2FVEA

Structure of 10:0-acp (protein alone)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Biosynthetic protein
molecule keywords Acyl Carrier Protein
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fveA00
2KOSA 2KR5A 5KP6B 2FQ1A 2K0YA 2GDWA 2KOPA 2MD9A 2FACA 2X2BA 2MY5A 2KOOA 1L0HA 2K0XA 4IZ6A 2FVAA 2KW2A 2DNWA 1F80D 2CNRA 2MVVA 3GZMA 2N6YA 1VKUA 2JU2A 2MF4A 2M5RA 4BPGA 2AVAA 1DV5A 5CZDB 2L9FA 2L22A 2EHTA 2K92A 2MVUA 2KGAA 2CGQA 1DNYA 2KG9A 2XZ1C 4PWVB 2AF8A 2AFDA 1L0IA 2FVEA 2K2QA 2N6ZA 2L0QA 2FAEA 2MR7A 2ROQA 2JGPA 2LPKA 2QNWA 4PXHB 5KP8B 2JQ4A 5HV8A 2CG5B 2KGEA 2XZ0D 2FADA 2K93A 2LIUA 2LKIA 4R0MA 2L4BA 3EJBA 3RG2A 2FQ2A 2JU1A 4MRTC 2FVFA 1OR5A 2EHSA 3NY7B 2VSQA 4CA3A 1KLPA 2KGCA 2KGDA 3GZLA 4BPHA 1X3OA 2LOLA 2KORA 2LTEA 2FHSC 1AF8A 2AFEA 2KG8A 2LIWA 2N5IA 1T8KA 2N98A 4DG9A 2LMLA 4H2WC 4H2YC 2KG6A 1ACPA 4NEOA 2KWLA 3EJEA 2LL8A 2MR8A 2PNGA 3CE7A 2FQ0A 2GDXA 2N5HA 4BPFA 5KP7B 2GDYA 1HQBA 5EJDA 5HVCA 3LMOA 4HKGA 4H2XC 2K94A 1NQ4A 2CQ8A 3EJDA 2N50A 1HY8A 2KOQA
chains in the Genus database with same CATH superfamily
4IPYA 2Z45A 5KP6B 2FQ1A 1NJIQ 2MD9A 2GZIA 2MY5A 1QRJA 2KOOA 5F2NA 1L0HA 3B4QA 2K0XA 4IZ6A 1D1DA 3GZMA 2PEQA 3NTEA 3VRLC 3HYBA 3HZQA 1K73Q 4F37A 2MF4A 2JB0A 2GZJA 1DV5A 2L9FA 3DS3A 3CCSP 2KODA 2PEMA 1RO2A 2KG9A 2XZ1C 3G28A 2AF8A 1L0IA 4COPA 5JPAA 2FVEA 2ROQA 2LPKA 4PXHB 1M6NA 3DTJA 3G29A 2QA4P 1VQ5P 3G21A 1A43A 2ERHA 1QVFO 2JU1A 5F2KA 2XXMA 3LRYA 3DS2A 3CCMP 4UHPB 1AUMA 2KGCA 3G4SP 2GZGA 1Q86Q 3CMAP 3CMEP 2L6EA 3DPHA 2KG8A 2LIWA 2N5IA 3MGEA 2LMLA 1ACPA 4XFZA 2KWLA 3EJEA 1VQ9P 2PEKA 1W2BO 2PNGA 1GXGA 1CEIA 3CC7P 3E2DA 1KD1Q 2K5XA 3CC2P 3I55P 1MZ8A 3DS4A 1Q7YQ 3LMOA 4XROA 4HKGA 1VQ7P 2WPTA 4H2XC 2KOQA 2OTLP 3G26A 4U0FA 2KOSA 5EW5E 2K0YA 2FACA 1YIJP 2JO0A 2KW2A 3G71P 2MVVA 2JU2A 2M5RA 2QEXP 2PEJA 3CCVP 4U0CA 2GYKA 3H4EA 5CZDB 1RNIA 2MVUA 1DNYA 1YITP 1Z6MA 2DGYA 3CCJP 5HGMA 2FAEA 2OTJP 2QNWA 2P9XA 5KP8B 2PENA 1VQOP 2JQ4A 5HV8A 2EG5A 1EOQA 2FADA 2LKIA 4R0MA 2VLOA 3RG2A 2M8NA 4QKOA 1KC8Q 