2FVFA

Structure of 10:0-acp (protein with docked fatty acid)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
b'AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl Carrier Protein
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Biosynthetic protein
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fvfA00
2N5IA 1ACPA 2L22A 2EHTA 2LKIA 2JQ4A 2AFEA 2FAEA 2CNRA 1DNYA 2KOOA 2MVUA 2N6YA 2FVEA 2LOLA 2LL8A 2KORA 3CE7A 3GZMA 2X2BA 2JU2A 4DG9A 2KOQA 2CG5B 2K0XA 4BPGA 1F80D 2FHSC 5KP6B 2KWLA 3EJBA 2K0YA 2KG8A 2MD9A 2VSQA 2EHSA 2KGAA 2N5HA 1OR5A 2JU1A 2N50A 4H2XC 2N6ZA 4BPFA 1HQBA 1X3OA 5KP7B 2DNWA 2FVFA 2MY5A 2MVVA 2KGCA 4MRTC 2K93A 2AFDA 1L0IA 2MF4A 1KLPA 2XZ1C 2FQ1A 3EJEA 2KG9A 2K92A 2N98A 2XZ0D 4H2WC 2M5RA 1DV5A 4IZ6A 4HKGA 4R0MA 1T8KA 1HY8A 1VKUA 4CA3A 2FQ0A 2L0QA 2MR8A 2KGEA 2PNGA 2K2QA 2CQ8A 2JGPA 4H2YC 1L0HA 2L4BA 5HVCA 2GDXA 2LIWA 3GZLA 2AVAA 2GDYA 2FACA 2LPKA 2GDWA 2LTEA 5HV8A 4PWVB 2KOPA 2KR5A 5EJDA 5KP8B 2MR7A 3LMOA 3NY7B 3EJDA 5CZDB 1AF8A 2CGQA 2KG6A 2ROQA 2KGDA 2KOSA 1NQ4A 2LIUA 2QNWA 2FVAA 4BPHA 2LMLA 2K94A 2AF8A 2FQ2A 2FADA 4NEOA 2KW2A 2L9FA 4PXHB 3RG2A
chains in the Genus database with same CATH superfamily
2JBGA 2JQ4A 2Z46A 1Q82Q 2AFEA 3G26A 1K73Q 1DNYA 1BXIA 1Q86Q 1W2BO 2KORA 2LL8A 1VQOP 4BPGA 4U0AA 2KWLA 3EJBA 2K0YA 1VQ7P 3CC4P 1MZ8A 2VSQA 3DPHA 5JPAA 2PEJA 1EOQA 3CCMP 2KODA 2N6ZA 1HQBA 1M1KQ 1K8AQ 2DNWA 2MVVA 2KGCA 1L0IA 2XZ1C 4GR6A 2PENA 1QVGO 2XZ0D 2NO8A 4H2WC 2M5RA 2XT1A 4R0MA 3CC7P 3H4EA 2FQ0A 2EFJA 2JB0A 2KGEA 2CQ8A 1L0HA 1EMVA 3DS4A 5F2OA 1M6NA 2GDXA 3G1IA 2FACA 5HV8A 4PWVB 1NJIQ 3G71P 3U43A 2MR7A 3LMOA 1E0HA 2KG6A 3CCSP 2KGDA 2KOSA 2QNWA 4BPHA 2FADA 3P05A 1Q7YQ 1RNIA 1VHNA 2N5IA 2EHTA 2LKIA 2CNRA 2KOOA 1EIAA 1S72P 2MVUA 5BS2A 2N6YA 2LOLA 2JO0A 4DG9A 2KOQA 2K0XA 1F80D 2FHSC 2VLQA 3G0VA 3G1GA 2CWOA 4COPA 3M1MA 2EHSA 2JU1A 2N50A 5I4TG 4PH1A 3CMAP 1YJNP 2M8PA 2FVFA 3CCJP 2AFDA 1VQ6P 1KC8Q 4U0EA 1E6JP 3DS1A 2OTLP 2L6EA 3G29A 2GZJA 5EW5E 3HYBA 3CD6P 2XV6A 2JGPA 4H2YC 1KD1Q 1UJZA 5HVCA 3DTJA 2LIWA 