2FVNA

The fibrillar tip complex of the afa/dr adhesins from pathogen e. coli displays synergistic binding to 5 1 and v 3 integrins
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
142
structure length
142
Chain Sequence
SAELHLESRGGSGTQLRDGAKVATGRIICREAHTGFHVWMNERQVDGRAERYVVQSKDGRHELRVRTGGDGWSPVKGEGGKGVSRPGQEEQVFFDVMADGNQDIAPGEYRFSVGGACVVPQEDNKQGFTPSGTTGTTKLTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein afaD
publication title The solution structure of the invasive tip complex from Afa/Dr fibrils
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 9
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fvnA00
2CNYA 4OR1A 2IXQA 2AXWA 2CO4A 2FVNA 2CO1A 2CO3A 5D55A 2CO6A 3UIYA 2CNZA 3UIZA 4PHXA 2CO2A 2CO7A
chains in the Genus database with same CATH superfamily
3VI4E 4TUKL 1Q9WA 4OI7A 3O4LB 3W5MA 5F9JB 1DQLL 3II2A 3HZMA 2Z3FA 3C8KA 2WLJA 3QXDB 4PBWD 5A3IC 3D0LA 3UTTB 3CGTA 4KVNH 4JM2B 5CN2A 5LWYL 5A2LH 1SVCP 4BQCA 1Z0NA 3UBXG 2CDGB 3WAKA 1A2YB 4YHOL 2BZ7A 4Q9QL 1QFWM 3RZWA 3D0VB 3HUJE 2E8YA 2YK1L 3L9RA 5F2FA 2NNAB 3MVSA 4RISL 3R4RA 1CBVH 3IWUA 1FVCA 2PPAA 4LOEA 3UTZB 3PNWA 2CKBB 3SDXB 4PD4J 5A2BA 4I2XA 2R69L 3EYFB 3HEIB 1M05A 1HDMA 1LP9B 1BZOA 4NHCL 5D6CB 1NBCA 1J0JA 1MLBB 2AEPL 2LTQC 4HS6A 4WSJA 5T1JA 2VRQA 4IKNA 4WGVB 4DW2H 5B1KA 1S7RB 5E2WL 4BQ6A 2IALB 1E28A 4GT7A 2XX0A 2QGEA 1PL3A 1U3HC 3JZ7A 3VXSD 3SDDB 5ICXB 5CLZA 1OAUL 1SNRA 3AFLA 4TVPH 3FQTB 2YD9A 1KJMB 4Q8BA 5C0CA 1JXKA 2KPWA 1SF5A 1WG3A 1NCNA 4FFVD 2CGRH 3MUJA 2WNXA 2FCBA 3AS3A 4NQUA 3PGCA 5DRWA 2XXCB 5C0AB 5DMJB 4BXVA 4HWNA 4O5LL 5IQ9B 4XNAA 3TZVB 5GS0D 1WEJL 2BZDA 1MWAA 4L3EB 1DE4A 4N2NA 2K9FB 4LHJB 1SJEA 1BZ9B 4W9CC 1PLBA 4LKCB 3SCMA 3UBXA 3RVWC 1E6OL 3HNVL 4PB0L 2VCOA 3S37H 1OSPL 4J3SA 4HC1A 4HJJL 1HI6B 1YY9D 1NC4A 3CTTA 2VLRA 3O3AB 1MI5D 4EN3B 4HS8L 1NFKA 4H8VA 1QAWA 3PUUA 5AKTA 1TKWB 3OXRA 4TQ8A 2E3VA 2K3HA 3S98A 1H3TA 3GJFK 1QPPA 3DXAD 1ACYL 2I60L 1JGUH 2G75B 5IV2B 2WVUA 4N2OA 4BFKA 4XNYL 1UYWL 1B3JA 3K5RA 1N3NA 3K72B 3MLSL 4PR5A 4X98B 4F33A 3I75B 1FO0L 2P80A 4J27A 4JO2H 3FDWA 4NO3A 5I28A 4KUZH 4LOUC 3FUIA 3QQDA 1U8JA 3VFUA 5DHVB 4LL4A 1HEZB 2BP0B 3FFDA 3HG4A 2PP8A 5IF0B 2F8XC 4QLRA 3OAUH 4G8GE 5AOLA 1BDYA 4L1SA 4NKDB 2AK4B 1L9PA 3B7YA 2BM3A 5D5ME 1MJJA 3T0BA 2VDRB 4JFHE 3PWUB 4PUBH 1G9NL 2D03L 5FYKL 2XA3A 3KWWA 5T1KD 5GRUL 4NQEB 3L1OH 2EO1A 1C8PA 3ES6A 2WXNA 5F0PB 3MOAH 2NY5C 5G4NA 6CGTA 1CFBA 3OKEB 1CFSB 3RX8A 1KJ2B 2X6BA 1DBAH 1T20B 4JPIB 4XBGB 1MY7A 1XD0A 1GVIA 1ES0B 1W0VA 1EA9C 2IDFA 2MEJB 4BWUA 1XXDC 4YSTA 4U1MA 3TBSB 1NQBA 2UXVA 4H40A 4S2SB 2R4SH 5EZIH 3MNWB 4AYDC 1FJ1A 4RMSA 4C56A 3B6SB 1CGYA 1AVAA 2NY1B 2I07A 4CSTA 3CXHK 2Y7QB 3EGDB 3F00A 1IAIL 3O4OB 1N9PA 4M7ZB 1R3HB 1N4XH 2ZCHH 5HI5D 2OKMA 3FB7B 3TCTA 2EIMB 4J6RL 1J1OL 4LEOA 2L04A 2A4ZA 2A9CA 2O5XL 1QOKA 4NZJA 2YC1B 4WJ5A 1P7HL 1QVOB 3WIHH 1NFIB 3D51A 3WNIA 4JHBA 3SBWC 3D25A 2J21A 2A74C 4IS6A 1QQDA 5F7EL 4AYBA 1KYFA 1QA9A 2V9UA 2ZAIA 4I3RH 5H37H 3OF6D 5L2JA 1SDYA 5DA0B 3SKNA 4IM8A 2W81C 1DTUA 4L1TA 5CJXA 5T1LD 5KW9L 2PWHA 2QHRH 5L6YH 5D1XD 3NIGB 3FK3A 1TJIL 4APXB 3F85A 3U82B 3BJLA 1ZLDA 4K4KA 4YK4B 1R3KA 2VZ3A 2AKRB 3HBZA 3KPSE 1JNJA 1J9RA 15C8H 1ECYA 3K8MA 2FQEA 1R24A 5AW2B 1YY9C 1TYJA 4ELMF 4FA6A 2QMJA 1F8TL 3IMTA 3VG0L 2O5NA 3KBEA 4NQQA 3Q05A 5T5FL 2BDNL 1WSST 3CU7A 1L9TA 3QDJA 2CUAA 3HPJA 1KB5A 1NCDL 3GTVA 4MX7B 4UT6L 3RI5K 4CMHB 3ZZLA 3DX9A 2B14A 2DZEA 2ED9A 3EFDH 3WMPA 3X11B 2GHWB 3WU1A 2VJXA 2HT4D 4V1DA 5E7FA 1JF5A 4M5SA 1OAQH 2CBOA 2MOQA 2N59A 4FZEH 4JDTL 2WAQA 4TLTA 2OMZB 3K0WA 5DR5H 5D6DC 3WEXA 1HT6A 3NACH 1OCZB 1FYHB 2EKJA 3CV5A 4DK5A 4LXFA 1FVEB 1K4CB 5KSUA 2FEEL 1AANA 4JE0A 2OYKA 5F9OL 2ZX8A 4AMXA 3LDBC 4CRPA 4WEMB 3TIDA 4ATTA 4H44C 3G08B 4U6YB 5KJRH 2A38A 1LL1A 3HCVA 2IAMC 4U1KB 3N91A 3BVNA 3OPZH 1ORQA 3KVQA 4P5KA 1YEIH 1TQSA 2PWFA 2WZAA 2Y2YA 4GP5B 3QWRD 2X6UA 3MV9A 3BKMH 1OAZH 1I1AB 3G5VB 5E2TL 1NC2B 3K2KA 4XNQB 1E0OB 4JPVH 3HZYB 4RA3A 4EBQH 3N44F 1PY0A 3CIQA 3P4LA 2CU9A 2MIZA 2PWDA 4IBTA 2JJSC 4QHNA 4JG5A 4RGND 4ZUTB 1S6NA 2MCMA 1MJ7L 3PG2A 3UAJA 1IJ9A 3BIAX 4IIQB 1R3JA 5CHNA 4MJIB 5DQJA 2WANA 3S2CA 4AGQA 2ZX9A 1D5MA 1SJVA 3F58H 5FO7B 3LAFA 4DP9X 4JX0A 3LKQB 5JTWA 3VFPA 3BHBA 1QG3A 5F96L 1PLGL 3NT0A 4OZIE 2DLIA 1UM6H 1T7WA 3HE7D 2YD3A 4I0PD 2EACA 2MPVA 4CC1A 4Z7AA 1ZLUH 1RJZB 2A6IB 5KSBA 4BYHA 1LO0H 3S96A 3HE6A 5KN5B 5KS9E 4MNHA 4Z7OB 1MHCB 3U0PB 1ODAA 5L8JB 5H35A 3CD4A 25C8L 4XB3A 4G9FD 5EOCL 5D2LF 3RGVC 4ZXBA 1CZ8H 1T0MA 4LVNC 5IJKA 5KSAB 3UOAB 4UU9B 4Y5XA 4UF7C 5D1XC 1FPTH 1RZPA 1NJ9B 3L3GB 1QSEE 2KMWA 2FJHA 1CDHA 1IGFH 4DOHB 1RHHB 1SLWA 4UQ2A 1AH1A 4K9EC 3UAFA 2IWFA 4LLWA 3WTSA 4PU2A 1AQKH 3CDZB 1Q0XL 3UJTL 2VDOH 1JV5A 3M88A 2WV3A 4HOZA 3WUWB 5EN2B 3MNVA 4Y5VC 2COVD 2XPGA 3W2DL 3L4TA 3G6JF 4X2UA 1AXSB 1CBJA 4ZS6C 5GJTL 4QRPA 2NX5D 5CIPA 1CXFA 1BQSA 1HNGA 1E8YA 3CHXA 1Z5YD 2J7LA 5CU5A 4AQ1C 2F8VA 3AC0A 1BM7A 2RHEA 4DJMA 4ODSH 3ZE1F 2ZOKA 2MOVA 4LLMB 3P4NA 4GLRI 3MNMA 1T6VN 2YD4A 1NCTA 3RU8H 1U8NB 3SDCB 2OMVB 2V7HB 1I7TB 2YZ8A 2HT4C 5DHEA 2PCFA 2OL3A 3T0EE 1HXYA 3AWEA 4KHXH 2ADFL 