2FVZA

Human inositol monophosphosphatase 2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
262
structure length
244
Chain Sequence
WEECFQAAVQLALRAGQIIRKALTEETETDHLVEDLIISELRERFPSHRFIAEEAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase 2
publication title Structure of Human Inositol Monophosphatase 2
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 74
structure length 244
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2fvzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2fvzA02
1FPKA 3D1RA 2Q8MA 5J16A 1FPIA 1NV7A 2FBPA 3RPLB 4GX3A 4GX4A 1NUYA 1LBZA 1IMEA 2Y5LA 2FIEA 1NUXA 1FSAA 5ET6A 2R8TA 5ET7A 1BK4A 1FJ9A 1YYZA 4GWYA 4HXVA 2WBBA 4GWXA 4I40A 4HE2A 5LDZA 1NI9A 2P3VA 1NV0A 4QXDA 2FVZA 4GWWA 3FBPA 3LUZA 1FJ6A 1LEVA 4AS5A 1NV2A 1NV1A 5ET8A 2QVUA 4GX6A 4I3EA 1FPJA 1EYIA 1KA1A 5IZ3A 2DDKA 5EYGA 1SPIA 2CZKA 2FHYA 1VDWA 1IMBA 1EYJA 1FBCA 1FPDA 3LV0A 1IMDA 4H46A 3QMFA 4AS4A 4KXPA 2WEFA 1INPA 4GBWA 1YXIA 3RPLA 4MJOA 1FBEA 1K9ZA 2PCRA 2P3NA 1DBZA 4HE1A 2CZHA 1FPGA 2F3BA 5EYHA 1G0HA 2FIXA 1LBVA 2QFLA 1RDXA 2QVRA 2VT5A 3IFAA 1NV4A 3KC0A 2F3DA 1AWBA 1G0IA 3BIHA 5EQ9A 3IFCA 5T3JA 1LBYA 1IMAA 3B8BA 1NV3A 2HHMA 5ESYA 1QGXA 1FBGA 1K9YA 1CNQA 2BJIA 4FBPA 5DW8A 1FBHA 1JP4A 2GQ1A 4GWSA 5F24A 3T0JA 1FPEA 1Q9DA 1FPBA 4I3YA 2Q74A 4G61A 1KA0A 1LBWA 1NV5A 5EQAA 1DK4A 4O7IA 1LBXA 5FBPA 4GWUA 1FPFA 2CZIA 1NUZA 5EQ8A 1FBPA 1XI6A 1FBDA 2Y5KA 5EQ7A 5IZ1A 5A5LA 3A29A 1RDYA 1DCUA 2JJKA 4PTKA 1NV6A 1FPLA 2OWZA 2QVVA 1FTAA 3KBZA 1KZ8A 3KC1A 1D9QA 4IR8A 1NUWA 1IMFA 1EYKA 2WBDA 5ET5A 1RDZA 1FBFA 2OX3A 4HE0A 4GWZA 4GBVA 1FRPA 1YZ0A 5IZ3B 3BIGA 3ROJA 1IMCA 4H45A 4N81A 5I3SA 3RYDA
chains in the Genus database with same CATH superfamily
3ECRA 3MP6A 4ESXA 3OENA 1B58A 1UTBB 4GWYA 4EXLA 3TTMA 3RTFB 4NWDA 4PFYA 5K2XA 1FQEA 4N17A 1T0KA 4NF4B 4PFUA 4ZEIA 1N76A 1LB9A 5EYGA 2UYEA 3U8QA 1POY1 3FJGA 1ZLQA 2Q89A 4WXJA 4AS4A 4YB6A 1M5BA 4R6KA 3T9HB 3KJ7A 2KR0A 2VPNA 4NQ8A 2F35A 4XFEA 1ZKBA 3HCQA 2O69A 4FE8A 4HW8A 3IO4A 3BIHA 3IFCA 1LLSA 1USYH 3B6QA 3BFTA 3KOSA 4R2FA 3THIA 5ESYA 2PFZA 3HV1A 4IGRA 4QFNA 1XT8A 3EHTA 1SQYA 4MH5A 3MYUA 4AB6A 4G4PA 5BWJA 1AH5A 3H6WA 4YKJA 2WX9A 1O63A 1DMBA 4GRKA 4ZEDA 1OIBA 2O6AA 5CMKA 4OTEA 4H8IA 4MHFA 2Q2CA 4GOTA 4DDDA 4RY1A 4HE0A 4QFPA 4RNSA 4MLQA 3MPKA 3FUZA 4KCDA 2DSFA 1MPDA 3EPEA 4N4UA 1BKAA 1SBPA 2UVGA 3TTKA 3ZSFA 2HAUA 4QSDA 3QIMA 4PCDA 4ZZAA 5EHSA 1NH8A 3PD8A 1VSOA 3MW0A 3U65A 3IAZA 1YTVA 5TPAA 4NF0A 2D21A 2ZXTA 2ZYMA 3K0VA 1FTJA 2A5TA 4XTCQ 1FPJA 1B3LA 2XD3A 5I59A 2Y7RA 1FBCA 4IGTA 1D9VA 3LV0A 1SVXB 3EHSA 5F7VA 4H5FA 1INPA 1IQ7A 2BJJX 4NN3A 1P1QA 3E79A 2M8CA 2RCAA 2V3QA 2UXAA 1Y20A 2F3DA 1Y3NA 4MNPA 2PFYA 4QHQA 3C4MA 3CFXA 3QXMA 3TCHA 2B4MA 1OQGA 4RYAA 1CNQA 1M5CA 4TLMB 2AL4A 2DS9A 4YICA 5FTHA 4M1VA 4GWSA 5AA4A 2Q74A 4GIZA 4AB5A 4BLAA 2Z8FA 1SD3A 2D5WA 4JVIA 2Y5KA 3FGSA 3MC2A 2F34A 4TOZA 2ZYOA 2AL5A 4P1EA 1B5HA 4XIGQ 3C33A 1IMFA 4NHBA 2Z8EA 4BDQA 1FRPA 1I69A 1MRPA 4Z7EA 5J16A 2DQVA 4F3SA 4C0RA 2FBPA 2OJTA 2AIXA 4POXA 3TQLA 1NUYA 1L5TA 1IMEA 4PETA 3OMBA 1NUXA 3ODBA 4XF5A 2GHAA 2OWTA 5ET7A 2DYXA 2Q8JA 5I2NA 2CZLA 2P3VA 3E13X 4BDOA 4DXUA 3N26A 5H8NA 1NNPA 1OVBA 1NV1A 2XHDA 5DVIA 4EQ9A 2LAOA 3KFMA 4G68C 3QSLA 2HZKA 3T93B 4NF5B 4OFJA 5JK4A 1OQHA 3R6UA 1QW0A 1AL3A 3TUSA 2PCRA 1VE4A 1JW5A 1TFAA 1MY2A 3RPWA 5EYHA 2PYYA 3IFAA 3MPLA 1HSLA 1AWBA 4U1OA 5KDTB 5DEXA 2XXVA 1IMAA 4PGNA 4JVDA 4PFTA 1TXFA 2RINA 4HS7A 2V3TA 3RQTA 5AA2A 5ITOA 4MFIA 1FPFA 2I4CA 5EQ8A 1GGGA 4NMYA 3FJ7A 2HCAA 4K3FA 5H8QA 1B7HA 3SKPA 4ZDMA 4X1DA 2I4BA 3G3FA 2XXYA 5DYHA 4P0GA 3QYTA 4N81A 5I3SA 2NUVA 3K1PA 4PDDA 1WODA 2DOJA 4GXSB 3FXQA 1POTA 3TYHA 5FHMA 3KN7A 2V3UA 2R71A 1MY0A 4ISUA 4OWDA 1YYZA 4ZE8A 1IXGA 4OZ9A 4N13A 5CM6A 5I57A 3MP8A 4E0XA 4U4XA 3LUYA 1LEVA 4ZEFA 4OVPA 1MQIA 4H5GA 2Z8DA 1FPDA 1LFHA 3KZGA 3N6UA 4P3LA 4BDRA 3FD3A 3IB0A 4LN5A 1LBVA 4HCYA 1NV4A 3SEVA 4X8RA 5T3JA 4JWOA 1LBYA 1FQDA 3PMWA 2DWJA 4JSDA 1FBHA 3HSTA 4I62A 5I58B 2CZIA 3HFUA 2F78A 4LA9A 4QFOA 4GD5A 5A5LA 1A54A 5L8DA 4LP2B 1QULA 1AOVA 1I6BA 3U1OA 1B7UA 3IR1A 2REJA 3TPAA 4GWZA 5CRYA 1B6HA 4WKMA 3GBAA 3LBSA 3B7DA 1SW2A 4MF3A 4DZ1A 2REGA 4IO6A 