2FVEA

Structure of 10:0-acp (protein alone)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
b'AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl Carrier Protein
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Biosynthetic protein
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fveA00
2AFDA 2MR7A 2KOOA 2XZ1C 3CE7A 2AVAA 2XZ0D 2KR5A 4BPHA 3GZMA 2GDXA 2L9FA 2N50A 4NEOA 2KOSA 3EJDA 2MD9A 2FACA 1X3OA 3RG2A 4CA3A 1DNYA 2GDWA 2KG6A 2EHTA 2MR8A 3GZLA 2PNGA 2JQ4A 4IZ6A 2FQ2A 2KG8A 5KP8B 2MVVA 4H2WC 1HQBA 2AFEA 2JU2A 4PXHB 2FVFA 2CG5B 2KWLA 4BPFA 2FQ1A 2KOPA 2QNWA 2K94A 2VSQA 1T8KA 2KGCA 2AF8A 1L0IA 1F80D 2KGEA 2LMLA 2LL8A 2L0QA 2LPKA 5CZDB 2N98A 5KP6B 2LIUA 2GDYA 2L4BA 4BPGA 2DNWA 2K0YA 2KG9A 1OR5A 2FVEA 5KP7B 2EHSA 2X2BA 2KGAA 4PWVB 1HY8A 5HV8A 4DG9A 3EJEA 5HVCA 2L22A 4MRTC 2KOQA 2FVAA 2FHSC 2JU1A 2N5HA 2K93A 4H2YC 1KLPA 2CGQA 2MY5A 2N5IA 2CNRA 2N6YA 2LIWA 4H2XC 2ROQA 1NQ4A 2FQ0A 2MVUA 1L0HA 2KW2A 4R0MA 2N6ZA 2MF4A 1VKUA 2LOLA 1ACPA 2LKIA 2LTEA 2KGDA 2K0XA 3LMOA 3EJBA 2KORA 4HKGA 2FADA 2FAEA 5EJDA 2CQ8A 2JGPA 2M5RA 1AF8A 2K2QA 1DV5A 2K92A 3NY7B
chains in the Genus database with same CATH superfamily
3CC2P 2KOOA 1VQOP 1S72P 1K30A 2KR5A 2Z46A 3CCRP 4BPHA 3G71P 2L9FA 1YITP 2K5XA 2KOSA 5BS2A 1YJWP 3RG6C 3RG2A 3I55P 2GDWA 2LF4A 4IZ6A 2FQ2A 2M8PA 1HQBA 2QEXP 2AFEA 2JU2A 2OTJP 3LRYA 4BPFA 4XRQA 3G4SP 1M90Q 3P05A 1UJZA 2VSQA 2AF8A 4PH1A 1VQ9P 1JJ2O 5KP6B 5HGLA 2GDYA 2VLNA 4UHPB 2GZJA 2OTLP 1QRJA 2EG5A 3G28A 2JAZA 2BUOA 2PENA 4XFXA 2FHSC 2JU1A 3U43A 1Q7YQ 2K93A 1VQMP 2LIWA 1IUQA 4H2XC 3DS0A 3HZQA 2MVUA 1A8OA 4U0EA 4R0MA 3DS4A 2JB0A 2XXMA 3Q20A 2EIAA 1ACPA 3DPHA 1MZ8A 5F2KA 1ZNVA 3DS1A 1CEIA 3EJBA 1Q81Q 2KORA 4HKGA 2FADA 3G6EP 2GZIA 3CMEP 2ERHA 2K2QA 1AYIA 1E6JP 2L6EA 2AVAA 2GZFA 2XZ0D 2GDXA 1RNIA 4U0BA 2EFJA 2N50A 1E0HA 3EJDA 3CC7P 1X3OA 4CA3A 1GXHA 3CMAP 5KP8B 2MVVA 4U0DA 3E2DA 1BXIA 2PEQA 3B5IA 4COPA 2K94A 3G1IA 3CCLP 1T8KA 4WYMA 1ZMBA 4U0FA 3GKLC 5DCKA 2LL8A 2L0QA 3HYBA 5CZDB 5JPAA 2M8LA 1QVFO 2DGYA 3CCMP 2XT1A 