3GZLA 1D1DA 2GDWA 2BUOA 2K0DX 3H0DA 2KOPA 3EJDA 5CZDB 4XFZA 2CGQA 2ROQA 2JAZA 2Z44A 3CMEP 2LIUA 4UHPB 3VRLC 4U0BA 2AF8A 2FQ2A 4NEOA 4F37A 2WPTA 3NTEA 2BHVA 2FAEA 4QKOA 3G4SP 3RG6C 5BS1A 2DGYA 2PEMA 2X2BA 2JYLA 2JU2A 1YI2P 3CCEP 1FR2A 5KP6B 2M8NA 1VQ9P 1YJWP 2OARA 2KG8A 2MD9A 2KGAA 1IMPA 1OR5A 1M6EX 1X3OA 5KP7B 3G6EP 1ZMBA 3E2DA 2P9XA 4MRTC 5HGNA 3OW2O 1GPJA 2MF4A 1KLPA 3G28A 2FQ1A 2ONTA 3EJEA 3LRYA 1K30A 1GXGA 1ZNVA 1VQKP 1AUMA 4IZ6A 4HKGA 1HY8A 1KQSO 1VKUA 5HGMA 1CEIA 2L0QA 2L4BA 2PY8A 2AVAA 2QA4P 2GZGA 2EIAA 5KP8B 1IMQA 3NY7B 4GR2A 1K9MQ 1UNKA 1AF8A 2VLOA 3DS5A 4U0FA 2PEOA 3GKLC 1NQ4A 2XXMA 2M8LA 2FVAA 1M74A 3I55P 2LMLA 1VQ5P 1A8OA 3CCRP 2KW2A 1YIJP 2L9FA 3CPWO 5DCKA 1ACPA 2L22A 3MGEA 3CCVP 1Q81Q 1GXHA 4XROA 5F2NA 2FVEA 4WYMA 1VQPP 1AYIA 3CE7A 3GZMA 2CG5B 2PEQA 4IPYA 3DS2A 5HGOA 1VQNP 1RO2A 1QVFO 4PH0A 2N5HA 2EG5A 4H2XC 3WBHA 1Z6MA 4BPFA 2PEKA 2MY5A 2K93A 2Z45A 4XFXA 2LF4A 5HGLA 2KG9A 2K92A 1A43A 4QNBA 2N98A 4U0DA 1DV5A 3H47A 2K5XA 2GZFA 1T8KA 1N8RQ 2GZEA 4CA3A 4COCA 1YHQP 3DS0A 3CCQP 1YITP 3G21A 2MR8A 1BAJA 2JYGA 3B4QA 2PNGA 2K2QA 2VLNA 2QEXP 1VQ8P 1IUQA 4XFYA 1JJ2O 2GDYA 4M0IA 2E1MA 2OTJP 1VQLP 2ERHA 2LPKA 2LTEA 3CCUP 1VQMP 3CC2P 2KR5A 5EJDA 3HZQA 7CEIA 1VQ4P 3GJNA 2GZIA 1QRJA 3Q20A 4U0CA 2GYKA 4XRQA 2PEIA 3CCLP 1YJ9P 3B5IA 1RO0A 2K94A 3DS3A 2VLPA 3CXCO 5F2KA 3I56P 4PXHB 3RG2A 1M90Q
chains in the Genus database with same CATH topology
2N5IA 1ACPA 2L22A 2EHTA 2LKIA 2JQ4A 2AFEA 2FAEA 2CNRA 1DNYA 2KOOA 2MVUA 2N6YA 2FVEA 2LOLA 2LL8A 2KORA 3CE7A 3GZMA 2X2BA 2JU2A 4DG9A 2KOQA 2CG5B 2K0XA 4BPGA 1F80D 2FHSC 5KP6B 2KWLA 3EJBA 2K0YA 2KG8A 2MD9A 2VSQA 2EHSA 2KGAA 2N5HA 1OR5A 2JU1A 2N50A 4H2XC 2N6ZA 4BPFA 1HQBA 1X3OA 5KP7B 2DNWA 2FVFA 2MY5A 2MVVA 2KGCA 4MRTC 2K93A 2AFDA 1L0IA 2MF4A 1KLPA 2XZ1C 2FQ1A 3EJEA 2KG9A 2K92A 2N98A 2XZ0D 4H2WC 2M5RA 1DV5A 4IZ6A 4HKGA 4R0MA 1T8KA 1HY8A 1VKUA 4CA3A 2FQ0A 2L0QA 2MR8A 2KGEA 2PNGA 2K2QA 2CQ8A 2JGPA 4H2YC 1L0HA 2L4BA 5HVCA 2GDXA 2LIWA 3GZLA 2AVAA 2GDYA 2FACA 2LPKA 2GDWA 2LTEA 5HV8A 4PWVB 2KOPA 