3B6TA 4JXIA 4JWYA 4GX3A 1LBZA 4OERA 5I84A 1R9QA 2GFEA 3KGCA 2ZZWA 4N8GA 3TTLA 4HE2A 5I7IA 4LATA 2NOOA 2YJPA 5IZ3A 1IMBA 4RA1A 2Z22A 1URDA 4NF8B 2UVJA 3QMFA 3MVYA 2ONKE 3K6XA 1MXVA 1DSNA 2F3BA 2QL3A 4IO5A 4QSCA 4U4SA 4R6HA 3N94A 1M5DA 3B8BA 3SEXA 3SEYA 1N7XA 4OFOA 3FVKA 2XXPA 4F3GA 1SI0A 2GQ1A 5F24A 3V83A 3PPRA 4FEDA 3EKIA 4TQUQ 4GFRA 5CBRA 1DK4A 1LBXA 1CE2A 1B3GA 3CIJA 3OO8A 4ESWA 2WKYA 5JTYB 4WEDA 3IL1B 3TFLA 2XXQA 4G68A 4F3BA 2DP8A 4DIGA 1MG1A 4FJPA 5AA1A 4GL0A 3LSWA 3FXUA 4GBVA 2HQ0A 4U22A 3E4RA 1SW1A 3U94A 2ESNA 1DTGA 2ONRA 1JW4A 1OVTA 4OVJA 1Y9UA 4MX6A 4GX4A 2CMOA 3K1MA 4GF8A 2XX9A 4KYEA 2VOZA 5TP9B 3MSTA 5CMMA 3P7IA 4LQ5A 3L6HA 2ZNSA 1SYIA 5DVFA 4YMAA 2QRYA 1XC1A 5EHMA 4NAPA 1MXYA 1Y4TA 1MQGA 2IA4A 1MM6A 4UABA 4YKIA 2Y7PA 2QVUA 2FA7A 1AMFA 2NXOA 2FHYA 3FATA 3TTRA 4XEQA 4KXPA 3S9MC 1ZMGA 4MIJA 4FATA 3Q25A 2F97A 4MAGA 2O51A 1G0HA 3SESA 5I2KB 5DTBA 2IEEA 3LC8A 4ECFA 2KLFA 4MNIA 3NOHA 2FYIA 1JQFA 4F29A 1GR2A 4GWOA 5FHNA 5A5XB 3CR9A 3RTWB 4QFKA 4KI0E 3G3KA 1UIVA 3T9VA 2X7QA 4KR5A 2OCUA 1GVCA 1MH3A 3WAFA 3H06B 2XXXA 1MY4A 4G2ZA 5ET5A 1XVXA 2O7UA 3K6UA 4C1UA 3BIGA 3CG1A 3PUZE 4IO4A 3ZKLA 1A8FA 1TFDA 2Q8MA 2V93A 2RC7A 2L5VA 3BKIB 4X04A 3GBBA 1Z7NE 2XXUA 3RPLB 2OWSA 3K6WA 2ALUA 4Q30B 1R1NA 4QF9A 1AIVA 3E78A 3IK6B 3PTYA 1UIUA 3KN3A 2VD3A 3DP4A 1NV0A 4QXDA 3VDFA 3CFZA 4G8MA 1FJ6A 3OSRA 5B70A 3MBPA 5HBCA 3OO9A 1M5FA 4I3EA 4DE8A 1KA1A 2HZLA 2DDKA 3G3GA 3VXBA 3F11A 1BIYA 1EYJA 3TAJA 1H45A 1LBBA 3Q26A 2W7YA 4P56A 1PEBA 3O66A 1FBEA 3MZBA 4UA8A 4IB2A 3PMXA 1RDXA 1N3XA 1LAFE 2ZZVA 4KYDA 4ELRA 2O84X 3PUWE 1EZPA 2O1LA 1NV3A 1B3HA 4PQJA 4HCWA 3R26A 2DE3A 3CHGA 2HPGA 3IB2A 4C1TA 2CEXA 1N0TA 4YU0A 3G7WA 4ELQA 2Z23A 3FASA 3SDFA 1RKMA 3CSBA 4DI3D 3UORA 3A29A 1USYE 5KCJA 1NNFA 2F5XA 4OVRA 2XWKA 4N91A 1FTAA 4XKQA 3KBZA 2F6PA 2OPEA 4QSEA 2O1MA 4GQOA 4PE3A 5ITPA 4LZ5A 3A3UA 4FEBA 3VVEA 4YAHX 1FPKA 4U1ZA 1S7YA 2XX7A 4KHZE 1UQWA 3MJNA 1FJ9A 1NH7A 3V8XB 4EQBA 5L9OA 4I40A 3QK6A 4DCXA 1IEJA 4KYSA 2FVZA 2X26A 4HTGA 4UACA 4PC9A 1H43A 1FW0A 2NWJA 5AE4A 3T9UA 3H7MA 2QSXA 4KPTA 1O64A 3MAMA 3FV1A 1TWYA 2HAVA 4XKNA 4MEVA 3M3FA 4GBWA 1O7TA 4PFIA 3I3VA 3HPIA 1I6AA 4PAKA 3K1NA 1FPGA 2A5SA 3FV2A 2ANJA 2VT5A 4ONYA 1G0IA 1A7LA 3D4CA 2QJEA 2OPDA 2DWIA 4MMPA 5ICTA 3VVDA 5DW8A 1IXIA 3MVXA 1Q9DA 3CVGA 3C35A 5EQAA 5FBPA 3HO7A 3D4GA 1A8EA 1LCFA 2Q2AA 4O8MA 4RPNA 1UTHA 4EF2A 2VGQA 3O97A 5TPAB 1NUWA 2V84A 3FXRA 3MVWA 1EU8A 4ZZEA 3IOWA 4OESA 2A5TB 1II5A 1P1OA 2H25A 3OEMA 5I59B 2DWHA 2ZYNA 4Q0CA 1B40A 4EQ7A 4IO7A 4F1UA 2FIEA 3IJOB 2F7BA 2XWVA 5KZTA 1URGA 2D3IA 4OYVA 2HXRA 1B5IA 4PFBA 3VE1B 1LCTA 4BDMA 4H65A 2VHAA 4F1VA 2GRVA 3A3CA 2AYSA 3MQ9A 1Y3QA 1DTZA 4R9GA 4NGUA 3OO6A 3FVNA 1A99A 3VV5A 3O6GA 5AA4B 2HXWA 2V4CA 3EQ1A 2RCBA 5CC2A 5CBSA 1RYOA 2ZMBA 2B65A 4O7MA 4P47A 1PB9A 3VXCA 3MUQA 3OXNA 4N8YA 1LAXA 3DP8A 1ZBMA 1Y3PA 3OEKA 4F1YA 2I3WA 2PT1A 4M4GA 4RJZA 3UGWA 1Q1KA 1TT1A 1YAEA 2XWIA 1PDAA 4KQPA 5I5PA 4O3CA 4GVOA 5ELVA 1FBPA 1FBDA 4WEPA 3TELA 3G3JA 5L9MA 5I2NB 1FQBA 3EHUA 5JTYA 2XXWA 5I56B 4PBHA 1PBQA 3MZ9A 1US5A 2F36A 1MDQA 2WBDA 1NL5A 5JEIA 3N6TA 3ONMA 4O3BA 3OSQA 3D1RA 3GXAA 2I3VA 2NVUB 5F1QA 1RYXA 4G8HA 5H8FA 1FSAA 4EF1A 2F7CA 3Q27A 2RC8A 2X7PA 3E3KA 2DXYA 4PAFA 5DEXB 1NI9A 2XXHA 4MBPA 5TU0A 3K02A 4P0IA 1J1NA 3AXFA 4GX6A 1MQDA 1FTLA 4RK2A 4TLLB 4FORA 4ZS9A 4ELPA 2MKZA 3MP1A 3B6WA 3C31A 4NG7A 5J1DA 1YXIA 4QFLA 4X1BA 2XXRA 1B4HA 3FVGA 4R9FA 1UTBA 3KG2A 5H8QB 5BUUA 2R6GE 4N07A 5EQ9A 1N3WA 1B7ZA 4GXAA 4H6DA 4H8JA 5I2KA 2OK2A 5B7DA 3T66A 1B2HA 4NF4A 2BJIA 1LAGE 4FAJA 5DT6A 2F7AA 3VLVA 3ILUB 3S4UA 1P1UA 2HEUA 1H3DA 2GHBA 1P99A 1RDYA 4PDHA 1SYHA 2XX8A 2QVVA 5I57B 1KZ8A 3USDA 3TDJA 4F3PA 2B3FA 3HHFA 4THIA 5FHOA 3PPNA 1FCKA 3B50A 3IOTA 4LQ2A 2DVCA 3JYRA 1NKXA 3W15C 4NF6B 3PUVE 4LUBA 3RLFE 1SW5A 5EYFA 2UVIA 3RY3A 4F39A 1MY1A 3KSXA 1N7WA 2PVUA 1FTMA 2CEYA 1WVJA 3GLBA 1LAHE 2WBBA 4N6KA 4I9DA 4YZZA 2O68A 3SZPA 4P11A 1BTJA 1NNTA 3UP9A 1SPIA 2CZKA 2G93A 4O94A 1IXHA 1IMDA 5FTIA 1JEVA 3H03A 3V89B 3PU5A 4G8NA 3O9PA 4F22A 5IAIA 1XVYA 3JZJA 3DP6A 3VLWA 3EN3A 2H5YA 4OENA 5M2VA 5HM4B 2HHMA 2P1SA 1MM7A 3EF7A 4F31B 1B0LA 4P9KA 4OHNA 3S9EA 2H9BA 1LBWA 3IOVA 