4HETA 1GGBL 2D7MA 2EEFA 4NQDD 1N6QH 1AQMA 2BJML 4GUPA 4Z0XA 3BESR 3ZHFA 5I6PA 1TG8A 4MQSB 4BH7A 4OM1H 1EDYA 3BZEB 1WGOA 1KXQE 1X7QA 1FZJA 2WIIB 3D18B 4HCRH 5DMGD 1OAXH 2M83A 3MRKB 4XOAA 4NENB 3PL6B 2E8ZA 5IB4A 4F58L 1XHHA 4E41E 1FGVH 5L2KD 4FFYA 2NQ3A 5D7IA 5T8IA 4NZTL 5E9DD 3RPIB 2OV0A 2VOTA 4PS4H 4ZG1A 5DGQA 3BZDA 1WTGT 1H8NA 2Z8VC 5J89A 5G5DB 5GRWA 3OM3B 3LJ3A 1U6AL 4N5EC 3F7QA 4G3YL 3N55A 1T6BX 1HNFA 3APCA 4RGNC 4A2DA 3QC6X 3JT2A 4XE0A 5CF3A 2H2PC 2XWRA 4APQB 4BSVB 3K2UH 1FL5B 2EXYD 4P46C 2BNRE 4E68A 4AYMC 4PP2B 1VFOA 4FXTA 4F7CA 2A9AA 1A6UH 5DEGB 5AYUL 1Z66A 3V9FA 3NK3A 5J3HC 2JKIS 5DZLA 1CMOA 4HSCX 2HLFD 3GJEB 1MIEL 5DVOA 1NMAL 5LN8A 1TEFA 4J1UA 3HE7C 1T21B 1G7QA 4FKKA 3GSNA 2VC2L 4Q6KA 4Z7WB 1GR7A 4HXAH 5HDQL 4UB0H 2UXFA 2VWEE 4RMQA 1QHQA 4M1CD 3A6BL 4BJLA 2G4EA 1HSAA 3VFSA 5C0IA 2G4GA 3WY4A 1CXEA 2BCMA 2C7FA 3AJ7A 2MWCA 3S34L 5IUSA 2QQLH 2A73B 4KDVA 2TRHA 2J5LB 3Q0HA 2YZ1A 3IN0A 2IC2A 2DMBA 5DD3L 4DK6A 4OZHE 2G2NA 3L5JA 1PZ3A 5B1CA 3SOBL 5JXAL 4XCYA 2CKNA 3OKOB 4JZNA 3W56A 3V0IA 2H3NB 3CZJA 1JNLL 3CVBA 4YIQB 4L1BA 4UDUA 3EHBB 4KTDH 3D07A 2YPKB 2OTWB 3O6KH 3S36L 1A64A 4WWNA 3IGAA 5B7FA 1OGAD 4LE8A 2RMNA 3ZPDA 3TJEL 2FD6H 2WXGA 4JQXA 2XTJC 5JHDD 3MRLA 1FP5A 2OR7A 1RD6A 3LZQA 2PXYB 1XTMA 1TSRA 2DD8L 2YGQA 3PWLB 4X9GA 2DIJA 1JTTA 3RDTD 1SUHA 1SDAB 2N7AA 3ZIYA 2NZ1A 3S5ZA 3DECA 1K4DA 3QPQC 4GAYA 4ENZA 4KXBA 3ARWA 3FKUS 4RESB 2AQQA 2Y36H 4PJAB 4AH2A 2DQIL 2R2HA 2X89D 3FRUA 4H4NA 4FQCH 5HYSB 4HBCH 1A0QL 3V4UH 4PJFA 4ZOEA 5C08A 3VVWA 1QLEL 3HAEG 4ZFOB 3VJ6A 1BP3B 3FH5A 1HL9A 1JF1A 3PQYB 4RFOL 5D7KD 1S5HA 4PWFA 3OC8A 3S37X 4JG1L 4NNYB 4ODWB 1T5XA 4RA0C 2VQTA 5MENA 2ZPKL 5JA8B 2VRAA 2WLYA 4MMZA 1FBIH 1HOEA 3GO1H 3FU9A 1M1XB 2FRGP 3FQNA 2OS7A 1YDPA 4I9XA 3FXIC 3IJ8A 3U6RA 1CICB 3TO4B 4G83A 4LIQH 1TETL 1G6RA 2XWCA 2BOCA 5DZVA 3P2BA 3S0PA 3TOPA 3JVGC 1W8OA 2YN3A 1ZS8A 4PJ8A 4NWUL 2KQNA 1U4EA 3UZVB 1YNKL 1O75A 1QUNB 5EU3B 4XN2A 5HHME 1RJYB 1WS7A 1XZ0A 4OJYA 5E1HB 1JPTH 5GRVK 4AY0A 3WEAA 2NXYC 3QIUC 3C5SA 2YD6A 3L3HA 4OZHA 3BW9A 1YECH 1K8DB 5BZXA 2A6DB 3HG2A 3E6FA 4CMMB 2G0KA 3GZPA 1EZLA 2DLFH 3A47A 4YSEA 2WWKO 1L6XA 1SYVB 5DQDH 3D05A 4E9VA 3QARA 4NNPH 3QA3A 2IG2H 5T5NF 4DP0X 4OQTA 5BXFA 4IKIA 1AP2A 1GZPB 4LLUA 4MWFA 4PJGF 5L9DL 4CILA 4F8QA 4ZBJA 3KJ6H 3HB3B 1OT1A 1U21A 1WIOA 3NH7L 3HAEA 4K3EH 3N85L 4P2QA 1R5IA 2HT3D 4B9KC 1W6WA 3BDYH 4W9LC 3H55A 5EF0A 4E9QA 4BK8A 2QQNH 3QJZA 4EXKA 4UZGA 4HWEH 4I4WA 4XVUD 5TQ0L 4EVNB 3MNDA 4MRCA 5JIKA 3OR7B 5I19L 3L3IB 5I1KH 1B0GB 3CVHB 2Z0UA 2C1PA 4LDLB 2D7OA 3F64A 2DQTL 2PYED 3P3TA 4OAWB 1KJVA 5GSRB 1EZVY 4HV8B 1QKZH 4GW4B 1JNNH 5GPRA 4O58L 3ULVD 5IOKA 2AXWA 5HGGS 4OBRA 5LLIC 4JZOA 3WLBA 3VXSA 4YHIB 4YPGA 2GTWB 2N4IA 2WLKA 2R0LL 4M00A 4H8WC 5PCYA 4JCLA 5IB5A 4GUOA 4PJ9C 5IWLC 4DP7X 1N67A 4GJTB 5T3XD 5DJ6B 3LKRA 3CXDL 3A6CH 3SE8H 3UZEA 2O6CA 2FIKA 4B97A 5AD0A 4P5TB 3QG7L 2C9AA 2D73A 4A55A 1INQA 1SBBA 2IH3B 2P5WE 4OB5H 5EWIH 4IMLA 4RGMC 2JJTC 3MLPA 3MODH 5GZNC 5E24E 1XZWA 2ZXQA 1F3DH 4NO0D 3BFQG 4M7KH 4QGYA 1JUFA 1ASOA 3HJ0A 4PSPA 1XO8A 1ITCA 3KGUA 4FZ8H 4KKRA 4JZJC 2X4NA 3H3PH 1X5MA 2P4AB 4PJBB 4UAOB 4ZS7L 3ELAT 1A7PH 1Q0YL 1T3FB 3DDFA 2HSIA 2NY7L 1T1XA 2XLLA 4Z3FA 3NIDE 1F3DJ 4C54A 2MMXA 5EO0B 4YHKL 3GS0A 3VXTB 2EDRA 4HWZA 3WTTA 1GW6A 1MI5A 4DZBB 2N7SA 4XBEH 3GXDA 5TDOB 4LL9A 1WS8A 5E6ID 2E7DA 3P0YL 3LZRA 3U2IA 3H9HA 3KBFA 2WXQA 3DXAA 4LBEA 1SJMA 3ILEA 3ZHDA 5DSCB 2X7LB 2JVUA 4M1GL 5GS3A 4A66A 8PAZA 2FLMA 3SPVA 1NGPL 4Y19E 5IROA 5AYQA 2WBXA 3CHSA 1N8ZA 4MCZB 1WFTA 1EHNA 1XIWB 4LRNL 4IOIB 2N0KA 2ZYIA 5B39G 3PP4L 1CF8L 3FZUD 5ACZB 3ZUNC 1RZQA 4YO0B 5C2UB 2J25A 5EU6E 2FR4A 1VADB 2EEAA 4N2DA 4NQXA 5LCVL 5D70L 3O41B 2K70A 1QR4A 5IVXE 2XV0A 1OW0A 3MBXH 4TTDC 4Y2DC 1JMZA 4GW5A 5T1KA 1AJ7H 4TOYH 2I32A 1A3LH 3K1DA 1KLFB 2FWLB 3O2DL 4Y8AA 5JPNC 3SDYH 1ILSA 3BKCL 1ZLSH 2VISB 2Z7WA 2CJSA 4ISVB 1MRDH 4P9MH 1SYSA 4OD3L 2X4UA 3QZWB 4NIKB 4U49A 1QBMH 1GGYA 4Y9EA 1I4FA 4MA8L 1XF2B 4PY7B 4WTXA 2QDWA 1J5DA 4MB3A 7TAAA 1BD2D 5DDHA 1N7ML 3NABL 4UQCA 2EE9A 5TK2A 2KLTA 2QTEA 2UZIL 1AE6L 3DX4A 3JWNH 3WO4C 5GIRB 1EO7A 2DJUA 1OGPA 4Z7UB 3U7WL 3AXIA 2H9GB 4HUNB 4NQTA 4XOCA 2GUYA 3KCWA 1INEH 4K5MA 2XFXB 1ASPA 5INDA 3UABA 4JJOA 4Q0XH 1RURL 2GUOA 2XJKA 1W2KT 4DZ8A 1KLUA 4FQQA 1FZKA 5A40E 5EZPA 2PR4L 5B39A 3FQRB 1RJLB 4PJEA 1G9HA 1XGZA 3BDBA 4U6HB 2Y07L 4XWOC 3GIZL 1A7NH 1ZVNA 3LQZB 1Y18A 4NQCB 2CZNA 4X0NA 2IGFL 3VSQA 2ICWA 3OF6A 4IU2A 4XH2B 5IEKB 3GTTA 4HCFA 2Z1PA 1FH5L 3LQAC 1DDTA 2G9HB 5FKPA 4JFED 1AQ8A 1I9JH 4XMPH 4AM0A 5HYQA 1MCSA 2DI8A 2WTRA 2QPSA 1O6SA 2XKNB 4NJ9L 3ZSTA 1IKNC 5BOPA 3D08A 3LNFA 2PO6B 3ULUD 3Q6FA 3C09C 2EDNA 5L4IA 1OT4A 2I85A 1OP3K 1HZHL 4IGBD 4XP1L 5TTRA 1F6LL 2IIJA 4JG9A 1PDKA 4XI5D 2Q7YB 2X38A 3PV6A 1P7QD 2X4SA 4AIZB 1NBVH 1NPNA 2GIYA 3X3FH 5BQ7B 3C6SA 1QSFB 5J1AB 5C0BA 3RWFB 3O8XA 3V4PL 1CCZA 3VXNA 4PS3A 2W07B 1NDGA 5FB8B 5JPMC 4XNUL 3MTRA 3F04A 2J8UF 2ZG1A 2D9QB 3HZVB 5J6HB 1IAII 1PNCA 3CPLB 3ENEA 3ZKMC 1NEPA 3R8BB 1R5VB 3FZUC 4FADA 4YX2H 3UBHA 3VYNA 5E9NA 4KQ4L 3RI5F 4BRJA 1Q9WB 3ARQA 3SSGA 3A67L 4GEJA 3HZMB 3C8KB 5JMOC 