2KGAA 3CCVP 5F2NA 3CCUP 2L22A 2KOQA 3CCQP 1IMPA 2M8NA 4GR6A 1YJ9P 3B4QA 1KLPA 2N6YA 1YJNP 1K8AQ 3M1MA 1VQ4P 1L0HA 4PH0A 1VKUA 1VQNP 2P9XA 1W2BO 4U0CA 2VLPA 1QVGO 2K0XA 3LMOA 3G21A 1GPJA 3H47A 2CQ8A 1KD1Q 1AF8A 2AFDA 2XZ1C 1M6EX 5HGOA 2OARA 3GZMA 3CC4P 2Z45A 4NEOA 2JYLA 1Z6MA 2MD9A 1D1DA 2VLOA 2EHTA 2MR8A 1K9MQ 1RO2A 2JQ4A 2PNGA 4F37A 3H0DA 3CXCO 3G1GA 3OW2O 3CPWO 1VQ7P 4PXHB 2FVFA 2KWLA 3CCSP 1RO0A 2QNWA 1VQLP 2PEKA 4COCA 1KC8Q 2KGCA 2KGEA 1A43A 2LPKA 2N98A 1VHNA 4BPGA 2L4BA 2GZEA 1BAJA 1OR5A 3VRLC 2JBGA 2X2BA 2QA4P 1HY8A 3G29A 2FVAA 2WPTA 5HGMA 2MY5A 2N5IA 2CNRA 2JO0A 2CWOA 3WBHA 3H4EA 2NO8A 2N6ZA 1M6NA 7CEIA 2LKIA 2LTEA 1M74A 2KGDA 4IPYA 3I56P 3G0VA 4QNBA 3DTJA 2FAEA 1IMQA 2M5RA 1Q86Q 1M1KQ 3NY7B 3DS2A 1VQPP 2MR7A 3NTEA 3CE7A 1NJIQ 4XFZA 3CCEP 5BS1A 3DS3A 1YHQP 1Q82Q 2FACA 1VQ8P 1DNYA 2KG6A 3GZLA 2GYKA 2PEMA 2KG8A 2ONTA 2XV6A 4H2WC 2PEIA 2CG5B 4XROA 1UNKA 2FQ1A 2KOPA 2PEOA 5EW5E 2GZGA 1EOQA 3GJNA 1AUMA 5I4TG 3G26A 4U0AA 2BHVA 1GXGA 1L0IA 1F80D 2LMLA 4M0IA 2LIUA 1N8RQ 2DNWA 2K0YA 2KG9A 5KP7B 2FVEA 3MGEA 2EHSA 3DS5A 1VQ6P 2K0DX 1VQ5P 4PWVB 1FR2A 5HV8A 4DG9A 3EJEA 5HVCA 4MRTC 2N5HA 2KODA 1YIJP 4H2YC 4XFYA 1YI2P 2CGQA 1EMVA 2PY8A 1VQKP 2E1MA 2ROQA 5F2OA 4GR2A 1NQ4A 2FQ0A 2KW2A 4QKOA 2MF4A 1EIAA 3CCJP 2JYGA 2LOLA 2PEJA 1K73Q 3CD6P 2VLQA 2Z44A 5EJDA 2JGPA 5HGNA 1KQSO 2K92A 1DV5A
chains in the Genus database with same CATH topology
2AFDA 2MR7A 2KOOA 2XZ1C 3CE7A 2AVAA 2XZ0D 2KR5A 4BPHA 3GZMA 2GDXA 2L9FA 2N50A 4NEOA 2KOSA 3EJDA 2MD9A 2FACA 1X3OA 3RG2A 4CA3A 1DNYA 2GDWA 2KG6A 2EHTA 2MR8A 3GZLA 2PNGA 2JQ4A 4IZ6A 2FQ2A 2KG8A 5KP8B 2MVVA 4H2WC 1HQBA 2AFEA 2JU2A 4PXHB 2FVFA 2CG5B 2KWLA 4BPFA 2FQ1A 2KOPA 2QNWA 2K94A 2VSQA 1T8KA 2KGCA 2AF8A 1L0IA 1F80D 2KGEA 2LMLA 2LL8A 2L0QA 2LPKA 5CZDB 2N98A 5KP6B 2LIUA 2GDYA 2L4BA 4BPGA 2DNWA 2K0YA 2KG9A 1OR5A 2FVEA 5KP7B 2EHSA 2X2BA 2KGAA 4PWVB 1HY8A 5HV8A 4DG9A 3EJEA 5HVCA 2L22A 4MRTC 2KOQA 2FVAA 2FHSC 2JU1A 2N5HA 2K93A 4H2YC 1KLPA 2CGQA 2MY5A 2N5IA 2CNRA 2N6YA 2LIWA 4H2XC 2ROQA 1NQ4A 2FQ0A 