2FVEA

Structure of 10:0-acp (protein alone)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl Carrier Protein
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Biosynthetic protein
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fveA00
2FQ2A 2L22A 2LL8A 3RG2A 2K93A 4BPHA 2FVFA 2LTEA 1OR5A 2N6YA 2MVUA 2MF4A 4H2YC 1L0IA 1ACPA 2LIUA 2FHSC 2K94A 2M5RA 1HQBA 4DG9A 3NY7B 3LMOA 2JU2A 2FADA 2XZ0D 2KG6A 3EJEA 2MY5A 1F80D 2AFDA 2X2BA 2K0XA 1AF8A 5KP8B 2PNGA 2KOQA 1VKUA 2MR7A 4HKGA 3EJDA 3EJBA 2KOOA 2FQ0A 2K92A 2KGCA 2KOPA 2XZ1C 4BPGA 2KORA 2DNWA 4NEOA 4BPFA 2JU1A 3CE7A 2GDXA 2FACA 2N50A 4PWVB 4H2WC 2LMLA 2KG8A 2MR8A 2KGAA 2QNWA 2AF8A 2KGDA 1NQ4A 5KP7B 4CA3A 2FQ1A 2LOLA 3GZLA 2EHSA 1X3OA 2AVAA 1KLPA 1HY8A 2L4BA 2KG9A 2KGEA 5CZDB 2LKIA 5KP6B 2L0QA 2EHTA 5HV8A 5HVCA 4PXHB 2KR5A 2LIWA 1DNYA 4IZ6A 2MVVA 2FVAA 4MRTC 2GDYA 2CG5B 2CQ8A 2CGQA 2CNRA 2MD9A 2FVEA 2KOSA 2N5HA 2L9FA 2LPKA 2N5IA 2K2QA 2JQ4A 1L0HA 2K0YA 2KWLA 1DV5A 4H2XC 5EJDA 2VSQA 2JGPA 2FAEA 2AFEA 4R0MA 2N6ZA 3GZMA 2KW2A 2N98A 2ROQA 2GDWA 1T8KA
chains in the Genus database with same CATH superfamily
2Z45A 2JO0A 2LL8A 1Z6MA 2GYKA 2N6YA 1IMPA 2LIUA 1EIAA 2Z44A 2K94A 3H0DA 1VQOP 3LMOA 2XZ0D 2KG6A 1F80D 5BS1A 2BHVA 2X2BA 2K0XA 5KP8B 2PEJA 2PNGA 1VQ9P 1VKUA 2MR7A 4HKGA 3VRLC 2KGCA 3NTEA 2GZFA 4QNBA 2KORA 2DNWA 3DS2A 1D1DA 2N50A 4H2WC 1UJZA 3CCRP 2MR8A 1GXHA 2KGDA 2GZEA 5KP7B 2PEMA 2XXMA 3CCUP 1GPJA 3GZLA 4GR2A 2LF4A 2K5XA 1X3OA 2AVAA 1E6JP 5F2KA 2KGEA 4WYMA 2JB0A 2EIAA 5HV8A 4PXHB 3B5IA 3HYBA 3H4EA 1DNYA 2VLOA 3U43A 2MVVA 2VLNA 3CC4P 4MRTC 2GDYA 5I4TG 1W2BO 4XROA 2MD9A 2L9FA 2LPKA 2JQ4A 1L0HA 1ZNVA 2K0YA 1DV5A 4H2XC 2AFEA 4R0MA 2ONTA 3GZMA 2N98A 1EMVA 3CPWO 5HGNA 3CC7P 1N8RQ 1BAJA 3DPHA 2LTEA 1OR5A 1L0IA 3M1MA 2M5RA 1HQBA 3NY7B 3DS3A 2FADA 3EJEA 1YITP 4XFXA 3G26A 2VLQA 4U0CA 3CMEP 4COPA 3CCMP 2XZ1C 2XT1A 1YJWP 1K30A 1Q86Q 3G21A 5EW5E 5HGMA 2NO8A 2JU1A 2FACA 2QEXP 1K9MQ 4U0DA 1CEIA 2KG8A 1A8OA 2AF8A 4U0BA 3G29A 3GJNA 2LOLA 1Q82Q 1VHNA 2EHSA 3DTJA 1KD1Q 