5LNGA 3D0LB 3FS9A 4DKDC 1IFHL 1NKOA 4CA4A 2EDEA 3HC0A 5BO1H 3CVCA 3ALXA 5DZAA 1R5WA 1EHLL 4XNXH 3BSGA 3CFNA 4IMKC 4GKOA 3K8KA 4CN6A 1RERA 3QZLA 3L9RB 3UYRL 4HG4J 3TEWA 4L5FL 3FU5A 1RUML 3GZKA 3OVUB 4IRJD 1N18A 2RH0A 4L4JA 4LESA 1FVCB 3QWRA 4M3HA 5FS5A 5IK3A 1U3ZA 2G9KA 2XZCH 3PNWB 4I2XB 1YJDC 5FGCE 3QXAA 1M05B 4WKZA 2WXHA 2H8PA 1CK0H 3UTPE 4L3FA 4HS6B 3S3SA 4AZ8A 4W9ZA 4TM9A 2XV6B 3MBED 5I1GL 4L5FE 1USZA 2F19L 1E28B 4P4KD 1T5WA 3L3KA 3IDYB 3MJGX 1TMQA 3KYKL 1AD0A 5C0CB 2WJ5A 3E1F1 1NAML 4R97C 2FJUB 4X6EA 4GAJL 2DPKA 4I0PA 5TH2A 3WHXA 3DURA 5AW7B 1BQLL 1S3KL 4TS6A 1MWOA 3PGCB 3I84A 5DRWB 4KVNL 3O6MH 5CN3A 3W0WE 1M7DA 4JNXA 1PZ2A 1I3UA 3BWUC 4X6CA 1MWAB 5ALBL 3VFOA 5AAWC 4K7PH 3EO1A 3VFMA 3BGAA 1DE4B 4JMNA 3MFGB 4G9FA 2YEZA 3AWFA 1NDTA 2X10A 3SCMB 5ECGA 5HYEA 3UBXB 2Y22A 1DVUA 3ERXA 4K8RC 1DFBL 4PIRF 2FEEI 5DQ9A 1J88A 1UWEH 2VXSH 3ZDYF 4NDMA 4TNVK 1NC4B 2Y06H 5DURB 2XICA 4XWGL 3RZCA 1G1CA 1SHWA 1TT6A 3B2XA 3O0RL 4P4RA 4PLOB 3OXRB 3ZE0B 2JKRM 4DW2L 5FFOA 2LVEA 5C2BL 3T3PB 2NY6D 4JFHD 4RDBA 3I6LD 2VXQH 2R0WH 1H6FA 4ZMZA 3OGCA 4JRLA 4F33B 1N3NB 2DWTA 3FTVA 4PR5B 4TVPL 2YD8A 1DJHA 3BPNB 4NO3B 3EJTA 4YPJA 1B4RA 2Z34A 3EKCA 3MLRH 1U8JB 2WQVA 5ANHA 4ZODA 3TEXA 4PG2C 1EJ8A 3VFUB 2DQEH 1RSYA 1KIQA 3FFDB 2CGRL 4GUQA 1AR2A 5ISZA 3FH7A 1PZBA 3FCSA 3QW9A 5TDPA 1MJJB 3AT0A 1BMGA 5FYKD 4UTAL 1FAIH 3GT6A 2ZQKA 4NQDA 4KKLD 3KWWB 1RIVL 2R7EA 4NAQA 1JE6A 4Z23A 2HWZL 2GCYA 4KZEH 1NUNB 5LBSA 3ES6B 5EV7A 1KIPB 3S37L 2G3XA 5CKGA 4EUPH 4MXVE 3GJFH 5TE4H 4M7JL 1RK7A 3MO1A 1W0VB 3QS2A 4S0TD 3UTSE 2D3NA 3GHBH 3FPYA 2EDQA 4U1MB 5A16A 5L2KA 3WNNA 3MPCA 4GH7B 1F3RB 2YXMA 2NY3B 5E9DA 1MNUH 1FJ1B 2ZX6A 4C56B 2PCPB 3BC9A 3RUGF 4PJIF 2H45A 4NSKB 1T1WA 2FX8H 3TV3L 4P06A 5E2VL 1MCIA 4KUZL 4EF3A 2RIKA 3O11B 4GQPH 4TUOB 2O1AA 3ZE2B 4L9LA 4PRNB 4LEOB 2LVCA 2VLJE 5A2IH 5KVEL 3FFCD 1E42A 1J1XL 4XN1A 4PUBL 4N24A 4WJ5B 1KCLA 1QLRA 3QUMA 4KY1H 4OLXL 3B7TA 4KY2A 4OF8A 3S48A 5ILTL 4IS6B 3EJQA 1QQDB 3IAGC 1QA9B 3MOAL 5CP3H 2OYPA 5L2JB 4PRIA 4P23D 3MRRA 3FU8A 3SKNB 3VGAC 3H9YA 4FNUA 3EH1A 3GSQA 1DBAL 2Y23A 3O9WD 5KVEE 2UX6A 2FWUA 1C16A 3ZTNL 4HPYL 3ZVVA 3D33A 5JQIB 5D9SB 4HIJB 3S8FB 3L1GA 2R4SL 5EZIL 4B7IA 1MW3A 3D48R 3GB7A 2WO2B 4AJWA 1R3KB 2X2UA 1CGVA 1DLFL 3IJ7A 1R24B 4GSXA 5ANME 1FFOA 4LB8A 2DW5A 3V9CA 4MVBD 4A2MA 4HD9A 4JHWH 5C0GA 2E56A 3JUZA 5IY5B 3KJ4C 1N4XL 5ALCH 3CXHJ 2MCPH 3V8OA 3L95A 3AVEA 2NT0A 4KV5F 4WUUE 5I71B 1GZHC 1A7RL 1QTPA 3O6LL 3NCBB 3PDDA 3QDJB 3HPJB 5I1EH 3MRMA 3LTVA 5DC4B 5E0QA 3FYIB 4OCWH 4QKXB 3DX9B 2V3FA 1OGAA 1UD8A 3CC5A 4AE1A 4V1DB 1IAKA 4Q52A 3ZDXE 5IHBA 1NGZB 2AP2A 4AL8H 5F89A 4I3RL 1WWBX 3IRCA 1G7PA 4OIIH 3IGUA 4MZ3A 4AGOA 3WEXB 1L7TH 1Y1UA 3STZA 2K7PA 1G9NC 3QR2A 4OFVA 3SGEI 2J1XA 3QJSB 1CD1A 1JP5A 1VFUA 2QHRL 3ARED 4KQ3H 5C3TA 3RDTA 5KSUB 4IJ3C 4URTB 5L6YL 2FAUA 4XNBA 1B4LA 1TQWA 3TIDB 4LARH 4LSPH 3HCVB 2X89A 4JR9H 3MV8D 1NKRA 3BVNB 5GSVA 3Q8CA 1ORQB 4P5KB 4OCRH 5CCHE 4PCKA 2FLBT 3O2VH 2NY4B 2VN6A 2VXTH 1EZSA 3Q44A 3QQ4A 4NUPA 3KPLA 4M8RA 4KI5F 1F56A 1MCPH 4S1QH 2A1WL 3FB8A 4QHNB 4C59B 1MREH 2O5YH 5FCUH 2F2HA 1R3JB 2HZHA 5CHNB 5J6SA 3BYYA 5E8OA 5DQJB 1RZFH 5HVHC 3IAQA 5K9KA 1D5MB 3EFDL 1SVBA 1BIHA 1NAKH 1ZT1A 1OAQL 3BHBB 4FZEL 5C97A 4LSSH 3WJJC 1MJ8H 4KUCF 35C8H 2IPTH 4ADJA 4JM2F 3NACL 1B90A 4LEXH 5DD0H 5KSBB 1M9WA 4NUGH 5BZZA 4ABVA 4L8CA 3S96B 3HE6B 2OSWA 5I75C 3PF2A 4MNHB 5CGBA 3PGDA 3VACA 1LE9A 2BCKA 3UGXA 3MFFA 5H35B 1H0DA 2Y1VA 1JGLH 5DU7A 5CBAA 3DGGA 4PH8A 5D4HA 5F7MC 5ADOH 2H4EA 3OLIA 5FHAL 4ZXBB 1T0MB 3SDXF 2HVBA 4KU1A 1YEIL 3O9WC 2XWEA 4FLSA 4IBZA 4HOWA 43C9A 3IDMA 1LP9F 2JB5H 4KJPD 4TLSA 3LS5L 3VXME 2FJHB 4JPVL 4I3GA 1DUZA 4EBQL 1V3KA 4HGKC 4UUJA 4I3SH 4UQ2B 4YHLL 4M62H 2DIAA 3W39A 3J07A 5FM5M 1TQBC 4LLWB 5HBBA 1Z9NA 1UEYA 2WZ0A 4JLRA 4JQIH 1JV5B 3W11C 3BH9A 4LDOB 2OP4H 3MNVB 2XPGB 3F58L 3CSGA 4XPFL 1WO2A 1HX0A 4WFED 1CVSC 4QRPB 2WAHA 4XB7A 4JO1H 3IFNL 2A83B 4B5ZA 1UM6L 1S78C 1U8OA 2YA1A 3VFRB 2ZOKB 1AFVH 3P1VA 4DESA 3P4NB 4DGUA 2WWOA 2J1KA 2IMMA 3I6KA 4DIXA 3CXFA 4JN2A 5MI0B 2PCFB 2Q86A 5F0LB 4F1SA 2OL3B 5HDWA 4OFQA 4PJ6A 1JXFA 1PCXA 1KENH 4Z0XB 2FGWH 4GUPB 3DX6A 2N1KA 1ZXQA 2OQJA 1FNHA 5CGYC 4FD0A 3UC2A 4BH7B 3CZSA 1FPTL 1M4KA 5CO1A 4B5EA 3MJ7A 1KPRA 1FZJB 2DAVA 3NJMA 1TZIA 1KIRA 2APVA 2ZWLT 2Y7LA 5IB4B 2UVEA 3D3VD 1CF1A 4DPCX 4ERSH 5D72H 1NMBL 5D7IB 1J10A 4PY8I 4F2EA 3MA7A 5EU7E 2ZKYA 2CE6A 1AQKL 2VR9A 2VDOL 1E90A 3NZUA 5DFWH 5EF3A 1I53A 1ZMYA 2BZCA 5FYKU 3U2JA 4YGAB 2J55A 4HOMA 4MNQD 2GPZA 4PSRA 4BFIA 4WF7A 4LCWD 1JZGA 5CSBA 4X5LA 1WWCA 1A1MA 3TVMD 3CLFH 5E6IA 2OI9C 3T0DA 2ZCLL 4MS6A 1PJWA 4F7CB 4CN1A 1IC0A 1PIGA 2XWTA 3WY3A 4POZD 2XOTA 3ZXAC 5DJYA 3MRJA 4KHXL 2JI1A 4KRPB 4J1UB 1N6QL 1IT9L 4X9BA 4F9LA 5E08H 5JW5A 3WCYA 1G7QB 4PIBA 1KYDA 2WLZA 3GSNB 1ZLVK 1S9YA 1JI1A 2B15A 2G2RA 2BP3A 3N42B 2X9XA 1HSAB 1KGCE 4HUKB 5C0IB 1FGVL 2WNGA 3DBSA 5EIQA 1IB5A 4OJFH 3A4AA 1CDGA 4PI2A 3WJLA 1E4HA 3VW3L 2CHZA 3PDOA 5G4OA 1WAAF 2CWRA 2RACA 4N8CL 5AOJA 2MCG1 1E67A 2VDLH 3W38A 4JRYE 2SODB 2NDGA 4POUB 4CC0A 4PV1C 3UAEA 4XCYB 2FJFB 4D0BA 1YUKB 1ZK9A 4JZNB 2EVGA 