2FVFA

Structure of 10:0-acp (protein with docked fatty acid)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl Carrier Protein
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Biosynthetic protein
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fvfA00
2N98A 1DNYA 2LKIA 2K2QA 3EJBA 2KR5A 2L9FA 1L0IA 2EHTA 1KLPA 1F80D 2JU2A 1NQ4A 4IZ6A 3GZMA 2MY5A 1L0HA 3LMOA 1X3OA 2FVEA 2N50A 2LPKA 2FVAA 2LTEA 4R0MA 5KP7B 3RG2A 2KOPA 2N5IA 2CGQA 2KOOA 2K0YA 2DNWA 4NEOA 2KGEA 5EJDA 2M5RA 2N6YA 4BPGA 2FADA 2FQ1A 2AVAA 2FQ2A 2GDXA 4MRTC 2LIWA 2GDWA 2MR8A 1HQBA 4BPHA 5KP8B 3EJEA 1HY8A 2EHSA 2K94A 2MD9A 2L0QA 2FHSC 4PWVB 2KOQA 2LIUA 2KG6A 2MVUA 1T8KA 2QNWA 2KG9A 4H2WC 1VKUA 2CNRA 2CQ8A 2K93A 2FQ0A 2K0XA 2KGAA 2VSQA 2KG8A 2AFEA 2GDYA 2LL8A 2KGCA 2FVFA 2AFDA 2LOLA 3CE7A 4DG9A 4CA3A 5HV8A 5KP6B 2FACA 2KGDA 1ACPA 2KOSA 4BPFA 2MR7A 2JGPA 2N6ZA 2KW2A 2L22A 2LMLA 2X2BA 5CZDB 2MVVA 3NY7B 4H2XC 1OR5A 1AF8A 2MF4A 2K92A 2JQ4A 3GZLA 2L4BA 2KWLA 2PNGA 2ROQA 2KORA 2CG5B 4H2YC 2JU1A 1DV5A 4HKGA 2AF8A 3EJDA 2XZ0D 4PXHB 2FAEA 2XZ1C 2N5HA 5HVCA
chains in the Genus database with same CATH superfamily
2M8LA 3CXCO 1Z6MA 2K2QA 3EJBA 2XT1A 2L9FA 1L0IA 1AUMA 1RO0A 1S72P 4U0AA 1NQ4A 3GZMA 3M1MA 2MY5A 2JB0A 2LPKA 2FVAA 2KOPA 3G71P 2N5IA 2CGQA 2KOOA 1K8AQ 2PY8A 4GR2A 4XFYA 3CMEP 3CCQP 2JAZA 4QKOA 3CCEP 2GZFA 2M8PA 4MRTC 2LIWA 2GDWA 2XV6A 4XFXA 1ZMBA 2JYGA 1VQ9P 1VQ8P 2L0QA 2MVUA 2JO0A 1T8KA 4U0BA 4M0IA 1GPJA 1KC8Q 2CQ8A 2PEJA 5BS1A 5DCKA 2K0XA 2VSQA 3G21A 1W2BO 1M6EX 3MGEA 3DS5A 5KP6B 2JBGA 1KQSO 2LF4A 2OTLP 4BPFA 1RO2A 1VQLP 1Q7YQ 1K73Q 3G6EP 3B4QA 2L22A 2PEMA 1UJZA 1GXGA 1E0HA 1BXIA 1VQNP 2PNGA 4UHPB 5HGMA 2KORA 1N8RQ 2ERHA 4PH0A 2AF8A 5JPAA 2Z44A 5F2NA 4PXHB 2N5HA 2N98A 3CC7P 1DNYA 2PEKA 2KR5A 5BS2A 3H0DA 2EHTA 1F80D 3G29A 4IZ6A 2GZIA 1X3OA 2WPTA 1IMQA 5KP7B 1M74A 2K0YA 4COCA 2GZGA 3CCLP 2FADA 5HGNA 1VQ5P 2M8NA 2AVAA 2FQ2A 2MR8A 1HQBA 5KP8B 3EJEA 3U43A 1YJNP 2KODA 5F2OA 3G28A 5F2KA 5I4TG 4GR6A 2LIUA 1FR2A 2QNWA 2KG9A 4H2WC 2OARA 1VKUA 2CNRA 