3DS0A 1KLPA 3CD6P 1VQNP 5CZDB 5JPAA 2GZGA 2L0QA 5HVCA 2JYLA 3CCLP 2KR5A 1Q7YQ 4IZ6A 1BXIA 3CC2P 3G1GA 2BUOA 4XRQA 1M90Q 2CNRA 3GKLC 1YIJP 1RNIA 2FVEA 2KOSA 2N5HA 1MZ8A 1VQ6P 2N5IA 2VSQA 2JGPA 2N6ZA 3B4QA 2KW2A 1YHQP 1VQLP 3CCQP 1VQ4P 7CEIA 4M0IA 1QVGO 2K93A 4PH0A 2FVFA 5BS2A 4PH1A 1KC8Q 1VQKP 3RG6C 3CCVP 3OW2O 2MF4A 2EFJA 4H2YC 2JAZA 2FHSC 1VQ5P 3CCSP 2JU2A 2GZIA 2OARA 2XV6A 2MY5A 2AFDA 1VQ8P 2KOQA 2PEIA 3EJDA 3EJBA 2FQ0A 2K92A 1YJNP 3G28A 2KOPA 4BPGA 2M8NA 4COCA 1M6NA 4NEOA 1VQ7P 1Q81Q 1VQPP 3CE7A 2GDXA 4PWVB 1M6EX 4GR6A 3CXCO 2QNWA 2KGAA 2QA4P 1NQ4A 5HGLA 3CCEP 3DS1A 1K8AQ 2FQ1A 2VLPA 2M8PA 2KG9A 2PEOA 5F2OA 3DS5A 2EHTA 4IPYA 1M74A 3LRYA 1GXGA 1E0HA 4U0EA 2P9XA 4U0FA 2JYGA 2Z46A 2CQ8A 2CGQA 2DGYA 1YJ9P 1YI2P 2K2QA 5EJDA 1ZMBA 1K73Q 2FAEA 3G6EP 2WPTA 2GDWA 2FQ2A 2L22A 1UNKA 1M1KQ 3RG2A 1QVFO 4BPHA 2L6EA 2MVUA 4XFYA 1ACPA 2PENA 4QKOA 4F37A 4DG9A 2PEQA 1RO2A 3DS4A 5DCKA 1AF8A 3WBHA 1VQMP 3P05A 1EOQA 2KOOA 5F2NA 3CMAP 2JBGA 3Q20A 3MGEA 4BPFA 3CCJP 2CWOA 2LMLA 5HGOA 2PY8A 2PEKA 2EG5A 4CA3A 1AUMA 3H47A 1JJ2O 2KODA 2OTLP 1IUQA 1S72P 1HY8A 3G4SP 1QRJA 2L4BA 3I56P 2M8LA 2LKIA 3G0VA 5KP6B 2ERHA 2E1MA 3HZQA 4XFZA 4UHPB 1KQSO 2LIWA 2OTJP 1IMQA 2FVAA 2CG5B 1FR2A 3E2DA 2K0DX 4U0AA 3G1IA 1AYIA 2KWLA 2GZJA 1A43A 1NJIQ 3G71P 2ROQA 1RO0A 3I55P 1T8KA
chains in the Genus database with same CATH topology
2FQ2A 2L22A 2LL8A 3RG2A 2K93A 4BPHA 2FVFA 2LTEA 1OR5A 2N6YA 2MVUA 2MF4A 4H2YC 1L0IA 1ACPA 2LIUA 2FHSC 2K94A 2M5RA 1HQBA 4DG9A 3NY7B 3LMOA 2JU2A 2FADA 2XZ0D 2KG6A 3EJEA 2MY5A 1F80D 2AFDA 2X2BA 2K0XA 1AF8A 5KP8B 2PNGA 2KOQA 1VKUA 2MR7A 4HKGA 3EJDA 3EJBA 2KOOA 2FQ0A 2K92A 2KGCA 2KOPA 2XZ1C 4BPGA 2KORA 2DNWA 4NEOA 4BPFA 2JU1A 3CE7A 2GDXA 2FACA 2N50A 4PWVB 4H2WC 2LMLA 2KG8A 2MR8A 2KGAA 2QNWA 2AF8A 2KGDA 1NQ4A 5KP7B 4CA3A 2FQ1A 2LOLA 3GZLA 2EHSA 1X3OA 2AVAA 1KLPA 1HY8A 2L4BA 2KG9A 2KGEA 5CZDB 2LKIA 5KP6B 2L0QA 2EHTA 5HV8A 5HVCA 4PXHB 2KR5A 2LIWA 1DNYA 4IZ6A 2MVVA 2FVAA 4MRTC 2GDYA 2CG5B 2CQ8A 2CGQA 2CNRA 2MD9A 2FVEA 2KOSA 2N5HA 2L9FA 