1L3NA 4YDVA 2P7TA 4LLQA 2XZQH 3RG1C 1II4E 1XT5A 4OM0H 4UDUB 3T0EC 2YOAA 4X99A 5L4MA 5TK4A 4OCSH 1ED3A 2EE2A 4GXVL 4LKXA 3FTYA 4HF5H 3UH8A 4YNYA 2E0PA 2VTFA 3L45A 1VACA 2CRIA 4NRZA 2G3MA 2CUMA 2JXMA 2OSYA 2DLTA 4PBXA 4QTFA 5T3ZH 3GSVA 3TBVA 3ZUCA 1TYEB 3NCXA 2AI0H 5LQBH 4G7YH 4ODXA 3MRLB 2O93L 1T5KA 4ZUWA 4WZ9A 3TWCL 4HXAL 2F0CA 4JKNA 1VHPA 4OJCA 5LAXA 4UB0L 3NIGF 1AR1B 4NXKA 1CPUA 3U4BH 1H6EA 4ODTH 3TT1H 4Z18A 3N9GH 3U4KA 2BW4A 2K9UA 1ZHBA 1DVFD 2OTPA 1NCUA 1K4DB 4GAYB 4JFOA 1RL1A 2QQLL 2WXIA 3HHMA 2C1OA 1RU9L 3ZT6A 2R2HB 3ZDWA 2FWSA 3FRUB 2BY0A 2YSTA 2XZZA 3H2PA 5C08B 5FO2A 3L5XH 4K07A 3H85A 1KTBA 4HEMA 2CJUH 2O26U 3GK8H 1WZKA 2J6EH 1S5HB 2YUWA 4JFEA 3WN5A 1BGXH 1T5XB 1DBKH 3MLVH 4Y4KC 5MENB 1IEAA 4MMZB 3U1SH 2MPAH 5F1OB 1DP0A 5HHMD 3O6FC 3GBLA 4P5SA 4LNRA 3FQNB 4YC2B 3UYPA 1YDPB 2C3VA 4I18C 3U6RB 4LOVA 5CR1A 2WNWA 1G6RB 5HHOD 3O6KL 2X4RA 4I7ZC 4R7NB 2BOCB 4AGLA 5JLZA 5J11B 2GQHA 3V79C 1THCA 1V8HA 3QJOA 4IGBA 4PWKA 5C0EA 4IBLT 1L6PA 2FD6L 4A7UA 1ZS8B 2VXVH 4PJ8B 2VWEC 3PHQB 4R2GC 4HIIA 1NGWB 3ASOB 1TR7A 3NIFB 1CFVH 1PKQA 3GKZA 4FQHA 3HG1E 1FV1A 2WXRA 5K9OA 4P99A 1XZ0B 2ZUYA 2AZUA 5DO8A 1MCWM 5AKRA 2YPLA 1DANU 4XAKE 3C5SB 2R1WB 3L3HB 3BW9B 3GSXA 4HUWA 4OCYH 4F5CE 4PW4A 2Y36L 3E6FB 2W80C 3MRPA 1OTSD 1ZT4B 4EDWH 4FQCL 2YWYA 2CM5A 3V4UL 4ELME 3AG1B 3MV01 2BHFA 1AZNA 3QA3B 1IM9A 1ML0A 1FYTD 4Y88A 5BXFB 1AP2B 2AVGA 3QIBA 4LLUB 4MWFB 2WWKT 5DYOA 4Q6IC 1NH6A 3NCMA 3H9SE 4GG6F 3TBTA 3HAEB 1FBIL 4P2QB 1R5IB 3GO1L 4UI2A 1JPFA 1JZDC 3E2HB 3TJPA 5BZWA 5FOBA 2XIIA 3VM7A 2ZXAA 3E6HA 3WFDH 4I4WB 2V5RA 4LCCA 4IRJA 4PRHD 5K1NA 4QRRD 2GSMB 3HC2A 3QSKB 2W9LA 2RR3A 2R69A 3P3SA 4NKMA 3G3LA 1E5UI 3WLWD 1ZVSA 4UZUA 4ZW3A 1OP5K 3MCYA 1FA4A 2C1PB 3V55A 3FSWA 4C57C 4WKXA 1KJVB 3QEUA 4YDJA 3RVUC 1J8HD 4R5VA 3MBEA 3WKML 2CO2A 1Y0LA 1VKXA 2TSAA 3V52L 1FGNL 2D7NA 1Z3GH 4YH6A 1N19A 2DQDH 1MCLA 4P4KA 4QOKE 4JZOB 4F93B 3WLBB 5D96B 4QNPF 3BSHA 2BNQA 2QELA 3KH3A 4YPGB 3V10A 3VXSB 5FDWA 2X2IA 4M8UA 5IB5B 4U4BA 4UTBA 3QDAA 1H3PL 2E86A 3AQDA 2A99A 3LKRB 5DQDL 1FIEA 5BRZD 2FIKB 1LYQA 5AD0B 1V3MA 3W81A 4XOEA 5IQ7H 1INQB 2H32B 4L8DA 4LPTA 3BPOB 4IMLB 2EDKA 3QNFA 3U0WL 5DWUH 3ZMEA 4FQ1L 2R29H 3RBSA 4XMUA 4CN4A 3NJVA 1D7DA 1B0WA 1JUFB 2X4OA 3CLEH 3FONA 4D94A 2VL4A 1UWXK 4YE0A 4R0LC 4HWEL 2ED6A 3WIAA 5JHLA 2J2ZA 2X4NB 2KT6A 2XY2A 1C7SA 3P40A 4OI9A 4KJWD 1N2RA 2CHDA 1U95A 4Y19D 5B1JC 4XXDA 1CE1H 5I1KL 4AEEA 2PTUA 1MI5B 1E4KA 2FO8A 5AOKA 1JNNL 1J12A 2ODHA 3H9HB 2IWKA 3MREA 5FUOH 4JG0H 3CMOL 3DXAB 4LBEB 4DVBA 4YDKL 3MRIA 2JCWA 3SPVB 1YQVL 5E6RB 1HAWA 4PLKC 3QS3A 1N8OE 3QXUA 5BW7C 1UXLA 1N8ZB 1EDHA 5AG8A 1FI8C 4JHAH 3H9SA 1XMEB 4KK5D 4GSUA 5JHBA 3UYOD 4Z7IA 2BRQA 5BOZG 5DS8B 5EWIL 4KDTC 4G80A 4ZMWA 4D8OA 3HNSH 1UACH 4C8XA 3KLQA 5C07E 1XGQB 2ATAA 2QZQA 3ML9A 4GIPD 5E56A 1IBYA 4GW5B 5T1KB 1OW0C 2G3NA 2WUBH 4ZZFA 1F41A 4U0RC 4FC3E 4YXLH 3G6JE 3ZO9A 4OFKA 2NY5H 3LCYA 3MGTA 1SYSB 1I3GH 2X4UB 3KBPA 1TOXA 3L7EA 1B6DA 4TNGA 4HIXL 1KJ2H 2ZXEB 1I4FB 1C5CL 4ODUA 1MFAH 4N5UA 4TSAH 3PE9A 5DDHB 4NN6C 2X87A 2VLME 4KTYA 3TEZA 3N06B 4XCCL 5FYJE 3V6OE 3QNXA 2DMGA 3MBWA 4X4YA 2DYSB 2VR6A 4LLDA 1OOAA 3AY2A 3QFJE 1ZOXA 4MZ2A 4Z7WF 4IOSA 1SOQA 2WO4A 4YLQT 3LPPA 4W6WB 1I1CA 1XF3A 4V33A 4MNGA 2WP3O 5INDB 3L4XA 2G5UA 1AIFA 2JH2A 3D9AH 1KV3A 1VA9A 1ZVHA 4D8PA 2GUOB 3IDIA 3OXSA 1IIKA 1KLUB 3FFCA 4DZ8B 3B7RL 1FZKB 3B9EA 4FQQB 2VIRA 4MMXA 1N0XH 4GP8B 5B39B 4PJEB 1K8IA 3KPPA 3MUUA 1TSHA 4R8WH 4TSCH 3A4DA 1QUPA 1Y18B 4EZLA 4Q9RH 2X40A 3AWGA 3EFFB 3OX8A 3SDYL 1ZLSL 3P69A 3Q2NA 2ICWB 4IU2B 3BQUD 4P23A 1MRDL 1P2CA 4E9LA 5T1LB 1CFNA 3ETBF 5FKPB 4GRWB 1F3JA 3QWOA 4AM0B 2CCWA 3MRBA 3WV0A 1YMMD 1N5YH 4UV4L 4AT6A 4LSUH 3V4VH 5D2LA 3DO3A 3Q6FB 5HJDA 3GBMH 3N5AA 4PYHA 1ZSDA 3LH8A 4YHPA 4KGJA 1G0YR 2BSED 3QT2A 4JFFA 4L4VE 5D1ZI 3ETTA 4ZFQA 1PDKB 4KX8A 1P5VA 3PV6B 4CVZB 2X4SB 3II1A 5CFAA 5HD8D 3GLAA 3A22A 4LPXA 3C6SB 5C0BB 2WWNA 3O8XB 3VXNB 1INEL 4WSGA 1NDGB 4HBQA 1F97A 4AQ1B 2JELH 4Q0XL 3CH8A 3LD8C 1JXJA 2EILB 2XCMC 4J3OC 1LO2L 2EDDA 4PJAF 4P3CL 3WS6A 1MG2C 1OTUC 3ZKSD 1A7NL 2BSTA 3KL0A 4KK5C 5F0JB 5BV7B 1AZBA 4X7DC 4XN7A 1MFCH 2B5IC 4PRBA 4MD0A 3AREA 1I9JL 3GMOA 4XMPL 3BKYL 3HC0B 3NEXA 4FI7A 1QI4A 1OM3L 1R5WB 1MCJA 1KCVH 3AMLA 1OP3H 2IQ9H 3TN0D 1ROWA 1PG7W 2VQ1A 3CFKA 1NGXA 3MV8A 1SY6A 3ARYA 4ZSOE 2ZONA 3W82A 4G6MH 3DV6A 3HPLA 2J1WA 1X9QA 5IK3B 4FTVE 1L5GA 2BY1A 1L6ZA 4OCLC 1NBVL 3QXAB 1SDDA 4WKZB 3X3FL 3UPCA 4ELKA 2H8PB 1D9KA 3ZZSA 1OCCB 3MYZA 4LU5H 4LLYA 3VGBA 5CU9A 5TDNA 3V6ZA 3S6CA 2DM2A 5TE7L 4BZYA 5CGMA 1BG1A 5AB0A 2R4RH 4GNKB 1T5WB 3U79A 3GUFA 3L3KB 5LKNA 3X1GA 4K3JL 4YDLB 4HHWA 1AD0B 4YX2L 1NTDA 3N6YA 3SE4C 2AABH 4ZMOA 1HWHB 1PX3A 1CC3A 1A22B 1YC8A 4HXBL 5TH2B 4I0PB 3WHXB 3DO7A 3CE1A 4FMVA 4MLIA 3CZGA 3ZHLA 2N1TE 2R51A 5BO1L 3W57A 2H6UA 2XPZA 4UMSA 1M7DB 5TFSL 1RIHL 4FKHA 1R46A 4JB9H 4X6CB 3VFOB 2ZOUA 1KCWA 3TCLB 2XPYA 3EO1B 3KPOA 3VFMB 1SQMA 5F7YC 3BQUC 3VFNA 4G9FB 4AWJC 1SN5A 2VJ8A 2YEZB 2CDEA 5TPWL 4BFJA 4U4IA 1K72A 2FZ3A 5IBLD 1MCCA 2XZCL 3B9VA 1DO5A 5AB9A 5DQ9B 3WEOA 5J7CC 1R33A 4M4RA 4NDMB 4X6BB 2VZUA 2C9PA 1DJIA 