2FVEA

Structure of 10:0-acp (protein alone)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Biosynthetic protein
molecule keywords Acyl Carrier Protein
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fveA00
4IZ6A 2XZ0D 2LKIA 2LIUA 2VSQA 1L0IA 2LMLA 5KP8B 2L22A 2N98A 1KLPA 2CNRA 2M5RA 1OR5A 1HQBA 2KOOA 2FACA 2L0QA 4BPGA 2MR8A 2MVVA 2JU1A 2L9FA 1AF8A 2KOQA 2LPKA 2FVFA 4HKGA 4MRTC 2XZ1C 4H2YC 2KW2A 1NQ4A 2LIWA 2MD9A 4CA3A 2N6YA 2QNWA 2AF8A 2CGQA 2KG8A 4PXHB 2KGDA 2N50A 2KR5A 2DNWA 2K0XA 2KGEA 2FVEA 2KGCA 5CZDB 2PNGA 2CG5B 2FQ1A 3RG2A 2K2QA 5HV8A 1VKUA 2AFEA 3EJDA 2FHSC 2K94A 1ACPA 1T8KA 2FVAA 4BPHA 2FQ0A 1DV5A 1X3OA 3CE7A 2MR7A 2KOPA 4PWVB 3GZMA 2JQ4A 4H2WC 2LOLA 2JGPA 2K92A 3EJBA 5KP6B 2K0YA 2GDYA 2MY5A 2CQ8A 2KORA 5HVCA 2ROQA 3EJEA 1HY8A 3GZLA 1DNYA 3LMOA 4DG9A 5EJDA 1F80D 4R0MA 2KGAA 2FAEA 4BPFA 4H2XC 2AVAA 5KP7B 2N5HA 2MF4A 2N6ZA 2AFDA 2GDXA 2KG9A 2JU2A 1L0HA 2LTEA 2KG6A 2L4BA 2MVUA 2FQ2A 2LL8A 2N5IA 2KWLA 3NY7B 2KOSA 2K93A 2FADA 2X2BA 2EHTA 4NEOA 2GDWA 2EHSA
chains in the Genus database with same CATH superfamily
3CPWO 2LKIA 2VSQA 5HGMA 4U0CA 3H0DA 2GZFA 5JPAA 4U0FA 1VQ9P 2M5RA 4BPGA 2L9FA 1AYIA 2XZ1C 1YJ9P 1UNKA 2BUOA 2K0XA 3OW2O 2KGCA 2EIAA 2FQ1A 3RG2A 2AFEA 1S72P 1T8KA 1VQ5P 2FQ0A 1VQ4P 2GZJA 4PH0A 4PH1A 3CC7P 2KOPA 1IMPA 1BAJA 4COCA 3GZMA 1Q7YQ 1JJ2O 2Z45A 1YHQP 3I55P 1YIJP 1M74A 2VLQA 2KORA 4XROA 2XT1A 2CWOA 3G1GA 4R0MA 3B4QA 1IUQA 3CCLP 1VQKP 4M0IA 2M8PA 3DS1A 2KG9A 2JU2A 2KG6A 4WYMA 1UJZA 1EMVA 2XV6A 3B5IA 2K93A 2VLOA 2ERHA 4NEOA 2EHSA 2PENA 4IZ6A 2DGYA 2N98A 4U0BA 3WBHA 1VQPP 2OTLP 4XFYA 2CNRA 1A8OA 1W2BO 2KOOA 1AUMA 2FACA 5EW5E 2KOQA 3NTEA 5F2KA 1GXHA 3E2DA 4H2YC 3MGEA 2JB0A 4CA3A 1KQSO 2N6YA 2QNWA 2KGDA 2N50A 2DNWA 2KGEA 5CZDB 3CC4P 1VHNA 1GXGA 1YJNP 1VQ6P 1QVFO 2JYLA 3CMEP 3G6EP 2M8NA 3G1IA 3DS0A 2PEMA 2FVAA 4UHPB 1DV5A 2PEIA 1VQOP 3LRYA 3DS2A 5I4TG 2LOLA 1N8RQ 4F37A 2PY8A 3DPHA 2GDYA 2CQ8A 3CCSP 1GPJA 3GZLA 3LMOA 2QEXP 1F80D 3CCMP 4XFZA 4QNBA 1VQ8P 1K9MQ 3H47A 2N6ZA 2GDXA 1E6JP 