4N6PA 1N04A 1KWHA 5EQ7A 3O29A 3T22A 1B52A 4PFRA 1LB8A 4FECA 2UYFA 3TQWA 5AA2D 1P1WA 5H8HB 4IR8A 1EYKA 4MNCA 4QBAA 4OETA 2WYKA 2P0SA 5IZ3B 4OANA 2VPOA 3LR1A 4X48A 1VFEA 3ZS6A 4H45A 1US4A 1MS7A 3KSJA 1B46A 5CMBA 1JVYA 4JB7A 2ABHA 3H4ZA 1IIWA 1DPPA 2R8TA 1B3FA 1XOCA 4XKRA 1NNKA 1P1NA 4GWWA 3TMGA 3TEPA 1NV2A 5ET8A 2H98A 1MY3A 2ZNTA 1MPCA 2OBGA 2V25A 3C32A 1PBPA 5AA3A 3QUFA 4H46A 3RUMA 4IY5A 1MQJA 1MH4A 2ONSA 1N84A 3JV9A 4JWXA 1D9YA 3PPPA 1CB6A 4HE1A 3R7XA 1SW4A 2QVRA 4RPOA 4F18A 3KC0A 1I6QA 4G68B 4Z0IA 2ZNUA 4NEDA 3BFUA 3RT8A 3Q29A 3FVOA 3RGYA 3CI8A 5L9SA 2PMSA 1M5EA 1FTOA 2DVZA 2ZYKA 4AQ4A 1YCJA 3LSLA 4NF5A 3C9HA 4O7IA 3SERA 1LGBC 2I6EA 3LSFB 3OOAA 2XWOA 4E0WA 1SDXA 3T9XB 4PTKA 4DLDA 1FPLA 2OZZA 2H4IA 3KC1A 5KDTA 4L17A 4ELOA 5CI5A 1FBFA 2F8DA 2DWAA 4IO2A 4PF6A 1Y4CA 3ROJA 1OLAA 4ZECA 3RYDA 1JVXA 4QRZA 3PGFA 4I8CA 3PPOA 4LONB 1BLFA 2I0CA 5ET6A 4GL8A 3RN8A 1JEUA 3CSGA 4Q8RA 1QKBA 3K2DA 3VFJA 5IZZA 4NTLA 3DLNA 1LFIA 1ANFA 2WYPA 3G3HA 3M3KA 4AS5A 1ATGA 3GZGA 4U2RA 3U93A 3H3GA 1BP5A 1FQCA 1EYIA 3MVZA 1FQFA 3FXBA 3ZKKA 1ZJLA 5LOMA 2O7IA 3UN6A 4MJOA 2DE4A 4N15A 4OQOA 1B0HA 2DXRA 1SI1A 1F9BA 2Q9TA 1QGXA 1FBGA 3PUYE 3IX1A 3K4UA 4JSOA 3O2AA 1JNFA 1D3KA 3LSXA 5LTCA 3BBRA 1FPEA 3PUXE 1H76A 1NV5A 4GWUA 2VD2A 3FZVA 1EZOA 3QUJA 3RT6B 4OA4A 5IZ1A 3M8UA 1ELJA 1GTKA 3UA8A 1LBCA 1FTKA 3TCFA 4OFLA 1D9QA 1S9TA 2RC9A 3H6VA 4PFWA 1RDZA 1A55A 3FIRA 4DCYA 2Y7WA 5I56A 1ZTYA 3W9VA 4OVTA 2XXIA 1Y1MA 3K00A 2XD2A 4EUOA 3UIFA 4P1LA 4XXUA 4GLIA 4IY6A 1FPIA 4PF8A 5IM2A 5I58A 1LSTA 4DXCA 1BK4A 3DELB 1MXXA 3E9XA 1A40A 1D4NA 4PAIA 5LDZA 3SEUA 4F2QA 3MZ1A 2Q88A 3S2VA 3O6IA 3MWBA 1VR5A 4JVCA 3VVFA 3T1BA 3S9LC 3WAEA 3PV0E 4LZ7A 3I5OA 4NWCA 4EDPA 4N6DA 1MQHA 1QKAA 2WEFA 1K9ZA 2RKMA 4U21A 4Q5TA 4IO3A 5KCJB 4R72A 2R9JA 4ND9A 3U92A 2PT2A 1QUIA 4H0WA 3I6VA 2E1SA 1B3EA 4NX1A 5DVJA 4F2OA 2THIA 2G29A 2XA5A 1K9YA 3CRBA 3PMVA 1VFDA 2H99A 1JP4A 3OO7A 4PE5B 4R6YA 3OELA 4G61A 2QMXA 4NF8A 2QS3A 5CMCA 3M3LA 1GV8A 3IORA 3KN8A 3C34A 2JJKA 3TZAA 5K2YA 1NMUA 2QS4A 1B9JA 4OVQA 4I1DA 3U72A 3IOUA 3KOTA 1B1HA 1PB7A 1MPBA 4YKPA 1YZ0A 1MDP1 3KEIA 2ZZXA 1B32A 4YMBA 1Z7ME 4R2BA 4KCCA 3T96B 3K01A 4G77A 1NV7A 4NF6A 4OEVA 1B51A 4H67A 1NFTA 2DE2A 2FNCA 5H8NB 3SETA 4GWXA 3TCGA 2UVHA 1XHYA 2B3BA 3A09A 1QUKA 4NE4A 5H8SA 3HHGA 1QVSA 1DOTA 1VDWA 1FQAA 2RF1A 3O28A 2QS1A 4O3AA 2P3NA 1DBZA 3K6VA 1UTHB 1HSJA 3ISPA 2QFLA 5TP9A 4F19A 2B4LA 4R73A 4EXKA 2P2AA 4KD5A 2I0BA 1ZU0A 2OLBA 4R75A 5AA2B 3IO6A 3PD9A 4OXVA 4FIMA 3T0JA 3FJMA 4I3YA 1KA0A 1Y1ZA 3W9WA 1MXZA 1WDNA 1NUZA 3QAXA 3TODA 1XI6A 1DCUA 3RNNA 1NV6A 3OD7A 1S50A 3TTNA 1B5JA 3CG3A 4OMBA 4BDLA 4DXBA 3O6HA 4OVSA 4P8BA 1OLCA 1LFGA 1IUDA 2OX3A 4ZE9A 5H8HA 4RXLA 1IMCA 1Q35A 5A5XA 3G3IA 4YKKA 2PX1A 2Y84A 1DPEA 3TKDA 2F6GA 5HPQA 4ZEBA 3DM0A 1HSEA 1JETA 2Y5LA 3UK4A 4KFQA 4DI4B 4HXVA 4MLVA 3FBPA 3LUZA 2KQZA 4U23A 1PB8A 2XXTA 3KJTA 4YB7A 3ILTB 4PP0A 3VLUA 2GH9A 2I48A 2XXKA 1H44A 1B1XA 3Q28A 1YPNA 3IJXB 2Y7IA 1URSA 1XS5A 2VP1A 1IITA 4BDNA 3RPLA 2QS2A 2CZHA 2E0SA 3S9NC 3C36A 4PBQA 2FIXA 3IB1A 1B4ZA 3N5LA 1QUJA 2YLNA 1OMPA 3H6UA 1QJMA 1EH3A 4XKPA 1MXWA 3CFLA 4X9TA 3L6GA 2YPNA 1R9LA 2PBWA 3KBRA 1MXUA 3HN0A 4FBPA 2Y7KA 5ISUA 4LVQA 4MCOA 1FPBA 5IGAA 4YB5A 1R6ZA 4PGPA 5H8FB 4JBZA 4POWA 2QMWA 4ZEKA 1B05A 5ICQA 1EZ9A 1IZ1A 1IXCA 2OWZA 4LZ8A 2I49A 5IKBA 3SEWA 3V5AA 4OEUA 3PPQA 3GYYA 4RK9A 2QPQA 2I58A 4H1XA 2HFBA 3H6TA 1JW1A 4JDFA 1PC3A 4R74A 1ZIUA
chains in the Genus database with same CATH topology
4GX3A 1LBZA 4F1UA 2FIEA 2XWVA 5ET6A 2HXRA 4PFBA 4GWYA 2ZZWA 4N8GA 4F1VA 4HE2A 5IZZA 2WYPA 5I7IA 4NGUA 4AS5A 4N17A 5IZ3A 1EYIA 5EYGA 3FXBA 1IMBA 2V4CA 3QMFA 4AS4A 4MJOA 4O7MA 4P47A 4NQ8A 2KR0A 2VPNA 2DE4A 2F3BA 4N15A 4XFEA 3BIHA 4N8YA 3IFCA 3B8BA 2Q9TA 5ESYA 1QGXA 2PFZA 1FBGA 5LTCA 2GQ1A 5F24A 1FPEA 2XWIA 3EKIA 5I5PA 1NV5A 1DK4A 1LBXA 3MYUA 4GWUA 1FBPA 1FBDA 4OA4A 5IZ1A 2WX9A 1D9QA 4PBHA 4MHFA 2WBDA 1RDZA 4HE0A 4GBVA 3W9VA 4OVTA 3D1RA 4N4UA 4P1LA 1FPIA 4PF8A 5IM2A 4MX6A 4GX4A 4PCDA 1FSAA 1BK4A 3MSTA 3U65A 4PAIA 4PAFA 5LDZA 1NI9A 4NF0A 4NAPA 4UABA 2QVUA 4GX6A 1FPJA 4JVCA 2FHYA 3T1BA 2MKZA 1FBCA 3LV0A 4XEQA 4N6DA 4KXPA 2WEFA 1INPA 4NG7A 4MIJA 