2IPUK 2W0FA 3QR0A 4GY4A 1I85C 1XF4A 1E3FA 3AXLA 1KT2A 4HUMB 3RZCB 4NN7B 4K9EH 4P4RB 5FM5O 5SWZE 2DF3A 3ECBA 1GS6X 5EBGA 3N1GC 4PJ7A 4U6TA 4XXWC 2XRAH 5JOEA 3LNIA 1BX2B 2NMSA 4TVPD 3OGCB 2ZX5A 3CZEA 2V0AA 3RIAF 2NX5B 1EVUA 3LIZH 5F3BA 4FEIA 5EZJB 5H94A 5CZXC 2CDFA 3FMGL 4ODHL 3X2QB 4MYWB 1H5BA 1XDTT 3QUYC 4PJGE 1KIQB 5C92A 3TJHC 1KCRH 3MRHA 5ISZB 2UWEA 4TPRL 3RPKA 5DVLA 3FCSB 4U1HA 5TDPB 4OZFH 2CPCA 1X5AA 2F5AH 2WZ5A 4QHLA 4W4NA 4NQDB 2DOCA 4PJBF 5IKCA 2R7EB 4UIKH 3ORJA 4BEIA 2GCYB 1BWWA 2G30A 2XVGA 1RPUA 4KK6C 1OCRB 3GXMA 5DLMH 3P3UA 4Y4HD 3U7YL 4KROD 1UWEL 4N2AA 4IQHA 3CHOA 1W72L 1MJUL 4ANXA 3MO1B 2COQA 3GSWA 1KC5H 3FTSA 4JPSA 4UOJA 5T5NG 1J5OL 1FE8H 5A16B 5L2KB 1UT9A 3NQIA 3VWKD 4J4PD 2NUPB 3FT9A 1OCWL 5E9DB 3RB5A 3X14A 3LY6A 1B4JL 2GAZA 4LVEA 4P2RD 3BVWA 1XL6A 5E23A 3UG4A 1F58L 4DERA 6PAZA 1T1WB 4L8SA 2R0WL 3FN0L 4JQVA 1UXWA 3U4EA 4LLVA 4MNQA 5D7JD 2PCYA 1WA1X 3D5OF 1YPZE 3H42H 3AU1B 3QNYA 2F54D 1ESOA 2ZUWA 4LCWA 8FABB 2R8SL 4ZTPH 1M2VA 3TVMA 2DQEL 4EZMA 3RWDA 1E3ZA 1BZQK 3VD1A 4LCIL 2FVNA 4Y2NA 1ZAGA 4AV4A 2XVKA 3T3MF 3OHXA 2Q3XA 2O6PA 3DI3B 1AZCA 5J13B 1FAIL 1QLRB 1XH0A 3QUMB 5I0DA 1MLCA 1UATA 5A1AA 2GEEA 3AB0B 2KLRA 2CPUA 3IXAA 2ESVE 2NPLX 4PRIB 5CZVH 2W59A 3MRRB 2XVBA 3GSQB 5TE4L 5DCCA 1DVSA 1C16B 3GHBL 2Q5BA 4RMBA 2QLYA 3NRPA 1M6OA 2EIEA 2VSDA 5JQ6H 1HK6A 2EXSA 3GB7B 3T65A 4KJQD 4MA3A 2D3LA 4YS4A 2JKTM 2FSEA 1CU4H 4HK0A 2WO3B 4DP4X 2YLKA 4IOFD 2FX8L 1FFOB 2EE3A 4LSVL 3CVIH 1XWVA 3EGSA 2WBWB 1TJXA 3CJJA 3SODB 5E00A 1LMKA 2XIDA 1MCWW 3AXHA 4X6DA 4PCSA 5E03A 2XUWA 3L95B 1G7HA 2F15A 2Z8RA 3VQLA 3V4LA 3WS3A 2BINA 2OR8A 4X4KA 1BEXA 1IAIM 5LGYA 2JKNA 32C2A 3WY1A 4HJEA 4BFRA 2ZOLA 2APBA 1OGAB 3CC5B 1RZGA 5DC9B 4GBXD 1QW8A 1IAKB 1QFPA 5F9WB 1JG9A 3K80A 5EC2A 4MAYC 2YRPA 1CQYA 3QXWA 4GW1A 5L88H 9PCYA 5F89B 3ETBJ 1T83C 3FHQA 1G7PB 4IYKA 2XSKA 3PPEA 3GLDA 3QRGH 5E51A 4XCFH 3STZB 5CZRA 4GS7C 1CD1B 1WD9A 3N3EA 3RDTB 3QUKA 4X8GA 1DVFA 1ZJAA 4A6YA 4FL4B 4QIRA 5FYLH 1BAFL 3ARVA 4HPOH 4F7MA 1WAPA 3ZLQC 4DEWA 4Y4HC 3OKYA 3VXRA 3FQ4A 5GSVB 4ZD3H 5D1ZC 3IPBA 1OSYA 4JHWL 2VDPB 2ZE0A 3RHWF 3KYAA 3RX7A 3KPLB 4KKCD 3VWKC 3Q2VA 4JAMA 4OCNC 3PAYA 1N26A 4R7LA 2MCPL 3QVAA 2NY0D 4I0KA 4JM0A 3QEQE 4YUEH 2YMXL 3KS0H 1NICA 3LEVH 3OR6A 4HZ1A 3ATAA 3FB8B 5CD5D 5I1EL 5KVDH 2Y2TA 2YBRA 4Z77A 1F45A 2WZPD 4OCWL 5D7JC 5E8OB 3FCBA 5HHOA 1UWGH 4FA7B 5K9KB 5BUPA 3GMLA 3QJHB 1GA2A 1SQ2N 2ESVA 1HXKA 2JNZA 2G60L 4QHMA 3KS0J 1JYXA 3KLHD 1AS8A 1ZT1B 4MZRA 4Z3HA 1JWSA 2MTPA 4AL8L 3CAFA 4OIIL 3UPAA 4AG4H 4A1RA 1L7TL 5FCSH 4U3HA 3EJZC 2DV6A 1LO4H 3THMH 4LNVA 4YSRA 3BUQA 5AG9A 4KQ3L 4L8CB 2C3XA 4H1LG 1G1KA 3D2TA 4DETA 1WZLA 1LE9B 4KX9A 1HH9A 3MFFB 5D8JH 5IQLA 1S8DA 1H0DB 4XODA 1KEGH 4LARL 2VW4A 5CBAB 3DGGB 5F72S 4JR9L 4HALA 3HC3L 1NSNH 3Q8BA 4OCRL 1P7BA 1JHLH 1FYTA 5HDRA 2DLHA 43C9B 3IDMB 3L3OA 5EO9A 5EEUA 1DUZB 2W91A 2J12B 4XP6H 5I0ZA 4UUJB 1MCPL 5DFAA 4KJQC 5AW3B 4KK9D 3W39B 4OFDA 1VLXA 1MREL 2O5YL 3DHJA 4U6XA 3P54A 5FCUL 2H47C 2J8UE 4JLRB 3DX0A 1DJZA 1RZFL 4LPYA 3VD4A 3P11H 1YO4A 5PAZA 3BH9B 4PRHA 4M4PA 4QRRA 3P3RA 4O02H 5M7QA 4CDGC 3US0A 4JRFA 3SE3A 4PJ5E 3DC0A 1HYSD 4LSSL 3L9BA 1KBWA 2O61A 3Q5YA 4N3UA 1MJ8L 3WE1A 1U8OB 35C8L 4IDJH 1AS7A 2IPTL 3QUZC 1RZKH 2EDOA 3W9EA 3BWZA 3GI8H 3L1EA 1UB5A 1X5XA 3I6KB 4FYTA 4ZMVA 4JN2B 1BW8A 3OPUA 2VERN 2Q86B 4LSTL 4R3SA 3PHOA 1JGLL 4MCMA 1BOYA 3DX6B 4XXCA 5ADOL 4EDXA 1N12A 4H8WH 2OQJB 2PYFA 3QR1A 4H1LA 1UHVA 5BRZA 4B9ZA 4L9DA 1KPRB 4MA1B 1TZIB 1KIRB 4Y4FD 1BEYH 1WC7A 4M62L 3OZKA 4OGAD 1YEGH 1ZXKA 5AW6B 1S2EA 2XWDA 3PWPD 5CINL 3LXAA 4XZ4A 3KCPA 3ZE0F 4E9YA 1DDHA 4ZMLA 3T3PF 4ZMTA 3MA7B 3HKZA 4JQIL 2YKLH 3OSKA 1CT8B 2GJJA 2OP4L 3LZFL 4A2EA 2DWSA 3GXPA 5IVNA 1Q0EA 1IGML 3C09B 3IMRA 4FJYA 2Z31D 5HVGB 4QLWA 1YAZA 4BFIB 1OALA 4JO1L 2QSVA 3ZYZA 5E8DL 2QVIA 1A1MB 3AGWA 3Q1EA 5E6IB 4GLRH 3B5TA 3ZQXA 1FDLH 5BZDA 3R18A 2D31A 4NLAA 1I1YA 4Y2LA 1EV2E 3F6LA 2AHIA 3OJVC 2XWTB 1NBYA 1HL5A 1UT2A 1ZANH 5JPMB 3HLAB 3QUXC 5DJYB 3MRJB 5JIHA 3T2NH 1KENL 3NVQA 2FGWL 1S5IH 1J05A 5JW5B 3R0NA 2ZUTA 2DI7A 4HW6A 4M61A 4YXKL 1DBJH 4JRYD 4N0UA 5GRZA 3ZDYE 1S9YB 2BS9A 2KDGA 1ZA6A 2NXZD 1OE3A 3QB7C 3BSZH 3MV7D 5LCVA 1SEQH 3RA7H 3F8UB 1QBLH 1RUPL 1AHMA 3NG5A 2YN5A 3KWXA 3NSYA 1OZUA 2ZF9A 5D72L 3T6WA 1CI3M 1JPST 3U25A 1ACCA 1PSKL 3O2DA 2ZKMX 1XSOA 2DQJL 3MRQA 4NXSA 1TQCC 1WZ1L 2PPDA 2D7TH 5D1QD 2WW8A 3T4YA 5SX4H 4Z95H 5GRYA 3K3QA 4FNTA 1AKPA 4JO3L 3L4ZA 3GKWH 1H3VA 1AMYA 4YDVB 2P7TB 2YUXA 3CHPA 4LLQB 4F3FA 5DJ0A 3DDGA 1CWVA 4X99B 1CGUA 1BD2B 1CLVA 1ED3B 2YO3A 2CBMA 1KDIA 4LKXB 2FB4H 1KGXA 3Q1SH 4YNYB 4JREC 3BUTA 4M6AA 1VACB 1ZLVH 4NRZB 5ACMA 2EXWD 5E08L 1MHPH 3R7QA 2JXMB 3FU6A 3TBVB 3GSVB 4Z7NB 3JV4A 4D9LL 2G5RA 4ODXB 1WIPA 4ZUWB 1CLOH 3WE6A 4PJXE 3WI9A 2WXMA 5LAXB 2K4WA 5EU7C 5I1IH 4FNLH 1KCKA 3WNMA 4N2LA 1GPOH 1ZHBB 1AY1L 4XHJD 4JFOB 3RUGE 3V5DA 2C1OB 4ZFZA 4PJIE 5AZUA 3SO3B 4X8XA 1EGJH 2NY2D 1SOSA 4WWID 1NOLA 3ATFA 2QADB 2CUIA 5HPMA 2E7LC 4OGAC 3D12B 3N2JA 3MX0A 4JFEB 1Y6MR 2WB1A 5ESVA 3UBGA 3WN5B 4WO4D 3HG1D 1IEAB 1IC7H 1YMMA 2XZQL 1Q90A 2X41A 2Y6SC 4KOCA 5E2UL 4OM0L 3HHRB 