2FVNA

The fibrillar tip complex of the afa/dr adhesins from pathogen e. coli displays synergistic binding to 5 1 and v 3 integrins
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
142
structure length
142
Chain Sequence
b'SAELHLESRGGSGTQLRDGAKVATGRIICREAHTGFHVWMNERQVDGRAERYVVQSKDGRHELRVRTGGDGWSPVKGEGGKGVSRPGQEEQVFFDVMADGNQDIAPGEYRFSVGGACVVPQEDNKQGFTPSGTTGTTKLTVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein afaD
publication title The solution structure of the invasive tip complex from Afa/Dr fibrils
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 9
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2fvnA00
2CO6A 4PHXA 2CO7A 2CO3A 2AXWA 2IXQA 4OR1A 3UIYA 3UIZA 2CNZA 2FVNA 5D55A 2CO2A 2CNYA 2CO1A 2CO4A
chains in the Genus database with same CATH superfamily
4OZHB 2WQRA 1MFUA 1A7OH 4BKTC 4R5XA 3T04D 3QGVA 4XXWC 5A40E 3UX9B 3ZU8A 4NN5B 2BWQA 5EU5A 3V5DB 5AOLA 2GEQA 2VL5B 1QKZL 3EG9B 3CFEB 5CR1A 5LG6A 2UZYB 1QI5A 1CFVH 3TIDA 3O6LL 3FO0L 2HB0A 1PKQA 2VXQA 5A7BA 2R39A 5GRUL 1FFNA 3JTTB 1VHPA 3Q2WA 4XMLL 4IGBB 4HG4K 2V5TA 2H32H 1RERA 2Y25A 3A3YB 5E2VL 2ITFA 4HCIA 1C8PA 4KO9A 4FQQA 2Z8SA 4UDTB 3QC6X 1RD6A 3S34L 3ZT5A 1IM3A 2Y0SA 4DN3L 2WKOA 4Z7VA 5JW4M 1AH1A 4N0UB 3QCVH 4DK5A 1HYRC 5HI5D 4GXUN 1AXIB 4MQ7A 4N9GA 2QGDA 4TSCH 1QWHA 2ITEA 5T3XH 5KUMA 2NY2C 5D7HA 5JIMA 3ML8A 1ZLUH 4XC3L 3OWEA 5EUKB 4N0YH 2ICWB 3WI9A 1T2QH 2AEIT 4O4YL 3Q8FA 1MF2L 1UEMA 3QR1A 1X4ZA 1E6OH 1YNTB 4JGMA 5MEPB 3CFCH 1WQVT 5MERB 4RDQF 5DFVC 4UILH 4Y2DA 4PRAB 2BSDA 1MHPH 1Y1UA 3KBFA 4HPHA 4TQEH 4CMMB 2VC2L 4AYBA 1Z3RA 3DHUA 1URZA 4HT1L 4Z7WA 4X4ZA 3IJHA 2YAMA 1FL6B 3AGWA 1GJUA 1UHVA 2CHXA 4GG6B 4S0SD 3FCUB 5DWUL 2D8KA 3CHOA 4LF3A 4AV4A 3V79C 5F72S 1D5RA 4UT6A 1F8TL 5JDSB 4OGAC 5JO5B 3DUSA 5A3IC 4JHAH 2DIAA 3R1GL 1WT5C 1EANA 4MJIA 5DJ8B 4JKNA 4HCFA 3EYFB 5TPWH 3ZRSA 3EHBD 3ORJA 3RBSA 5CLWA 2AQQA 2F7RA 2XV0A 1CFSB 5AUMA 3UAJC 1NIFA 4OLXL 5KVDE 1IVTA 3QI9D 4O02B 1BQRA 4DPAX 2UZXA 1D5XA 1CGTA 4A04A 4BFJA 4KO5A 1SXCA 3H3KA 3N2JA 3PAUA 2B16A 4BHUI 4C56B 2RA1A 4R9HA 3DWTA 3ZLQC 4MXQD 2EYSB 4N86A 4X0NA 4R90L 3QUML 5KG9B 3KVDD 1TNMA 1G7PB 2VDPH 4OKVA 4PJDF 4IU2B 3RDTC 3U7YH 2E6PA 3H7LA 3EF7A 4J4PA 5DQDL 3VDBA 4PUBH 1SBSL 4Y89A 1IE4A 4MXWH 4KVNH 4JE4B 3QIBA 1DVUA 3L1GA 5DUMH 3B9KC 3KGUA 3COOA 3RWCA 4XCFL 5CZRA 4U1GC 1UZ6E 4HXBL 5KJ4A 2YHGA 4RZCA 2Z8WC 3CDCA 2ZUVA 4Y8DC 3W9DA 3OKEA 1XWVA 5DD5H 3NUKA 3EHBB 3SCMA 3KJ6L 2OX5A 1KJ2H 4PJEA 3SE9H 5KSBE 1U8CA 2WTRA 2WN3A 5DJ6A 4QLWA 1LWHA 4FHBD 2VR7A 4RCAA 2PXYA 2NDGA 3ZZQA 3VFWB 1E67A 3VFTA 1WZMA 1FSKB 3DBXB 3QI9B 3MODL 3UG3A 5A2IH 2P5EA 3WIIL 2W0FA 4X8JB 2DMKA 4G1MA 4KXAA 2MRYA 2YZ1A 5DYOB 1NDMB 3QUZA 1I7UA 5EF1A 2Z7UA 1Q9KA 2X3CA 4JO1L 4BFRA 4P4KD 2J55A 4ZUVA 2L04A 2Y36L 4PJHF 3BP5B 3QIWC 2JCCF 4ODWA 4NIKB 2YO3A 4QAWA 3L3OB 3GMNA 2CGRL 1FORL 2VXVH 1YA5A 5H4ZA 2X7LB 3C5ZC 5BJTB 3BIKB 4IK7A 4X8CA 4XODA 4ZSOE 4N2GA 1FNAA 2QELA 4X5WB 4KROB 4KK6D 3O3BA 2VZUA 2YD7A 1QZ1A 4N0FA 2VAAA 1RH8A 2WBJD 4L5FL 4N6QA 1HS6A 3A4EA 5EPMB 4RNRA 5JOEA 2WIMA 1I4FA 2X70B 1KTCA 2JCWA 4OVUA 4R0LB 3SGJA 1DJHA 1N8ZB 4ZMXA 4S2SA 4QHKI 4UANA 4LIQH 5IF0A 4Y4HA 2J44A 2H7WA 4HBQA 1MOEA 2Q7AA 5BZDA 2E9GA 2VLME 4W9FC 5F2FA 12E8L 4KH2A 4I18B 5B1CA 1M9SA 1TTGA 3D6GA 4JRYD 5EU4B 4GIPD 1X9LA 2PTVA 1AZNA 1UOVA 2Z4QA 3RPIB 4W9ZA 4EIZC 4P46A 2O5XH 2BOBA 2AZUA 4KJPC 2YZ8A 3X12B 2WQVA 3D18A 3LY6A 2TRYA 1ITBB 4P4KB 1FI8C 2QADD 5IGXH 2AP2A 2FL5A 3WFZA 3TESA 1CICC 4KNQA 3MLSH 4Z7OB 1FZMA 3WD5H 4AZ8A 3BZ5A 3B7UX 4X6FA 4ZS6C 1OGSA 4YQXH 3FAWA 3QDGD 1CE6B 2C1PA 4OJFH 5DZJA 1HEZB 3IJYA 3RA7H 4F2EA 1DVTA 2XIBA 3ZSSA 5C7ZA 2C26A 3L5HA 4HOZA 4MLIA 4AJ0A 2WBJB 3NZSA 3FB8B 3BQUA 2OXGB 2ZOWA 3ARFC 4BIKA 4RZKA 1KJMB 1TMQA 5D7KE 3UTTA 1NBYA 1XB8A 4IRSA 4I9XA 6FABH 2Q3AA 3TIEB 3HFML 2GUOB 2VE6A 3ILDA 4Q2ZA 3O2VH 4UQCA 3ZMEA 5ANMA 2ADFH 3AU1B 4UBDC 3F62A 4XH2A 5E5UB 3GPEA 1KUMA 1QSVA 3OXSB 4JRYB 3ZZ1A 2OR9H 5C0NC 4PJ5E 4EVNB 4OM0H 3O6FC 4Y9EA 2DM7A 2QLVB 3O2DH 4GUQA 3OKNB 3DPBA 5ADOH 2G3MA 1WICA 4HC1L 5DEJA 3KE0A 2O6PA 1T6BX 4ONOA 4UQ3A 5JORB 5GISL 1B0WA 2FIKA 5F97E 2OXHB 3MUHL 1MCJA 1LQBC 5E8DL 5GJSH 2EO7A 2ZICA 1JYXA 1O7VA 3BAKA 1YEWA 2OSWA 1NEZB 2E47A 2BJML 3K0WA 1IC7H 2G3XA 3E3QE 1CI3M 3DX9B 1KCSL 4U33A 3APCA 4URTB 5B4MD 3WSQL 5ABZA 2ODIA 2YA0A 5ALBL 3MRNB 5EZJA 1GGCL 2WP3O 3GPSA 3QDGB 1HTYA 4Z77B 3GRWL 1T03L 4KZEH 2CIKA 1N6QH 2F15A 1DN2A 4X4YA 5B1JC 4HUVA 3O41A 2ITDA 3F01A 4X2UA 3CCHA 3RWJB 2J43A 3KPNA 4ZUTB 3K2UL 3L4VA 3GXDA 4H1LG 4R96A 4JUTA 1J1OL 3P3YA 4G2AA 3ETSA 2F58H 1DVSA 1NLDL 4CMHC 3OMAB 3MXVH 2MOQA 1XGRB 5E00B 1WAEA 5JW5B 1TEFA 3QPQC 2W94A 1IL1B 3CZKA 2VSCA 4YWGL 4FFVC 1B4JL 2KZWA 4XNZB 4F8TA 5I6XB 1OTTC 3QAZC 1H5BC 1Q9LB 4O5LL 4KXDA 3DHPA 3BVVA 3UGUA 1JPEA 3ARXA 3B3BA 4FXLA 4F3FB 4HHWA 3ZDXF 4K3JL 1R3JA 5AZ2H 3JSSA 5CJ5A 1TJIL 1LO0H 2R4SH 3FU0A 3F7PC 3W5MA 4QOKE 5LB1A 4KZ0A 4L1SA 4PSPA 3LQAC 3MNWA 4GXVL 5LBVA 3WHXA 4GMSL 3N40F 5DJCA 4R6UA 1S8DA 2A77H 1E3ZA 1CE1H 1XF4B 3JYBA 3PAYA 2WSKA 1X5JA 3K3QA 3IRZA 1OSEA 3TWCL 1IB5A 2JK5A 5EF3A 4PJ8A 1WK0A 3K4DA 4JN2B 3HG1D 1TVHA 