1YXIA 5J1DA 4NN3A 1K9ZA 3E79A 2V3QA 4MAGA 1G0HA 2F3DA 4MNPA 4MNIA 5EQ9A 3NOHA 4NX1A 2PFYA 2XA5A 2B4MA 1K9YA 1CNQA 2BJIA 4YICA 1JP4A 4M1VA 4GWSA 2Q74A 4G61A 4JVIA 2Y5KA 1RDYA 4PDHA 2JJKA 2QVVA 4P1EA 1KZ8A 4OVQA 1IMFA 4NHBA 5ET5A 3B50A 1FRPA 1YZ0A 3BIGA 2ZZXA 5J16A 2Q8MA 2L5VA 4X04A 1NV7A 2FBPA 3RPLB 1NUYA 1IMEA 4PETA 1NUXA 4XF5A 3E78A 2DE2A 5ET7A 3PTYA 2CEYA 2WBBA 4N6KA 4GWXA 4YZZA 2P3VA 1NV0A 4QXDA 1FJ6A 3SZPA 1NV1A 4I3EA 1KA1A 2HZLA 2DDKA 1SPIA 2CZKA 4O94A 1VDWA 2HZKA 1EYJA 1IMDA 5JK4A 4P56A 1FBEA 2PCRA 2P3NA 1DBZA 5EYHA 3ISPA 2QFLA 1RDXA 2ZZVA 3IFAA 4F19A 2B4LA 1AWBA 1IMAA 4PGNA 1NV3A 4JVDA 2HHMA 4HCWA 2DE3A 3T0JA 3CHGA 4P9KA 4I3YA 2HPGA 1KA0A 2CEXA 3W9WA 1LBWA 1FPFA 1NUZA 5EQ8A 4DI3D 1XI6A 5EQ7A 3A29A 1DCUA 4PFRA 1NV6A 2F5XA 4OVRA 2XWKA 4N91A 1FTAA 3KBZA 4IR8A 1EYKA 4MNCA 4P8BA 4OVSA 4QBAA 2OX3A 2WYKA 5IZ3B 4PE3A 4OANA 2VPOA 1IMCA 4H45A 4N81A 5I3SA 1FPKA 4PDDA 2Y5LA 2R8TA 1FJ9A 1YYZA 4DI4B 4HXVA 4I40A 2FVZA 4GWWA 5CM6A 3FBPA 3LUZA 2KQZA 1LEVA 4PC9A 1NV2A 4OVPA 5ET8A 2XXKA 1FPDA 4H46A 4MEVA 4GBWA 3RPLA 4PFIA 4P3LA 4PAKA 4HE1A 2CZHA 1FPGA 4LN5A 4PBQA 2FIXA 1LBVA 2VT5A 4HCYA 2QVRA 4F18A 1NV4A 3KC0A 1G0IA 4X8RA 4X9TA 5T3JA 1LBYA 4MMPA 4FBPA 5DW8A 1FBHA 2DVZA 4MCOA 1Q9DA 1FPBA 5EQAA 5IGAA 4O7IA 5FBPA 4PGPA 2CZIA 3HFUA 2XWOA 5A5LA 4O8MA 4PTKA 1FPLA 2OWZA 3KC1A 1NUWA 3GYYA 1FBFA 4PF6A 4GWZA 2QPQA 3ROJA 3RYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPK A;  3D1R A;  2Q8M A;  5J16 A;  1FPI A;  1NV7 A;  2FBP A;  3RPL B;  4GX3 A;  4GX4 A;  1NUY A;  1LBZ A;  1IME A;  2Y5L A;  2FIE A;  1NUX A;  1FSA A;  5ET6 A;  2R8T A;  5ET7 A;  1BK4 A;  1FJ9 A;  1YYZ A;  4GWY A;  4HXV A;  2WBB A;  4GWX A;  4I40 A;  4HE2 A;  5LDZ A;  1NI9 A;  2P3V A;  1NV0 A;  4QXD A;  2FVZ A;  4GWW A;  3FBP A;  3LUZ A;  1FJ6 A;  1LEV A;  4AS5 A;  1NV2 A;  1NV1 A;  5ET8 A;  2QVU A;  4GX6 A;  4I3E A;  1FPJ A;  1EYI A;  1KA1 A;  5IZ3 A;  2DDK A;  5EYG A;  1SPI A;  2CZK A;  2FHY A;  1VDW A;  1IMB A;  1EYJ A;  1FBC A;  1FPD A;  3LV0 A;  1IMD A;  4H46 A;  3QMF A;  4AS4 A;  4KXP A;  2WEF A;  1INP A;  4GBW A;  1YXI A;  3RPL A;  4MJO A;  1FBE A;  1K9Z A;  2PCR A;  2P3N A;  1DBZ A;  4HE1 A;  2CZH A;  1FPG A;  2F3B A;  5EYH A;  1G0H A;  2FIX A;  1LBV A;  2QFL A;  1RDX A;  2QVR A;  2VT5 A;  3IFA A;  1NV4 A;  3KC0 A;  2F3D A;  1AWB A;  1G0I A;  3BIH A;  5EQ9 A;  3IFC A;  5T3J A;  1LBY A;  1IMA A;  3B8B A;  1NV3 A;  2HHM A;  5ESY A;  1QGX A;  1FBG A;  1K9Y A;  1CNQ A;  2BJI A;  4FBP A;  5DW8 A;  1FBH A;  1JP4 A;  2GQ1 A;  4GWS A;  5F24 A;  3T0J A;  1FPE A;  1Q9D A;  1FPB A;  4I3Y A;  2Q74 A;  4G61 A;  1KA0 A;  1LBW A;  1NV5 A;  5EQA A;  1DK4 A;  4O7I A;  1LBX A;  5FBP A;  4GWU A;  1FPF A;  2CZI A;  1NUZ A;  5EQ8 A;  1FBP A;  1XI6 A;  1FBD A;  2Y5K A;  5EQ7 A;  5IZ1 A;  5A5L A;  3A29 A;  1RDY A;  1DCU A;  2JJK A;  4PTK A;  1NV6 A;  1FPL A;  2OWZ A;  2QVV A;  1FTA A;  3KBZ A;  1KZ8 A;  3KC1 A;  1D9Q A;  4IR8 A;  1NUW A;  1IMF A;  1EYK A;  2WBD A;  5ET5 A;  1RDZ A;  1FBF A;  2OX3 A;  4HE0 A;  4GWZ A;  4GBV A;  1FRP A;  1YZ0 A;  5IZ3 B;  3BIG A;  3ROJ A;  1IMC A;  4H45 A;  4N81 A;  5I3S A;  3RYD A; 
#chains in the Genus database with same CATH topology
 3ECR A;  3MP6 A;  4ESX A;  3OEN A;  1B58 A;  1UTB B;  4GWY A;  4EXL A;  3TTM A;  3RTF B;  4NWD A;  4PFY A;  5K2X A;  1FQE A;  4N17 A;  1T0K A;  4NF4 B;  4PFU A;  4ZEI A;  1N76 A;  1LB9 A;  5EYG A;  2UYE A;  3U8Q A;  1POY 1;  3FJG A;  1ZLQ A;  2Q89 A;  4WXJ A;  4AS4 A;  4YB6 A;  1M5B A;  4R6K A;  3T9H B;  3KJ7 A;  2KR0 A;  2VPN A;  4NQ8 A;  2F35 A;  4XFE A;  1ZKB A;  3HCQ A;  2O69 A;  4FE8 A;  4HW8 A;  3IO4 A;  3BIH A;  3IFC A;  1LLS A;  1USY H;  3B6Q A;  3BFT A;  3KOS A;  4R2F A;  3THI A;  5ESY A;  2PFZ A;  3HV1 A;  4IGR A;  4QFN A;  1XT8 A;  3EHT A;  1SQY A;  4MH5 A;  3MYU A;  4AB6 A;  4G4P A;  5BWJ A;  1AH5 A;  3H6W A;  4YKJ A;  2WX9 A;  1O63 A;  1DMB A;  4GRK A;  4ZED A;  1OIB A;  2O6A A;  5CMK A;  4OTE A;  4H8I A;  4MHF A;  2Q2C A;  4GOT A;  4DDD A;  4RY1 A;  4HE0 A;  4QFP A;  4RNS A;  4MLQ A;  3MPK A;  3FUZ A;  4KCD A;  2DSF A;  1MPD A;  3EPE A;  4N4U A;  1BKA A;  1SBP A;  2UVG A;  3TTK