1VQ4P 2EHSA 3NY7B 3U43A 2VSQA 1Q81Q 2LOLA 1IMPA 1GXHA 1EIAA 3H47A 3OW2O 3RG6C 3CD6P 3CCEP 4H2WC 2KG6A 4COCA 4PH0A 2JYLA 5HGNA 2MR8A 1KQSO 2GDXA 2BUOA 3GKLC 1ZMBA 3G6EP 4M0IA 1HQBA 3CCRP 2CWOA 5EJDA 2GZEA 2K94A 2NO8A 3CPWO 2N50A 1HY8A 2KR5A 2X2BA 5F2OA 1VQKP 1F80D 1VQNP 2PEIA 1Q82Q 1AYIA 4U0DA 1YJWP 3CCUP 1JJ2O 1S72P 5BS1A 4PWVB 1VHNA 1M74A 3G0VA 2GZFA 2K2QA 2N6ZA 2MR7A 1QVGO 2JGPA 3WBHA 1RO0A 1M90Q 1E6JP 5DCKA 3B5IA 2KGEA 2XZ0D 2M8LA 3EJBA 3DS1A 2EIAA 2XV6A 1OR5A 4CA3A 2K0DX 2JBGA 2KGDA 3GZLA 4XRQA 1K8AQ 4U0BA 3CCQP 2FHSC 1AF8A 2AFEA 1T8KA 2N98A 4DG9A 2M8PA 4H2YC 4NEOA 5I4TG 5HGLA 3CXCO 3M1MA 1ZNVA 7CEIA 1VQ6P 4BPFA 1GPJA 1BAJA 5HVCA 1EMVA 1NQ4A 2CQ8A 3EJDA 2Z46A 2PY8A 2Z44A 4U0AA 3CCLP 2KOPA 2GDWA 3P05A 4QNBA 2VLQA 2FVAA 2DNWA 2CNRA 4PH1A 5HGOA 2N6YA 2JAZA 1VKUA 2OARA 3GJNA 3H0DA 4BPGA 2AVAA 1IMQA 2L22A 1IUQA 2EHTA 2K92A 2KGAA 2CGQA 2LF4A 1K30A 2AFDA 2ONTA 2L0QA 1BXIA 1FR2A 1N8RQ 1A8OA 4U0EA 1VQMP 2CG5B 2EFJA 2K93A 2LIUA 1VQPP 4GR6A 1VQLP 5BS2A 2XT1A 2L4BA 2BHVA 2FQ2A 1E0HA 2E1MA 4MRTC 2FVFA 1UNKA 2JYGA 1YJNP 1KLPA 4XFYA 3CC4P 3I56P 4BPHA 1YJ9P 1X3OA 3DS5A 1YI2P 1M1KQ 4XFXA 2KORA 4GR2A 2LTEA 3G1IA 2VLNA 3Q20A 3DS0A 2VLPA 1M6EX 1YHQP 4WYMA 2LL8A 3CE7A 2FQ0A 2N5HA 2PEOA 3G1GA 1UJZA 5KP7B 2GDYA 1VQ8P 1K9MQ
chains in the Genus database with same CATH topology
2KOSA 2KR5A 5KP6B 2FQ1A 2K0YA 2GDWA 2KOPA 2MD9A 2FACA 2X2BA 2MY5A 2KOOA 1L0HA 2K0XA 4IZ6A 2FVAA 2KW2A 2DNWA 1F80D 2CNRA 2MVVA 3GZMA 2N6YA 1VKUA 2JU2A 2MF4A 2M5RA 4BPGA 2AVAA 1DV5A 5CZDB 2L9FA 2L22A 2EHTA 2K92A 2MVUA 2KGAA 2CGQA 1DNYA 2KG9A 2XZ1C 4PWVB 2AF8A 2AFDA 1L0IA 2FVEA 2K2QA 2N6ZA 2L0QA 2FAEA 2MR7A 2ROQA 2JGPA 2LPKA 2QNWA 4PXHB 5KP8B 2JQ4A 5HV8A 2CG5B 2KGEA 2XZ0D 2FADA 2K93A 2LIUA 2LKIA 4R0MA 2L4BA 3EJBA 3RG2A 2FQ2A 2JU1A 4MRTC 2FVFA 1OR5A 2EHSA 3NY7B 2VSQA 4CA3A 1KLPA 2KGCA 2KGDA 3GZLA 4BPHA 1X3OA 2LOLA 2KORA 2LTEA 2FHSC 1AF8A 2AFEA 2KG8A 2LIWA 2N5IA 1T8KA 2N98A 4DG9A 2LMLA 4H2WC 4H2YC 2KG6A 1ACPA 4NEOA 2KWLA 3EJEA 2LL8A 2MR8A 2PNGA 3CE7A 