2KR5A 5EJDA 5KP8B 2MR7A 3LMOA 3NY7B 3EJDA 5CZDB 1AF8A 2CGQA 2KG6A 2ROQA 2KGDA 2KOSA 1NQ4A 2LIUA 2QNWA 2FVAA 4BPHA 2LMLA 2K94A 2AF8A 2FQ2A 2FADA 4NEOA 2KW2A 2L9FA 4PXHB 3RG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N5I A;  1ACP A;  2L22 A;  2EHT A;  2LKI A;  2JQ4 A;  2AFE A;  2FAE A;  2CNR A;  1DNY A;  2KOO A;  2MVU A;  2N6Y A;  2FVE A;  2LOL A;  2LL8 A;  2KOR A;  3CE7 A;  3GZM A;  2X2B A;  2JU2 A;  4DG9 A;  2KOQ A;  2CG5 B;  2K0X A;  4BPG A;  1F80 D;  2FHS C;  5KP6 B;  2KWL A;  3EJB A;  2K0Y A;  2KG8 A;  2MD9 A;  2VSQ A;  2EHS A;  2KGA A;  2N5H A;  1OR5 A;  2JU1 A;  2N50 A;  4H2X C;  2N6Z A;  4BPF A;  1HQB A;  1X3O A;  5KP7 B;  2DNW A;  2FVF A;  2MY5 A;  2MVV A;  2KGC A;  4MRT C;  2K93 A;  2AFD A;  1L0I A;  2MF4 A;  1KLP A;  2XZ1 C;  2FQ1 A;  3EJE A;  2KG9 A;  2K92 A;  2N98 A;  2XZ0 D;  4H2W C;  2M5R A;  1DV5 A;  4IZ6 A;  4HKG A;  4R0M A;  1T8K A;  1HY8 A;  1VKU A;  4CA3 A;  2FQ0 A;  2L0Q A;  2MR8 A;  2KGE A;  2PNG A;  2K2Q A;  2CQ8 A;  2JGP A;  4H2Y C;  1L0H A;  2L4B A;  5HVC A;  2GDX A;  2LIW A;  3GZL A;  2AVA A;  2GDY A;  2FAC A;  2LPK A;  2GDW A;  2LTE A;  5HV8 A;  4PWV B;  2KOP A;  2KR5 A;  5EJD A;  5KP8 B;  2MR7 A;  3LMO A;  3NY7 B;  3EJD A;  5CZD B;  1AF8 A;  2CGQ A;  2KG6 A;  2ROQ A;  2KGD A;  2KOS A;  1NQ4 A;  2LIU A;  2QNW A;  2FVA A;  4BPH A;  2LML A;  2K94 A;  2AF8 A;  2FQ2 A;  2FAD A;  4NEO A;  2KW2 A;  2L9F A;  4PXH B;  3RG2 A; 
#chains in the Genus database with same CATH topology
 2JBG A;  2JQ4 A;  2Z46 A;  1Q82 Q;  2AFE A;  3G26 A;  1K73 Q;  1DNY A;  1BXI A;  1Q86 Q;  1W2B O;  2KOR A;  2LL8 A;  1VQO P;  4BPG A;  4U0A A;  2KWL A;  3EJB A;  2K0Y A;  1VQ7 P;  3CC4 P;  1MZ8 A;  2VSQ A;  3DPH A;  5JPA A;  2PEJ A;  1EOQ A;  3CCM P;  2KOD A;  2N6Z A;  1HQB A;  1M1K Q;  1K8A Q;  2DNW A;  2MVV A;  2KGC A;  1L0I A;  2XZ1 C;  4GR6 A;  2PEN A;  1QVG O;  2XZ0 D;  2NO8 A;  4H2W C;  2M5R A;  2XT1 A;  4R0M A;  3CC7 P;  3H4E A;  2FQ0 A;  2EFJ A;  2JB0 A;  2KGE A;  2CQ8 A;  1L0H A;  1EMV A;  3DS4 A;  5F2O A;  