A;  3ZSF A;  2HAU A;  4QSD A;  3QIM A;  4PCD A;  4ZZA A;  5EHS A;  1NH8 A;  3PD8 A;  1VSO A;  3MW0 A;  3U65 A;  3IAZ A;  1YTV A;  5TPA A;  4NF0 A;  2D21 A;  2ZXT A;  2ZYM A;  3K0V A;  1FTJ A;  2A5T A;  4XTC Q;  1FPJ A;  1B3L A;  2XD3 A;  5I59 A;  2Y7R A;  1FBC A;  4IGT A;  1D9V A;  3LV0 A;  1SVX B;  3EHS A;  5F7V A;  4H5F A;  1INP A;  1IQ7 A;  2BJJ X;  4NN3 A;  1P1Q A;  3E79 A;  2M8C A;  2RCA A;  2V3Q A;  2UXA A;  1Y20 A;  2F3D A;  1Y3N A;  4MNP A;  2PFY A;  4QHQ A;  3C4M A;  3CFX A;  3QXM A;  3TCH A;  2B4M A;  1OQG A;  4RYA A;  1CNQ A;  1M5C A;  4TLM B;  2AL4 A;  2DS9 A;  4YIC A;  5FTH A;  4M1V A;  4GWS A;  5AA4 A;  2Q74 A;  4GIZ A;  4AB5 A;  4BLA A;  2Z8F A;  1SD3 A;  2D5W A;  4JVI A;  2Y5K A;  3FGS A;  3MC2 A;  2F34 A;  4TOZ A;  2ZYO A;  2AL5 A;  4P1E A;  1B5H A;  4XIG Q;  3C33 A;  1IMF A;  4NHB A;  2Z8E A;  4BDQ A;  1FRP A;  1I69 A;  1MRP A;  4Z7E A;  5J16 A;  2DQV A;  4F3S A;  4C0R A;  2FBP A;  2OJT A;  2AIX A;  4POX A;  3TQL A;  1NUY A;  1L5T A;  1IME A;  4PET A;  3OMB A;  1NUX A;  3ODB A;  4XF5 A;  2GHA A;  2OWT A;  5ET7 A;  2DYX A;  2Q8J A;  5I2N A;  2CZL A;  2P3V A;  3E13 X;  4BDO A;  4DXU A;  3N26 A;  5H8N A;  1NNP A;  1OVB A;  1NV1 A;  2XHD A;  5DVI A;  4EQ9 A;  2LAO A;  3KFM A;  4G68 C;  3QSL A;  2HZK A;  3T93 B;  4NF5 B;  4OFJ A;  5JK4 A;  1OQH A;  3R6U A;  1QW0 A;  1AL3 A;  3TUS A;  2PCR A;  1VE4 A;  1JW5 A;  1TFA A;  1MY2 A;  3RPW A;  5EYH A;  2PYY A;  3IFA A;  3MPL A;  1HSL A;  1AWB A;  4U1O A;  5KDT B;  5DEX A;  2XXV A;  1IMA A;  4PGN A;  4JVD A;  4PFT A;  1TXF A;  2RIN A;  4HS7 A;  2V3T A;  3RQT A;  5AA2 A;  5ITO A;  4MFI A;  1FPF A;  2I4C A;  5EQ8 A;  1GGG A;  4NMY A;  3FJ7 A;  2HCA A;  4K3F A;  5H8Q A;  1B7H A;  3SKP A;  4ZDM A;  4X1D A;  2I4B A;  3G3F A;  2XXY A;  5DYH A;  4P0G A;  3QYT A;  4N81 A;  5I3S A;  2NUV A;  3K1P A;  4PDD A;  1WOD A;  2DOJ A;  4GXS B;  3FXQ A;  1POT A;  3TYH A;  5FHM A;  3KN7 A;  2V3U A;  2R71 A;  1MY0 A;  4ISU A;  4OWD A;  1YYZ A;  4ZE8 A;  1IXG A;  4OZ9 A;  4N13 A;  5CM6 A;  5I57 A;  3MP8 A;  4E0X A;  4U4X A;  3LUY A;  1LEV A;  4ZEF A;  4OVP A;  1MQI A;  4H5G A;  2Z8D A;  1FPD A;  1LFH A;  3KZG A;  3N6U A;  4P3L A;  4BDR A;  3FD3 A;  3IB0 A;  4LN5 A;  1LBV A;  4HCY A;  1NV4 A;  3SEV A;  4X8R A;  5T3J A;  4JWO A;  1LBY A;  1FQD A;  3PMW A;  2DWJ A;  4JSD A;  1FBH A;  3HST A;  4I62 A;  5I58 B;  2CZI A;  3HFU A;  2F78 A;  4LA9 A;  4QFO A;  4GD5 A;  5A5L A;  1A54 A;  5L8D A;  4LP2 B;  1QUL A;  1AOV A;  1I6B A;  3U1O A;  1B7U A;  3IR1 A;  2REJ A;  3TPA A;  4GWZ A;  5CRY A;  1B6H A;  4WKM A;  3GBA A;  3LBS A;  3B7D A;  1SW2 A;  4MF3 A;  4DZ1 A;  2REG A;  4IO6 A;  3B6T A;  4JXI A;  4JWY A;  4GX3 A;  1LBZ A;  4OER A;  5I84 A;  1R9Q A;  2GFE A;  3KGC A;  2ZZW A;  4N8G A;  3TTL A;  4HE2 A;  5I7I A;  4LAT A;  2NOO A;  2YJP A;  5IZ3 A;  1IMB A;  4RA1 A;  2Z22 A;  1URD A;  4NF8 B;  2UVJ A;  3QMF A;  3MVY A;  2ONK E;  3K6X A;  1MXV A;  1DSN A;  2F3B A;  2QL3 A;  4IO5 A;  4QSC A;  4U4S A;  4R6H A;  3N94 A;  1M5D A;  3B8B A;  3SEX A;  3SEY A;  1N7X A;  4OFO A;  3FVK A;  2XXP A;  4F3G A;  1SI0 A;  2GQ1 A;  5F24 A;  3V83 A;  3PPR A;  4FED A;  3EKI A;  4TQU Q;  4GFR A;  5CBR A;  1DK4 A;  1LBX A;  1CE2 A;  1B3G A;  3CIJ A;  3OO8 A;  4ESW A;  2WKY A;  5JTY B;  4WED A;  3IL1 B;  3TFL A;  2XXQ A;  4G68 A;  4F3B A;  2DP8 A;  4DIG A;  1MG1 A;  4FJP A;  5AA1 A;  4GL0 A;  3LSW A;  3FXU A;  4GBV A;  2HQ0 A;  4U22 A;  3E4R A;  1SW1 A;  3U94 A;  2ESN A;  1DTG A;  2ONR A;  1JW4 A;  1OVT A;  4OVJ A;  1Y9U A;  4MX6 A;  4GX4 A;  2CMO A;  3K1M A;  4GF8 A;  2XX9 A;  4KYE A;  2VOZ A;  5TP9 B;  3MST A;  5CMM A;  3P7I A;  4LQ5 A;  3L6H A;  2ZNS A;  1SYI A;  5DVF A;  4YMA A;  2QRY A;  1XC1 A;  5EHM A;  4NAP A;  1MXY A;  1Y4T A;  1MQG A;  2IA4 A;  1MM6 A;  4UAB A;  4YKI A;  2Y7P A;  2QVU A;  2FA7 A;  1AMF A;  2NXO A;  2FHY A;  3FAT A;  3TTR A;  4XEQ A;  4KXP A;  3S9M C;  1ZMG A;  4MIJ A;  4FAT A;  3Q25 A;  2F97 A;  4MAG A;  2O51 A;  1G0H A;  3SES A;  5I2K B;  5DTB A;  2IEE A;  3LC8 A;  4ECF A;  2KLF A;  4MNI A;  3NOH A;  2FYI A;  1JQF A;  4F29 A;  1GR2 A;  4GWO A;  5FHN A;  5A5X