJJ A;  2AFA A;  3QFY A;  3WIR A;  4EHM B;  1D8E B;  3ANJ A;  3DSX B;  1TNU B;  2B4F A;  4DOD A;  2H6I B;  3M76 A;  2JJB A;  3OXU A;  1D8D B;  1O6H A;  2B39 A;  2PMV A;  2WY7 A;  1FMI A;  3EZ8 A;  3M7L A;  2NVP A;  1LD7 B;  3ANK A;  4CJ0 A;  3DST B;  3E30 B;  1H3B A;  3KLS A;  4D4C A;  4AYQ A;  3RX5 A;  3RRS A;  3M7B A;  3RSY A;  4TXT A;  2V3P A;  5M7Y A;  1CLC A;  3RX8 A;  3QXF A;  1IS9 A;  3Q75 B;  3P5R A;  1NC5 A;  3WKG A;  5FOB B;  4ZRQ A;  3QT3 A;  1H3C A;  3W7X A;  3SDT A;  3REN A;  3PYA A;  3GT5 A;  2RI9 A;  3E37 B;  2RI8 A;  1DOG A;  3G6J B;  3DSU B;  5E2J A;  1IA6 A;  4EL8 A;  4ZRP A;  1VD5 A;  1G9G A;  1JCS B;  2R2L B;  4GTO B;  5GZK A;  4Z4L A;  1NXC A;  3W5N A;  3E33 B;  1KKT A;  1N94 B;  1GAI A;  1V5D A;  2BB6 A;  3GZK A;  4FXG B;  3M75 A;  3E73 A;  3GLY A;  1QBQ B;  4FUS A;  2GZ6 A;  1HZF A;  3X17 A;  3H3K A;  1AYX A;  2V8I A;  2PN5 A;  4MU9 A;  2F6D A;  4MBG B;  1KZP B;  1C3D A;  1KSD A;  3QDE A;  4WVB A;  2XWJ B;  1CEM A;  3DPY B;  3RX7 A;  4GL3 A;  1LF6 A;  2VN7 A;  1H3A A;  1V7X A;  3A3V A;  1FBW A;  1H39 A;  2WII B;  3VW5 A;  4YDO B;  3T33 A;  4AYR A;  3WIQ A;  3C72 B;  3ACS A;  1FCE A;  3M7E A;  1XWQ A;  1KRE A;  3QWT A;  1TN6 B;  2JG0 A;  1F9O A;  4M76 A;  4LNV A;  3DSV B;  1GA2 A;  2DRS A;  4ZG8 A;  1H36 A;  4BOJ A;  1FT1 B;  3M72 A;  4KTP A;  3WKF A;  1G9J A;  3CU7 A;  3W7W A;  3E32 B;  4ONT A;  3ANI A;  3E6U A;  1QQF A;  2H6H B;  1W6K A;  2CQT A;  1TNZ B;  4Z4J A;  2EAB A;  4AYP A;  3DRA B;  1GXN A;  2VN4 A;  3WUX A;  3DSS B;  4D94 A;  2XWB B;  1KFG A;  2FBA A;  3HXF B;  3W7U A;  3P5P A;  1V7V A;  1N4S B;  4XUV A;  5GY3 A;  1KZO B;  3Q73 B;  1TNO B;  3WC3 A;  3KQ4 A;  2DRR A;  4L9P B;  5KKB A;  3ACT A;  5JPN B;  4GTS B;  3D5R A;  1KWF A;  1KS8 A;  1H12 A;  3D3I A;  2D5J A;  2QNO A;  2XQW A;  4J5T A;  3RJ3 A;  5M7I A;  3Q7F B;  1FBO A;  1H54 A;  2V8K A;  1KSC A;  1K72 A;  1F9D A;  3E34 B;  1JS4 A;  4WVC A;  1GXO A;  2GOX A;  1L1Y A;  1XW2 A;  3ON6 A;  1G6I A;  3SDR A;  2A73 B;  1O1T B;  4GTQ B;  1KRF A;  5CZL A;  1NL4 B;  3S4D A;  2EAD A;  1FPP B;  3WKH A;  5DGR A;  3Q7A B;  1V5C A;  5MEH A;  1AGM A;  2P0V A;  1H14 A;  1NI1 B;  2XFG A;  3K7X A;  1LF9 A;  1TN7 B;  1N4Q B;  1O79 A;  3QSP A;  1DL2 A;  4GTV B;  1FP3 A;  3QT9 A;  1TF4 A;  2FV0 A;  1GHQ A;  3KSQ B;  5FO7 B;  4BOK A;  1X9D A;  2G02 A;  4CE7 A;  4DOE A;  1LTX B;  4D4D A;  1O6Q A;  1RQ5 A;  3DSW B;  3HXB B;  2V8J A;  4KKJ A;  3QPF A;  2H6F B;  3EQA A;  1MZC B;  3M77 A;  1JCQ B;  1ULV A;  3W7T A;  2ZBL A;  2A8Z A;  2FUZ A;  2BED B;  1WU4 A;  3QXQ A;  2I07 B;  1WU5 A;  2G0D A;  3P2C A;  2BBC A;  1LD8 B;  3K11 A;  3SFY B;  1H37 A;  2GH4 A;  1SA4 B;  2ZZR A;  3QFZ A;  1O6R A;  1H35 A;  3S9V A;  3PZ1 B;  5DGQ A;  4LIX A;  3WIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...