2FQ0A 2GDXA 2N5HA 4BPFA 5KP7B 2GDYA 1HQBA 5EJDA 5HVCA 3LMOA 4HKGA 4H2XC 2K94A 1NQ4A 2CQ8A 3EJDA 2N50A 1HY8A 2KOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOS A;  2KR5 A;  5KP6 B;  2FQ1 A;  2K0Y A;  2GDW A;  2KOP A;  2MD9 A;  2FAC A;  2X2B A;  2MY5 A;  2KOO A;  1L0H A;  2K0X A;  4IZ6 A;  2FVA A;  2KW2 A;  2DNW A;  1F80 D;  2CNR A;  2MVV A;  3GZM A;  2N6Y A;  1VKU A;  2JU2 A;  2MF4 A;  2M5R A;  4BPG A;  2AVA A;  1DV5 A;  5CZD B;  2L9F A;  2L22 A;  2EHT A;  2K92 A;  2MVU A;  2KGA A;  2CGQ A;  1DNY A;  2KG9 A;  2XZ1 C;  4PWV B;  2AF8 A;  2AFD A;  1L0I A;  2FVE A;  2K2Q A;  2N6Z A;  2L0Q A;  2FAE A;  2MR7 A;  2ROQ A;  2JGP A;  2LPK A;  2QNW A;  4PXH B;  5KP8 B;  2JQ4 A;  5HV8 A;  2CG5 B;  2KGE A;  2XZ0 D;  2FAD A;  2K93 A;  2LIU A;  2LKI A;  4R0M A;  2L4B A;  3EJB A;  3RG2 A;  2FQ2 A;  2JU1 A;  4MRT C;  2FVF A;  1OR5 A;  2EHS A;  3NY7 B;  2VSQ A;  4CA3 A;  1KLP A;  2KGC A;  2KGD A;  3GZL A;  4BPH A;  1X3O A;  2LOL A;  2KOR A;  2LTE A;  2FHS C;  1AF8 A;  2AFE A;  2KG8 A;  2LIW A;  2N5I A;  1T8K A;  2N98 A;  4DG9 A;  2LML A;  4H2W C;  4H2Y C;  2KG6 A;  1ACP A;  4NEO A;  2KWL A;  3EJE A;  2LL8 A;  2MR8 A;  2PNG A;  3CE7 A;  2FQ0 A;  2GDX A;  2N5H A;  4BPF A;  5KP7 B;  2GDY A;  1HQB A;  5EJD A;  5HVC A;  3LMO A;  4HKG A;  4H2X C;  2K94 A;  1NQ4 A;  2CQ8 A;  3EJD A;  2N50 A;  1HY8 A;  2KOQ A; 
#chains in the Genus database with same CATH topology
 4IPY A;  2Z45 A;  5KP6 B;  2FQ1 A;  1NJI Q;  2MD9 A;  2GZI A;  2MY5 A;  1QRJ A;  2KOO A;  5F2N A;  1L0H A;  3B4Q A;  2K0X A;  4IZ6 A;  1D1D A;  3GZM A;  2PEQ A;  3NTE A;  3VRL C;  3HYB A;  3HZQ A;  1K73 Q;  4F37 A;  2MF4 A;  2JB0 A;  2GZJ A;  1DV5 A;  2L9F A;  3DS3 A;  3CCS P;  2KOD A;  2PEM A;  1RO2 A;  2KG9 A;  2XZ1 C;  3G28 A;  2AF8 A;  1L0I A;  4COP A;  5JPA A;  2FVE A;  2ROQ A;  2LPK A;  4PXH B;  1M6N A;  3DTJ A;  3G29 A;  2QA4 P;  1VQ5 P;  3G21 A;  1A43 A;  2ERH A;  1QVF O;  2JU1 A;  5F2K A;  2XXM A;  3LRY A;  3DS2 A;  3CCM P;  4UHP B;  1AUM A;  2KGC A;  