2MVUA 1L0HA 2KW2A 4R0MA 2N6ZA 2MF4A 1VKUA 2LOLA 1ACPA 2LKIA 2LTEA 2KGDA 2K0XA 3LMOA 3EJBA 2KORA 4HKGA 2FADA 2FAEA 5EJDA 2CQ8A 2JGPA 2M5RA 1AF8A 2K2QA 1DV5A 2K92A 3NY7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFD A;  2MR7 A;  2KOO A;  2XZ1 C;  3CE7 A;  2AVA A;  2XZ0 D;  2KR5 A;  4BPH A;  3GZM A;  2GDX A;  2L9F A;  2N50 A;  4NEO A;  2KOS A;  3EJD A;  2MD9 A;  2FAC A;  1X3O A;  3RG2 A;  4CA3 A;  1DNY A;  2GDW A;  2KG6 A;  2EHT A;  2MR8 A;  3GZL A;  2PNG A;  2JQ4 A;  4IZ6 A;  2FQ2 A;  2KG8 A;  5KP8 B;  2MVV A;  4H2W C;  1HQB A;  2AFE A;  2JU2 A;  4PXH B;  2FVF A;  2CG5 B;  2KWL A;  4BPF A;  2FQ1 A;  2KOP A;  2QNW A;  2K94 A;  2VSQ A;  1T8K A;  2KGC A;  2AF8 A;  1L0I A;  1F80 D;  2KGE A;  2LML A;  2LL8 A;  2L0Q A;  2LPK A;  5CZD B;  2N98 A;  5KP6 B;  2LIU A;  2GDY A;  2L4B A;  4BPG A;  2DNW A;  2K0Y A;  2KG9 A;  1OR5 A;  2FVE A;  5KP7 B;  2EHS A;  2X2B A;  2KGA A;  4PWV B;  1HY8 A;  5HV8 A;  4DG9 A;  3EJE A;  5HVC A;  2L22 A;  4MRT C;  2KOQ A;  2FVA A;  2FHS C;  2JU1 A;  2N5H A;  2K93 A;  4H2Y C;  1KLP A;  2CGQ A;  2MY5 A;  2N5I A;  2CNR A;  2N6Y A;  2LIW A;  4H2X C;  2ROQ A;  1NQ4 A;  2FQ0 A;  2MVU A;  1L0H A;  2KW2 A;  4R0M A;  2N6Z A;  2MF4 A;  1VKU A;  2LOL A;  1ACP A;  2LKI A;  2LTE A;  2KGD A;  2K0X A;  3LMO A;  3EJB A;  2KOR A;  4HKG A;  2FAD A;  2FAE A;  5EJD A;  2CQ8 A;  2JGP A;  2M5R A;  1AF8 A;  2K2Q A;  1DV5 A;  2K92 A;  3NY7 B; 
#chains in the Genus database with same CATH topology
 3CC2 P;  2KOO A;  1VQO P;  1S72 P;  1K30 A;  2KR5 A;  2Z46 A;  3CCR P;  4BPH A;  3G71 P;  2L9F A;  1YIT P;  2K5X A;  2KOS A;  5BS2 A;  1YJW P;  3RG6 C;  3RG2 A;  3I55 P;  2GDW A;  2LF4 A;  4IZ6 A;  2FQ2 A;  2M8P A;  1HQB A;  2QEX P;  2AFE A;  2JU2 A;  2OTJ P;  3LRY A;  4BPF A;  4XRQ A;  3G4S P;  1M90 Q;  3P05 A;  1UJZ A;  2VSQ A;  2AF8 A;  4PH1 A;  1VQ9 P;  1JJ2 O;  5KP6 B;  5HGL A;  2GDY A;  2VLN A;  4UHP B;  2GZJ A;  2OTL P;  1QRJ A;  2EG5 A;  3G28 A;  2JAZ A;  2BUO A;  2PEN A;  4XFX A;  2FHS C;  2JU1 A;  3U43 A;  1Q7Y Q;  