1VFAB 1JV5B 3QZBA 5E5RB 2B2XH 2YD1A 3D08A 2NTSP 4Y16C 5DD1L 5ENWA 3AREA 3F7YB 5GZOA 5DT1H 3MCKA 2VITA 4B9IA 3K71A 5KSVA 5C3LD 4BFOA 2GI0A 5FOBB 1RCYA 5I1AB 5JA8B 4PBDA 4PI0A 2R56H 1A4JB 3QG6A 4NUGH 1JHTB 2R29H 3KWWB 1R24A 3W37A 2R4RL 3RUGA 3V6FB 1N5AB 4C59B 3RU8L 1PEZA 4LVNC 2CDEB 4NWUL 1XGYH 5T1LD 2GTWB 3MA9H 2ZKHH 2EYRA 1MXDA 1U3NA 1LP9A 3EGSB 3PXLA 4YAQB 3DTXA 3KEDA 3WHE0 5HJDA 1HJCA 1KELL 4CN6A 3S3PA 2VDOH 3QUYD 2Y07L 4YDVA 3GHPA 1U92A 4GINA 3RVUD 2EDLA 4ZD3H 1XCQA 3WY4A 4Y5YC 4M7ZC 5D1QA 2PO6C 4EOWL 5IQ7H 2UY6B 3K6SA 4Q6KA 4XCEA 1JZDC 5EIIB 2X0UA 4NWTH 4TOYL 4ADGA 1LGVA 4FABL 4GKSB 3Q6GL 1ZGLA 3WOVA 4UU9A 4O9HL 3CK0H 1WCBB 2J7LA 4NGHL 3MLXH 4JHBA 1E27A 1IV8A 2ARJB 1OGPA 1OAUH 1ZEAL 3HG1B 4LSQL 1NFKA 3D9AL 4IYKA 4D8PB 5CMAA 1LE9B 3SGEI 1JGDA 1XF3A 1UXWB 3VU1A 3OKLB 1KJ2A 1LXMA 3N3EA 4LVOB 2D3VA 1ZLWH 3CH8A 3DECA 5FW6A 4G8GD 1TCRB 3VCLB 4N5EC 2LFGA 1WBXA 2YC1A 3GXMA 3NCJL 3RWDA 4IJ3C 1S7UB 3O3DA 2HRPL 3TL5A 2V3DA 1MFDL 4GUPA 4OB5H 3EDKA 5IHZB 3QUYB 3DI3B 4F15B 1G9MH 4LSPL 2IH3A 4PRIE 1UWEH 3GBDA 1G1OA 2IQAB 2ENSA 4L3EA 5IVZB 3SO5A 2IC2A 1CO1A 4A2LA 1RUKL 4D9LH 1P7HL 2VSMB 3GKZA 2I24N 5CNHA 4JM2D 1NLBH 1WEJL 4JG1H 5BMFH 3HC2A 4P2RA 4YDNA 2HT3C 4BK5C 2VMJA 4LFHD 4OZGB 4TTGA 3CFJA 3D3VA 3KLLA 4GW5B 5HDRA 4G6AD 3UTZA 1E3FA 1J18A 5A2FA 3CVBA 3ASWA 1A4CA 1K5NA 1WS7A 3PGCB 4GKNA 1E9OA 4PIBA 5FWQA 3STLB 5K59E 1MNUH 4XPBH 3ATEA 3HJEA 4ZUSA 4L8DB 3FU9A 4ATTA 1HOCB 3LMJH 5T3ZE 4FULA 4UTBA 4YEFA 3G9VA 4G8GB 4H20H 1QFUH 3GK8H 4ZW6A 1RL1A 4DESA 3QIUA 3D0VB 4XVOA 5AOMA 1LDSA 3EDEA 3TO4D 4BELD 2A73A 3BOVA 2C34A 3D69A 3J27A 4JQIH 1KLGA 1F11A 3CNKA 1FG9C 2E75C 1FFOB 3QWOB 5DZ9A 1KFAH 1U36A 4FNLH 4X9GA 3PQYA 4LSVH 4H88L 5EUOE 4BA8A 4DKFL 4QHLA 2XFXA 4I0PC 3RY6C 3SKUD 5BS0E 4EJ1C 1QRNA 2BNUB 3Q8CA 3O11A 1A6PA 1MCBA 4QI3A 4OFKA 1QBLL 3AY2A 5AZUA 2RHEA 1A6WH 4LOFA 3U7WH 4JM2B 4X7CC 5I1CL 3Q9QA 4IHOA 3QULA 2IPKB 2CU9A 3M1CA 2QR0B 4LRNH 4LKCA 3GSQB 1NMAL 1U3HC 4F24A 3FT3B 4UTCA 5KVDL 2KPNA 2FSEA 1GL4B 4H0GA 5L88H 5IKCA 1KXHA 3AAZB 1E43A 4U31A 4WTZG 5TK2A 5IROC 2VZ1A 3RWHB 2XETA 3E8UH 3FRUA 3SDDA 1MFCH 3BPLC 1FNGB 5DJAB 2IAMD 1U9KA 3WIFA 3MFFA 2VW6A 2BVTA 1IJNA 1UG9A 2G2NA 3G5YB 3T0EA 2XN9A 2YUZA 1JK9B 4M7LL 4PS4H 4XP5L 1YJDH 2A4ZA 2XSKA 3S6CA 4GSDH 2QGBA 3FF8A 4N22A 1A3LL 3UYPB 1OP3H 1KIRB 3CN3A 4GS7C 3FHQA 1ZIAA 1MRDH 5FLVA 4H13C 2XACC 5T1MB 3T0WA 2DL9A 1KYFA 3GGWB 5DO2D 4ZUUA 4OLYH 3ZJAA 4RLDA 5MENA 1RSYA 1GZHA 4LCVA 2VR3A 1OOAA 3QHFH 2Y1VA 3M45A 4YIQB 3WNNA 3BGFB 2RTTA 4LDEB 4M6OL 4KDVA 1AQDB 4YBLC 1AMXA 4AQ8C 1J9RA 4XWOD 3AUVA 5I17A 4AL8C 5CWSB 1RHHA 5DHVH 1OAYH 1NCBH 2ZOKA 1LO4H 1E9PB 4FF9A 3UTSE 3R4RA 5L2KA 1I1YB 1XF5B 1XH1A 2XWJB 3IDMA 4Q6IB 4JB9H 2IAMB 3EO9L 3ULUH 2FUTA 4D3CH 5FO7A 3D4CA 5I75C 1GCFA 5CZVL 4Z7QF 1OSZB 5DJXB 2DYPA 4PJHA 5IW6B 2E3VA 3ULUD 3SPJA 2V8MA 3OKDA 4FYRA 1RUPH 1RULH 4R2GC 4K4KA 4GSXA 1EBAA 4ZFGL 4IOIB 2J25A 1RZGB 1R5WB 3GNML 4J27A 3K6IA 5KW9L 4UAOB 2H2PD 1N18A 4QCIA 3LKQA 4CU6A 2G9HA 1IFHL 1IGYA 2BP5M 4NCC2 3FCSB 5D8JL 5GS3A 3RLSA 4XBGB 3T5WA 4R8WH 1RI8A 1CI5A 2HH0L 4KZCA 3OGOE 5H94A 3WMSA 4JEGB 4ZTOL 1PG7X 5GSRB 1KT2A 3RI5F 2W60B 1PZAA 3O3EA 4ZPVA 3BHBB 3VI3E 3MOBH 4B5EA 4BK4A 1E4XI 4M00A 5DUBB 3QDHA 4YDKH 3KXFA 1NDGA 2BFVH 4QYAA 3CBKB 2NR6A 1BECA 2HLFD 4FG0A 5HI4C 1UC6A 3QCUH 3S36H 1C5DA 1OAQL 4DUVA 4XNMB 2V2TA 5JOFB 4AGPA 5I1DB 3PWNA 1MJUH 1QVOA 1HAUA 5DK0B 1XSIA 4FQXD 2F7OA 1XAKA 3H7BB 1BOGA 1HEJC 1AS8A 4YHKH 1O9VA 3RVWD 3GI8H 2BVOA 1BGXL 4WU5B 4Y7MA 1AKPA 2HPTA 3VVVA 4HKZB 1W0VB 4X42A 3OAYK 5H37G 2EVIA 1OARH 5K9QG 1I3GL 4Y7OC 1J1PH 3QJHA 3W2DH 2VLKA 4NRXB 5IB4B 4OF3A 1DQQA 4C57C 3MFGB 1GC1L 1U3ZA 5TE4H 2ED8A 4UINL 5FUZH 3QQ3A 2QHRL 1VIWA 4ANUA 4CC1A 1PX4A 1KGXA 3OKMB 4MAYC 5MP6L 3V4LA 2EDJA 1V05A 1OGAE 3MTRA 3O0LA 5CCKL 4MMZA 3W11C 3ZYJA 2XA8L 4S1SH 4IU3A 3QZNA 4FKHA 5GIRA 1PS3A 4HEME 3O6ML 4HWEL 4YE4H 3V0HA 3G6JE 4G3YL 4W6XB 3QA3B 1DEEB 4PFEA 3U6XS 3MRLA 1YCSA 4HK3N 4FN0A 3FMGL 1IX2A 2CRIA 3BVNA 1T20B 5AVYB 3IWUA 5DK3A 2APVA 5IB2A 4PD4J 3MRGA 2VLJD 1CZ8L 2YD0A 4N0CD 3D85D 1JL8A 4FQXB 5JIKA 2VDMH 3SPGA 1AI1H 2VDRH 5IM7B 2X28A 4M4PA 3NFNA 2DLIA 3RVXC 1INEH 4XPGL 4P57B 4PRHD 4LHUG 4EN3A 2ZCKL 2HFEB 4Q9QL 4ZS7L 2YK1L 5E1GA 1A9BB 2BCKB 1A9EA 1HX0A 4U1LB 3QDMD 4N3TA 1CDJA 3N1FC 3PL6D 1QACA 5GZNA 3GBEA 3VDAA 1WRFA 1RK0B 4MMXC 5B8CC 3DI2B 5GS0H 2XN0A 1GPOL 3WN5A 1PCXA 4WEBH 1NSNL 2ZG3A 2CALA 2YQGA 2YMTA 1PZBA 3C60C 5B38G 5KYNA 2BW4A 4WY7H 1SVBA 4XGZA 4FL4C 1L9TA 4PWIA 3L3DB 1WFJA 3LKPB 2QL1A 3PWJA 3NPZB 2GSIA 4N1EA 3TVMD 4YL9A 4MCMA 3LRSB 4PGCB 1T4WA 1L7TL 4YLQT 5HHNB 3T65A 5K39A 1QI4A 4TTDD 5B7EA 2ZOLA 2IDCA 4LCYB 4RQQB 3PS6A 4FYTA 3D85B 1FGNH 1IGMH 3BPCB 5F3BB 4HISA 1MKFA 2A6JA 5I1GL 3IJSB 5CU9A 1MJJA 4F2FA 3KNBA 2X6AA 1MCPL 3EZ8A 4PRHB 4XOEA 5DI8B 4KVPA 2YLKA 3KPSE 1IT9L 3GSNL 1PF3A 5F70A 1NMBL 1HHKA 2NNXA 1HXKA 2BLFA 4O58L 5EF2A 1H0DB 4KJYA 5ETUB 4G1EB 3N9GL 3QDMB 3VFRB 1BMZA 4WSGA 3JVFC 2K1MA 3HUJB 5K33A 4DP5X 1YEFL 3PL6B 2OP4L 4MZIA 4ZX6A 4BZ2H 2FHBA 3NFPB 5KVFE 4B27A 2AJYL 4PRIB 1BIIA 5E70A 3NN8B 5BUAA 3SDAD 4NSKB 4NKDA 2NY7H 