2LPKA 2N5IA 2K2QA 2JQ4A 1L0HA 2K0YA 2KWLA 1DV5A 4H2XC 5EJDA 2VSQA 2JGPA 2FAEA 2AFEA 4R0MA 2N6ZA 3GZMA 2KW2A 2N98A 2ROQA 2GDWA 1T8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ2 A;  2L22 A;  2LL8 A;  3RG2 A;  2K93 A;  4BPH A;  2FVF A;  2LTE A;  1OR5 A;  2N6Y A;  2MVU A;  2MF4 A;  4H2Y C;  1L0I A;  1ACP A;  2LIU A;  2FHS C;  2K94 A;  2M5R A;  1HQB A;  4DG9 A;  3NY7 B;  3LMO A;  2JU2 A;  2FAD A;  2XZ0 D;  2KG6 A;  3EJE A;  2MY5 A;  1F80 D;  2AFD A;  2X2B A;  2K0X A;  1AF8 A;  5KP8 B;  2PNG A;  2KOQ A;  1VKU A;  2MR7 A;  4HKG A;  3EJD A;  3EJB A;  2KOO A;  2FQ0 A;  2K92 A;  2KGC A;  2KOP A;  2XZ1 C;  4BPG A;  2KOR A;  2DNW A;  4NEO A;  4BPF A;  2JU1 A;  3CE7 A;  2GDX A;  2FAC A;  2N50 A;  4PWV B;  4H2W C;  2LML A;  2KG8 A;  2MR8 A;  2KGA A;  2QNW A;  2AF8 A;  2KGD A;  1NQ4 A;  5KP7 B;  4CA3 A;  2FQ1 A;  2LOL A;  3GZL A;  2EHS A;  1X3O A;  2AVA A;  1KLP A;  1HY8 A;  2L4B A;  2KG9 A;  2KGE A;  5CZD B;  2LKI A;  5KP6 B;  2L0Q A;  2EHT A;  5HV8 A;  5HVC A;  4PXH B;  2KR5 A;  2LIW A;  1DNY A;  4IZ6 A;  2MVV A;  2FVA A;  4MRT C;  2GDY A;  2CG5 B;  2CQ8 A;  2CGQ A;  2CNR A;  2MD9 A;  2FVE A;  2KOS A;  2N5H A;  2L9F A;  2LPK A;  2N5I A;  2K2Q A;  2JQ4 A;  1L0H A;  2K0Y A;  2KWL A;  1DV5 A;  4H2X C;  5EJD A;  2VSQ A;  2JGP A;  2FAE A;  2AFE A;  4R0M A;  2N6Z A;  3GZM A;  2KW2 A;  2N98 A;  2ROQ A;  2GDW A;  1T8K A; 
#chains in the Genus database with same CATH topology
 2Z45 A;  2JO0 A;  2LL8 A;  1Z6M A;  2GYK A;  2N6Y A;  1IMP A;  2LIU A;  1EIA A;  2Z44 A;  2K94 A;  3H0D A;  1VQO P;  3LMO A;  2XZ0 D;  2KG6 A;  1F80 D;  5BS1 A;  2BHV A;  2X2B A;  2K0X A;  5KP8 B;  2PEJ A;  2PNG A;  1VQ9 P;  1VKU A;  2MR7 A;  4HKG A;  3VRL C;  2KGC A;  3NTE A;  2GZF A;  4QNB A;  2KOR A;  2DNW A;  3DS2 A;  1D1D A;  2N50 A;  4H2W C;  1UJZ A;  3CCR P;  2MR8 A;  1GXH A;  2KGD A;  2GZE A;  5KP7 B;  2PEM A;  2XXM A;  3CCU P;  1GPJ A;  3GZL A;  4GR2 A;  2LF4 A;  2K5X A;  1X3O A;  2AVA A;  1E6J P;  5F2K A;  2KGE A;  4WYM A;  2JB0 A;  2EIA