2OTJP 2L4BA 2FQ2A 2LL8A 2KODA 3G29A 2E1MA 2KOSA 2OARA 3HYBA 2JYGA 2GDWA 1YJWP 4U0DA 1RO2A 2JBGA 1L0IA 5KP8B 2L22A 1KC8Q 3GKLC 1KLPA 2GYKA 1VQMP 1EOQA 1OR5A 1YITP 2GZEA 3DTJA 1A43A 1MZ8A 2LPKA 4HKGA 3M1MA 1CEIA 1NQ4A 2AF8A 2KG8A 5F2NA 3G4SP 1ZNVA 2FVEA 3Q20A 2PNGA 2CG5B 3U43A 1VQNP 2XXMA 5HV8A 1VKUA 2VLNA 1Q82Q 2FHSC 2K94A 1ACPA 1D1DA 3HZQA 2K5XA 5BS1A 2JQ4A 1Q86Q 2K92A 3CCRP 5KP6B 2K0YA 2MY5A 1M90Q 2ROQA 5DCKA 1DNYA 5EJDA 2FAEA 4IPYA 2PEKA 1NJIQ 1RO0A 1M1KQ 2AVAA 5KP7B 4U0EA 3RG6C 2EFJA 1L0HA 2MVUA 3CCJP 2EG5A 1Q81Q 4COPA 2N5IA 3CC2P 4U0AA 2NO8A 1QVGO 2FADA 2XZ0D 2LIUA 4XFXA 2GZIA 2LMLA 1IMQA 5HGOA 2QA4P 3P05A 2P9XA 3I56P 1HQBA 2L0QA 2MR8A 1VQLP 2MVVA 1ZMBA 2M8LA 2JU1A 1AF8A 2FVFA 3G28A 4MRTC 3CCVP 2LF4A 1K8AQ 3G26A 1VQ7P 2PEOA 2KW2A 2LIWA 1EIAA 2MD9A 2CGQA 1M6EX 2GZGA 3DS3A 4PXHB 2KR5A 2Z44A 2BHVA 2VLPA 2K2QA 1K73Q 1K30A 3EJDA 3H4EA 3CMAP 3DS5A 4BPHA 1RNIA 4QKOA 2PEJA 1X3OA 3CE7A 2MR7A 4PWVB 4H2WC 1KD1Q 5F2OA 2JGPA 1QRJA 2JO0A 3EJBA 2JAZA 2L6EA 5HVCA 1Z6MA 5HGLA 2PEQA 1FR2A 3EJEA 3CXCO 2WPTA 1HY8A 4DG9A 1BXIA 2KGAA 1M6NA 4BPFA 4H2XC 4XRQA 7CEIA 3GJNA 3G21A 5BS2A 3G71P 2N5HA 1E0HA 5HGNA 2K0DX 2MF4A 3CCQP 1YI2P 2AFDA 3CCUP 2Z46A 3DS4A 2LTEA 3CD6P 2ONTA 2KWLA 3NY7B 3VRLC 2X2BA 4GR6A 2EHTA 4GR2A 3G0VA 3CCEP
chains in the Genus database with same CATH topology
4IZ6A 2XZ0D 2LKIA 2LIUA 2VSQA 1L0IA 2LMLA 5KP8B 2L22A 2N98A 1KLPA 2CNRA 2M5RA 1OR5A 1HQBA 2KOOA 2FACA 2L0QA 4BPGA 2MR8A 2MVVA 2JU1A 2L9FA 1AF8A 2KOQA 2LPKA 2FVFA 4HKGA 4MRTC 2XZ1C 4H2YC 2KW2A 1NQ4A 2LIWA 2MD9A 4CA3A 2N6YA 2QNWA 2AF8A 2CGQA 2KG8A 4PXHB 2KGDA 2N50A 2KR5A 2DNWA 2K0XA 2KGEA 2FVEA 2KGCA 5CZDB 2PNGA 2CG5B 2FQ1A 3RG2A 2K2QA 5HV8A 1VKUA 2AFEA 3EJDA 2FHSC 2K94A 1ACPA 1T8KA 2FVAA 4BPHA 2FQ0A 1DV5A 1X3OA 3CE7A 2MR7A 2KOPA 4PWVB 3GZMA 2JQ4A 4H2WC 2LOLA 2JGPA 2K92A 3EJBA 5KP6B 2K0YA 2GDYA 2MY5A 2CQ8A 2KORA 5HVCA 2ROQA 3EJEA 1HY8A 3GZLA 1DNYA 3LMOA 4DG9A 5EJDA 1F80D 4R0MA 2KGAA 2FAEA 4BPFA 4H2XC 2AVAA 5KP7B 2N5HA 2MF4A 2N6ZA 2AFDA 2GDXA 2KG9A 