2BNQD 2XIIA 3OGCB 4X4ME 3QEUB 4G42A 4P23A 4P3WA 4JLRA 4A67A 4DAGH 2AV7B 3UBHA 5CN3A 3HI6L 4BXVA 1G0YR 4WWID 1I1FB 1KBVA 3OXRB 4NRYA 3TVMB 5I18L 2LQRA 1FGVL 2ZXAA 3CZFB 4P2OD 3IAQA 1A66A 5IBUB 4MWFA 4ERSL 2H5UA 2Z91A 3ZRFC 5IW3A 1UVQB 5C2BL 4MS8D 1Q0XL 5AKRA 3RJOA 2E7LA 4FQIH 1A22B 1IQWH 4AYFA 2FJFA 1Q94B 5L8KB 3DVFA 1JF1B 5CCGE 2Z8VC 4KMTL 1I8LA 3TBCA 5ESQA 1ONQB 2AXHA 3RTQB 2KZBA 2XBTA 3BPNB 4ABUA 4LPVA 3DO7A 2P5WE 1N8OE 4HHGA 1S7VA 2BVQB 2DKUA 5CN1A 5E7BA 4WI2A 5AVTB 1DUYA 3HS0B 3MRCA 2DQTH 4NKMB 5G4NA 2XN1A 4K7FA 4JPSA 3US0A 1I8IB 1L5GA 4QRRA 5AAPA 5EB9A 3ECVA 4HHAA 4OFPA 1O6SB 4N2FA 4S1DD 5EUOB 2OS7A 1V7MH 3CFUA 1AE6H 4KHXH 1QSZA 3DVNB 1KF9B 1NFDF 2QQNL 3IJEA 3SDAB 3BKCL 1SDDB 2BNQB 2QFRA 3SDYH 1HC1A 2MCPL 5FW7A 3FTWA 3KGTA 4PS7A 3S35H 1J8HD 4ZMPA 3B2UC 3DJSA 2XPGA 4E5XB 5DJYB 2OTWB 3I75B 5JXED 3KPLB 2BP8B 4KVCH 2WLKA 5JXAL 2BERA 1YYLH 1C7SA 4P2OB 3KPRE 3BAJA 5GSVB 2X4TB 1J1XL 1Y1DA 2J88L 1QOKA 2DTSA 5AL8A 4YHYC 1AXSB 1SMDA 3UTSD 1JFQH 2G5BA 4AMKH 5IR1B 1GGBH 2LLLA 4ZXBA 1G1YA 3QJFB 4PLJD 1GJIA 3SE3C 1LQSR 3S5LG 5CGBA 1E2VA 4YHNA 1ORSB 4R5TA 5AW4B 4BSWA 1P6AB 2OYPA 2K3HA 1D6VL 4R7NA 3FUMA 5F7AA 1N6VA 1M6UA 1ZT7A 4DT2A 2JJVA 1F1DA 4PV1C 1AC0A 3BVXA 3LEXA 3LPFA 1DANU 3TASA 2O61B 2SODB 1E8ZA 1AAJA 3RFZB 1P9MC 5T3ZL 3HOGA 2J12B 4JY6A 4WNQA 3TBBA 1L0YA 2VXTL 4E9LA 3P3UA 4E0RA 2CIIA 5KYYA 1W15A 1JG9A 3FQRA 4P5KA 2B9AA 3GMRB 3BJ91 1IEBB 4PPTA 1J8HB 3AS3A 3EJTA 2V9RA 3P30L 4ODHH 3PWPA 4YHOH 2EDWA 3MGOB 2HTLC 2M2DA 3D12B 2A9DA 3FTSA 3V52L 2KDYA 3WDIA 4EI6B 1HZKA 3D48R 4NAJA 2MHAB 1S4IA 3AFLA 3UZVA 1PZ5B 2DJMA 4YZWA 3PGDA 3QRGL 2ALWA 1N64H 1ET5A 3QJVB 3QRBA 3UTSB 1PY0A 3HMXH 4GQ9L 1MCDA 3FUNA 2FH8A 4G80B 4Y4FD 4KQ3H 4MA8H 1M7DA 3MRKB 1KZQA 3VFMA 4KKCC 2LABA 4AENB 2XA3A 1IBBA 3MPCA 1BM3L 3QYMA 5FM8A 1R3KA 3BISA 4JJOA 4IRJD 4J3TA 4OBRA 1CQKA 5JW4N 3GMLB 1H15A 1V8HA 3QWNA 3FSOA 4U1KB 3RKDD 1KV3A 2IIJA 2Z92B 3W0WE 5J11C 3SODB 1N3NA 4IW4C 4M7JH 1QWUA 5HHXH 1HI6A 1PAMA 1TU2A 7PCYA 4YFLF 4OU3A 1CB4A 2F0CA 3NCYP 4KI5C 3FQTB 4I85A 2W5PA 3CSPA 4NENA 1LEKA 4LLQA 5E56A 2P46B 3VI3B 1RZJC 3GHBH 5DEZA 1H3WM 4EKXA 3MRHB 2NCEA 3LKOB 1HXYB 1KGCE 5IVNA 5JHDA 1UQSB 3L9YA 3KL5A 4M8QB 4PGDB 1S5HB 5EWIL 3V2AR 3DURA 3VFGH 4DN4L 4NAQA 1GXEA 1AGDB 4UM9D 3JV0A 4HLJA 2WQXA 3V0WL 5AD0A 1VSCA 4Y4FB 5HI3C 2X4QA 2AEOA 3MBED 1D9KD 5ICYA 2D7OA 2JKWA 4N87A 1BFSA 1TETH 4GIOA 1FAIH 3MNDA 1ZRUA 4XZ4A 3X13B 5DMKA 2MPAH 1O6VA 1T22B 4IRJB 4FFYA 4D9RD 3A6CH 3QH3B 3O45B 5TD4A 3G6DH 3NVQA 1T2XA 2D7TL 2WD0A 3I3DA 4NP9A 1AHWC 3IGAB 1PPIA 3STZA 3SY6A 3QUKB 2W65A 2C3VB 3LIZH 4ACTA 2OMUB 1BBJB 4AVHA 5D6CA 3QQ4A 3HNTH 4XNXL 2EXSA 3HPJB 1A0QL 4ZTEA 1KIPA 1PBYA 4YXLH 2E9BA 4DFIA 1M1XA 3WY3A 1HESA 3OTTA 3F12B 4JCWA 4KKBD 2AW2A 3PGFH 4YHLH 1A14L 3G6JB 4CGUB 4J3OG 5FCUH 2FEDC 1HU8A 4WI9A 1F4WL 3GXPA 3FQUB 1JVLA 4WHYH 4XPTH 1V3JA 1CTOA 1U8HA 2D3JA 4FFWC 3VMPA 5ERWA 1FFTB 2V2XA 3FN9A 3PU7A 4LBEA 4UM9B 1JPFA 1EHLH 2KHAA 4F58L 4CSTA 4MSWA 4PVLA 1LYQA 4PSRA 3WKYA 2FJHA 3MBEB 4Z6AT 1D9KB 5IHLB 1I1CA 4MXVE 3IE9A 1A9VA 5BUPA 3LNGA 4I2XA 3EBAA 1PX8A 4BK8A 3V6ZA 3IGFA 2I60L 1B88A 3LVEA 4XE5B 2F19H 5C08E 2PYED 1QSFA 1MREL 2ZXWB 4RGOH 1YNLL 4P9HL 4WU7B 2IALA 2XZCL 4IS6B 5AVRB 3LN4A 1IC4H 4IRZH 3KPSD 1CGXA 4DGIL 1BQHG 1PZ2A 3MRQB 5K9KB 1HHGA 1HL5A 1SYVB 3BIAX 4G59C 2JV6A 2ICES 4Q9CA 2B1HH 5I1HH 2HJFA 4M5ZL 1DLFL 3I6KB 1JOIA 1FDLH 1MI5D 5B39A 3KPQB 4NT6B 5JHLH 2IGTA 4OCYL 1QKZH 2EIZA 3LN5A 1OANA 1TQBC 5F1IB 4YFEA 5IEKB 3L5WA 1WG3A 3J2PA 4JCLA 3FUFA 3O6LH 2XKNA 4YHIB 4JK0D 3FO0H 3UJTL 1U8NB 5BUGA 2QKIB 3UYRL 2GFBB 3Q0HA 2OJEA 3S4SG 4K7PY 1GZPB 5F1OB 1WAAE 3IXAA 43C9A 5GPRA 4IOSD 4WSJA 1Q9OB 1CVRA 3FNKA 5ESAA 3U46A 3ZTDC 2XOTA 3EYVA 5F6HI 1BF2A 1U4FA 3FUDA 3APDA 3ML9A 4QKTA 5TH2A 3S34H 4DN3H 2V7NB 1INQA 2J2ZB 3MRMB 1FO0H 4PW9A 3Q1SL 2PYEB 3SSGA 3NH7L 1RZ7L 2HFGL 2Y06H 1XF2B 2GK0A 3U2IA 4ZO8A 4AQEA 3C5XA 3KPSB 5EN2B 3QEHB 4O4YH 2P5WD 1NBZA 2P80D 3L1OL 5B21A 2UZIL 1IAII 4BZ1A 5C0FB 1KLFA 5M95B 5HYIA 1YQVL 3AACA 1MI5B 5EOTB 4QTHA 4HQQH 3S96B 4IJTA 1V10A 3DRTA 4DCQB 3R06B 4KXZH 5C0AE 3NFSL 4JFDA 1N4XL 2VC2H 3K91A 4GT7A 4HT1H 3GSRB 4HOMA 2JTDA 1RZQA 3WY1A 1FNFA 1RHFA 4G9FD 5F7YC 3SY0B 2OYKA 5DXWA 1DN0A 3HN5A 2WXHA 1TJHH 1LTXA 5CHNA 3C9NB 1BWWA 3GJFK 2XX0A 4XMUA 4DQAA 4W93A 5I16B 1DHKA 1F8TH 1XTMA 2WXNA 3AM8A 1OZUA 3PHOB 4ZYKA 1XMWA 2VTFA 3R1GH 1F3JB 3Q6FB 1ZT4A 3L7FA 1L6XA 1GCYA 4FQJL 5GRJH 4ELKB 4GYBA 4IBQA 5CP3A 2HLAB 1NC2D 1CBJA 3BKJL 3TN0B 1JD9A 2C4FU 3PYCA 1HHJB 5ABAA 1KJ3L 1AS7A 3BMWA 3P2TA 2ZPKL 5KBNC 5FKPA 4ZPTB 5AVXB 2YEZA 2AZAA 2Y7SA 4QNPF 2P5WB 4JY4B 1FV1A 4YHPB 5K93A 1R5IB 2DIBA 2JFCA 2EDKA 1SJEA 3A6BH 3M17A 4LPCA 3CUPA 2ED6A 4QRQB 4ICXA 5C7XL 4OCXH 1EVUA 5EZLB 1I75A 1FYTA 3M86A 3QUMH 1TYJA 2ZTBA 3MV9D 1RIHH 2A7BA 5AVWB 3B2XA 4MMYA 2L7EA 2YQ3A 2H6PA 5IMOA 3II3A 4ENZA 1U3YA 4GIAA 2CO7B 4G9FB 4OJCA 3ZZLA 5DQDH 4HD5A 1T7VA 1NAMA 4Y5VB 4PJAF 4HS8L 1FYHB 2V37A 1NBVL 3SPVA 3NAAH 4HWUA 1JZ4A 5KVFL 2BIQA 3V4PH 3BX7C 4NAMA 3WL9B 4HBCL 4L8BB 4X9IA 5EHFA 5A2AA 5FYKH 5HHPA 2EXWC 1NC2B 1OV8A 3AY4A 3FH8A 3IFLL 5BV7C 1TLMA 