1M1KQ 3G1IA 1IUQA 2AFEA 2GDYA 1CEIA 1YJWP 2LL8A 3CE7A 2K0DX 5HV8A 3RG6C 2FACA 4F37A 1VQ6P 1UNKA 3LRYA 1YHQP 2MR7A 2N6ZA 3GJNA 3H4EA 1QVGO 1YJ9P 2LMLA 3NY7B 4H2XC 2VLOA 1OR5A 2CWOA 1AF8A 3GZLA 4U0EA 1RNIA 2EG5A 2Z45A 2GYKA 1VQKP 2Z46A 3DS1A 3B5IA 3EJDA 2XZ0D 2FAEA 1EIAA 3NTEA 4U0CA 3VRLC 2LKIA 4XFZA 1KLPA 2JU2A 2VLPA 3DPHA 1Q82Q 1L0HA 1YIJP 1YITP 2N50A 3CC4P 2XXMA 2LTEA 4R0MA 3I56P 3RG2A 3CPWO 2PEOA 3CCMP 3CMAP 2PEIA 3G4SP 1ZNVA 2JYLA 2KGEA 2N6YA 4BPGA 4QNBA 1QRJA 3DS4A 1VQ7P 3CCVP 2GZEA 4PH1A 3DS0A 2EHSA 2K94A 3E2DA 2FHSC 4PWVB 2KOQA 2BUOA 2KG6A 2ONTA 5HGLA 3HYBA 1AYIA 2BHVA 2QA4P 2P9XA 2DGYA 3G0VA 2KGAA 2KGCA 2AFDA 4CA3A 4U0DA 2K5XA 4XROA 1ACPA 1VHNA 2KOSA 1YI2P 2GZJA 2KW2A 3WBHA 2OTJP 2X2BA 2NO8A 3CCRP 2K92A 3P05A 2ROQA 3HZQA 1BAJA 2CG5B 1DV5A 4HKGA 3GKLC 1M90Q 3CCJP 5HVCA 2EIAA 1VQ4P 2VLNA 3DTJA 1VQPP 1D1DA 3H47A 2PENA 1VQMP 1VQOP 3LMOA 3OW2O 2FVEA 1M6NA 5HGOA 4WYMA 2VLQA 2EFJA 4COPA 3Q20A 2DNWA 1NJIQ 4NEOA 1A43A 5EJDA 2M5RA 4XRQA 2PEQA 2FQ1A 2L6EA 3CCUP 2GDXA 3CCSP 7CEIA 1JJ2O 4BPHA 1Q81Q 1HY8A 2QEXP 3CC2P 2MD9A 1EOQA 3DS2A 2E1MA 1K9MQ 4U0FA 3CD6P 1E6JP 1MZ8A 3G26A 2K93A 1IMPA 1KD1Q 2FQ0A 1Q86Q 2KG8A 2FVFA 2LOLA 4DG9A 3I55P 2KGDA 5EW5E 4IPYA 2JGPA 1GXHA 1QVFO 1A8OA 5CZDB 2MVVA 2MF4A 2JQ4A 1K30A 2L4BA 3DS3A 2KWLA 1EMVA 4H2YC 2JU1A 3G1GA 2XZ1C
chains in the Genus database with same CATH topology
2N98A 1DNYA 2LKIA 2K2QA 3EJBA 2KR5A 2L9FA 1L0IA 2EHTA 1KLPA 1F80D 2JU2A 1NQ4A 4IZ6A 3GZMA 2MY5A 1L0HA 3LMOA 1X3OA 2FVEA 2N50A 2LPKA 2FVAA 2LTEA 4R0MA 5KP7B 3RG2A 2KOPA 2N5IA 2CGQA 2KOOA 2K0YA 2DNWA 4NEOA 2KGEA 5EJDA 2M5RA 2N6YA 4BPGA 2FADA 2FQ1A 2AVAA 2FQ2A 2GDXA 4MRTC 2LIWA 2GDWA 2MR8A 1HQBA 4BPHA 5KP8B 3EJEA 1HY8A 2EHSA 2K94A 2MD9A 2L0QA 2FHSC 4PWVB 2KOQA 2LIUA 2KG6A 2MVUA 1T8KA 2QNWA 2KG9A 4H2WC 1VKUA 2CNRA 2CQ8A 2K93A 2FQ0A 2K0XA 2KGAA 2VSQA 2KG8A 2AFEA 2GDYA 2LL8A 2KGCA 2FVFA 2AFDA 2LOLA 3CE7A 4DG9A 4CA3A 5HV8A 5KP6B 2FACA 2KGDA 1ACPA 2KOSA 4BPFA 2MR7A 2JGPA 2N6ZA 2KW2A 2L22A 2LMLA 2X2BA 5CZDB 2MVVA 3NY7B 4H2XC 