4MXWH 3RL2A 3SGKA 4QXUH 4EKJA 4LNRB 4WFFE 3UYPB 4TKWA 4OCSL 2C3VB 2EDYA 4PS7A 3C5ZD 4FMFA 4G71B 2KZ1B 4ZZKA 3QWQB 4FF9A 4PWGA 4BZ2H 2X4RB 5JLZB 1KV7A 5BJTA 5I1CH 3WFEH 2BSEA 4M9PA 2H2SD 4IGBB 2AJ3A 5C0EB 1UD4A 5KBMA 3ARFD 4AGMA 5T3ZL 5LNEA 5LQBL 3NQKA 4G7YL 4FNRA 4WWKC 3HFML 4J3UA 2AJVH 4WI3A 2F58H 1PKQB 4JFUA 1KMGA 5CJ8A 1FV1B 5K9OB 1WBZA 3U4BL 4QCIA 3RWCA 3T71A 5JOPE 2YPLB 2BNUA 2VDMH 3N9GL 2YPVA 3X3GH 3GSXB 5JZ7D 4HUXA 3T2QA 3EYSH 4PB9L 1M3JA 5K5YA 3MRPB 3CDGA 2BWQA 3L4VA 4JDVA 2X9ZA 4RIRA 1LEKA 3BH8A 3Q8FA 2D7QA 5JQHC 3L5XL 2OZNA 1IM9B 3T8MA 2CJUL 1U8HA 2J6EL 3ARUA 3QIBC 1XFPA 3LN5A 3A0OA 4M9OA 4L2YA 1DBKL 5CGTA 4KV5E 4Z6AT 3TBTB 2K78A 5GRJH 2MPAL 3RQ3A 3U1SL 4Y9FA 1FSKC 4LRIC 3A5VA 2PMZA 4NC0B 3TN0A 1JPFB 2AVFA 5HYFA 3NZHL 4UQEA 5BZWB 5FOBB 3NCJL 3NRQA 1TTGA 1R47A 3RTQD 3UGUA 4IRJB 1W8NA 4I48A 5H2BA 4LCCC 4JRXD 4AV5A 1JERA 1NEZG 4NKMB 5I6XB 2WSPA 1UOLA 1ZVSB 2V4LA 2VXVL 2KZKA 1H9VA 5KG9A 1YJDH 5JNYA 1H3GA 5KSBF 3UEQA 3OZLA 1A4KA 3QEUB 4NWTH 1J18A 1DLHA 3LPWA 3MBEB 1VKXB 4EI6B 3BGMA 5F9AC 1KLGA 2EXWC 4P4KB 2BNQB 4OCYL 4OV5A 5F6IC 5FDWB 3ILQD 1JOIA 1RK1A 3AW5A 2VJ0A 4JFDD 4UBDC 4YGVA 3C75A 4MB5A 5BRQA 2UYLA 2VMFA 3GEFA 3DSFH 5SWSD 4KI5E 4L8DB 3T8XA 3FL7A 4MDRA 3VRIA 1Z5HA 2W92A 1GJIA 1RVFH 2X4OB 2QV2A 3FONB 2EVFA 2K6ZA 4B3EA 3EOTH 3GLZA 1E4XL 2ROYA 2RTTA 2J2ZB 1OP5H 4A39A 1GAFH 2E7CA 1ODUA 2RGSA 1GYWA 2V5YA 1N2RB 4JDZA 1U95B 4XXDB 3O4LE 3RWHA 3B34A 3JTSA 1CDUA 5C0FA 3NP4A 4K8RH 1JGDA 3VU2A 5GRVL 5DZ9A 2CKBL 3KE0A 5J06A 3U30B 3PNRB 5I8EA 5JYLA 4P04A 3UTTE 3C5ZC 1K9TA 2JLPA 1NEZA 2O6DA 4Y1AA 3ZKMD 3MREB 2HTLC 3LVTA 4GO6B 1Z3GL 4DVBB 2NY6B 4XE5B 4XN4A 3MRIB 3S3CB 5KYYA 4HJ1A 4LCVA 1IZKA 3HC4H 1W15A 1NL0H 2OJ1A 2VR5A 3BAYA 3HA0A 4HZLA 4L8BA 4ZW7A 5J56B 3QI9C 3GXFA 3SDXE 3T0AA 2DQUH 4AM0Q 4DGVH 3QORD 5E6YA 3EFOA 4G9DA 1OB0A 4FQLH 1VEMA 1UKSA 1LP9E 1NM9A 2P24A 1IL1A 1EUUA 1FL6B 3MLUL 2YD7A 4RSYA 4UQ9A 4G80B 2BK8A 5DWUL 4HMEA 1S9KC 1HTYA 1TPXB 2JKWA 1I9RH 3WKMH 3CLEL 2MQ0A 4TUKH 3EZ8A 3AROA 4KQ0A 5HI3D 3TA3D 4EPSA 1XTLA 2V2XA 2X1WL 2VLMD 3S5LG 5E0FA 2Z7UA 5T33H 3KPRD 1MHEA 4DN3L 2V2TA 4BUGA 5H4ZA 2DYRB 4ETQA 2C3GA 5LWYH 4MZIA 5HHXL 2XWBB 3L7EB 4AGPA 4Q9QH 2UX7A 3CZFA 5C0AE 4ODUB 3FQWA 1OVZA 4J4PA 4RISH 2IGLA 2B7DT 2DJ4A 2X6MA 3IBOA 5FUOL 3IS0X 3GPSA 1AO7A 4P2RA 2O6EA 4L3EE 3FQ1A 4LP8A 3QNXB 3S8GB 2ZUQC 3MBWB 4X4YB 4LLDB 2DY2A 2OW6A 1YYCA 3N44B 4AQ8C 2F54A 3N40P 4LK4A 4PWJA 3N42F 1XF3B 1OF2A 1BQRA 1VCAA 3GLEA 4MNGB 3COOA 1AIFB 5H37G 4D8PB 3IDIB 3FFCB 2YRBA 2WP3T 4PVMA 3SPHA 2VIRB 4MMXB 1MEXL 5CEXB 3APDA 1XVSA 2PW1A 1K8IB 1FFQA 3KPPB 4NAJA 2WUBL 3MOBH 2GBTA 2CBPA 2RALA 4CAGA 3OX8B 4JFZL 5GGTL 4B9JA 2YRLA 2WQAA 3HMXL 1D7CA 4P23B 4O5LH 2NY5L 4OTXL 5F44A 1GY1A 1P2CB 4K5NA 1I3GL 1CFNB 1UGKA 3S5LA 1P4UA 2AXJA 1F3JB 1KY6A 3QWOB 1KJ2L 2VH5L 2AK4E 3MRBB 4GI6A 1MFAL 2GTZA 2ENJA 4HJIA 3QCVH 4OLWL 4AT6B 2BSCA 3FN3A 4XGZA 5D2LB 1ICTA 1Z1WA 4BGLA 1CYWA 5GGRY 1ZSDB 4ORGA 4YHPB 1AGEA 1DJYA 2Y7NA 4NQEE 4JFFB 5EEXA 1IIIA 3FCUB 3KWUA 2BXYA 4DEPC 2Q8BH 4DQOH 1P5VB 5B21A 2OCCB 3QWNA 4CSZA 4W93A 1ACZA 4WLCA 5KBDA 2KZBA 2Q1EA 4C47A 3EXJA 1SXZA 2I60H 2IBGA 3KWVA 3NPSB 3WTYA 1KXVA 3QGVA 4IU3A 1VEPA 2XJLA 4XNYH 4I1NB 4UYQA 3MLSH 3QG6A 3WIHA 3JTBA 1TTBA 2K1MA 1KB5H 4KH9A 2MNWA 4Z78A 3QORC 6FABH 3BRGC 4X5QA 2IDQA 1JGEA 3OV6A 2BSTB 4GBXA 1NA8A 4TSCL 1U8QA 2VXUL 5H37A 4NCDA 3TIEA 4Q9RL 1H8OA 5SV4A 4UT7H 4Q4IA 3ZE1B 1S7VA 1A9EA 4FTVD 2J71A 2WGXA 3TZVA 2YMOA 4PRBB 4WHCA 3SYQA 4MD0B 4CBPA 1RZJL 4FNPA 3AREB 5HI3C 5FECA 1G9NH 3GMOB 3QC5X 3NEEA 1WICA 1YEEH 1E2ZA 3V6OC 3LKOA 5GRUH 1BZ9A 2NZ9C 1JL8A 1YN7A 1N5YL 3LNEA 3A3YB 3V4VL 2VQ1B 3CFKB 1H3UA 4NFBA 1NGXB 1A3RH 1BF2A 3MV8B 3JV5A 1TZAA 3T2PA 1U58A 1BHGA 4L3CA 1WWWX 2WQRA 3DV6B 3SYAA 1XGTA 1KNOA 1L5GB 2VLKD 3C6LD 4R4NC 1NUFA 2GBVA 2XY1A 3ECQA 3F7VA 5F88A 1SDDB 2PW2A 4LPCA 5CCKL 4FQIH 4LVHC 4ELKB 1N5AA 3PV7A 1D9KB 2HLEB 4RZKA 3RILA 4WW2A 3NIGE 4WV1C 3SDAC 5TDNB 3V6ZB 5HHVH 5FXCH 2JELL 5HVFB 2F68X 5HI4D 1X5HA 4P2OD 3KXFD 3OB8A 5T1MA 3GTNA 1GCFA 2P8LA 4TVSa 1CQKA 1J1OH 1ZPLA 2AK4A 3E3QE 1BXVA 4YSOA 3DO7B 4OZGF 2CGZA 1MFCL 4P48A 3KHQA 1OK8A 4A38A 3DMMD 3K1KC 3SQOH 3UERA 2QPDB 5DK2A 4AITA 3IM1A 1KCVL 3C5XA 2IQ9L 3TP4A 2VDKH 4Y16D 2DQ6A 3KPOB 3VFNB 1ZGLP 4X42A 1CFSA 1TNMA 1NDMA 5CUSL 4G6ML 3VYOA 2FZ3B 4QYOA 2JQZA 4W9HC 1OE1A 4B9CA 5KANI 1TJIH 4M4RB 1LMIA 2W0FB 1M2OA 3KHOA 5IQOA 1VSCA 2AJUL 2C9XA 3EDEA 3AXLB 1XF4B 5E1QA 1KT2B 1YC7A 4W9KC 2I27N 2WXPA 4M5ZL 2GVYA 3I3DA 3RAJL 2Y6TE 1E6JL 3ECBB 1WTLA 2J73A 3EGDA 4PJ7B 1OD9A 1WAAA 3FN9A 4GAGH 3VG0H 1KACB 3RTLA 1TXKA 5J12B 2R4RL 3G6AA 4JFXA 3GMNA 1ZDSA 3PUCA 5T5FH 4Y1TA 5F3BB 4AJYV 3GZQA 5H94B 4F7PA 2CDFB 1PEZA 4BHUI 1NCDH 4HP5A 4UT6H 5CIPH 4BWWA 4F2ME 1H5BB 3H1ZA 2FBOJ 2LR4A 3HI1A 4P05A 2X9YA 5I66B 2WBJA 2DDQH 1VFBA 3MRHB 4HSAC 2UWEB 4KXZI 4U1HB 4MJIE 3LKNA 1S4IA 3DPBA 4JB9L 4QHLB 1IBHA 1QRNA 1W9XA 5IKCB 2N01B 3ET9F 3TL5A 4GFTB 2CO1A 4PTTA 4KZ0A 1CR9L 2RQ8A 5I76A 4F7KA 5ABZA 3LEYH 1B9KA 4APXA 1X9LA 4EKXA 4Y4FA 5BS0D 3GSWB 4AEIH 3D3VB 3PWPA 1C08A 2EDTA 4K9EL 2HFGL 3VXUA 2CK0H 3X14B 4Z7OE 4ABQA 