3TF4A 1S7XA 3S8GB 2JQZA 3TPUA 2V9QA 3PV7A 4M4RA 1RKRA 3C8KB 3ARGD 5C9JA 3QDJE 4FNRA 1PLCA 5FYKD 25C8H 4OZIA 3MODH 1TNNA 5EDSA 4XMKH 5FGCE 3WIIH 2DI8A 2BSTA 4XHJD 4J3OC 4IBWA 3H2QA 3G5WA 4KHTH 3VD0A 5ID1A 3ULSB 3G5VA 1KEGL 4LKXA 1FRGH 1W72H 3MV9B 3P3SA 4L8CA 3DOIA 2YFNA 3U0WH 4HUCA 1FORH 1QLRB 2WTOA 3IDYC 2IADB 3R7RA 1PKOA 5E51A 3SQOH 3MXWL 5KBLA 2GT9B 3QEQE 3PWVA 4RESB 2O6FA 3ZO9A 4K8RL 1UJ3B 3BKML 3IDGA 3EGDB 3MHZA 5JQ6L 1Q1JL 4KRNA 4ZFZA 4YDIH 5JPNB 1KGCD 1SOXA 4A6YB 4ZFFA 4DPCX 1SHWA 3ILQC 5GGUA 2NW3B 2JI1A 1GW6A 1XR8A 3DIDA 4RRPA 2NUPB 5DHEA 4PLNC 3HI1A 4L3CB 2KKQA 5T5FL 5IB1B 2G75B 3KR3H 5SX4I 1BX2A 5IB3B 3ARGB 4ZAKD 3ARTA 4TNWF 4K73A 4XBEL 3V4VB 1X7TA 5E8EA 3TF7C 4ODXA 1PY9A 4KTYA 4U0QB 2HVBA 4ZMAT 5GHWH 2VDKH 1MY7A 4TSBH 3VX0A 2JIXD 3TBWA 1QWNA 2HKHH 1WO2A 2P24B 3FQWA 4PGBB 5J8OA 3E9UA 3V5KB 3GUFA 4D0DB 4DGVH 2XKSA 5FYLE 4AQ1B 4X4XA 5E08L 4KRPB 1XCTA 3WIHA 1QFWM 3BLBA 3K2IA 1IGFH 4XCYA 3TA4D 2GHWB 3DX8A 2ZKXA 1KC5L 4ELME 2BP0A 1QX1A 3MRPA 2H1XA 1L3NA 3SKMB 5FWRA 3TA3C 2XYCA 3S35X 2YPKB 1URLA 4UIMA 1BM7A 4JPKL 4L1DA 5ISZA 3TBYA 1JMXA 1KIQA 4PJXE 2L7JA 5T5NG 1KGIA 1AGEB 3WEXB 4OD3L 3BZ4A 4RGMB 2HRGA 3GZPA 2C9SA 4LCWA 4ZDHB 3OPZL 1BYNA 4F7EA 1WAPA 4DZ8B 5DK2A 3UAAA 3IU3B 4U1SB 2CUHA 3BKYL 4YLCA 4LEOA 2FR4A 1A64A 1OEZW 3KPTA 4WWPA 4D9QE 2Z8RA 1YDPB 4QRAA 5CEZE 4Z7NE 2NY2D 4QEGA 1IFRA 2Q10A 4ZAKB 3QFJA 1JNHA 1ZV2A 2OL3H 3QP3A 1OE2A 5ITFA 1P2CA 3NMEA 4XOBA 2VKXA 2FUQA 3MLWL 5GGVH 1OLLA 4HC1H 2JIXB 3UCQA 4NUJB 5A2CA 3FOLA 3MLTA 1LO5B 2H9GB 4PJCA 1KENH 4PV8A 3MLYL 5I28A 4E9VA 5DFVD 1IAOA 4RX4A 2HWZH 4RFEA 2Y72A 4NHUA 1FVDB 4RSVA 4M6NL 4W9LC 3HBZA 1JIBA 3GSXB 1GGCH 4QHMA 4U6VH 5FAAA 2NOYA 3D87B 3P4LA 3GRWH 3T0XA 3ZN6A 2F18A 2JI2A 1ML0A 3WV0A 1YEHH 3HZMB 4AV0A 2WP3T 5ILTL 4YBQC 5C0RH 2J3SA 4B95C 4OGAD 2ROYA 4CUCA 1MW3A 5A3ID 2D03L 3L45A 1J1OH 1YYMH 5E9DA 3LEVL 4U2ZA 4AVKA 1HINL 4I3RH 2ZIDA 2ZUYA 3JWDL 1NLDH 1PMYA 1HE8A 3MREB 4JDEA 1Q0YL 1YRKA 3LNHA 2CKBB 1TYRA 2EICA 4L2YA 2DYSB 4LLYB 4HGWB 3MV8E 2NY2B 3O9WA 4ZMZA 5JW4R 1AZBA 2WSDA 4E41E 4YWGH 2OCFD 2PCXA 2XX1A 1JYNA 4DP1X 1B4JH 5LBGA 3UAJD 3B3IA 4JZNA 5M94B 4UQ9A 2IQ9H 4PREA 1HQ4B 2WKLA 1CGUA 3SQRA 1JN6A 4ICWA 1EBPA 1RJLA 3HA0A 1JGLL 4K3JH 2EDYA 2OYMA 1FNEB 1TJIH 2XPYA 1NA8A 5D4HA 5FYKU 1P4LA 4YLBA 3IKKA 2FLBT 1R3LB 3BWAA 1DQDH 4XMVA 2ATPB 3RDTD 2J5LC 4XVJH 1BQ5A 5I0DA 3IJ9A 4EN2A 5C0AD 2X09A 3H55A 3TWCH 5FA3B 1T1YB 2AJ3B 2R27A 5DD1H 3KS0H 3V5DA 2VL5A 3ZGIA 4LOVA 4OLUL 3TO2A 3SYPA 3B9KD 1OCZB 1UUSA 2QVKA 3L8QA 3T1WA 2Q2LA 2VN3A 5MI0C 2VMCA 3IAPA 3FONB 4M56A 3IJ7A 5PCYA 4U1HB 3MMEB 3I9IA 2WXRA 2WLLB 4XN4A 1IKFL 3HZKB 3JTTA 1R3HA 4IGBA 2R4RH 2MKLC 2XVKA 2JXMB 3D51A 2A6DB 5C07E 4WZ9A 3RU8H 3RWIB 4NWUH 1KB3A 4Y5XC 1OWWA 5E99L 3LSOA 3US9A 4PGEB 2ZP8A 2ZAGA 4N0UA 3UJJH 3DBSA 1VCBC 3MGAA 2R0LL 2Y07H 2R2BB 4ENEC 2LOEA 1JPSL 3UBXI 2DDQL 3QO0A 3QUMA 4NM4L 2CKBL 4OUUB 4PJIF 4QRPE 5EUKA 3MLZL 4A2GA 1GMIA 3CV5A 2V3FA 1R9FA 1TPXC 3QCTH 3GQFA 3BO8B 1BXAA 5J06A 4V1DD 3ZHFA 1WUZA 1YNTA 2NXYC 3QIWD 4Q9BA 2AKRB 5MEPA 3UC2A 3RDTB 1K6QH 5MERA 4NGHH 2RCSH 2WXIA 3C5ZD 1X9UA 3MUGB 5C0AB 3TH2T 1GJWA 3TTYA 2YXFA 3I6GB 1ZEAH 4MNHB 1UZ6F 3D9AH 3N41F 1GOGA 2C9VA 2CMRH 2Q86B 2VM4A 4CMMA 2QVFB 3B9KB 3IMUA 2FWOB 5F7LB 1L0QA 4YXHL 2EINB 3UAFA 3CN4A 4U1GB 3WDJA 4JPQA 3L13A 1ZVNA 5KSBF 4OFYD 2BY3A 2FX7L 1FL6A 3U1PA 1MIMH 3NJIA 1YEIH 1WA1X 4QWWC 2ZUSA 2DD8L 3KYMA 5JO5A 4J8RB 1FUNA 4MTMA 3WFBH 4S1QL 3ESOA 1KV7A 4Q58C 2D31B 1YUKB 4J3WA 5DJ8A 1MRFH 1M7UA 1X9QA 3EYFA 4FQ1L 5K1VA 2P45B 3FSVA 3VXNB 2X88A 3ULVC 4B6ZA 4TLUA 2XG5B 1LO2L 4I77L 3BVUA 4X99B 3HG2A 1MUJB 3QXWA 4KJPD 5ADPH 4PJ7E 3BUYA 3QSKB 4HJSA 1AQKL 2G4EA 3LZNA 1KXQA 2OMYB 2VMFA 5DEFB 3T6VA 4MD0A 1RUKH 1CICD 4O51B 4V1DB 3QIWB 1NGXB 4C56A 5FO9A 4ZS6D 2PPCA 3U48A 4KQ0A 3GLDA 2EE6A 2FIRT 4S10A 4O2EB 3C5ZB 1IBGL 3R7QA 3JXAA 1M3IA 4G6ML 4B9GA 1EFQA 4XAKD 5KG9A 2WK2A 1N70A 1GYVA 2YKLL 4ZT1A 3NK3A 3VXRD 2ZCHH 1OOWA 4F80A 3QWQB 3MOAL 4OF6A 3HPLA 1DVFC 2HVKA 4HXAL 1WIOA 3ARFD 4YBHA 3AQXA 2WM0A 4EDXB 4PHZA 3T6QC 1PZDA 4OCWH 4LT7A 1AQ8A 2BHYA 2YXWA 4UBDD 1ES0B 2XPZA 3H0TB 1RZFL 5EA0H 5C0ND 1M3JA 2BY2A 3O2WH 3O6FD 3SDCC 2DWDB 2FQFA 3OLEA 4IMKA 5F9OL 4DKFH 4AT6B 2IH9A 5FGCB 1L3WA 3ETTA 4Y2DC 3PY9A 5I6MA 3VFWA 1E40A 3DBXA 3GLZA 2N01B 1RZKH 2ZWSA 4PRPA 1QBLH 1U8PB 1CICB 4KDTA 5F71A 1E7VA 5JHBA 5LGJB 2WNKA 1LNUB 4TVPE 4X8JA 5I1CH 5ELIA 3FOMB 5DYOA 1NDMA 2EDTA 5I8OL 1AS6A 5AYQA 1KGJA 4G7QB 4PY8I 5ID0A 5AEAA 5EU3B 1NMAH 4Q9RL 1H3GA 1H8OA 4Y19D 1SOQA 2IVFC 1YAIA 2IAND 3CXHK 2MSPA 2FX8H 5IQMA 3MNZB 5EC1B 3VXRB 1JNNL 1ID5I 1KCVL 4NRZB 2X2JA 4WCYL 5IVXB 1TZHB 4K5MA 3QEQB 2X7LA 5FPIA 3W38A 1V7NH 3BIKA 4FKKA 3GC3A 3ARFB 3ZE2E 3FUKA 1KPVB 2ADYA 1PSKL 4M7LH 2DY2A 1V55B 4XP5H 1U2YA 3PXHA 1M6OB 3NCCB 4LXFA 3V8CA 4Y88A 5EPMA 3QPQD 4FP8L 5LBSH 4YN3A 4JKKA 3ALXA 1HN1A 3D4ZA 3B8SA 3IDNB 4R0LA 5KSUB 1N8ZA 4FFVD 2PPAA 2P52A 1OTTD 3CFDB 1HFUA 3O6FB 4B3EA 4ETQB 5CEZD 5I6NA 3DIVA 5E0FA 1NCNA 3NQKA 3VFVB 2GJPA 1JZHA 3ABGA 1UACL 3ARQA 3HKZA 4WFFE 5IFJB 1ADQA 2QVMA 4Y4KA 1HZHH 3AB0C 4EMZA 3CJJA 5EU4A 1Y6MR 2A9MH 5AB0A 