1M6N A;  2GDX A;  3G1I A;  2FAC A;  5HV8 A;  4PWV B;  1NJI Q;  3G71 P;  3U43 A;  2MR7 A;  3LMO A;  1E0H A;  2KG6 A;  3CCS P;  2KGD A;  2KOS A;  2QNW A;  4BPH A;  2FAD A;  3P05 A;  1Q7Y Q;  1RNI A;  1VHN A;  2N5I A;  2EHT A;  2LKI A;  2CNR A;  2KOO A;  1EIA A;  1S72 P;  2MVU A;  5BS2 A;  2N6Y A;  2LOL A;  2JO0 A;  4DG9 A;  2KOQ A;  2K0X A;  1F80 D;  2FHS C;  2VLQ A;  3G0V A;  3G1G A;  2CWO A;  4COP A;  3M1M A;  2EHS A;  2JU1 A;  2N50 A;  5I4T G;  4PH1 A;  3CMA P;  1YJN P;  2M8P A;  2FVF A;  3CCJ P;  2AFD A;  1VQ6 P;  1KC8 Q;  4U0E A;  1E6J P;  3DS1 A;  2OTL P;  2L6E A;  3G29 A;  2GZJ A;  5EW5 E;  3HYB A;  3CD6 P;  2XV6 A;  2JGP A;  4H2Y C;  1KD1 Q;  1UJZ A;  5HVC A;  3DTJ A;  2LIW A;  3GZL A;  1D1D A;  2GDW A;  2BUO A;  2K0D X;  3H0D A;  2KOP A;  3EJD A;  5CZD B;  4XFZ A;  2CGQ A;  2ROQ A;  2JAZ A;  2Z44 A;  3CME P;  2LIU A;  4UHP B;  3VRL C;  4U0B A;  2AF8 A;  2FQ2 A;  4NEO A;  4F37 A;  2WPT A;  3NTE A;  2BHV A;  2FAE A;  4QKO A;  3G4S P;  3RG6 C;  5BS1 A;  2DGY A;  2PEM A;  2X2B A;  2JYL A;  2JU2 A;  1YI2 P;  3CCE P;  1FR2 A;  5KP6 B;  2M8N A;  1VQ9 P;  1YJW P;  2OAR A;  2KG8 A;  2MD9 A;  2KGA A;  1IMP A;  1OR5 A;  1M6E X;  1X3O A;  5KP7 B;  3G6E P;  1ZMB A;  3E2D A;  2P9X A;  4MRT C;  5HGN A;  3OW2 O;  1GPJ A;  2MF4 A;  1KLP A;  3G28 A;  2FQ1 A;  2ONT A;  3EJE A;  3LRY A;  1K30 A;  1GXG A;  1ZNV A;  1VQK P;  1AUM A;  4IZ6 A;  4HKG A;  1HY8 A;  1KQS O;  1VKU A;  5HGM A;  1CEI A;  2L0Q A;  2L4B A;  2PY8 A;  2AVA A;  2QA4 P;  2GZG A;  2EIA A;  5KP8 B;  1IMQ A;  3NY7 B;  4GR2 A;  1K9M Q;  1UNK A;  1AF8 A;  2VLO A;  3DS5 A;  4U0F A;  2PEO A;  3GKL C;  1NQ4 A;  2XXM A;  2M8L A;  2FVA A;  1M74 A;  3I55 P;  2LML A;  1VQ5 P;  1A8O A;  3CCR P;  2KW2 A;  1YIJ P;  2L9F A;  3CPW O;  5DCK A;  1ACP A;  2L22 A;  3MGE A;  3CCV P;  1Q81 Q;  1GXH A;  4XRO A;  5F2N A;  2FVE A;  4WYM A;  1VQP P;  1AYI A;  3CE7 A;  3GZM A;  2CG5 B;  2PEQ A;  4IPY A;  3DS2 A;  5HGO A;  1VQN P;  1RO2 A;  1QVF O;  4PH0 A;  2N5H A;  2EG5 A;  4H2X C;  3WBH A;  1Z6M