A;  5HV8 A;  4PXH B;  3B5I A;  3HYB A;  3H4E A;  1DNY A;  2VLO A;  3U43 A;  2MVV A;  2VLN A;  3CC4 P;  4MRT C;  2GDY A;  5I4T G;  1W2B O;  4XRO A;  2MD9 A;  2L9F A;  2LPK A;  2JQ4 A;  1L0H A;  1ZNV A;  2K0Y A;  1DV5 A;  4H2X C;  2AFE A;  4R0M A;  2ONT A;  3GZM A;  2N98 A;  1EMV A;  3CPW O;  5HGN A;  3CC7 P;  1N8R Q;  1BAJ A;  3DPH A;  2LTE A;  1OR5 A;  1L0I A;  3M1M A;  2M5R A;  1HQB A;  3NY7 B;  3DS3 A;  2FAD A;  3EJE A;  1YIT P;  4XFX A;  3G26 A;  2VLQ A;  4U0C A;  3CME P;  4COP A;  3CCM P;  2XZ1 C;  2XT1 A;  1YJW P;  1K30 A;  1Q86 Q;  3G21 A;  5EW5 E;  5HGM A;  2NO8 A;  2JU1 A;  2FAC A;  2QEX P;  1K9M Q;  4U0D A;  1CEI A;  2KG8 A;  1A8O A;  2AF8 A;  4U0B A;  3G29 A;  3GJN A;  2LOL A;  1Q82 Q;  1VHN A;  2EHS A;  3DTJ A;  1KD1 Q;  3DS0 A;  1KLP A;  3CD6 P;  1VQN P;  5CZD B;  5JPA A;  2GZG A;  2L0Q A;  5HVC A;  2JYL A;  3CCL P;  2KR5 A;  1Q7Y Q;  4IZ6 A;  1BXI A;  3CC2 P;  3G1G A;  2BUO A;  4XRQ A;  1M90 Q;  2CNR A;  3GKL C;  1YIJ P;  1RNI A;  2FVE A;  2KOS A;  2N5H A;  1MZ8 A;  1VQ6 P;  2N5I A;  2VSQ A;  2JGP A;  2N6Z A;  3B4Q A;  2KW2 A;  1YHQ P;  1VQL P;  3CCQ P;  1VQ4 P;  7CEI A;  4M0I A;  1QVG O;  2K93 A;  4PH0 A;  2FVF A;  5BS2 A;  4PH1 A;  1KC8 Q;  1VQK P;  3RG6 C;  3CCV P;  3OW2 O;  2MF4 A;  2EFJ A;  4H2Y C;  2JAZ A;  2FHS C;  1VQ5 P;  3CCS P;  2JU2 A;  2GZI A;  2OAR A;  2XV6 A;  2MY5 A;  2AFD A;  1VQ8 P;  2KOQ A;  2PEI A;  3EJD A;  3EJB A;  2FQ0 A;  2K92 A;  1YJN P;  3G28 A;  2KOP A;  4BPG A;  2M8N A;  4COC A;  1M6N A;  4NEO A;  1VQ7 P;  1Q81 Q;  1VQP P;  3CE7 A;  2GDX A;  4PWV B;  1M6E X;  4GR6 A;  3CXC O;  2QNW A;  2KGA A;  2QA4 P;  1NQ4 A;  5HGL A;  3CCE P;  3DS1 A;  1K8A Q;  2FQ1 A;  2VLP A;  2M8P A;  2KG9 A;  2PEO A;  5F2O A;  3DS5 A;  2EHT A;  4IPY A;  1M74 A;  3LRY A;  1GXG A;  1E0H A;  4U0E A;  2P9X A;  4U0F A;  2JYG A;  2Z46 A;  2CQ8 A;  2CGQ A;  2DGY A;  1YJ9 P;  1YI2 P;  2K2Q A;  5EJD A;  1ZMB A;  1K73 Q;  2FAE A;  3G6E P;  2WPT A;  2GDW A;  2FQ2 A;  2L22 A;  1UNK A;  1M1K Q;  3RG2 A;  