1N59B 2B3IA 3RPIA 4BUQA 5TGBB 4M6OH 4HPOL 5DJ0B 4E68A 4XNQB 1RU9H 3T8XB 4ZJ9A 1UWXH 5T1KD 4P4KA 1UUNA 1ZPLA 5JYMA 1GKOA 4P5TA 1RUMH 2K78A 2RD0A 4ELMB 5AB1A 2HKAA 4GAJH 4Y16D 1ICTA 1UENA 1QLFB 3EO9H 1GGYA 2KH2B 1CE6A 2X5PA 1DSFH 1OE3A 4LQFL 1HEZA 3SCMC 4PJXB 5SWZD 2K9UA 2Q7YB 2XZAL 3HC4L 1LK3L 1T1ZA 2Z9TA 2PXYC 4CMHB 4NOBA 4TQPA 1KYUA 2OXGA 5BW7C 2CG9X 3GLAA 3QS3A 1KXTB 5KW9H 4GKZB 4JFOB 5F7WC 4AGOA 3QAZB 2Y7NA 1H5BB 2DJ4A 4Z7NB 4E41D 2GUOA 3DGDA 4K7PX 1MRCL 3CX5K 2HH0H 2CR6A 4NN6C 3AU1A 2W81C 2FJSA 3OXSA 4JRYA 4ZTOH 2DKMA 5GS1C 1TQSA 1LP9E 4EVNA 2PO6D 4FG4A 1KN4L 2IO5A 3ENEA 4A55A 2XQBH 3OKNA 2F54E 1G6RH 5D72H 3U2SB 4W9IC 3HZVB 4QRUB 3TH3T 5JORA 3T4AA 5F8QC 5T1KB 1I8MA 2OXHA 3UZEA 3OJDB 2NX5E 3CVDA 2WJ7A 3QNYB 5C0GB 3K6FA 1NEZA 2IWFA 4WWKB 2XBZA 1YEJL 2K0RA 3ZL1A 4U1MA 3DX9A 2BSBA 1OAQH 5I1IL 1YMMD 2GB2A 4N2AA 3QXUA 3SGJC 1SJXA 3QDGA 4FQLL 1T6VN 3D8MA 4XN7A 5HDBB 4KI1A 4Y4HC 5FYLL 3V0FA 2PYFB 2MOVA 5GGRY 5E8OA 5AW8B 2XG4B 4OF0A 1UM5H 2EUWA 2ZNWA 4N5ED 1DZBA 1Z5HA 3Q43A 3RWJA 5TE7L 1P4IH 4ZUTA 1PX3A 3DX6A 4LVNB 1AFVH 4J3XA 3D1MC 3OMNB 2AEPL 5C07D 2XVLA 3U36B 3CFNA 4E41B 1KTJA 2H0PA 1XGRA 5E00A 3ARDC 5JW5A 1GC1H 3NJLA 4PWHA 1IL1A 2EILB 2QHRH 3CHXA 2FO8A 4KX8A 4ZX3A 4Y5YB 2R2EA 5MP6H 4M7ZB 4R4BB 2PO6B 3JTSB 3CFTA 5KVGE 1PLBA 3U83A 4DH2A 4P8QA 3I9PA 4MA1C 4QRPD 4X4KA 5AOIA 2BIMA 2BNRE 4F3FA 4A39A 4JQVA 4MDJB 4LNVA 5D7IB 4A7UA 2HT3D 2Z4TA 1XL6A 1CU4H 2M83A 4P2AA 2ZWNA 4TRPH 4L3EE 4K3DL 2WANA 4YZFE 1G9NC 5E94B 3MC0A 1BVKA 3WMPA 1ZLEA 2JJWA 1XF4A 4ZMLA 2VR9A 4U7KA 2E8YA 3UP6A 2XTJC 1G7MB 4IRSC 1T66C 4TQHA 2XWXA 4JN2A 3U25A 1VFAA 1JV5A 3UPRB 1NMCC 3VU2A 2ED9A 4LLWB 4WI5A 1MAMH 4IJ3B 1QYGL 4XPGH 1CURA 1UD8A 1RMFL 2OQJB 2IPTH 3ZTNL 4F1SA 4TSAL 4KTDL 5FOBA 1P4UA 2FK9A 5DZLA 5C07B 4RDQG 4CILA 4ZS7H 4PJFF 2P26A 3KWWA 1OTUC 4IMLB 4PP1C 1ZTMA 3V6FA 3QYNA 1N5AA 1FNLA 4DW2L 5KS9B 1VLXA 4Q56A 1CWVA 3EGSA 1AP2A 2WLHA 4BGLA 1JZ6A 1KEMH 5F3HB 1WZ1H 4H40A 1MH5B 4M1GL 1GPOH 4QRPB 1IAMA 3D4GA 3SDXE 3ZYZA 4TUOA 4LSTL 5EEVA 1FF5A 1UASA 2Y69B 1QLEL 3AT8A 1J9QA 4JFEE 1D7FA 4UT6L 4EBQH 4WW2C 2OZ4H 1U3HD 2UY6A 2ICWI 3A67L 2RR3A 4JDTH 5IROD 5CSGA 3F65A 3V0GA 3PUUA 1KB5H 3KL0A 1CD1A 4BDVB 3HNSL 4G6KH 4K0OA 1DJZA 2R83A 2ARJA 4Z5RA 4PWJA 4GPVA 4D8PA 4Z7IA 1LE9A 3T2NH 3WJMB 2B20A 1UXWA 3UDWC 1A6ZB 1MCPH 3OKLA 2QTEA 3B7YA 3GSNH 4P04A 3FTGA 3TV8A 1TEGA 3VCLA 3UBFA 2Q1EA 1SZNA 3N9GH 2Z35B 4L3FA 1EMTL 2N7BA 3PDGA 3NYKA 1S7UA 4I0PB 3DXAE 2I69A 5K9OB 1O6TA 4TQ8A 1DBBH 2B77A 4MJ5B 4H1LB 4PJ7B 4KU1A 4Q8BA 3QUYA 5IHZA 1A5FH 1KZYA 3DOHA 5HHQB 5ICZB 3THML 2DM2A 4NFBA 4XXCA 1U8IB 3QS2A 1CLOL 1E5YA 3FU7B 2IQAA 2YXVA 4FZEL 1U3HB 5IVZA 2PTTB 4NQSA 3HI6H 1A7QL 1CLZL 4JRXD 5I18H 5GZOC 2VDLH 4QHKJ 5LAXB 2K4WA 5CS7A 1R0AL 3BPLB 5CKGA 3OC8A 1FHNA 1IC1A 4R4FL 1FNSL 2J1KA 3HLAB 1ETZB 4DQOH 2D4DA 1WHOA 4GW5A 3U79A 3PGCA 5I66A 2X4UA 3AMLA 2NYZA 1U95B 2Z0BA 4KMTH 4R2GD 3STLA 4MD4B 4L8DA 4WSKA 4KKLC 1LD9B 4GS7B 1A8JH 2WBXA 4IIQC 2BZ7A 4PQXA 5EFIA 3STBA 3BUPA 4OQTL 3SE8H 3X11B 4HP5A 4XCNA 3D0VA 5KYUB 3WAJA 3FYIB 2WSPA 4N4YB 3KLAA 3ZKXC 3UJIH 3GZKA 4PHXA 4WIQA 5KSBA 3IKCB 1FFOA 3QWOA 4KJWD 3ZKSD 4F8NA 5I1KL 3BKCH 2H1PL 5I1LA 4XMPL 3Q1EA 5F89B 1SN5A 4N1HB 4YBLB 1XAUA 6PAZA 4OGYL 4PCKA 1UOKA 3WN6A 4JKMA 4JRXB 4FQ2L 1DBMH 3H54A 5JXAH 4PG2A 4AJYV 3GF8A 5HI4D 4FNSA 4JM2A 3O3AB 4XOAA 2IPKA 4CVXB 2QR0A 4PCYA 4UYPA 3GSQA 1J1XH 2FCBA 4JRLA 2GJRA 4L4TD 4EPSA 3UTOA 1NOFA 4NO5A 1KTLB 4JFXB 3RWHA 4L1LA 2PNDA 4CC4A 4XVSL 4TUKH 3ZE2B 5DJAA 4EZKA 4R2GB 3SGDH 4UV7L 2WO4A 5H4YA 1D6VH 3E1F1 4UNIA 4UNVA 3G5YA 3B2VL 5F7EH 1YNKL 2O5YH 5EORH 3HE6A 2IMNA 2EVJA 1JK9A 4K71C 2WUBL 3EBIA 1IAKA 1WD9A 3AXLB 1ZSDB 4IM8A 3UYPA 5JDJA 1F1GA 1NIAA 3QUXC 3D0LB 4MAYD 5T3ZH 4PJGF 2VXTH 3QQDB 1C5BH 1CT8B 3Q9PA 3ZE0E 4NOFA 4ZO6A 5AKTA 3R8BB 1JGVH 3W11D 2WNWA 3GGWA 3LXCA 3AG4B 3I85A 5I5MA 1IGTB 4AM0Q 5A7EA 4WNSA 4DPBX 1MFAH 3GS7A 4PMEA 3JUYA 4KKPA 2F54D 1ZA3B 5MEQB 1RAMA 1MLBB 4YIQA 3GB7A 4BRJA 2HP4A 5E8NB 1AQDA 3WE6B 2NX5D 1ZVHA 2LFEA 2RQEA 4ECNA 1EZSA 3TNMB 4L4TB 3QRGH 2OYLA 3RNKA 5CWSA 4W9GC 2MTAA 3I6LE 3QPXH 1DQLL 1E9PA 3ILPB 4TVPL 1RUQL 1SEQH 5CEYB 3OLDA 1I1YA 2XWJA 4Q6IA 2P8LA 2IAMA 2QADC 1E4XL 4AW4A 1CC3A 3RVXD 2F8VA 2Y3AA 2R8SH 4KAQH 5EULV 5L7XH 3PFUA 3C2AH 3F7QA 5BZXA 3VTTA 2DEYX 1QP1A 1OSZA 5DJXA 3AWEA 5IW6A 1I1AC 4JQXA 1MG2C 5E4EC 4CN1A 1SJMA 1BBDH 3TLRA 5AAWC 1RQ5A 2DQGL 4PB0L 4MHHI 4FCAA 2VM3A 4IOIA 1P5VB 1R5WA 5DMIH 1OB0A 4BCYA 4MAYB 2F2HA 1XD1A 2F7PA 2FSDA 5LUMA 2Y1YA 3FCSA 1BLNB 4OLWL 4XBGA 4CSZA 3KMDA 2DQCL 2FWUA 3MA7B 3C60D 4P2QD 2F54B 2BINA 5GSRA 4LMQI 3UTQB 3K46A 3SDDC 2R69L 3CN2A 3B37A 4HIQA 3F83A 5KBMA 1DP0A 3BHBA 4GAFB 4ONHB 2WQWA 3ESUF 2NX5B 4YH6A 3KW7A 4H8WL 4XWGH 1K4CB 2ZD0A 3A21A 4XP9L 2LAAA 2XQYA 3U1SL 1V54B 1A7RL 3EFDL 5IZ7A 3O4LD 1EO8L 4PP2B 4A7VA 3V0WH 4DEWA 4YSDA 2IPUK 4GAGH 3IRPX 4CSPA 4XNMA 1F4XL 2ZT9C 5JOFA 1AGCB 1CDIA 4QKXB 5I1DA 2IXQA 2VMEA 3IDJB 1E4KA 3VRLE 5DK0A 3UFIA 5B4MC 3H3PL 5KYXB 4HUWA 1TZGH 2EEDA 3DROB 4LVHC 4WLCA 5HP5A 4LB8A 3KPMA 3L5JA 1GGUA 4BSVB 3ZK0A 1CDBA 4HKZA 1W0VA 4OF5A 4NO2A 5I0WA 5LWYH 