4NKIH 4FFYH 2GAZB 5EU5A 3KYOA 2XRAL 4QNPE 4L8SB 2KQMA 1UXWB 3U4EB 3BZ4A 1NFDB 3L4WA 4LLVB 4MNQB 2Z31A 3LIZL 2BY2A 3QNYB 4LCWB 5LJYH 1YYMH 4ADIA 4DOHE 3TVMB 1B0IA 3RWDB 2CD0A 2CUHA 4IHBA 5C09A 1V7NH 1F5WA 4NT6A 2J8HA 3HRPA 3L4YA 3OHXB 2CLVB 4WFHD 4WSKA 3ISWA 5ITFA 1XXFC 4DT2A 2EVHA 1UURA 1MLCB 2B77A 4UIKL 2ROXA 1UA6H 3IT8D 3DMMC 3IXAB 4HCRA 3MJ9L 4YDMA 2CCLA 4E2OA 4YE4H 3CHRA 2GJ6D 1KC5L 5DO2C 5HHPA 1WP6A 1FE8L 1M6OB 3B1TA 5EOCH 2GK0A 4IRSC 4E5XG 1EZUA 3CBJB 3RY6A 4NFCA 4MA3B 4N2EA 3QZPA 2YMTA 1A25A 2FSEB 4HK0B 5DUBA 5B1BB 1DHKA 1Q38A 2R59A 2ITCA 4HMCA 4LO9A 1U9KA 3HZYA 4M6ML 5D1QA 1E7VA 4ZRGA 5HDBB 3EGSB 3CH1A 1EUTA 4FQPA 5E00B 4X6DB 3WY2A 4UQIM 4AQOA 4GG6A 1THAA 4ZQKA 3QNZB 4ZTPL 3VA6A 1HHIA 3FUKA 3KWTA 1G7HB 2IH9A 2NLJA 3C2SA 3WS3B 4JW3A 2CLZA 1QEWA 3W2DH 4WAFA 4PJEF 32C2B 4A67A 2J43A 3UBFA 1WT5C 5DA4A 2ZOLB 3APFA 5EHFA 2D2OA 1P5UC 1RZGB 3L5IA 2EDJA 4YLBA 1U41A 2BC4A 1JWUA 3L9EA 2DWEA 5EC2B 4LP5A 4GW1B 3QDMD 5CILH 4GRMA 2QKIA 3QIWA 2VW7A 4I13B 4JKLA 4D7BA 5CZVL 1UD3A 2GKIA 4GRWF 1ZE3C 5I18H 4HGMA 3DO4A 4MJ4A 5AOZA 3NJJA 3HG0A 4KOBA 5LVEA 1GGBH 3HN5A 1Z9MA 2BJMH 3QUKB 2ZUXA 3FUJA 3QULA 4KPHH 3VB9A 1DVFB 2IWGA 4CL7A 4TRPL 5ACLA 3MJWA 1XCXA 4A6YB 1XF1A 1CU4L 1WIUA 1QLEB 4NEHB 1WYJA 5LGHH 5CFHA 2EICA 4N1HB 3FT0A 4E5XA 1U8PA 3VG9C 1PVHA 5IOPA 2W0LA 4Z7WE 2XN9A 4PP1D 4NZTH 1AQHA 1I8MA 1JYNA 4WO4A 3UG5A 1WE5A 4OLYL 3OR6B 2JKSA 5HHMB 5I17A 4F92B 5I6KA 2MQGA 2YBRB 3GSUA 4WI0A 4Z77B 1U6AH 4GINA 2AW2A 3VD2A 4NPYA 5HHOB 4HJTA 3QRBA 4NQSA 3APNA 3OWRA 2AQSA 3GMLB 1D5ZA 2IBZX 5EUOF 5DJ2A 1PZ5A 3ARFA 4LLMA 3BN3B 3D2UD 1CXLA 1JWSB 4K94C 3LRKA 3VDCA 1QRKA 4LEEA 5AYUH 1RPKA 3C60C 2Q10A 4XCFL 4OGZA 1DBBL 3MDJA 3VD7A 3MYJA 2RCSH 1HH9B 4QRQA 1S8DB 2HKFH 5FYLL 4HPOL 1ZJBA 2VC2H 3MHZA 2H3XC 4ZD3L 4BFNA 2BWIA 4U1SA 3ILDA 4ATWA 1EO5A 3PL6A 1FYTB 4Y1SA 3PGFH 1UASA 3AAZA 2IAND 4PJ5D 3L3OB 3O3UN 4C83A 5EO9B 4OQTH 4PPTA 1UJ3C 3QQ9D 3WBDA 3LEVL 1BBDL 4GRLD 5KVDL 4U6XB 4GMTH 2DWDA 2AERT 4AYID 3VU1A 2Z4QA 5E6SB 4XVJL 1Y6KR 4PJAE 1UWGL 4KKAD 1RXLA 4O51B 3RTQA 2BFVH 4E0RA 3OKKA 4M48H 1CD8A 4PRHB 5JXAH 1E9OA 3DIVA 1B2WH 3DX3A 4QRRB 1HH6A 5CEZE 3MJ8A 3UACA 2VMCA 4Q6YA 1JNLH 1ZHLB 3LHAA 4NP4L 2WN2A 3PQYE 3CBKB 3M1OA 2EDLA 4QRAA 5C6WH 5L0QC 3GC3A 4ZAKD 2O61B 2E27H 1O7DE 3VCLA 3VWJA 4AG4L 4BH8A 5KVDE 1EEYA 1FRGL 3LRHA 4Y9BA 3UZQA 3W9EB 1H19A 1J8HB 4OF3A 4QMEA 1UB5B 4JY6A 3ZK0A 3S4SG 2WKOF 1YMHA 2J6WA 5D8JL 4Q4EA 4J8QA 2NR6A 3PHOB 1KEGL 4FXKC 2CXGA 3EYVA 2WSDA 5C71A 4EDXB 2BXZA 2PYFB 2QVKA 5LG6A 4JFDA 4H1LB 5D4IA 5E5UB 1JHLL 4LVOB 2UUDK 5BRZB 5HHQA 5I73B 5I5MA 1YEHH 3BD3A 4YDZA 4YHZH 1MNNA 5SWSA 4NJAL 1EANA 1UADC 3RKDC 2QVMA 4B27A 1WC7B 3P9MA 3ZR5A 2L7JA 3FJTA 5AW1B 1SF3A 1YSOA 2DQIH 5DT1H 1UH4A 3KCPB 1A0QH 1DDHB 3TM6A 4B41A 3FBKA 3P11L 4MD4A 4RFOH 3INOA 1PBYA 3O3BA 4O02L 2APXA 2ZPKH 2JQAA 1ECZA 4EMZA 2OULB 3HBPA 1QO3A 1S7QB 2EEXA 4G6JH 1U3YA 1LQSR 3V0DA 3IN2A 4IDJL 1RZKL 4QD2E 5BZDB 1TETH 4BA0A 1J0HA 2D31B 1UUSA 1I1YB 4Q9BA 4HWBA 5AQ0A 3RWEA 2XQYK 1NBYB 4AL8C 4PJHA 1DSYA 3K6NA 3LRSA 5CKAA 5HYIA 3BUYB 2WINB 4PGJA 2J44A 4Q14A 4KTGA 1J05B 1H6TA 4H8WL 3HS0A 3S4SA 4M61B 3PWLA 2FBJH 2CHWA 3TS8A 4N20A 2HLAA 1LDPL 1CGWA 2AS5M 4PV9A 4N0UB 3K6FA 1ZA6B 3WFCL 5E95B 3SE6A 1BEYL 2R2CA 2W8CA 5KVMC 1YEGL 4IW4C 4X7CC 4XAWH 4PRDA 4N6QA 5EUKA 1ZDQA 2K3TA 2YKLL 4ZFOA 1SGKA 4CC4A 2H26A 3MRQB 2DH3A 4WK2B 3KPRA 2NDFA 4FJZA 3NA9L 2IOOA 3JV6A 1HCZA 1ZIBA 4U7MA 3F01A 2AJXH 3VTMA 4Q97A 3T4YB 3N85H 4K3HA 3JWNG 2AQTA 3BGFB 4HAKA 5GS1C 4F3FB 1DVZA 1FDLL 1DJSA 1E4XI 1YHPA 4MD5A 5DJ0B 3UADA 2XBZA 4O4YH 1KULA 1X5JA 4F27A 4Z3EA 3ARDC 1BLIA 1BYNA 1MUJA 4BK5A 1ZANL 4EI5D 1KCSH 3MKGA 3VMNA 2JMRA 1FCGA 3EYUH 4PJBE 4O2EA 2DQTH 3X1BA 3UC0H 3WFBL 1RJYA 3JV4B 1KTCA 4EIGB 2W9DL 3B56A 4O58H 2WXKA 4BV1A 3IDJA 3LH2L 3BSZL 3A23A 1SEQL 3RA7L 1QBLL 4JFTA 4PGDA 4F37F 4H0IA 4UT9A 4XCEA 3PXLA 4B9FA 3OB0K 1TLKA 2ORBH 4N2MA 4PGCB 1A65A 4WFFD 3CXDH 4M93C 5LDUA 3BUIA 4G6FD 3JWOC 5JDSA 4MQTB 3V5DB 1BECA 1DBML 4ZFZB 3WD5H 3LXUX 3VXPA 2X0WA 1KGUA 5AENA 4H8QA 5HPMB 1CLZH 5AL8A 4Z95L 3KPTA 4ELDA 3MX0B 1TUPA 4Y7OC 5HJ3A 4YJZL 1MHHA 1YMMB 3ZQ9A 2BSRA 3DLQR 3RL2B 4H20L 4ZS7H 1Q0YH 3CFTA 2NY7H 3IDNA 3Q1SL 4BFEA 5BJTB 3EO9H 5FFLA 3HR5A 2AJ3B 5T3ZD 2R23A 3V4PB 1BFSA 1KF9B 1CLOL 1M56B 1UZGA 2ZWKA 3RY4A 1WBZB 1DEEA 4QCIB 4FNLL 3RWCB 5I1IL 2BNUB 2OPCA 1AGFA 1GPOL 5JMRA 4ORZC 5DJ6A 4J3OH 4HUXB 1T7XA 1Z7JA 3PP4H 1CF8H 4P5TA 1WCQA 3LEXA 4JDVB 4RIRB 1J5CA 1EGJL 5EZLA 1LEKB 3BH8B 4Z7UE 1S9WA 3KM1A 1I8IA 3FUFA 4OVVA 4TSBH 1G9EA 1U8HB 3CMGA 2Z91A 5D70H 3SZKC 4XT1C 3LN5B 3ATEA 5DS1A 1EJOL 2VDNH 2Z92A 2JI3A 2XHNA 3TN0B 4QXUL 1IKFL 4WU5A 5E4OA 2IH8A 4DKEL 2ARJA 5IHUH 2I24N 3CSTA 4BZ2L 1KTJA 4KK8D 3I6SA 2ZWYA 3M1CA 4I48B 4X4MA 5H2BB 3VFWA 1BAGA 3VXTA 1AG0A 2VR7A 4NQCE 4PQXA 3ZU8A 1A9BA 1EHKB 5DMKA 2F9BT 3GSOA 5DS2A 1AC0A 5DZNA 2VLKA 1BXXA 2QPEB 3C6LA 4MA8H 1LQBC 2IFFL 3RX9A 5KG9B 2YS4A 3K46A 4YSDA 5DJXA 5JNYB 2F58L 1GGCL 2EDHA 1A4KB 4LHUD 1DLHB 3G7TA 4U1GB 1B6UA 1DQDL 3N0AA 3RRQA 2V5TA 3BGMB 2NSMA 2VDML 4RDQF 3BFOA 1KLGB 1QZNA 4Z7VA 3VA2C 3U7WH 4P2OA 4BGDA 5D7LA 