3G4S P;  2GZG A;  1Q86 Q;  3CMA P;  3CME P;  2L6E A;  3DPH A;  2KG8 A;  2LIW A;  2N5I A;  3MGE A;  2LML A;  1ACP A;  4XFZ A;  2KWL A;  3EJE A;  1VQ9 P;  2PEK A;  1W2B O;  2PNG A;  1GXG A;  1CEI A;  3CC7 P;  3E2D A;  1KD1 Q;  2K5X A;  3CC2 P;  3I55 P;  1MZ8 A;  3DS4 A;  1Q7Y Q;  3LMO A;  4XRO A;  4HKG A;  1VQ7 P;  2WPT A;  4H2X C;  2KOQ A;  2OTL P;  3G26 A;  4U0F A;  2KOS A;  5EW5 E;  2K0Y A;  2FAC A;  1YIJ P;  2JO0 A;  2KW2 A;  3G71 P;  2MVV A;  2JU2 A;  2M5R A;  2QEX P;  2PEJ A;  3CCV P;  4U0C A;  2GYK A;  3H4E A;  5CZD B;  1RNI A;  2MVU A;  1DNY A;  1YIT P;  1Z6M A;  2DGY A;  3CCJ P;  5HGM A;  2FAE A;  2OTJ P;  2QNW A;  2P9X A;  5KP8 B;  2PEN A;  1VQO P;  2JQ4 A;  5HV8 A;  2EG5 A;  1EOQ A;  2FAD A;  2LKI A;  4R0M A;  2VLO A;  3RG2 A;  2M8N A;  4QKO A;  1KC8 Q;  1VQ4 P;  2EHS A;  3NY7 B;  3U43 A;  2VSQ A;  1Q81 Q;  2LOL A;  1IMP A;  1GXH A;  1EIA A;  3H47 A;  3OW2 O;  3RG6 C;  3CD6 P;  3CCE P;  4H2W C;  2KG6 A;  4COC A;  4PH0 A;  2JYL A;  5HGN A;  2MR8 A;  1KQS O;  2GDX A;  2BUO A;  3GKL C;  1ZMB A;  3G6E P;  4M0I A;  1HQB A;  3CCR P;  2CWO A;  5EJD A;  2GZE A;  2K94 A;  2NO8 A;  3CPW O;  2N50 A;  1HY8 A;  2KR5 A;  2X2B A;  5F2O A;  1VQK P;  1F80 D;  1VQN P;  2PEI A;  1Q82 Q;  1AYI A;  4U0D A;  1YJW P;  3CCU P;  1JJ2 O;  1S72 P;  5BS1 A;  4PWV B;  1VHN A;  1M74 A;  3G0V A;  2GZF A;  2K2Q A;  2N6Z A;  2MR7 A;  1QVG O;  2JGP A;  3WBH A;  1RO0 A;  1M90 Q;  1E6J P;  5DCK A;  3B5I A;  2KGE A;  2XZ0 D;  2M8L A;  3EJB A;  3DS1 A;  2EIA A;  2XV6 A;  1OR5 A;  4CA3 A;  2K0D X;  2JBG A;  2KGD A;  3GZL A;  4XRQ A;  1K8A Q;  4U0B A;  3CCQ P;  2FHS C;  1AF8 A;  2AFE A;  1T8K A;  2N98 A;  4DG9 A;  2M8P A;  4H2Y C;  4NEO A;  5I4T G;  5HGL A;  3CXC O;  3M1M A;  1ZNV A;  7CEI A;  1VQ6 P;  4BPF A;  1GPJ A;  1BAJ A;  5HVC A;  1EMV A;  1NQ4 A;  2CQ8 A;  3EJD A;  2Z46 A;  2PY8 A;  2Z44 A;  4U0A A;  3CCL P;  2KOP A;  2GDW A;  3P05 A;  4QNB A;  2VLQ A;  2FVA A;  2DNW A;  2CNR A;  4PH1 A;  5HGO A;  2N6Y A;  2JAZ A;  1VKU A;  