2JU2A 1L0HA 2LTEA 2KG6A 2L4BA 2MVUA 2FQ2A 2LL8A 2N5IA 2KWLA 3NY7B 2KOSA 2K93A 2FADA 2X2BA 2EHTA 4NEOA 2GDWA 2EHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZ6 A;  2XZ0 D;  2LKI A;  2LIU A;  2VSQ A;  1L0I A;  2LML A;  5KP8 B;  2L22 A;  2N98 A;  1KLP A;  2CNR A;  2M5R A;  1OR5 A;  1HQB A;  2KOO A;  2FAC A;  2L0Q A;  4BPG A;  2MR8 A;  2MVV A;  2JU1 A;  2L9F A;  1AF8 A;  2KOQ A;  2LPK A;  2FVF A;  4HKG A;  4MRT C;  2XZ1 C;  4H2Y C;  2KW2 A;  1NQ4 A;  2LIW A;  2MD9 A;  4CA3 A;  2N6Y A;  2QNW A;  2AF8 A;  2CGQ A;  2KG8 A;  4PXH B;  2KGD A;  2N50 A;  2KR5 A;  2DNW A;  2K0X A;  2KGE A;  2FVE A;  2KGC A;  5CZD B;  2PNG A;  2CG5 B;  2FQ1 A;  3RG2 A;  2K2Q A;  5HV8 A;  1VKU A;  2AFE A;  3EJD A;  2FHS C;  2K94 A;  1ACP A;  1T8K A;  2FVA A;  4BPH A;  2FQ0 A;  1DV5 A;  1X3O A;  3CE7 A;  2MR7 A;  2KOP A;  4PWV B;  3GZM A;  2JQ4 A;  4H2W C;  2LOL A;  2JGP A;  2K92 A;  3EJB A;  5KP6 B;  2K0Y A;  2GDY A;  2MY5 A;  2CQ8 A;  2KOR A;  5HVC A;  2ROQ A;  3EJE A;  1HY8 A;  3GZL A;  1DNY A;  3LMO A;  4DG9 A;  5EJD A;  1F80 D;  4R0M A;  2KGA A;  2FAE A;  4BPF A;  4H2X C;  2AVA A;  5KP7 B;  2N5H A;  2MF4 A;  2N6Z A;  2AFD A;  2GDX A;  2KG9 A;  2JU2 A;  1L0H A;  2LTE A;  2KG6 A;  2L4B A;  2MVU A;  2FQ2 A;  2LL8 A;  2N5I A;  2KWL A;  3NY7 B;  2KOS A;  2K93 A;  2FAD A;  2X2B A;  2EHT A;  4NEO A;  2GDW A;  2EHS A; 
#chains in the Genus database with same CATH topology
 3CPW O;  2LKI A;  2VSQ A;  5HGM A;  4U0C A;  3H0D A;  2GZF A;  5JPA A;  4U0F A;  1VQ9 P;  2M5R A;  4BPG A;  2L9F A;  1AYI A;  2XZ1 C;  1YJ9 P;  1UNK A;  2BUO A;  2K0X A;  3OW2 O;  2KGC A;  2EIA A;  2FQ1 A;  3RG2 A;  2AFE A;  1S72 P;  1T8K A;  1VQ5 P;  2FQ0 A;  1VQ4 P;  2GZJ A;  4PH0 A;  4PH1 A;  3CC7 P;  2KOP A;  1IMP A;  1BAJ A;  4COC A;  3GZM A;  1Q7Y Q;  1JJ2 O;  2Z45 A;  1YHQ P;  3I55 P;  1YIJ P;  1M74 A;  2VLQ A;  2KOR A;  4XRO A;  2XT1 A;  2CWO A;  3G1G A;  4R0M A;  3B4Q A;  1IUQ A;  3CCL P;  1VQK P;  4M0I A;  2M8P A;  3DS1 A;  2KG9 A;  2JU2 A;  2KG6 A;  