1QVF O;  4BPH A;  2L6E A;  2MVU A;  4XFY A;  1ACP A;  2PEN A;  4QKO A;  4F37 A;  4DG9 A;  2PEQ A;  1RO2 A;  3DS4 A;  5DCK A;  1AF8 A;  3WBH A;  1VQM P;  3P05 A;  1EOQ A;  2KOO A;  5F2N A;  3CMA P;  2JBG A;  3Q20 A;  3MGE A;  4BPF A;  3CCJ P;  2CWO A;  2LML A;  5HGO A;  2PY8 A;  2PEK A;  2EG5 A;  4CA3 A;  1AUM A;  3H47 A;  1JJ2 O;  2KOD A;  2OTL P;  1IUQ A;  1S72 P;  1HY8 A;  3G4S P;  1QRJ A;  2L4B A;  3I56 P;  2M8L A;  2LKI A;  3G0V A;  5KP6 B;  2ERH A;  2E1M A;  3HZQ A;  4XFZ A;  4UHP B;  1KQS O;  2LIW A;  2OTJ P;  1IMQ A;  2FVA A;  2CG5 B;  1FR2 A;  3E2D A;  2K0D X;  4U0A A;  3G1I A;  1AYI A;  2KWL A;  2GZJ A;  1A43 A;  1NJI Q;  3G71 P;  2ROQ A;  1RO0 A;  3I55 P;  1T8K A; 
#chains in the Genus database with same CATH homology
 2FQ2 A;  2L22 A;  2LL8 A;  3RG2 A;  2K93 A;  4BPH A;  2FVF A;  2LTE A;  1OR5 A;  2N6Y A;  2MVU A;  2MF4 A;  4H2Y C;  1L0I A;  1ACP A;  2LIU A;  2FHS C;  2K94 A;  2M5R A;  1HQB A;  4DG9 A;  3NY7 B;  3LMO A;  2JU2 A;  2FAD A;  2XZ0 D;  2KG6 A;  3EJE A;  2MY5 A;  1F80 D;  2AFD A;  2X2B A;  2K0X A;  1AF8 A;  5KP8 B;  2PNG A;  2KOQ A;  1VKU A;  2MR7 A;  4HKG A;  3EJD A;  3EJB A;  2KOO A;  2FQ0 A;  2K92 A;  2KGC A;  2KOP A;  2XZ1 C;  4BPG A;  2KOR A;  2DNW A;  4NEO A;  4BPF A;  2JU1 A;  3CE7 A;  2GDX A;  2FAC A;  2N50 A;  4PWV B;  4H2W C;  2LML A;  2KG8 A;  2MR8 A;  2KGA A;  2QNW A;  2AF8 A;  2KGD A;  1NQ4 A;  5KP7 B;  4CA3 A;  2FQ1 A;  2LOL A;  3GZL A;  2EHS A;  1X3O A;  2AVA A;  1KLP A;  1HY8 A;  2L4B A;  2KG9 A;  2KGE A;  5CZD B;  2LKI A;  5KP6 B;  2L0Q A;  2EHT A;  5HV8 A;  5HVC A;  4PXH B;  2KR5 A;  2LIW A;  1DNY A;  4IZ6 A;  2MVV A;  2FVA A;  4MRT C;  2GDY A;  2CG5 B;  2CQ8 A;  2CGQ A;  2CNR A;  2MD9 A;  2FVE A;  2KOS A;  2N5H A;  2L9F A;  2LPK A;  2N5I A;  2K2Q A;  2JQ4 A;  1L0H A;  2K0Y A;  2KWL A;  1DV5 A;  4H2X C;  5EJD A;  2VSQ A;  2JGP A;  2FAE A;  2AFE A;  4R0M A;  2N6Z A;  3GZM A;  2KW2 A;  2N98 A;  2ROQ A;  2GDW A;  1T8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...