1HCFX 2O6DA 4ZOCA 1W2KT 1SRDA 5LCVL 5B8CB 4MMXB 4NRXA 2W07B 5IB4A 1ECZA 3HHSB 1LE5A 3ARBC 4PH8A 4XP4L 4G7VL 1ZDSA 3C60B 1S7SB 3TU6A 3WO4C 4P2QB 4UZSA 2AGJL 1G5GA 5FYJH 4FL4B 5HYJE 4HALA 5DZAA 3B6SB 4GKOA 1FNHA 1AVAA 4GRLD 2AJSL 1F4WH 4UZUA 3UG4A 1MFEH 3RY4A 4NZ8A 3T2QA 4QOKA 1EEUA 2AJXH 1DEEA 3QA3A 4MA7L 2YXMA 4HJ1A 3ZIYA 3ROOB 4JHWH 1L7IL 4FLSA 1DBJL 4J8QA 4AYMC 5CJOH 1J9SA 1T20A 5DR5H 4ES9A 1CF1A 2IEPA 3N1MC 4AC2A 2UUDK 3GSNA 4F8OA 2W9EH 1XSOA 2WMPB 4FQXA 1TF4A 1MREH 2DQJH 1YNLH 4OCSL 5IM7A 2RJMA 3LPOA 3RX8A 4P57A 5BOZG 5IQ9B 3RIAF 4GAYB 1ILUA 1NWPA 3VXSE 3G08B 1IEHA 1HK6A 2HFEA 4HAFA 4M5ZH 2F53D 1E9QB 4LL9A 2DEWX 1SLUA 4KUZL 2AJZB 4YVUA 4U1LA 2NNAB 5F9JA 3QJOA 3T3ME 1EDYA 2OCJA 3LXUX 3ATBA 2MOGA 5C09D 2MPVA 3B2UD 4PYGA 1BXUA 5FECB 3SDXB 1ET8A 4F5CE 2QGEA 1RK0A 2A3TA 3LNIA 3NSDA 3TCXA 4BSJA 5I73B 4Z7UF 4WFGE 2F8IA 4NC1C 1NPUA 1S7QB 5AW7B 4BCZA 1GH7A 2VERA 5D4JA 3NA9L 3C5JB 4QJ4B 3N1QC 3FQ2A 4JO4H 5KVGL 3L3DA 3WXVL 3LKPA 4GRWE 4BUHA 3LRSA 4HCRH 5HHNA 1DFBL 4X9HA 3DYMA 5DRXA 4LCYA 4RQQA 3D85A 5TDNB 3Q1SH 1LEIA 1J5DA 5TQ2H 4YPGB 3BPCA 3NH7H 5F3BA 1KXVA 1H3UA 3IJSA 5HYSG 4NUPA 2CLVA 4NXKA 4X7DC 3SKJH 5F7HA 4KZDL 5LO7A 4YOKA 3O81A 2OR8A 3MRDA 5DI8A 4GXUM 2EEFA 3EO0B 5C0JB 3MRRA 1NEPA 3SBRA 4B9YA 4HJ0C 5E9NA 1H0DA 3DXAB 3MACL 2FLRT 2CO6B 2IPUG 1Q9WA 2NY4C 2DH2A 2OJ1A 3B34A 4HWNA 5C09B 1KULA 1C1EH 2A4CA 5AL0A 4F7TB 3PL6A 1TEYA 4I13B 4OM1L 4QPEA 4URKA 2HTLD 3NFPA 3CU7A 4H8UA 4PRIA 3L95B 3NN8A 3P0YL 1ZOXA 1YPZE 1MCRA 3QNXB 4LHUD 3OGCA 1PTZA 4HULB 2X1WL 4OD1L 2I27N 1SJHB 4LAQL 2H0FA 4YHYB 5DS1A 1N68A 1Z1WA 2AV7A 1LEGA 1ULVA 3OXRA 2JKTM 4GFXA 4KOCA 3E6FB 4MB3A 1IIKA 1ACYL 3FBQA 5CJBA 3HZ3A 3CZFA 3AGVA 2RAMA 2CXGA 1TVBB 3BKJH 1G9MC 4KKCD 2GSGB 2PPDA 2MCAA 1KJ3H 1UVQA 2O6EA 4IKLA 1ZVYA 5D1XC 5FGBA 3BWUF 1JGUL 5ICXB 2B4CL 2EECA 2X1XR 4M9OA 1I7TB 5I30H 4FXTA 2XXMB 4IDLA 5GS2H 2ZOOA 4JPVH 1HE7A 1ONQA 3RTQA 5DVNA 3UC0L 2FBOJ 2BVQA 5FDWB 3SBWC 3VD9A 1PDKB 2AQTA 4ABWA 2FD6L 2YN5A 4IBTA 4AUYA 4KI5D 1Q72L 1O6SA 3SB3A 4XMZA 2PW2B 2NZ1A 5EUOA 4OJDH 1ZLSL 4PW4A 4C83B 2PMZA 2WPGA 2ZX7A 3SDAA 4G6FD 1BPLB 1A7PH 1SDDA 2BNQA 4LHUB 2KQNA 4X80H 1E4WH 4Z3HA 5BS0A 2JE8A 2CPUA 4MQXC 3OKYA 4HZLB 1MVUB 2F5BL 2JNZA 2Q7NA 2Y7MA 3MUUA 4GI6A 4RMTA 4HS8H 4JBSA 2OTWA 3I75A 2WNXA 1FIGH 3OD3A 3IK2A 1C08A 2BP8A 3MRIB 3ZTCC 3GXFA 4BWWA 5IEHA 4P2OA 5HI3D 3CVHB 1ED3A 3A4AA 5DZNA 3PJNA 2X4TA 2EKJA 3IFLH 1OD9A 3I6LD 1UKQA 4UOQA 1AXSA 1JHKH 2J6EH 1NICA 1X7QB 5IR1A 3F7KA 5ITBH 5B38B 5FYJU 3QJFA 2DF3A 4XI5C 5F1NB 3SN6N 4JANB 5A1AA 1TTAA 2XICA 1CLYL 1WITA 2BC4B 2JSFA 4XPAH 5ACMA 2Y2TA 2B15A 1SOSA 3GT6A 5J11B 1FL3B 4Y2OB 4ZUWB 3PWLB 3HS8A 2A0LC 3FUJA 1USQA 3TOPA 5KUKA 1JXKA 1PIGA 5J6SA 1V3MA 3HR5B 2E0PA 4KXBA 2O61A 2XNAB 4B53A 5GRWA 4BFIB 3IT8D 4CDHA 5D2LF 5E2TL 3IPEA 1YY8B 1UD6A 2OMXB 1KG0B 4G6FB 1TT6A 3N44B 4DGYL 5IJKA 3GMRA 3MXWH 5LN4A 1IEBA 2FEDD 2CBOA 4EZLA 4K8RH 2QQQA 3BKMH 2J4WL 43CAA 1Q1JH 2OMWA 2BSRB 3DGGB 3CG8A 4FFWD 1MCOH 4FXGA 4LSUL 1CXFA 4CKQA 1VKXA 4EI6A 4OFVA 4JKLA 2MHAA 4EAEA 3TFKC 3ET9F 5T5FH 5HGAA 4X7TB 1LWRA 5AAMA 1QABA 1XGZA 2N3JA 2OKMA 2V17H 3UTSA 3VGAC 4HH9A 2YAPA 1HL9A 2AABH 4NKOB 2YA1A 1EZLA 2VXUH 4CNIB 4MGXA 4G80A 5KANI 3NIGE 5T8IA 4XBEH 4N2HA 3MRKA 1OP5H 2BOCA 1F45A 1JZ2A 4AENA 3CVHL 1AHWB 1OAXL 4QHNB 1XB6A 3U4EA 1QSFE 1EHNA 4HK0B 2IDSA 4XO4A 3KGRA 3W39B 4FA8A 1A3ZA 1G1KA 3GMLA 2BHFA 4X6CB 3MV7E 4J6IA 4U1KA 4X9BA 2Z92A 4G7SB 2A99A 2VH5H 3ALPA 3SBQA 1U8JB 3ZKMC 2XWCA 2EUZA 4I3SH 5IBLC 5CKAA 4X6DF 1KDJA 3HB3C 1ZTXH 1JRHH 4JPKH 3AITA 4KUCD 5B39G 2GIMA 3C5SB 1YY9C 4OZFB 3VI3A 1F41A 4AUUA 1CTMA 3FU5A 4JM4H 2BVPB 5BXFB 5KTEL 1ZA6B 3LKOA 1HXYA 1RZJL 2NY6C 3GDBA 1VGKA 1UQSA 5IBTL 3WUWG 1PD0A 4M8QA 4PGDA 1VPOL 1S5HA 3N43F 1GS8A 2JH2A 1IU1A 4LPWA 1AGDA 4HUXB 4XPHL 3UXFA 1XR9B 2FZ3B 4OLVL 1CK0L 2ZWZA 4NYLB 2G0LA 3KYKL 2WLJA 2WJ5A 4RMQA 4X9FA 1MELA 1KY7A 1L6PA 1YUHA 3ME0B 3X13A 2B59B 2KL6A 4OLZH 4L9LA 1T22A 4IRJA 3VFOA 3QH3A 3MLYH 3O45A 1I9EA 5DQJB 5F0JB 3IFPB 3S97C 4OI7A 2IWEA 3GTTA 2GJZB 3VXSD 2J8UB 2Q3XA 3S5LB 1JF6A 2ZWYA 1DBKH 5CN2A 3QUKA 2C3VA 1BBJA 2OMUA 1TQBB 3SYOA 3WNMA 1NPNA 1WAAF 2CJUL 2YPLD 3CZJA 3HPJA 5AW1B 1AY1H 1A4BA 1J5IA 2HT4C 3VUAA 1WS8A 4AEHH 3GHEL 1TFPA 4YPJA 2B0SL 1S5IL 1HAWA 1JZ8A 5SWQB 1XT5A 4NUQA 1XBRA 4QGYA 2ZNXA 4WFGD 5IT2L 2KLRA 5ILTH 1N12A 1IGCH 3F12A 3HNVH 4HEMA 4DKDC 1QNIA 3L1FA 3ZRCC 1CGWA 3NZHL 3G6JA 2YIHA 4PJ9C 1HINH 1YAZA 5DLML 3JWDH 1JHLL 2WOBA 3FQUA 5DA0B 4UMGA 1J86A 2WVSA 2LTQC 5C1MB 4FMVA 2J57A 3R19A 4JRFA 1SQMA 4RWYL 3WKML 4BKLA 3LPPA 3MBEA 5CILL 4FTVE 2J1XA 3FF7A 4B9KC 4F20A 5JIPA 3CBJB 4UT9H 3WFCL 3WTUA 1G43A 1JGLH 2NTFB 2A74C 4Y9GA 5C86A 3LPWA 4O2CA 4HYTB 4MDIB 1JPGB 3L4WA 2ZKWA 3VXSB 5K9KA 1NFIB 3MRQA 1AD9A 1SYVA 3TBVA 5BRZE 3FO9A 2VW7A 5HHVH 1G84A 1R5VB 3WAKA 3T3MB 3ZDZE 3M6DA 5C70A 1W91A 1WFUA 1FN4B 2YPLB 3I6KA 4QT5A 1MN4A 2CSPA 3CSBA 1F1AA 3AROA 1FLRL 3HI5H 1WZAA 3KPQA 5C71A 2YUWA 4HS6B 4K2UH 2BIHA 4NT6A 3V4UL 1ACCA 2JB6A 2VXSL 2KI6A 5DJ2B 1IAIL 4N2LA 2X3BA 1SLWA 1KBGH 4OLUH 3CGTA 5F1IA 2EE3A 1HL8A 3H2WA 4DETA 4YDJA 4L05A 4YSTA 5BV7H 