2K93 A;  1VQM P;  2LIW A;  1IUQ A;  4H2X C;  3DS0 A;  3HZQ A;  2MVU A;  1A8O A;  4U0E A;  4R0M A;  3DS4 A;  2JB0 A;  2XXM A;  3Q20 A;  2EIA A;  1ACP A;  3DPH A;  1MZ8 A;  5F2K A;  1ZNV A;  3DS1 A;  1CEI A;  3EJB A;  1Q81 Q;  2KOR A;  4HKG A;  2FAD A;  3G6E P;  2GZI A;  3CME P;  2ERH A;  2K2Q A;  1AYI A;  1E6J P;  2L6E A;  2AVA A;  2GZF A;  2XZ0 D;  2GDX A;  1RNI A;  4U0B A;  2EFJ A;  2N50 A;  1E0H A;  3EJD A;  3CC7 P;  1X3O A;  4CA3 A;  1GXH A;  3CMA P;  5KP8 B;  2MVV A;  4U0D A;  3E2D A;  1BXI A;  2PEQ A;  3B5I A;  4COP A;  2K94 A;  3G1I A;  3CCL P;  1T8K A;  4WYM A;  1ZMB A;  4U0F A;  3GKL C;  5DCK A;  2LL8 A;  2L0Q A;  3HYB A;  5CZD B;  5JPA A;  2M8L A;  1QVF O;  2DGY A;  3CCM P;  2XT1 A;  2KGA A;  3CCV P;  5F2N A;  3CCU P;  2L22 A;  2KOQ A;  3CCQ P;  1IMP A;  2M8N A;  4GR6 A;  1YJ9 P;  3B4Q A;  1KLP A;  2N6Y A;  1YJN P;  1K8A Q;  3M1M A;  1VQ4 P;  1L0H A;  4PH0 A;  1VKU A;  1VQN P;  2P9X A;  1W2B O;  4U0C A;  2VLP A;  1QVG O;  2K0X A;  3LMO A;  3G21 A;  1GPJ A;  3H47 A;  2CQ8 A;  1KD1 Q;  1AF8 A;  2AFD A;  2XZ1 C;  1M6E X;  5HGO A;  2OAR A;  3GZM A;  3CC4 P;  2Z45 A;  4NEO A;  2JYL A;  1Z6M A;  2MD9 A;  1D1D A;  2VLO A;  2EHT A;  2MR8 A;  1K9M Q;  1RO2 A;  2JQ4 A;  2PNG A;  4F37 A;  3H0D A;  3CXC O;  3G1G A;  3OW2 O;  3CPW O;  1VQ7 P;  4PXH B;  2FVF A;  2KWL A;  3CCS P;  1RO0 A;  2QNW A;  1VQL P;  2PEK A;  4COC A;  1KC8 Q;  2KGC A;  2KGE A;  1A43 A;  2LPK A;  2N98 A;  1VHN A;  4BPG A;  2L4B A;  2GZE A;  1BAJ A;  1OR5 A;  3VRL C;  2JBG A;  2X2B A;  2QA4 P;  1HY8 A;  3G29 A;  2FVA A;  2WPT A;  5HGM A;  2MY5 A;  2N5I A;  2CNR A;  2JO0 A;  2CWO A;  3WBH A;  3H4E A;  2NO8 A;  2N6Z A;  1M6N A;  7CEI A;  2LKI A;  2LTE A;  1M74 A;  2KGD A;  4IPY A;  3I56 P;  3G0V A;  4QNB A;  3DTJ A;  2FAE A;  1IMQ A;  2M5R A;  1Q86 Q;  1M1K Q;  3NY7 B;  3DS2 A;  1VQP P;  2MR7 A;  3NTE A;  3CE7 A;  1NJI Q;  4XFZ A;  3CCE P;  5BS1 A;  3DS3 A;  1YHQ P;  1Q82 Q;  2FAC A;  1VQ8 P;  1DNY A;  2KG6 A;  3GZL A;  2GYK A;  2PEM A;  2KG8 A;  2ONT A;  