1OR5A 1AF8A 2MF4A 2K92A 2JQ4A 3GZLA 2L4BA 2KWLA 2PNGA 2ROQA 2KORA 2CG5B 4H2YC 2JU1A 1DV5A 4HKGA 2AF8A 3EJDA 2XZ0D 4PXHB 2FAEA 2XZ1C 2N5HA 5HVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N98 A;  1DNY A;  2LKI A;  2K2Q A;  3EJB A;  2KR5 A;  2L9F A;  1L0I A;  2EHT A;  1KLP A;  1F80 D;  2JU2 A;  1NQ4 A;  4IZ6 A;  3GZM A;  2MY5 A;  1L0H A;  3LMO A;  1X3O A;  2FVE A;  2N50 A;  2LPK A;  2FVA A;  2LTE A;  4R0M A;  5KP7 B;  3RG2 A;  2KOP A;  2N5I A;  2CGQ A;  2KOO A;  2K0Y A;  2DNW A;  4NEO A;  2KGE A;  5EJD A;  2M5R A;  2N6Y A;  4BPG A;  2FAD A;  2FQ1 A;  2AVA A;  2FQ2 A;  2GDX A;  4MRT C;  2LIW A;  2GDW A;  2MR8 A;  1HQB A;  4BPH A;  5KP8 B;  3EJE A;  1HY8 A;  2EHS A;  2K94 A;  2MD9 A;  2L0Q A;  2FHS C;  4PWV B;  2KOQ A;  2LIU A;  2KG6 A;  2MVU A;  1T8K A;  2QNW A;  2KG9 A;  4H2W C;  1VKU A;  2CNR A;  2CQ8 A;  2K93 A;  2FQ0 A;  2K0X A;  2KGA A;  2VSQ A;  2KG8 A;  2AFE A;  2GDY A;  2LL8 A;  2KGC A;  2FVF A;  2AFD A;  2LOL A;  3CE7 A;  4DG9 A;  4CA3 A;  5HV8 A;  5KP6 B;  2FAC A;  2KGD A;  1ACP A;  2KOS A;  4BPF A;  2MR7 A;  2JGP A;  2N6Z A;  2KW2 A;  2L22 A;  2LML A;  2X2B A;  5CZD B;  2MVV A;  3NY7 B;  4H2X C;  1OR5 A;  1AF8 A;  2MF4 A;  2K92 A;  2JQ4 A;  3GZL A;  2L4B A;  2KWL A;  2PNG A;  2ROQ A;  2KOR A;  2CG5 B;  4H2Y C;  2JU1 A;  1DV5 A;  4HKG A;  2AF8 A;  3EJD A;  2XZ0 D;  4PXH B;  2FAE A;  2XZ1 C;  2N5H A;  5HVC A; 
#chains in the Genus database with same CATH topology
 2M8L A;  3CXC O;  1Z6M A;  2K2Q A;  3EJB A;  2XT1 A;  2L9F A;  1L0I A;  1AUM A;  1RO0 A;  1S72 P;  4U0A A;  1NQ4 A;  3GZM A;  3M1M A;  2MY5 A;  2JB0 A;  2LPK A;  2FVA A;  2KOP A;  3G71 P;  2N5I A;  2CGQ A;  2KOO A;  1K8A Q;  2PY8 A;  4GR2 A;  4XFY A;  3CME P;  3CCQ P;  2JAZ A;  4QKO A;  3CCE P;  2GZF A;  2M8P A;  4MRT C;  2LIW A;  2GDW A;  2XV6 A;  4XFX A;  1ZMB A;  2JYG A;  1VQ9 P;  1VQ8 P;  2L0Q A;  2MVU A;  2JO0 A;  1T8K A;  4U0B A;  4M0I A;  1GPJ A;  1KC8 Q;  2CQ8 A;  2PEJ A;  5BS1 A;  5DCK A;  2K0X A;  2VSQ A;  3G21 A;  1W2B O;  1M6E