B;  3CR9 A;  3RTW B;  4QFK A;  4KI0 E;  3G3K A;  1UIV A;  3T9V A;  2X7Q A;  4KR5 A;  2OCU A;  1GVC A;  1MH3 A;  3WAF A;  3H06 B;  2XXX A;  1MY4 A;  4G2Z A;  5ET5 A;  1XVX A;  2O7U A;  3K6U A;  4C1U A;  3BIG A;  3CG1 A;  3PUZ E;  4IO4 A;  3ZKL A;  1A8F A;  1TFD A;  2Q8M A;  2V93 A;  2RC7 A;  2L5V A;  3BKI B;  4X04 A;  3GBB A;  1Z7N E;  2XXU A;  3RPL B;  2OWS A;  3K6W A;  2ALU A;  4Q30 B;  1R1N A;  4QF9 A;  1AIV A;  3E78 A;  3IK6 B;  3PTY A;  1UIU A;  3KN3 A;  2VD3 A;  3DP4 A;  1NV0 A;  4QXD A;  3VDF A;  3CFZ A;  4G8M A;  1FJ6 A;  3OSR A;  5B70 A;  3MBP A;  5HBC A;  3OO9 A;  1M5F A;  4I3E A;  4DE8 A;  1KA1 A;  2HZL A;  2DDK A;  3G3G A;  3VXB A;  3F11 A;  1BIY A;  1EYJ A;  3TAJ A;  1H45 A;  1LBB A;  3Q26 A;  2W7Y A;  4P56 A;  1PEB A;  3O66 A;  1FBE A;  3MZB A;  4UA8 A;  4IB2 A;  3PMX A;  1RDX A;  1N3X A;  1LAF E;  2ZZV A;  4KYD A;  4ELR A;  2O84 X;  3PUW E;  1EZP A;  2O1L A;  1NV3 A;  1B3H A;  4PQJ A;  4HCW A;  3R26 A;  2DE3 A;  3CHG A;  2HPG A;  3IB2 A;  4C1T A;  2CEX A;  1N0T A;  4YU0 A;  3G7W A;  4ELQ A;  2Z23 A;  3FAS A;  3SDF A;  1RKM A;  3CSB A;  4DI3 D;  3UOR A;  3A29 A;  1USY E;  5KCJ A;  1NNF A;  2F5X A;  4OVR A;  2XWK A;  4N91 A;  1FTA A;  4XKQ A;  3KBZ A;  2F6P A;  2OPE A;  4QSE A;  2O1M A;  4GQO A;  4PE3 A;  5ITP A;  4LZ5 A;  3A3U A;  4FEB A;  3VVE A;  4YAH X;  1FPK A;  4U1Z A;  1S7Y A;  2XX7 A;  4KHZ E;  1UQW A;  3MJN A;  1FJ9 A;  1NH7 A;  3V8X B;  4EQB A;  5L9O A;  4I40 A;  3QK6 A;  4DCX A;  1IEJ A;  4KYS A;  2FVZ A;  2X26 A;  4HTG A;  4UAC A;  4PC9 A;  1H43 A;  1FW0 A;  2NWJ A;  5AE4 A;  3T9U A;  3H7M A;  2QSX A;  4KPT A;  1O64 A;  3MAM A;  3FV1 A;  1TWY A;  2HAV A;  4XKN A;  4MEV A;  3M3F A;  4GBW A;  1O7T A;  4PFI A;  3I3V A;  3HPI A;  1I6A A;  4PAK A;  3K1N A;  1FPG A;  2A5S A;  3FV2 A;  2ANJ A;  2VT5 A;  4ONY A;  1G0I A;  1A7L A;  3D4C A;  2QJE A;  2OPD A;  2DWI A;  4MMP A;  5ICT A;  3VVD A;  5DW8 A;  1IXI A;  3MVX A;  1Q9D A;  3CVG A;  3C35 A;  5EQA A;  5FBP A;  3HO7 A;  3D4G A;  1A8E A;  1LCF A;  2Q2A A;  4O8M A;  4RPN A;  1UTH A;  4EF2 A;  2VGQ A;  3O97 A;  5TPA B;  1NUW A;  2V84 A;  3FXR A;  3MVW A;  1EU8 A;  4ZZE A;  3IOW A;  4OES A;  2A5T B;  1II5 A;  1P1O A;  2H25 A;  3OEM A;  5I59 B;  2DWH A;  2ZYN A;  4Q0C A;  1B40 A;  4EQ7 A;  4IO7 A;  4F1U A;  2FIE A;  3IJO B;  2F7B A;  2XWV A;  5KZT A;  1URG A;  2D3I A;  4OYV A;  2HXR A;  1B5I A;  4PFB A;  3VE1 B;  1LCT A;  4BDM A;  4H65 A;  2VHA A;  4F1V A;  2GRV A;  3A3C A;  2AYS A;  3MQ9 A;  1Y3Q A;  1DTZ A;  4R9G A;  4NGU A;  3OO6 A;  3FVN A;  1A99 A;  3VV5 A;  3O6G A;  5AA4 B;  2HXW A;  2V4C A;  3EQ1 A;  2RCB A;  5CC2 A;  5CBS A;  1RYO A;  2ZMB A;  2B65 A;  4O7M A;  4P47 A;  1PB9 A;  3VXC A;  3MUQ A;  3OXN A;  4N8Y A;  1LAX A;  3DP8 A;  1ZBM A;  1Y3P A;  3OEK A;  4F1Y A;  2I3W A;  2PT1 A;  4M4G A;  4RJZ A;  3UGW A;  1Q1K A;  1TT1 A;  1YAE A;  2XWI A;  1PDA A;  4KQP A;  5I5P A;  4O3C A;  4GVO A;  5ELV A;  1FBP A;  1FBD A;  4WEP A;  3TEL A;  3G3J A;  5L9M A;  5I2N B;  1FQB A;  3EHU A;  5JTY A;  2XXW A;  5I56 B;  4PBH A;  1PBQ A;  3MZ9 A;  1US5 A;  2F36 A;  1MDQ A;  2WBD A;  1NL5 A;  5JEI A;  3N6T A;  3ONM A;  4O3B A;  3OSQ A;  3D1R A;  3GXA A;  2I3V A;  2NVU B;  5F1Q A;  1RYX A;  4G8H A;  5H8F A;  1FSA A;  4EF1 A;  2F7C A;  3Q27 A;  2RC8 A;  2X7P A;  3E3K A;  2DXY A;  4PAF A;  5DEX B;  1NI9 A;  2XXH A;  4MBP A;  5TU0 A;  3K02 A;  4P0I A;  1J1N A;  3AXF A;  4GX6 A;  1MQD A;  1FTL A;  4RK2 A;  4TLL B;  4FOR A;  4ZS9 A;  4ELP A;  2MKZ A;  3MP1 A;  3B6W A;  3C31 A;  4NG7 A;  5J1D A;  1YXI A;  4QFL A;  4X1B A;  2XXR A;  1B4H A;  3FVG A;  4R9F A;  1UTB A;  3KG2 A;  5H8Q B;  5BUU A;  2R6G E;  4N07 A;  5EQ9 A;  1N3W A;  1B7Z A;  4GXA A;  4H6D A;  4H8J A;  5I2K A;  2OK2 A;  5B7D A;  3T66 A;  1B2H A;  4NF4 A;  2BJI A;  1LAG E;  4FAJ A;  5DT6 A;  2F7A A;  3VLV A;  3ILU B;  3S4U A;  1P1U A;  2HEU A;  1H3D A;  2GHB A;  1P99 A;  1RDY A;  4PDH A;  1SYH A;  2XX8 A;  2QVV A;  5I57 B;  1KZ8 A;  3USD A;  3TDJ A;  4F3P A;  2B3F A;  3HHF A;  4THI A;  5FHO A;  3PPN A;  1FCK A;  3B50 A;  3IOT A;  4LQ2 A;  2DVC A;  3JYR A;  1NKX A;  3W15 C;  4NF6 