2OAR A;  3GJN A;  3H0D A;  4BPG A;  2AVA A;  1IMQ A;  2L22 A;  1IUQ A;  2EHT A;  2K92 A;  2KGA A;  2CGQ A;  2LF4 A;  1K30 A;  2AFD A;  2ONT A;  2L0Q A;  1BXI A;  1FR2 A;  1N8R Q;  1A8O A;  4U0E A;  1VQM P;  2CG5 B;  2EFJ A;  2K93 A;  2LIU A;  1VQP P;  4GR6 A;  1VQL P;  5BS2 A;  2XT1 A;  2L4B A;  2BHV A;  2FQ2 A;  1E0H A;  2E1M A;  4MRT C;  2FVF A;  1UNK A;  2JYG A;  1YJN P;  1KLP A;  4XFY A;  3CC4 P;  3I56 P;  4BPH A;  1YJ9 P;  1X3O A;  3DS5 A;  1YI2 P;  1M1K Q;  4XFX A;  2KOR A;  4GR2 A;  2LTE A;  3G1I A;  2VLN A;  3Q20 A;  3DS0 A;  2VLP A;  1M6E X;  1YHQ P;  4WYM A;  2LL8 A;  3CE7 A;  2FQ0 A;  2N5H A;  2PEO A;  3G1G A;  1UJZ A;  5KP7 B;  2GDY A;  1VQ8 P;  1K9M Q; 
#chains in the Genus database with same CATH homology
 2KOS A;  2KR5 A;  5KP6 B;  2FQ1 A;  2K0Y A;  2GDW A;  2KOP A;  2MD9 A;  2FAC A;  2X2B A;  2MY5 A;  2KOO A;  1L0H A;  2K0X A;  4IZ6 A;  2FVA A;  2KW2 A;  2DNW A;  1F80 D;  2CNR A;  2MVV A;  3GZM A;  2N6Y A;  1VKU A;  2JU2 A;  2MF4 A;  2M5R A;  4BPG A;  2AVA A;  1DV5 A;  5CZD B;  2L9F A;  2L22 A;  2EHT A;  2K92 A;  2MVU A;  2KGA A;  2CGQ A;  1DNY A;  2KG9 A;  2XZ1 C;  4PWV B;  2AF8 A;  2AFD A;  1L0I A;  2FVE A;  2K2Q A;  2N6Z A;  2L0Q A;  2FAE A;  2MR7 A;  2ROQ A;  2JGP A;  2LPK A;  2QNW A;  4PXH B;  5KP8 B;  2JQ4 A;  5HV8 A;  2CG5 B;  2KGE A;  2XZ0 D;  2FAD A;  2K93 A;  2LIU A;  2LKI A;  4R0M A;  2L4B A;  3EJB A;  3RG2 A;  2FQ2 A;  2JU1 A;  4MRT C;  2FVF A;  1OR5 A;  2EHS A;  3NY7 B;  2VSQ A;  4CA3 A;  1KLP A;  2KGC A;  2KGD A;  3GZL A;  4BPH A;  1X3O A;  2LOL A;  2KOR A;  2LTE A;  2FHS C;  1AF8 A;  2AFE A;  2KG8 A;  2LIW A;  2N5I A;  1T8K A;  2N98 A;  4DG9 A;  2LML A;  4H2W C;  4H2Y C;  2KG6 A;  1ACP A;  4NEO A;  2KWL A;  3EJE A;  2LL8 A;  2MR8 A;  2PNG A;  3CE7 A;  2FQ0 A;  2GDX A;  2N5H A;  4BPF A;  5KP7 B;  2GDY A;  1HQB A;  5EJD A;  5HVC A;  3LMO A;  4HKG A;  4H2X C;  2K94 A;  1NQ4 A;  2CQ8 A;  3EJD A;  2N50 A;  1HY8 A;  2KOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...