4WYM A;  1UJZ A;  1EMV A;  2XV6 A;  3B5I A;  2K93 A;  2VLO A;  2ERH A;  4NEO A;  2EHS A;  2PEN A;  4IZ6 A;  2DGY A;  2N98 A;  4U0B A;  3WBH A;  1VQP P;  2OTL P;  4XFY A;  2CNR A;  1A8O A;  1W2B O;  2KOO A;  1AUM A;  2FAC A;  5EW5 E;  2KOQ A;  3NTE A;  5F2K A;  1GXH A;  3E2D A;  4H2Y C;  3MGE A;  2JB0 A;  4CA3 A;  1KQS O;  2N6Y A;  2QNW A;  2KGD A;  2N50 A;  2DNW A;  2KGE A;  5CZD B;  3CC4 P;  1VHN A;  1GXG A;  1YJN P;  1VQ6 P;  1QVF O;  2JYL A;  3CME P;  3G6E P;  2M8N A;  3G1I A;  3DS0 A;  2PEM A;  2FVA A;  4UHP B;  1DV5 A;  2PEI A;  1VQO P;  3LRY A;  3DS2 A;  5I4T G;  2LOL A;  1N8R Q;  4F37 A;  2PY8 A;  3DPH A;  2GDY A;  2CQ8 A;  3CCS P;  1GPJ A;  3GZL A;  3LMO A;  2QEX P;  1F80 D;  3CCM P;  4XFZ A;  4QNB A;  1VQ8 P;  1K9M Q;  3H47 A;  2N6Z A;  2GDX A;  1E6J P;  2OTJ P;  2L4B A;  2FQ2 A;  2LL8 A;  2KOD A;  3G29 A;  2E1M A;  2KOS A;  2OAR A;  3HYB A;  2JYG A;  2GDW A;  1YJW P;  4U0D A;  1RO2 A;  2JBG A;  1L0I A;  5KP8 B;  2L22 A;  1KC8 Q;  3GKL C;  1KLP A;  2GYK A;  1VQM P;  1EOQ A;  1OR5 A;  1YIT P;  2GZE A;  3DTJ A;  1A43 A;  1MZ8 A;  2LPK A;  4HKG A;  3M1M A;  1CEI A;  1NQ4 A;  2AF8 A;  2KG8 A;  5F2N A;  3G4S P;  1ZNV A;  2FVE A;  3Q20 A;  2PNG A;  2CG5 B;  3U43 A;  1VQN P;  2XXM A;  5HV8 A;  1VKU A;  2VLN A;  1Q82 Q;  2FHS C;  2K94 A;  1ACP A;  1D1D A;  3HZQ A;  2K5X A;  5BS1 A;  2JQ4 A;  1Q86 Q;  2K92 A;  3CCR P;  5KP6 B;  2K0Y A;  2MY5 A;  1M90 Q;  2ROQ A;  5DCK A;  1DNY A;  5EJD A;  2FAE A;  4IPY A;  2PEK A;  1NJI Q;  1RO0 A;  1M1K Q;  2AVA A;  5KP7 B;  4U0E A;  3RG6 C;  2EFJ A;  1L0H A;  2MVU A;  3CCJ P;  2EG5 A;  1Q81 Q;  4COP A;  2N5I A;  3CC2 P;  4U0A A;  2NO8 A;  1QVG O;  2FAD A;  2XZ0 D;  2LIU A;  4XFX A;  2GZI A;  2LML A;  1IMQ A;  5HGO A;  2QA4 P;  3P05 A;  2P9X A;  3I56 P;  1HQB A;  2L0Q A;  2MR8 A;  1VQL P;  2MVV A;  1ZMB A;  2M8L A;  2JU1 A;  1AF8 A;  2FVF A;  3G28 A;  4MRT C;  3CCV P;  2LF4 A;  1K8A Q;  3G26 A;  1VQ7 P;  2PEO A;  2KW2 A;  2LIW A;  1EIA A;  2MD9 A;  2CGQ A;  1M6E X;  