1ZE3H 3WJJA 4YHIA 1U8NA 2QKIA 3H9SE 4QF1B 1WV7T 4AYID 4XP1L 5C0EB 2ZX9A 4LGPB 3MR9B 1IKFH 1GZPA 4YR6A 1HILB 1NAKL 2EXWD 2G2PA 2GBTA 1OALA 1SY6A 3NSFA 3AG2B 2G60H 1Q9OA 1F90H 3EDJA 3QBTB 2X05A 3ZPDA 2OBGA 1TLKA 4J3OH 5E99H 3BSZL 2WBKA 1XL4A 3POCA 4Q4IA 4F37K 4JHUA 2GQHA 5GS0C 5IP4A 2V7NA 3VXQB 2J2ZA 3MRMA 3JWOL 5L4IA 3DIFB 4J3OD 2E7HA 5F7NC 1JPSH 2PYEA 4BFEA 3FQNB 3OVUB 1XF2A 3BD5A 4LK4A 3PAZA 5E2JA 1TZAA 3GXNA 3KPSA 5EN2A 3QEHA 5AYUL 5C0FA 4FLRA 1OAKH 3GMQB 5C2UB 1HNGA 4NBXB 3ALWA 3RVTC 2UXGA 1WBYA 1CG9B 4LEXL 1CDHA 1NGYA 5EOTA 3S96A 3VH8B 3AG3B 3MROA 3Q2VA 4DCQA 1HWGB 3R06A 5J6HA 4HIIB 4D0CA 5DGQA 3X1NA 1K85A 4MFHA 4NJAL 2JB5L 3Q5YA 1YPZB 4HWBA 4X4MA 4Z1PA 2JKRM 4YVNA 1UYWH 4YSAA 4KKAC 3ILQD 5DJDB 2WB7A 3RPBA 4ZMTA 1Z3GL 1T2JA 3QXAA 4EDWH 1QG3A 2FNBA 2WUCL 1QR1A 3DSNB 1OP4A 3C9NA 1I9JL 2UX7A 2VR6A 4IOSA 4Z8FL 5I16A 1CDUA 3GBLA 5CFHA 3PHOA 1PEWA 4A7TA 1F3JA 4N8CL 1YYCA 4FQ1H 4LCUB 4FHJA 4RRPG 1QFWI 4KQ4L 5IQNA 3TN0A 2GPZA 2UWEE 3B2MA 5D71H 5AW6B 4NHCL 3ULAB 3HMWL 1HHJA 5H35A 1ACZA 1BXVA 2EEAA 2ZXDA 1B2YA 3H56A 5IMKB 2V9UA 3FJTA 4ZPTA 2Z31C 4HIXL 5IHUH 5AOJA 2BY1A 3NABH 2WXFA 2P5WA 3CLWA 4JY4A 4YHPA 3MJ6A 4F57L 2CK0L 3NJFA 3DJRA 2XWTA 2AANA 3VI4B 6TAAA 4QRQA 3IDYB 5CGYC 3NSXA 1IBGH 1U3JA 1CFBA 5EZLA 2A6IB 1UEYA 2BVYA 3TA3D 5E1AA 3CN1A 2IWKA 2YKLH 2QPSA 2WO2B 1PG7W 4AM0A 1BQHB 1MZZA 3U6RB 2D0GA 2G0KA 1L9NA 1CIDA 2CO7A 3MI6A 1G1CA 4N90E 3RL2B 1HHIB 2F61A 2V8LA 5J1TC 4Y5VA 1SHMA 2XTLA 2DJUA 1VZIA 3D52A 7FABL 1CDGA 4D94A 4H25A 2PN5A 2VDNH 4KTEL 5K5YA 1DQKA 4KFMA 1BFOB 3KPRA 3K5RA 3REWB 1CYWA 3WL9A 1U8LB 1RZFH 3D0AA 4L8BA 2ORBL 3K80A 5F9OH 4X7SH 2A9NL 1NGWB 3O8XA 3K0YA 3S4SB 4ALAL 2YRLA 1UZ8B 1U41A 5L4JA 3BJLA 4OGXH 3N0PB 3DDFA 9PCYA 3B2DC 1A25A 2PUQT 2NQCA 5BRQA 1UD2A 3VACA 1KSRA 5DRWA 2A38A 1AD0B 2ADGB 3MV7D 1LVEA 4LAJH 5DJZB 3ULSA 5DQ9B 4CBPA 1OXYA 2OCCB 3QT2A 3IMTA 4XP6L 3TA3B 3U4KA 3MV9A 4IEFA 3UTPE 3ESPA 3T8MA 3CMGA 4K9EL 1JNNH 1XH3B 4W4OA 4EE2A 3VG9C 2Q87A 4WCYH 2X4RB 1NINA 2DBLH 3N42B 1GGIL 4YBQD 1D5IH 2IADA 2IV9A 3AXIA 1AKJD 5E2UL 4B9FA 1PSKH 2GT9A 4WEEA 4X98B 4TUJB 1DJXA 3EGDA 2WWNA 3TJEL 3MNMA 2W1NA 1EGJL 4Z7VF 2PTUA 5ECJE 4N2CA 2WKOF 4WI7A 4A6YA 4FP8H 2HYMA 4R7LA 4XX1G 2NW3A 1EDHA 2NUPA 1AG0A 2EDRA 1U33A 4L3CA 5JNYB 2VDNB 2K70A 3VRJB 5IB1A 2G75A 2ESVE 2XZQH 1PVHA 1X44A 5SX5K 3NIGB 3S3SA 5IB3A 4PB9H 4AEIL 3ARGA 4GP4B 4P3CL 1RK1B 2BSSB 3G5ZB 3V4VA 1FAKT 4BD4A 4JFFD 4OCRL 4HPOH 3QG7H 2ADJA 4UTAH 5AW9B 4PGBA 3MV7B 3DJ9A 1O7DC 4FRWA 3V5KA 3W0WA 4D0DA 4GNKB 4U6XB 1X5HA 4AQ1A 1JWUB 3MTXA 3DA0A 1SXAA 1KTBA 4DP2X 1Z5LB 2E9IA 4LLDB 4G8IB 3DJTA 2EH7H 1PZUB 1J0IA 1ZCRA 2YBRB 4HK3J 1AKJB 2JJTC 3ETBF 5CBEA 4FFYL 3NT0A 4OZHE 2DIJA 3UEQA 3IVKB 2YPKA 3HC4H 3I9AA 1K3IA 5EOCH 1QO3B 1LK3H 2YA2A 3KYOB 2O26U 4PJBE 2JJSC 1NH6A 3M7FB 1DQVA 1AGEA 1H19A 3UGEA 2ICEC 3ZL4L 1JDCA 1VACB 4ZDHA 1EEYB 3TZVC 1N0XH 3HC3H 4DZ8A 3IPBA 3IU3A 4IIZA 3NSCA 3HAEB 4NKIH 2SEBB 1YN6A 4AH2B 2IOOA 1YDPA 1MRCH 4ENED 3RP1A 4FTVD 2YARA 3A23A 4ZAKA 15C8H 5B3SB 1P53A 1J8SA 3K81A 2HG0A 1KN4H 1B9ZA 4UOJA 4N0UE 3BN9C 3FO1B 4N8VA 2NXYD 4FJYA 2JIXA 3KH3A 4NUJA 4NO3B 5EU6D 1D5MA 1LO5A 3QJRB 4UDUB 4CL7A 2J5LB 2VABB 3RNQB 4MB1A 5AVZB 4U3HA 3P4NA 3UG5A 5KJ7E 2LU4A 3FRPA 3E7JA 4BA0A 1YEJH 2OMBA 2WTPA 5KAQF 3WTVA 1FVDA 1OGTB 4TLSA 3RURA 1EAPB 3D25B 5I1IH 1RVFH 2V9TA 2EZ0D 4ODVH 3GSXA 4FQLH 5E95B 2R9HC 1F3RB 2ZAHA 3B1UA 2Y22A 3BGMB 1P7KB 1UZGA 5B1AB 5L4FA 4QWWD 4N0RA 1DSWA 3P02A 3MJ9A 5TE7H 3IGKA 3H9SD 5CSZA 4UUJA 1KTRL 3SYQA 3BLKA 4Y5XB 3EW3B 3FFOA 5TQ0L 4PJEF 1UWGL 2VR5A 1BEXA 3BZEB 4GG6E 4XCCL 3MREA 1NM4A 3P11L 4QXTB 2CKBA 2YSSB 1C9SA 3ULVD 5FIEA 4TNVF 1UXSB 4FTVB 4HGWA 4LLYA 5LVEA 1CXHA 4Z0XB 1FWXA 2GAZB 2ZUWA 4XVUC 1IFGA 1N7MH 3GXUB 1TPXB 3HG4A 1HQ4A 2VXQH 5DEGA 4JNXA 5DRNA 4RMSA 3WEMA 3GI9L 2NXYB 4M62L 1IQDA 4OBSA 3U4BL 2ENYA 5EU6B 1P5UC 1G7JB 1JXJA 4LPUA 1DANT 4LLUB 4Z0BH 1FNEA 1TTRA 2I7SA 1W0YT 5BRZB 5KYWB 3TT3L 3ZDZB 5T3XE 3J07A 1F4YL 1SBBA 1WWWX 4B0MB 1R3LA 2CH8A 3MLUH 2ATPA 1KLUB 1IM3D 2DLEA 2AQ2A 4HJGB 5E4IA 1MFBH 3BDYL 3MJGX 1WISA 1DVFD 3BXNB 3GJFB 1I85C 5FA3A 3SIKA 5JA9A 1T1YA 2AJ3A 3P4MB 2LU5A 2N1KA 2YPVA 1TJMA 3FTXA 2NSQA 4FDWA 4M6ML 4OAWB 4WUKL 1GR7A 1AIFB 3UACA 2CJTA 2HFFB 3H9SB 4MDRA 4PWFA 1MIEL 5HHMD 1OE1A 1RMFH 3NIDF 4P0DA 3ZTNH 1WAAA 3N50A 4KTDH 5I5JA 3KWUA 4ZQTA 3FONA 3W81A 4MBRA 1NANH 1TTFA 3MMEA 3BVWA 1AMYA 4U1HA 3HZKA 3LQMA 3SDCD 5B1KA 3BIBX 3O3UN 4B7IA 2JXMA 2A6DA 3V9EA 3NIFE 2FBJL 3OX8A 4N24A 4Y2DD 4L8SC 3UAJA 4NN7C 1P7QD 4OY9A 3VNZA 4XNDA 4AV5A 1N0LA 4TNWK 2DQDH 4KMLB 1FCGA 3WXWL 4H26B 2R2BA 2WLIB 3ZL2A 4XOCA 4TULH 1E5CA 1MPAL 4P48A 4UT6H 1IRAY 4YMPA 4OUUA 5T1JA 5IK3B 4KPHL 4APQA 4LSSH 1FC1A 3ZDYE 1L9RA 1UURA 5T1DL 3BO8A 2H3NB 3KLQA 1OCOB 2AKRA 5T33L 3BEWA 3RDTA 1IM3B 5D7LE 2HG5B 4UIKH 3QRFM 3BLPX 4JS7A 1B2WL 4ODTL 1PLGL 3HNSH 4HETA 3MUGA 4NM8H 5C0AA 1TTUA 1DVFB 4JGNA 3I6GA 4MNHA 4TNGA 2QPDB 4P2CG 2BIPA 1MCFA 3W3BA 3B9KA 5EOQL 5HHMB 1QBML 3D33A 1SXZA 4S0TD 2QKSA 2JELL 5D93B 3V9FA 5FC9A 4ZZKA 4PD4K 3QHZL 1TENA 1ZHNA 1UT2A 3SDCB 5HGHB 1AXTL 4J8RA 2HCZX 3B1TA 4Y2DB 4WW1B 3CBRA 