B;  3PUV E;  4LUB A;  3RLF E;  1SW5 A;  5EYF A;  2UVI A;  3RY3 A;  4F39 A;  1MY1 A;  3KSX A;  1N7W A;  2PVU A;  1FTM A;  2CEY A;  1WVJ A;  3GLB A;  1LAH E;  2WBB A;  4N6K A;  4I9D A;  4YZZ A;  2O68 A;  3SZP A;  4P11 A;  1BTJ A;  1NNT A;  3UP9 A;  1SPI A;  2CZK A;  2G93 A;  4O94 A;  1IXH A;  1IMD A;  5FTI A;  1JEV A;  3H03 A;  3V89 B;  3PU5 A;  4G8N A;  3O9P A;  4F22 A;  5IAI A;  1XVY A;  3JZJ A;  3DP6 A;  3VLW A;  3EN3 A;  2H5Y A;  4OEN A;  5M2V A;  5HM4 B;  2HHM A;  2P1S A;  1MM7 A;  3EF7 A;  4F31 B;  1B0L A;  4P9K A;  4OHN A;  3S9E A;  2H9B A;  1LBW A;  3IOV A;  4N6P A;  1N04 A;  1KWH A;  5EQ7 A;  3O29 A;  3T22 A;  1B52 A;  4PFR A;  1LB8 A;  4FEC A;  2UYF A;  3TQW A;  5AA2 D;  1P1W A;  5H8H B;  4IR8 A;  1EYK A;  4MNC A;  4QBA A;  4OET A;  2WYK A;  2P0S A;  5IZ3 B;  4OAN A;  2VPO A;  3LR1 A;  4X48 A;  1VFE A;  3ZS6 A;  4H45 A;  1US4 A;  1MS7 A;  3KSJ A;  1B46 A;  5CMB A;  1JVY A;  4JB7 A;  2ABH A;  3H4Z A;  1IIW A;  1DPP A;  2R8T A;  1B3F A;  1XOC A;  4XKR A;  1NNK A;  1P1N A;  4GWW A;  3TMG A;  3TEP A;  1NV2 A;  5ET8 A;  2H98 A;  1MY3 A;  2ZNT A;  1MPC A;  2OBG A;  2V25 A;  3C32 A;  1PBP A;  5AA3 A;  3QUF A;  4H46 A;  3RUM A;  4IY5 A;  1MQJ A;  1MH4 A;  2ONS A;  1N84 A;  3JV9 A;  4JWX A;  1D9Y A;  3PPP A;  1CB6 A;  4HE1 A;  3R7X A;  1SW4 A;  2QVR A;  4RPO A;  4F18 A;  3KC0 A;  1I6Q A;  4G68 B;  4Z0I A;  2ZNU A;  4NED A;  3BFU A;  3RT8 A;  3Q29 A;  3FVO A;  3RGY A;  3CI8 A;  5L9S A;  2PMS A;  1M5E A;  1FTO A;  2DVZ A;  2ZYK A;  4AQ4 A;  1YCJ A;  3LSL A;  4NF5 A;  3C9H A;  4O7I A;  3SER A;  1LGB C;  2I6E A;  3LSF B;  3OOA A;  2XWO A;  4E0W A;  1SDX A;  3T9X B;  4PTK A;  4DLD A;  1FPL A;  2OZZ A;  2H4I A;  3KC1 A;  5KDT A;  4L17 A;  4ELO A;  5CI5 A;  1FBF A;  2F8D A;  2DWA A;  4IO2 A;  4PF6 A;  1Y4C A;  3ROJ A;  1OLA A;  4ZEC A;  3RYD A;  1JVX A;  4QRZ A;  3PGF A;  4I8C A;  3PPO A;  4LON B;  1BLF A;  2I0C A;  5ET6 A;  4GL8 A;  3RN8 A;  1JEU A;  3CSG A;  4Q8R A;  1QKB A;  3K2D A;  3VFJ A;  5IZZ A;  4NTL A;  3DLN A;  1LFI A;  1ANF A;  2WYP A;  3G3H A;  3M3K A;  4AS5 A;  1ATG A;  3GZG A;  4U2R A;  3U93 A;  3H3G A;  1BP5 A;  1FQC A;  1EYI A;  3MVZ A;  1FQF A;  3FXB A;  3ZKK A;  1ZJL A;  5LOM A;  2O7I A;  3UN6 A;  4MJO A;  2DE4 A;  4N15 A;  4OQO A;  1B0H A;  2DXR A;  1SI1 A;  1F9B A;  2Q9T A;  1QGX A;  1FBG A;  3PUY E;  3IX1 A;  3K4U A;  4JSO A;  3O2A A;  1JNF A;  1D3K A;  3LSX A;  5LTC A;  3BBR A;  1FPE A;  3PUX E;  1H76 A;  1NV5 A;  4GWU A;  2VD2 A;  3FZV A;  1EZO A;  3QUJ A;  3RT6 B;  4OA4 A;  5IZ1 A;  3M8U A;  1ELJ A;  1GTK A;  3UA8 A;  1LBC A;  1FTK A;  3TCF A;  4OFL A;  1D9Q A;  1S9T A;  2RC9 A;  3H6V A;  4PFW A;  1RDZ A;  1A55 A;  3FIR A;  4DCY A;  2Y7W A;  5I56 A;  1ZTY A;  3W9V A;  4OVT A;  2XXI A;  1Y1M A;  3K00 A;  2XD2 A;  4EUO A;  3UIF A;  4P1L A;  4XXU A;  4GLI A;  4IY6 A;  1FPI A;  4PF8 A;  5IM2 A;  5I58 A;  1LST A;  4DXC A;  1BK4 A;  3DEL B;  1MXX A;  3E9X A;  1A40 A;  1D4N A;  4PAI A;  5LDZ A;  3SEU A;  4F2Q A;  3MZ1 A;  2Q88 A;  3S2V A;  3O6I A;  3MWB A;  1VR5 A;  4JVC A;  3VVF A;  3T1B A;  3S9L C;  3WAE A;  3PV0 E;  4LZ7 A;  3I5O A;  4NWC A;  4EDP A;  4N6D A;  1MQH A;  1QKA A;  2WEF A;  1K9Z A;  2RKM A;  4U21 A;  4Q5T A;  4IO3 A;  5KCJ B;  4R72 A;  2R9J A;  4ND9 A;  3U92 A;  2PT2 A;  1QUI A;  4H0W A;  3I6V A;  2E1S A;  1B3E A;  4NX1 A;  5DVJ A;  4F2O A;  2THI A;  2G29 A;  2XA5 A;  1K9Y A;  3CRB A;  3PMV A;  1VFD A;  2H99 A;  1JP4 A;  3OO7 A;  4PE5 B;  4R6Y A;  3OEL A;  4G61 A;  2QMX A;  4NF8 A;  2QS3 A;  5CMC A;  3M3L A;  1GV8 A;  3IOR A;  3KN8 A;  3C34 A;  2JJK A;  3TZA A;  5K2Y A;  1NMU A;  2QS4 A;  1B9J A;  4OVQ A;  4I1D A;  3U72 A;  3IOU A;  3KOT A;  1B1H A;  1PB7 A;  1MPB A;  4YKP A;  1YZ0 A;  1MDP 1;  3KEI A;  2ZZX A;  1B32 A;  4YMB A;  1Z7M E;  4R2B A;  4KCC A;  3T96 B;  3K01 A;  4G77 A;  1NV7 A;  4NF6 A;  4OEV A;  1B51 A;  4H67 A;  1NFT A;  2DE2 A;  2FNC A;  5H8N B;  3SET A;  4GWX A;  3TCG A;  2UVH A;  1XHY A;  2B3B A;  3A09 A;  1QUK A;  4NE4 A;  5H8S A;  3HHG A;  1QVS A;  1DOT A;  1VDW A;  1FQA A;  2RF1 A;  3O28 A;  2QS1 A;  4O3A A;  2P3N A;  1DBZ A;  3K6V A;  