2GZG A;  3DS3 A;  4PXH B;  2KR5 A;  2Z44 A;  2BHV A;  2VLP A;  2K2Q A;  1K73 Q;  1K30 A;  3EJD A;  3H4E A;  3CMA P;  3DS5 A;  4BPH A;  1RNI A;  4QKO A;  2PEJ A;  1X3O A;  3CE7 A;  2MR7 A;  4PWV B;  4H2W C;  1KD1 Q;  5F2O A;  2JGP A;  1QRJ A;  2JO0 A;  3EJB A;  2JAZ A;  2L6E A;  5HVC A;  1Z6M A;  5HGL A;  2PEQ A;  1FR2 A;  3EJE A;  3CXC O;  2WPT A;  1HY8 A;  4DG9 A;  1BXI A;  2KGA A;  1M6N A;  4BPF A;  4H2X C;  4XRQ A;  7CEI A;  3GJN A;  3G21 A;  5BS2 A;  3G71 P;  2N5H A;  1E0H A;  5HGN A;  2K0D X;  2MF4 A;  3CCQ P;  1YI2 P;  2AFD A;  3CCU P;  2Z46 A;  3DS4 A;  2LTE A;  3CD6 P;  2ONT A;  2KWL A;  3NY7 B;  3VRL C;  2X2B A;  4GR6 A;  2EHT A;  4GR2 A;  3G0V A;  3CCE P; 
#chains in the Genus database with same CATH homology
 4IZ6 A;  2XZ0 D;  2LKI A;  2LIU A;  2VSQ A;  1L0I A;  2LML A;  5KP8 B;  2L22 A;  2N98 A;  1KLP A;  2CNR A;  2M5R A;  1OR5 A;  1HQB A;  2KOO A;  2FAC A;  2L0Q A;  4BPG A;  2MR8 A;  2MVV A;  2JU1 A;  2L9F A;  1AF8 A;  2KOQ A;  2LPK A;  2FVF A;  4HKG A;  4MRT C;  2XZ1 C;  4H2Y C;  2KW2 A;  1NQ4 A;  2LIW A;  2MD9 A;  4CA3 A;  2N6Y A;  2QNW A;  2AF8 A;  2CGQ A;  2KG8 A;  4PXH B;  2KGD A;  2N50 A;  2KR5 A;  2DNW A;  2K0X A;  2KGE A;  2FVE A;  2KGC A;  5CZD B;  2PNG A;  2CG5 B;  2FQ1 A;  3RG2 A;  2K2Q A;  5HV8 A;  1VKU A;  2AFE A;  3EJD A;  2FHS C;  2K94 A;  1ACP A;  1T8K A;  2FVA A;  4BPH A;  2FQ0 A;  1DV5 A;  1X3O A;  3CE7 A;  2MR7 A;  2KOP A;  4PWV B;  3GZM A;  2JQ4 A;  4H2W C;  2LOL A;  2JGP A;  2K92 A;  3EJB A;  5KP6 B;  2K0Y A;  2GDY A;  2MY5 A;  2CQ8 A;  2KOR A;  5HVC A;  2ROQ A;  3EJE A;  1HY8 A;  3GZL A;  1DNY A;  3LMO A;  4DG9 A;  5EJD A;  1F80 D;  4R0M A;  2KGA A;  2FAE A;  4BPF A;  4H2X C;  2AVA A;  5KP7 B;  2N5H A;  2MF4 A;  2N6Z A;  2AFD A;  2GDX A;  2KG9 A;  2JU2 A;  1L0H A;  2LTE A;  2KG6 A;  2L4B A;  2MVU A;  2FQ2 A;  2LL8 A;  2N5I A;  2KWL A;  3NY7 B;  2KOS A;  2K93 A;  2FAD A;  2X2B A;  2EHT A;  4NEO A;  2GDW A;  2EHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...