1P7QB 2IBZX 2D31A 2UWEB 1INDL 4KWUA 5FFOA 5DS8A 1AGFB 4PTTB 1NAML 1F3DJ 1MVYA 1BFVL 2LVEA 2NDFA 3GFUA 1LDPL 3IJHB 4Z7WB 5F7UA 5DF0A 2JKNA 3SPCA 3FAXA 2ZZUT 4I88A 3TNNA 1GSKA 4QD2E 1I9RL 5AB9A 1TQWA 4QJ5B 3OHXC 2VKWA 1A7QH 2LU3A 1JZ5A 1CDCA 1FZJB 3CDZB 3EJCA 4O51A 3QIWA 1NGXA 3LH2L 1WD8A 1R0AH 4HX1B 4AZUA 2YAQA 3ARPA 3HVNA 4D2NA 4NZRH 2XWDA 1Y0LB 4R4FH 1FNSH 3C5ZA 3C8HA 3MBWB 2K8QA 3SOBH 3SCMD 4OTXL 4IGBC 4OGZA 5DU7A 1XCXA 1DVXA 4Z7OE 4DVRL 2PXYD 1OAZL 3Q7JA 5CCJA 4O00A 3IF1B 2UZXB 2I07A 4KXZI 4XXDB 5EO9A 4AE0A 4EDXA 2VGLM 5DD0L 2H26A 3FT2B 3EJRA 1U8MA 5F88B 3HZYB 4AGNA 1WP6A 4HF5H 1KCRH 3BT2L 3RY5A 2EVGA 5EEXA 2AQPA 3MKKA 3AB0B 3H0TA 3QC5X 5HJGA 4U6HA 2ESVD 5CINL 5F1SA 2VRAA 1M42A 1A1MB 1CFNA 5EU7C 2DWDA 2H1PH 4YHZL 1KPUA 2IAAC 4AT6A 3VQLA 4LLMA 2L7QA 3L3GB 1NL0L 4PR5A 5FHBL 5KOMC 3JVGC 2PF6A 1S9VA 3OLIA 5MHSE 1NGPL 4LMQE 2VZ3A 4FE9A 4FQ2H 4DP0X 2YQBA 1U8PA 5CJQL 1CICA 5LGJA 4AITA 3FT9A 1JWMB 1LNUA 1A47A 2C9RA 2FE0A 3JWNG 1AGBB 1K8IA 4GEJA 4Y4HD 3RGHA 3MNZA 1U8CB 3P40A 5EC1A 3RGBA 1RP8A 4R26L 4EUPA 1DJIA 4NRZA 1H8NA 1TZHA 3QEQA 2ENJA 3I84A 1EVTC 3ARFA 2W0FB 4LCCC 1WIPA 5L2JB 1KPVA 3RUGF 4P46D 1SPDA 1I7UB 4XX5A 4I3GA 3TT1H 1LP9F 4JHVA 3B5HA 1PNCA 3V0EA 3ARDD 4J5VA 1ROWA 2RIKA 3UO1H 2EDNA 4JDVB 4NN6B 4ZUVB 5IMMA 2E59A 5KSUA 3IDNA 4I1NB 2ESVB 3KAAA 5GS1B 3K4AA 4N2KA 3O6FA 2R0WH 4OKDA 5I1EL 3AWFA 3EOTH 1KN2L 5AOKA 4HVBA 1E50A 5FV1L 5E8PB 2XY2A 1G9NH 4LCIL 5EZOL 3VFVA 2DLGA 3ZDWA 5IFJA 1NOLA 1K8DB 4XNUL 2FJGB 4XB8A 3PPEA 3O3BB 2Z1PA 2YMXL 2JKIS 5IB5B 3VFNB 5D7JB 5DMGC 4O2FB 5I1JH 5DJ0A 5FX3A 2X4OA 4M7KL 4XNQA 1IBHA 3T8XA 4IBVA 4PJDE 2D73A 4S2SB 4DO6A 1GAFH 3GEFA 2XTJD 5EMYA 2VJ0A 3LV3B 2ZYIA 4IRSD 1T66D 2H8PA 4Y4HB 5F7FA 3KVQA 1U6AH 2P44B 1MWAB 4J7RA 3V0VA 3H8NA 3P9LA 5B1JA 2D7NA 4ELMA 4ZTPL 3TV3L 2DH3A 3UCRA 2OSYA 2PCYA 2BIOA 2C9QA 1QLFA 1E4XH 3INUL 3MN8A 3BW9A 4HIHB 3LHPL 4HIPA 4PJXA 2Z4QB 2R0ZL 3RL1B 2Q7YA 4FLQA 4PJBB 3MNVB 5JUEH 1JPTH 1MCEA 4WAFA 5TJWK 1UWXK 4PP1D 1OTUD 4FQHB 3ARDB 1ETB1 4PB0H 3LZPA 1KXTA 1VFMA 4QJ3B 1EWHA 4KDTC 4P06A 4UB0H 1OCRB 1FZMB 2C4FT 4GKZA 4JFOA 4MD5A 4NZJA 1U2HA 4AZ8B 3GTVA 4UZGA 1TCMA 2P9RA 1OHZA 3S37H 4WWNA 4MA1B 5EC2B 3T71A 2CGZA 4BYHA 4R7DA 3OB8A 4RGNC 3EJZC 3X3FL 3VWJA 1KCWA 2W0LA 1NCDH 1KYOK 2JCCE 4H8WH 4XP9H 2XTJB 4KROC 1NBYB 2H0EA 2ARWA 3OJDA 4IRSB 5T3XD 5C0GA 3SGKC 1CJYA 3LEYH 1R46A 4WWKA 2Q8BL 4JMNA 1NMCB 3IMRA 5E6IA 1XSKA 2FEEI 4XO5A 5F7KC 4XBPB 4R0LC 3EDFA 3CQFA 5FUCC 4WI6A 3FFCE 2OMTB 1H6TA 1T04B 4XVTL 1R3IL 3HG1E 3QQ9C 4XAWH 1NCGA 3BVTA 2XG4A 1MWAL 1D5BB 4Y4KC 3T77B 4C58B 1ACXA 1U42A 3FU8A 2CPCA 2KBGA 3SDXF 2ZONA 1EJOH 1RFDH 4ZFOB 3MV8A 4NQXA 3U30C 4KNTA 2V5YA 2M1KA 2X42A 3FPYA 4GLRI 5FCSH 2X40A 4E41A 4KK5C 4G7VH 7CGTA 2ODHA 4OIIL 4WW2B 4P5TC 2H32B 4QUOA 4Y5YA 4PJ8D 4X4YB 4R4BA 1U93B 3DK2A 3UABA 4HUVB 2ITDB 2PO6A 3JTSA 4MA3B 5ACLA 1SN0A 3FT4B 5DVKA 4ABQA 2D7PA 1GS7A 3CCHB 4BWTA 5GZOD 4BH7B 2AJSH 1KNOA 3DV6B 3CHPA 4HJUA 4MDJA 5D7IA 1T21B 3QJSB 3EBGA 5CP7A 1T83C 3M8OL 4NNXB 1L7IH 5E94A 1DBJH 2WXMA 2VZSA 5D7LD 1QBBA 1L9OA 3L5IA 2Y23A 1MHHA 3ZW3A 1PJ9A 3D2TA 1Q0EA 1E8YA 4J23A 1FZKB 1XGQB 1B4LA 4OZGE 4ODBD 4KKLD 2I32A 2NPLX 2VDQH 3UPRA 1NBQA 3HVDA 4YDLC 1WYJA 3HBPA 4NP4L 1TITA 3NRPA 4LLWA 1FHGA 1SM3L 1Z0MA 4F92B 2OQJA 3UZQB 3JWNC 4GW1B 1R6VA 3I02A 5C07A 3NIFB 1JNLL 2G5RA 4KUZH 3T4AC 4IDJL 2HA1A 4G8GE 4IMLA 3B2PA 3UZEC 1UH2A 3MRFB 1RJCA 1A7OL 1D2PA 1XEDA 1DDTA 3Q8AA 4OI9A 5BOJA 32C2B 3UROR 2NZ9C 1IBZA 1MH5A 1S3KH 3BZFA 3MLRH 4QRPA 1TMCB 1ECYA 1M1SA 2WWKT 3MCLL 4ZFOL 1K9TA 3ZDYB 4WTWA 3TJPA 2VWEE 4BK5A 1J12A 3P0VH 5CJ8A 2RH0A 4F7CB 1R24B 3IYLW 3SJVD 2F5AH 5D7LB 1TDQA 3V10A 4LEBA 5D1XE 4PGJA 1HJBC 1B4RA 4BDVA 4OQTA 2IDQA 3QCVL 1I7RB 1FA4A 4TSCL 4IIQB 4O02L 3OV6A 3RILA 4KGLA 4K5OA 6CGTA 4N0YL 1A6ZA 1VB9A 5I8EB 1T2QL 2VDPB 3ZKXB 4PY8J 5AW2B 3QUXD 1BD2E 1NCAL 3X14B 1EIBA 3QPKA 2CDFB 4Q0XL 5BO1L 1ZGLB 4H2CA 4JQVC 4P2RD 1VZHA 3CFCL 3MACH 2YD3A 2FT6A 2Z35A 4NPKA 3EYUH 3APNA 5EZPA 4I0PA 4UILL 3RY6A 2BRQA 1MJ8L 5K9OA 5CIPA 3ZDXE 1MHPL 3DJZA 4EI5A 4UTBH 4TQEL 1JGDB 5DC9B 5I15L 3ZYIA 3S48A 3P0YH 4MJ5A 5I23A 4NQCE 4H1LA 4PJ7A 4RISH 3NDZE 5HHQA 2AVFA 1QW8A 5MHSD 4PY7B 2UXTA 1KJ2B 1U8IA 1UD4A 4HPYH 3FU7A 2OI9C 2ATKB 3SJVB 3FYEB 5IROA 5LAXA 1ACYH 1M2OA 3QWRA 2DLFL 4HLEA 1ZJAA 4G7RB 5BOPA 3CFBB 2LHAA 4NKQB 4ODUB 1K3ZA 4JVUA 2QSTA 2A5UA 1QZNA 5TPWL 1REIA 5GGSA 1ETZA 1JZ7A 5C8JB 2CDGB 1JGUH 4K71B 1HDMA 2B4CH 1XZWA 1I1AD 1T4KA 3EBHA 1D6EA 3GIVB 2W38A 4MD4A 3ZE0F 3QUXB 3EO1B 2K7QA 4NQUA 1ZDQA 3IDXL 4P2RB 3VM5A 3ZT7A 5KYUA 1BQSA 1RXLA 4FMKA 4B0MM 1K5WA 1Q72H 5HTSA 2B5IC 4JG0H 5INCB 7PAZA 3UTZB 4GMTL 3IKCA 3Q3GA 4W9HC 4UOW1 4JFTA 2YJQA 3M7OA 3BP4A 4N25A 1K5NB 3SDDD 2VDPL 3C2SA 2PR4H 4BJLA 5KBKA 4JX0A 5GGRA 5F89A 1PJWA 1WHPA 4OIFA 5F93C 4JY5L 4AQ8A 1QEXA 2VM9A 4F8QA 4KFZC 4PUBL 2XN9D 4OFQA 4HIJB 4JZOB 4MXWL 3WUZA 3DSFH 4H8QA 1KCBA 5DUML 1CFQB 4PV9B 4WK4B 1G9HA 3H42L 3RHWF 3O3AA 4KKZA 5EG6C 3IN2A 4ZNEE 2QADB 2E7MA 5D70H 4RFNC 1ADQL 1QPKA 3WEAA 3CLFH 1E28B 1XTLA 3G7TA 3SE9L 2VERN 1BAGA 1KTLA 4JFXA 3WTXA 1RZKC 1I1AB 2IBBA 5E4EB 3CXDL