2XV6 A;  4H2W C;  2PEI A;  2CG5 B;  4XRO A;  1UNK A;  2FQ1 A;  2KOP A;  2PEO A;  5EW5 E;  2GZG A;  1EOQ A;  3GJN A;  1AUM A;  5I4T G;  3G26 A;  4U0A A;  2BHV A;  1GXG A;  1L0I A;  1F80 D;  2LML A;  4M0I A;  2LIU A;  1N8R Q;  2DNW A;  2K0Y A;  2KG9 A;  5KP7 B;  2FVE A;  3MGE A;  2EHS A;  3DS5 A;  1VQ6 P;  2K0D X;  1VQ5 P;  4PWV B;  1FR2 A;  5HV8 A;  4DG9 A;  3EJE A;  5HVC A;  4MRT C;  2N5H A;  2KOD A;  1YIJ P;  4H2Y C;  4XFY A;  1YI2 P;  2CGQ A;  1EMV A;  2PY8 A;  1VQK P;  2E1M A;  2ROQ A;  5F2O A;  4GR2 A;  1NQ4 A;  2FQ0 A;  2KW2 A;  4QKO A;  2MF4 A;  1EIA A;  3CCJ P;  2JYG A;  2LOL A;  2PEJ A;  1K73 Q;  3CD6 P;  2VLQ A;  2Z44 A;  5EJD A;  2JGP A;  5HGN A;  1KQS O;  2K92 A;  1DV5 A; 
#chains in the Genus database with same CATH homology
 2AFD A;  2MR7 A;  2KOO A;  2XZ1 C;  3CE7 A;  2AVA A;  2XZ0 D;  2KR5 A;  4BPH A;  3GZM A;  2GDX A;  2L9F A;  2N50 A;  4NEO A;  2KOS A;  3EJD A;  2MD9 A;  2FAC A;  1X3O A;  3RG2 A;  4CA3 A;  1DNY A;  2GDW A;  2KG6 A;  2EHT A;  2MR8 A;  3GZL A;  2PNG A;  2JQ4 A;  4IZ6 A;  2FQ2 A;  2KG8 A;  5KP8 B;  2MVV A;  4H2W C;  1HQB A;  2AFE A;  2JU2 A;  4PXH B;  2FVF A;  2CG5 B;  2KWL A;  4BPF A;  2FQ1 A;  2KOP A;  2QNW A;  2K94 A;  2VSQ A;  1T8K A;  2KGC A;  2AF8 A;  1L0I A;  1F80 D;  2KGE A;  2LML A;  2LL8 A;  2L0Q A;  2LPK A;  5CZD B;  2N98 A;  5KP6 B;  2LIU A;  2GDY A;  2L4B A;  4BPG A;  2DNW A;  2K0Y A;  2KG9 A;  1OR5 A;  2FVE A;  5KP7 B;  2EHS A;  2X2B A;  2KGA A;  4PWV B;  1HY8 A;  5HV8 A;  4DG9 A;  3EJE A;  5HVC A;  2L22 A;  4MRT C;  2KOQ A;  2FVA A;  2FHS C;  2JU1 A;  2N5H A;  2K93 A;  4H2Y C;  1KLP A;  2CGQ A;  2MY5 A;  2N5I A;  2CNR A;  2N6Y A;  2LIW A;  4H2X C;  2ROQ A;  1NQ4 A;  2FQ0 A;  2MVU A;  1L0H A;  2KW2 A;  4R0M A;  2N6Z A;  2MF4 A;  1VKU A;  2LOL A;  1ACP A;  2LKI A;  2LTE A;  2KGD A;  2K0X A;  3LMO A;  3EJB A;  2KOR A;  4HKG A;  2FAD A;  2FAE A;  5EJD A;  2CQ8 A;  2JGP A;  2M5R A;  1AF8 A;  2K2Q A;  1DV5 A;  2K92 A;  3NY7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...