X;  3MGE A;  3DS5 A;  5KP6 B;  2JBG A;  1KQS O;  2LF4 A;  2OTL P;  4BPF A;  1RO2 A;  1VQL P;  1Q7Y Q;  1K73 Q;  3G6E P;  3B4Q A;  2L22 A;  2PEM A;  1UJZ A;  1GXG A;  1E0H A;  1BXI A;  1VQN P;  2PNG A;  4UHP B;  5HGM A;  2KOR A;  1N8R Q;  2ERH A;  4PH0 A;  2AF8 A;  5JPA A;  2Z44 A;  5F2N A;  4PXH B;  2N5H A;  2N98 A;  3CC7 P;  1DNY A;  2PEK A;  2KR5 A;  5BS2 A;  3H0D A;  2EHT A;  1F80 D;  3G29 A;  4IZ6 A;  2GZI A;  1X3O A;  2WPT A;  1IMQ A;  5KP7 B;  1M74 A;  2K0Y A;  4COC A;  2GZG A;  3CCL P;  2FAD A;  5HGN A;  1VQ5 P;  2M8N A;  2AVA A;  2FQ2 A;  2MR8 A;  1HQB A;  5KP8 B;  3EJE A;  3U43 A;  1YJN P;  2KOD A;  5F2O A;  3G28 A;  5F2K A;  5I4T G;  4GR6 A;  2LIU A;  1FR2 A;  2QNW A;  2KG9 A;  4H2W C;  2OAR A;  1VKU A;  2CNR A;  1M1K Q;  3G1I A;  1IUQ A;  2AFE A;  2GDY A;  1CEI A;  1YJW P;  2LL8 A;  3CE7 A;  2K0D X;  5HV8 A;  3RG6 C;  2FAC A;  4F37 A;  1VQ6 P;  1UNK A;  3LRY A;  1YHQ P;  2MR7 A;  2N6Z A;  3GJN A;  3H4E A;  1QVG O;  1YJ9 P;  2LML A;  3NY7 B;  4H2X C;  2VLO A;  1OR5 A;  2CWO A;  1AF8 A;  3GZL A;  4U0E A;  1RNI A;  2EG5 A;  2Z45 A;  2GYK A;  1VQK P;  2Z46 A;  3DS1 A;  3B5I A;  3EJD A;  2XZ0 D;  2FAE A;  1EIA A;  3NTE A;  4U0C A;  3VRL C;  2LKI A;  4XFZ A;  1KLP A;  2JU2 A;  2VLP A;  3DPH A;  1Q82 Q;  1L0H A;  1YIJ P;  1YIT P;  2N50 A;  3CC4 P;  2XXM A;  2LTE A;  4R0M A;  3I56 P;  3RG2 A;  3CPW O;  2PEO A;  3CCM P;  3CMA P;  2PEI A;  3G4S P;  1ZNV A;  2JYL A;  2KGE A;  2N6Y A;  4BPG A;  4QNB A;  1QRJ A;  3DS4 A;  1VQ7 P;  3CCV P;  2GZE A;  4PH1 A;  3DS0 A;  2EHS A;  2K94 A;  3E2D A;  2FHS C;  4PWV B;  2KOQ A;  2BUO A;  2KG6 A;  2ONT A;  5HGL A;  3HYB A;  1AYI A;  2BHV A;  2QA4 P;  2P9X A;  2DGY A;  3G0V A;  2KGA A;  2KGC A;  2AFD A;  4CA3 A;  4U0D A;  2K5X A;  4XRO A;  1ACP A;  1VHN A;  2KOS A;  1YI2 P;  2GZJ A;  2KW2 A;  3WBH A;  2OTJ P;  2X2B A;  2NO8 A;  3CCR P;  2K92 A;  3P05 A;  2ROQ A;  3HZQ A;  1BAJ A;  2CG5 B;  1DV5 A;  4HKG A;  3GKL C;  1M90 Q;  3CCJ P;  5HVC A;  2EIA A;  1VQ4 P;  2VLN A;  3DTJ A;  1VQP P;  1D1D A;  3H47 A;  2PEN A;  1VQM P;  1VQO P;  3LMO A;  3OW2 O;  2FVE A;  1M6N A;  5HGO A;  4WYM A;  2VLQ A;  2EFJ A;  4COP A;  3Q20 A;  2DNW A;  1NJI Q;  4NEO A;  1A43 A;  5EJD A;  2M5R A;  4XRQ A;  2PEQ A;  2FQ1 A;  2L6E A;  3CCU P;  2GDX A;  3CCS P;  7CEI A;  1JJ2 O;  4BPH A;  1Q81 Q;  1HY8 A;  2QEX P;  3CC2 P;  2MD9 A;  1EOQ A;  3DS2 A;  2E1M A;  1K9M Q;  4U0F A;  3CD6 P;  1E6J P;  1MZ8 A;  3G26 A;  2K93 A;  1IMP A;  1KD1 Q;  2FQ0 A;  1Q86 Q;  2KG8 A;  2FVF A;  2LOL A;  4DG9 A;  3I55 P;  2KGD A;  5EW5 E;  4IPY A;  2JGP A;  1GXH A;  1QVF O;  1A8O A;  5CZD B;  2MVV A;  2MF4 A;  2JQ4 A;  1K30 A;  2L4B A;  3DS3 A;  2KWL A;  1EMV A;  4H2Y C;  2JU1 A;  3G1G A;  2XZ1 C; 
#chains in the Genus database with same CATH homology
 2N98 A;  1DNY A;  2LKI A;  2K2Q A;  3EJB A;  2KR5 A;  2L9F A;  1L0I A;  2EHT A;  1KLP A;  1F80 D;  2JU2 A;  1NQ4 A;  4IZ6 A;  3GZM A;  2MY5 A;  1L0H A;  3LMO A;  1X3O A;  2FVE A;  2N50 A;  2LPK A;  2FVA A;  2LTE A;  4R0M A;  5KP7 B;  3RG2 A;  2KOP A;  2N5I A;  2CGQ A;  2KOO A;  2K0Y A;  2DNW A;  4NEO A;  2KGE A;  5EJD A;  2M5R A;  2N6Y A;  4BPG A;  2FAD A;  2FQ1 A;  2AVA A;  2FQ2 A;  2GDX A;  4MRT C;  2LIW A;  2GDW A;  2MR8 A;  1HQB A;  4BPH A;  5KP8 B;  3EJE A;  1HY8 A;  2EHS A;  2K94 A;  2MD9 A;  2L0Q A;  2FHS C;  4PWV B;  2KOQ A;  2LIU A;  2KG6 A;  2MVU A;  1T8K A;  2QNW A;  2KG9 A;  4H2W C;  1VKU A;  2CNR A;  2CQ8 A;  2K93 A;  2FQ0 A;  2K0X A;  2KGA A;  2VSQ A;  2KG8 A;  2AFE A;  2GDY A;  2LL8 A;  2KGC A;  2FVF A;  2AFD A;  2LOL A;  3CE7 A;  4DG9 A;  4CA3 A;  5HV8 A;  5KP6 B;  2FAC A;  2KGD A;  1ACP A;  2KOS A;  4BPF A;  2MR7 A;  2JGP A;  2N6Z A;  2KW2 A;  2L22 A;  2LML A;  2X2B A;  5CZD B;  2MVV A;  3NY7 B;  4H2X C;  1OR5 A;  1AF8 A;  2MF4 A;  2K92 A;  2JQ4 A;  3GZL A;  2L4B A;  2KWL A;  2PNG A;  2ROQ A;  2KOR A;  2CG5 B;  4H2Y C;  2JU1 A;  1DV5 A;  4HKG A;  2AF8 A;  3EJD A;  2XZ0 D;  4PXH B;  2FAE A;  2XZ1 C;  2N5H A;  5HVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...