A;  4BPF A;  2PEK A;  2MY5 A;  2K93 A;  2Z45 A;  4XFX A;  2LF4 A;  5HGL A;  2KG9 A;  2K92 A;  1A43 A;  4QNB A;  2N98 A;  4U0D A;  1DV5 A;  3H47 A;  2K5X A;  2GZF A;  1T8K A;  1N8R Q;  2GZE A;  4CA3 A;  4COC A;  1YHQ P;  3DS0 A;  3CCQ P;  1YIT P;  3G21 A;  2MR8 A;  1BAJ A;  2JYG A;  3B4Q A;  2PNG A;  2K2Q A;  2VLN A;  2QEX P;  1VQ8 P;  1IUQ A;  4XFY A;  1JJ2 O;  2GDY A;  4M0I A;  2E1M A;  2OTJ P;  1VQL P;  2ERH A;  2LPK A;  2LTE A;  3CCU P;  1VQM P;  3CC2 P;  2KR5 A;  5EJD A;  3HZQ A;  7CEI A;  1VQ4 P;  3GJN A;  2GZI A;  1QRJ A;  3Q20 A;  4U0C A;  2GYK A;  4XRQ A;  2PEI A;  3CCL P;  1YJ9 P;  3B5I A;  1RO0 A;  2K94 A;  3DS3 A;  2VLP A;  3CXC O;  5F2K A;  3I56 P;  4PXH B;  3RG2 A;  1M90 Q; 
#chains in the Genus database with same CATH homology
 2N5I A;  1ACP A;  2L22 A;  2EHT A;  2LKI A;  2JQ4 A;  2AFE A;  2FAE A;  2CNR A;  1DNY A;  2KOO A;  2MVU A;  2N6Y A;  2FVE A;  2LOL A;  2LL8 A;  2KOR A;  3CE7 A;  3GZM A;  2X2B A;  2JU2 A;  4DG9 A;  2KOQ A;  2CG5 B;  2K0X A;  4BPG A;  1F80 D;  2FHS C;  5KP6 B;  2KWL A;  3EJB A;  2K0Y A;  2KG8 A;  2MD9 A;  2VSQ A;  2EHS A;  2KGA A;  2N5H A;  1OR5 A;  2JU1 A;  2N50 A;  4H2X C;  2N6Z A;  4BPF A;  1HQB A;  1X3O A;  5KP7 B;  2DNW A;  2FVF A;  2MY5 A;  2MVV A;  2KGC A;  4MRT C;  2K93 A;  2AFD A;  1L0I A;  2MF4 A;  1KLP A;  2XZ1 C;  2FQ1 A;  3EJE A;  2KG9 A;  2K92 A;  2N98 A;  2XZ0 D;  4H2W C;  2M5R A;  1DV5 A;  4IZ6 A;  4HKG A;  4R0M A;  1T8K A;  1HY8 A;  1VKU A;  4CA3 A;  2FQ0 A;  2L0Q A;  2MR8 A;  2KGE A;  2PNG A;  2K2Q A;  2CQ8 A;  2JGP A;  4H2Y C;  1L0H A;  2L4B A;  5HVC A;  2GDX A;  2LIW A;  3GZL A;  2AVA A;  2GDY A;  2FAC A;  2LPK A;  2GDW A;  2LTE A;  5HV8 A;  4PWV B;  2KOP A;  2KR5 A;  5EJD A;  5KP8 B;  2MR7 A;  3LMO A;  3NY7 B;  3EJD A;  5CZD B;  1AF8 A;  2CGQ A;  2KG6 A;  2ROQ A;  2KGD A;  2KOS A;  1NQ4 A;  2LIU A;  2QNW A;  2FVA A;  4BPH A;  2LML A;  2K94 A;  2AF8 A;  2FQ2 A;  2FAD A;  4NEO A;  2KW2 A;  2L9F A;  4PXH B;  3RG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...