The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
89
|
structure length |
89
|
Chain Sequence |
NDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGNSHPALDPKSRATLEHVLTVQGDLAAFLVVARDMLLASL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of a central component of the yeast kinetochore: the spc24p/spc25p globular domain.
pubmed doi rcsb |
molecule tags |
Structural protein, protein binding
|
source organism |
Saccharomyces cerevisiae
|
molecule keywords |
Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
|
total genus |
19
|
structure length |
89
|
sequence length |
89
|
ec nomenclature | |
pdb deposition date | 2006-01-29 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Copper Amine Oxidase; Chain A, domain 1 | Copper Amine Oxidase; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 4GEQ A; 5T6J B; 3VZ9 B; 3VZA A; 5TCS D; 2FV4 A; 2FTX A; #chains in the Genus database with same CATH topology 1DYU A; 1OAC A; 5T6J B; 1QAL A; 1QAF A; 2WO0 A; 1JRQ A; 1QAK A; 2WOH A; 1D6Z A; 3VZ9 B; 1D6U A; 3VZA A; 2W0Q A; 2WGQ A; 2FTX A; 4GEQ A; 1SPU A; 1LVN A; 2WOF A; 1D6Y A; 5TCS D; 4DZO A; 2FV4 A; 3K1L A; #chains in the Genus database with same CATH homology 4GEQ A; 5T6J B; 3VZ9 B; 3VZA A; 5TCS D; 4DZO A; 2FV4 A; 2FTX A; 3K1L A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...