2FV4A

Nmr solution structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
b'NDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGNSHPALDPKSRATLEHVLTVQGDLAAFLVVARDMLLASL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
publication title Structure of a central component of the yeast kinetochore: the spc24p/spc25p globular domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein, protein binding
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2006-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.457.50 Alpha Beta 2-Layer Sandwich Copper Amine Oxidase; Chain A, domain 1 Copper Amine Oxidase; Chain A, domain 1 2fv4A00
3VZ9B 2FV4A 2FTXA 5TCSD 5T6JB 3VZAA 4GEQA
chains in the Genus database with same CATH superfamily
4DZOA 3VZ9B 2W0QA 1OACA 1D6ZA 3VZAA 2WOHA 1D6UA 2WOFA 3K1LA 2WGQA 4GEQA 1DYUA 1SPUA 1QAKA 1D6YA 1LVNA 1JRQA 2FTXA 1QAFA 2FV4A 5TCSD 5T6JB 2WO0A 1QALA
chains in the Genus database with same CATH topology
4DZOA 3VZ9B 2FV4A 2FTXA 5TCSD 3K1LA 5T6JB 3VZAA 4GEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VZ9 B;  2FV4 A;  2FTX A;  5TCS D;  5T6J B;  3VZA A;  4GEQ A; 
#chains in the Genus database with same CATH topology
 4DZO A;  3VZ9 B;  2W0Q A;  1OAC A;  1D6Z A;  3VZA A;  2WOH A;  1D6U A;  2WOF A;  3K1L A;  2WGQ A;  4GEQ A;  1DYU A;  1SPU A;  1QAK A;  1D6Y A;  1LVN A;  1JRQ A;  2FTX A;  1QAF A;  2FV4 A;  5TCS D;  5T6J B;  2WO0 A;  1QAL A; 
#chains in the Genus database with same CATH homology
 4DZO A;  3VZ9 B;  2FV4 A;  2FTX A;  5TCS D;  3K1L A;  5T6J B;  3VZA A;  4GEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...