3KXFA 4OV5B 2AXHA 3EYSL 5ACZA 1RK1B 2HKAA 4AIOA 5I1JH 2QR0A 4YGVB 1DVTA 2PWEA 3AUWB 1RURH 2UYLB 2AV7A 4XNZC 3D85D 2PR4H 3B9KD 4F91B 1RP8A 3T8XB 3VRIB 3UTTD 1KBGH 2DL2A 2DQCH 2Q76A 5GRJL 1ANUA 3ARBC 4OFYD 4Y16A 2QSCH 1D5RA 1YNTA 5IHLB 4ISVA 2ZOWA 4FLOA 1FH5H 3SGJA 2HFEA 1J11A 4JDZB 5A2FA 2HRPL 5BPPA 1ZVYA 1AHKA 1LNUA 1F4XL 3JTSB 1VGEL 5C0FB 3JUYA 1XF2A 2O30A 4NUQA 2ICEC 3QYNA 1YJDL 1JXGA 5I8EB 2JCCA 3IPFA 5F1KC 4G7VH 3SYOA 3EUUA 5IJCC 4NWTL 4EO5A 3T1FA 1NEZB 3ULVF 4N0CD 4Y1AB 5EEZA 1KFAL 2HJKA 1F2QA 1HZHH 4XP1H 4YVUA 3UX9B 1G7IA 2ZJSH 2VQ4A 3RL1A 2QMKA 4ONOA 3VGGA 5KYYB 1QZ1A 3DIFA 2XBTA 5DMYA 4A7GA 1AI1H 4HZLB 4Z3TA 3FQYA 4L8BB 3SDDD 3SBQA 2IEPA 3I6GA 4I2XE 1EK3A 2AJZA 1MZZA 1IRAY 3EFOB 4G9DB 5DK0A 1P4LA 2D4DA 2P24B 5I74C 1IL1B 5KOMC 2F7IA 5F3HA 4MA7L 5CCJA 1BOGA 2JK5A 3EJPA 1BF5A 1O9VA 4ZTEA 5C0AD 4EUPG 3ARSA 3VQ1C 1AQDA 4OGYL 4KQ4H 5E5LA 5DI8A 4ABUA 2NW3A 3OQRA 1XAKA 3B83A 2JJVA 3TC9A 1A1OA 1MWAL 4LDCA 1MAKA 2HA1A 1MHEB 1XCTA 3BPLB 5C0CE 2V2TB 4ETQB 1P4IH 3ULSA 4L4TD 1XGUA 4OVUA 3OQ3B 4K8RL 1GYVA 4KROB 3RVVD 5EMYA 3KM2A 4J2QA 4EQ3A 5BS0A 1QBBA 5DMIH 5EEYA 5IVZA 2XX1A 2PO6A 1SN2A 5KZCD 5T1DH 3CZFB 1F11A 3UYRH 2XDHA 3VWKB 3FQWB 4L5FH 1RUMH 1NMCB 2VXQA 1AO7B 4P2RB 3FHEA 1WF5A 5A43C 4BFBD 3KH4A 3HC4L 1NL0L 3OTTA 3SKOA 1QSFA 2APFA 4B9YA 1EAQA 2VM3A 2I9LA 2DQUL 3IDUA 2F54B 3E0GA 4KI5C 1JZIA 4LOUD 4DGVL 1NGYA 1HC1A 3IS1X 2VLRE 5I1GH 4BE6A 4MJ6A 1OF2B 3ELQA 1OPOA 1R1CA 3D34A 5IFHL 3UEZA 5DJCA 4L29A 3KYKH 5E4EB 4IJTA 3ZE0E 1I9RL 3R1GL 3BAKA 3T3PE 3TONA 1XV8A 1KXTA 1ZEAH 5HVWA 1NAMH 2PW1B 2YFNA 4GAJH 3UP1A 2FX9L 5T33L 4LQ1A 5AAMA 3NZ8A 1BQLH 5JW3H 1NUDA 1S3KH 3B9KC 4EUPA 3VRJA 1F6AA 1RLBA 3GJFA 3WXWH 4JM2C 5ES4B 4QI3A 3ZMNA 1YEKL 1YVLA 3M86A 3S5LB 3BE1L 2GJ6A 5ALBH 3V6FB 5IEHA 3ALWA 2GTZB 4OIFA 4W4OC 3W37A 1TF4A 3CCHA 1TMCB 1JRHH 3BQVA 4MAZA 4XGZB 1DFBH 4LT7A 2DJSA 3WXVH 4P5RA 4ORGB 1AGEB 2VABA 4Z7NF 4XWGH 1ET7A 2B0SL 4ZFFA 2YD2A 3DVNA 3O0RH 4K0OA 1T80A 1LGVA 5E6ZA 4P57B 4N0CC 4LLAA 5C2BH 4FA8A 4IU3B 4S0SD 3WEMA 1T89C 4X5WA 1G9ML 5DC2A 3QG6B 3SDDC 4C56E 5EN3A 5KVGL 1CD0A 1FC1A 5LGJA 4BQ8A 4Z78B 3X13A 5FPIA 5H8DA 1JGEB 4GBXB 1U8QB 2P42B 3MOBL 3TIEB 3HMWH 3QDMA 5CP3A 4FXGA 3PWVB 1S7VB 1A9EB 2YOCA 3GBNH 4AZUA 1VGKA 4JM4L 4UTAH 3ZE2E 5FECB 3LN4A 2B16A 3FOMA 5KVGE 1RIVH 1D7FA 5IESL 2HWZH 3LKOB 2LLLA 3ULUF 1YN7B 4X6FB 2BIOA 3QCVL 2CBQA 4HIEA 3SY0A 3IFLL 1U58B 3RVVC 4L3CB 4M7JH 3VI4F 5FC9A 1E4WH 1KCUL 1XGTB 2Q8BL 1KNOB 5DZOA 4DQOL 4EN3C 4KZDH 3F7VB 2VDPH 5F88B 2PW2B 3GM8A 2HRLA 4W9FC 1BQUA 2NY0B 1N5AB 3AY4C 4OCMC 3AM8A 2X2YA 2QPUA 5F1SA 4TYUA 4WW2B 4XOBA 1QFUH 4IBQA 4ONHA 4U2YA 2QKSA 3QISA 2BP8B 3TV3H 4M3KB 4YSPA 2GIXA 3PAUA 5D71L 2XETA 3TASA 1KB5L 4NAMA 5E2VH 2VLLA 5L8KB 2XYCA 6FABL 5T1MB 2Q2LA 2R0ZL 5JA9A 2P8LB 5ABAA 3D2UA 3EYQC 3PP3H 4UT7L 3UIZA 2A4CA 4AJ0A 5KVEH 2LABA 2UXTA 1DJXA 4UNIA 1J1XH 1HN1A 3QDJE 4OLXH 4BKSC 3CN2A 2A0LD 5IMOA 4CSPA 1YEEL 5DK2B 4F8PA 5ILTH 1UD5A 2PR9A 1QACA 4HLJA 3MUGA 3NJIA 1KIPA 4FERA 3OC5A 2IAMD 2B1OA 1A3RL 4I9WD 4V1DE 5CD3A 1BLNA 4HCIA 1NDMB 4QYOB 3ZTNH 4HPYH 1YEDA 3J2PA 2AEIT 4HHAA 1I1AD 1HE7A 5KWYC 3K71B 4FQIL 4HX1A 3PHSA 5CSGA 2VAAA 2PCPA 4GRLA 1GOFA 1E9PA 1X5KA 1DLFH 4HKXA 3CUPB 4JVWA 3MRGA 2FHFA 4NSKA 5HHVL 3S5YA 2NY1C 1XSJA 2AQRA 5EZOH 3VGHA 4H0GA 4MJID 3O4OC 3S88H 5LNDA 2MOGA 1HVXA 3G6AB 4M7ZC 3FUDA 4JFXB 3GMNB 1RFDL 2J88L 3L8QA 5GZOC 1QMUA 4C58B 2ZUUA 3O11A 4W81A 4JREB 3MV9E 4TUOA 5BQDA 4PRNA 1A7RH 3O6LH 3RNKA 4F7PB 4XX5A 4UQDA 4NPKA 4ZAKA 3KEDA 1HOCA 1AZVA 3HI1B 3B7SA 2F61A 2EYSA 2WBJB 5FA3A 5LXVA 1DANT 1VFBB 4ANUA 3PXJA 5DYFA 1MCRA 3SQOL 3LKNB 1IBDA 5GGUB 1C7TA 3DPBB 4JL1A 2P48B 4U3SA 1KY7A 1QRNB 2VDKL 3RGVD 1RZJC 2B1HH 3E8UL 3GI9L 3QDGD 2WNKA 4A7QA 1RLWA 5B8CA 4PTTB 4ANVA 1DVXA 3NGBB 4MHHI 5I15H 5I76B 5CWSA 1YYLH 4KVCH 5D9SA 4HIJA 5I0VA 5SWQA 4Y4FB 3DI2B 4I0CC 4YBLB 5KSBE 2FBRA 4YK4C 5JXEC 2VR4A 3PWPB 1C08B 3M45A 4N1CA 1XEDA 4JQIA 3VXUB 2VDOB 5KOVC 4N90D 2DN7A 1QFWI 3FOLA 4GAGL 4PFEA 3KYOB 5EU5B 2HTKC 2UY6A 3QJFA 4I5BA 4Y2OA 2JQMA 3SB3A 5C0NC 3HRZA 1UB6A 1EIBA 3BZ4B 3E3QC 2BVOA 3RFZA 4ZS6D 1IGJA 4A2GA 1YNLH 2Z31B 2A1WH 2ZYRA 3L13A 3L54A 4U7SA 5E4AA 5FOJA 3WSQL 4FNSA 1V7ML 2B1AH 1NLDH 2QVFB 1FN4A 3OZ9H 4XBPA 2WQ8A 4JFYA 3T4AC 4CMHC 5KJ7E 5C09B 3ASWA 2DDQL 4GYBA 2RBLA 4NT6B 4OSUL 2D0HA 3VQMA 1NGZA 4NO5A 5E2JA 4A7VA 5ITFB 4H2CA 4AUUA 5CJQH 4Q2ZA 2OL3L 3OGOE 5K69A 3VAEA 4QRPE 2AAVA 3ZR6A 3IPEA 2A0LC 4FP8H 4I89A 4PVLA 3LEYL 2NXZB 4FXLA 1SMDA 1QLFA 3MV7B 5I0XA 2DTSA 4AEIL 2BSDA 5DWPA 5HHPB 4X83A 1A5FH 12E8H 1D6VH 4HKZA 2GK0B 2Z4TA 4TL4A 2CK0L 5FHAH 1EO8H 2CHNA 4M43L 4NKIL 3I9GH 4FFYL 5DUBB 2ITCB 2CNZA 4MQXD 1I1AC 1JDDA 3DX7B 3LS5H 4EI0A 4YHLH 4N5ED 1SBSH 5D1QB 2QT6A 4UNTA 3CH1B 3QPKA 1CGTA 5AW8B 4N28A 2H2PD 2X88A 4ZQKB 4GG6B 4IK6A 1YYML 2QPFA 5J9PA 1HHIB 1F1DA 4IIQC 1TIUA 1DSFH 2NLJB 3ATDA 1MCBA 4MASA 1X5FA 4P46D 2CLZB 1V7NL 4XNMA 5D7IE 1QEWB 3T8VA 2N56A 4XPFH 4XO9A 2GBUA 1QP1A 5J3HD 1PG7X 4EI5A 3TPUA 3EBAA 4OY9A 4DFIA 1LO3H 3IFNH 1G0XA 4ODVL 5K9QI 4JANA 2BC4B 1JWUB 2DWEB 3DX1A 1UA7A 5AW0B 1UA6L 1BVNP 1CL7I 1T0OA 3LZPA