1UTH B;  1HSJ A;  3ISP A;  2QFL A;  5TP9 A;  4F19 A;  2B4L A;  4R73 A;  4EXK A;  2P2A A;  4KD5 A;  2I0B A;  1ZU0 A;  2OLB A;  4R75 A;  5AA2 B;  3IO6 A;  3PD9 A;  4OXV A;  4FIM A;  3T0J A;  3FJM A;  4I3Y A;  1KA0 A;  1Y1Z A;  3W9W A;  1MXZ A;  1WDN A;  1NUZ A;  3QAX A;  3TOD A;  1XI6 A;  1DCU A;  3RNN A;  1NV6 A;  3OD7 A;  1S50 A;  3TTN A;  1B5J A;  3CG3 A;  4OMB A;  4BDL A;  4DXB A;  3O6H A;  4OVS A;  4P8B A;  1OLC A;  1LFG A;  1IUD A;  2OX3 A;  4ZE9 A;  5H8H A;  4RXL A;  1IMC A;  1Q35 A;  5A5X A;  3G3I A;  4YKK A;  2PX1 A;  2Y84 A;  1DPE A;  3TKD A;  2F6G A;  5HPQ A;  4ZEB A;  3DM0 A;  1HSE A;  1JET A;  2Y5L A;  3UK4 A;  4KFQ A;  4DI4 B;  4HXV A;  4MLV A;  3FBP A;  3LUZ A;  2KQZ A;  4U23 A;  1PB8 A;  2XXT A;  3KJT A;  4YB7 A;  3ILT B;  4PP0 A;  3VLU A;  2GH9 A;  2I48 A;  2XXK A;  1H44 A;  1B1X A;  3Q28 A;  1YPN A;  3IJX B;  2Y7I A;  1URS A;  1XS5 A;  2VP1 A;  1IIT A;  4BDN A;  3RPL A;  2QS2 A;  2CZH A;  2E0S A;  3S9N C;  3C36 A;  4PBQ A;  2FIX A;  3IB1 A;  1B4Z A;  3N5L A;  1QUJ A;  2YLN A;  1OMP A;  3H6U A;  1QJM A;  1EH3 A;  4XKP A;  1MXW A;  3CFL A;  4X9T A;  3L6G A;  2YPN A;  1R9L A;  2PBW A;  3KBR A;  1MXU A;  3HN0 A;  4FBP A;  2Y7K A;  5ISU A;  4LVQ A;  4MCO A;  1FPB A;  5IGA A;  4YB5 A;  1R6Z A;  4PGP A;  5H8F B;  4JBZ A;  4POW A;  2QMW A;  4ZEK A;  1B05 A;  5ICQ A;  1EZ9 A;  1IZ1 A;  1IXC A;  2OWZ A;  4LZ8 A;  2I49 A;  5IKB A;  3SEW A;  3V5A A;  4OEU A;  3PPQ A;  3GYY A;  4RK9 A;  2QPQ A;  2I58 A;  4H1X A;  2HFB A;  3H6T A;  1JW1 A;  4JDF A;  1PC3 A;  4R74 A;  1ZIU A; 
#chains in the Genus database with same CATH homology
 4GX3 A;  1LBZ A;  4F1U A;  2FIE A;  2XWV A;  5ET6 A;  2HXR A;  4PFB A;  4GWY A;  2ZZW A;  4N8G A;  4F1V A;  4HE2 A;  5IZZ A;  2WYP A;  5I7I A;  4NGU A;  4AS5 A;  4N17 A;  5IZ3 A;  1EYI A;  5EYG A;  3FXB A;  1IMB A;  2V4C A;  3QMF A;  4AS4 A;  4MJO A;  4O7M A;  4P47 A;  4NQ8 A;  2KR0 A;  2VPN A;  2DE4 A;  2F3B A;  4N15 A;  4XFE A;  3BIH A;  4N8Y A;  3IFC A;  3B8B A;  2Q9T A;  5ESY A;  1QGX A;  2PFZ A;  1FBG A;  5LTC A;  2GQ1 A;  5F24 A;  1FPE A;  2XWI A;  3EKI A;  5I5P A;  1NV5 A;  1DK4 A;  1LBX A;  3MYU A;  4GWU A;  1FBP A;  1FBD A;  4OA4 A;  5IZ1 A;  2WX9 A;  1D9Q A;  4PBH A;  4MHF A;  2WBD A;  1RDZ A;  4HE0 A;  4GBV A;  3W9V A;  4OVT A;  3D1R A;  4N4U A;  4P1L A;  1FPI A;  4PF8 A;  5IM2 A;  4MX6 A;  4GX4 A;  4PCD A;  1FSA A;  1BK4 A;  3MST A;  3U65 A;  4PAI A;  4PAF A;  5LDZ A;  1NI9 A;  4NF0 A;  4NAP A;  4UAB A;  2QVU A;  4GX6 A;  1FPJ A;  4JVC A;  2FHY A;  3T1B A;  2MKZ A;  1FBC A;  3LV0 A;  4XEQ A;  4N6D A;  4KXP A;  2WEF A;  1INP A;  4NG7 A;  4MIJ A;  1YXI A;  5J1D A;  4NN3 A;  1K9Z A;  3E79 A;  2V3Q A;  4MAG A;  1G0H A;  2F3D A;  4MNP A;  4MNI A;  5EQ9 A;  3NOH A;  4NX1 A;  2PFY A;  2XA5 A;  2B4M A;  1K9Y A;  1CNQ A;  2BJI A;  4YIC A;  1JP4 A;  4M1V A;  4GWS A;  2Q74 A;  4G61 A;  4JVI A;  2Y5K A;  1RDY A;  4PDH A;  2JJK A;  2QVV A;  4P1E A;  1KZ8 A;  4OVQ A;  1IMF A;  4NHB A;  5ET5 A;  3B50 A;  1FRP A;  1YZ0 A;  3BIG A;  2ZZX A;  5J16 A;  2Q8M A;  2L5V A;  4X04 A;  1NV7 A;  2FBP A;  3RPL B;  1NUY A;  1IME A;  4PET A;  1NUX A;  4XF5 A;  3E78 A;  2DE2 A;  5ET7 A;  3PTY A;  2CEY A;  2WBB A;  4N6K A;  4GWX A;  4YZZ A;  2P3V A;  1NV0 A;  4QXD A;  1FJ6 A;  3SZP A;  1NV1 A;  4I3E A;  1KA1 A;  2HZL A;  2DDK A;  1SPI A;  2CZK A;  4O94 A;  1VDW A;  2HZK A;  1EYJ A;  1IMD A;  5JK4 A;  4P56 A;  1FBE A;  2PCR A;  2P3N A;  1DBZ A;  5EYH A;  3ISP A;  2QFL A;  1RDX A;  2ZZV A;  3IFA A;  4F19 A;  2B4L A;  1AWB A;  1IMA A;  4PGN A;  1NV3 A;  4JVD A;  2HHM A;  4HCW A;  2DE3 A;  3T0J A;  3CHG A;  4P9K A;  4I3Y A;  2HPG A;  1KA0 A;  2CEX A;  3W9W A;  1LBW A;  1FPF A;  1NUZ A;  5EQ8 A;  4DI3 D;  1XI6 A;  5EQ7 A;  3A29 A;  1DCU A;  4PFR A;  1NV6 A;  2F5X A;  4OVR A;  2XWK A;  4N91 A;  1FTA A;  3KBZ A;  4IR8 A;  1EYK A;  4MNC A;  4P8B A;  4OVS A;  4QBA A;  2OX3 A;  2WYK A;  5IZ3 B;  4PE3 A;  4OAN A;  2VPO A;  1IMC A;  4H45 A;  4N81 A;  5I3S A;  1FPK A;  4PDD A;  2Y5L A;  2R8T A;  1FJ9 A;  1YYZ A;  4DI4 B;  4HXV A;  4I40 A;  2FVZ A;  4GWW A;  5CM6 A;  3FBP A;  3LUZ A;  2KQZ A;  1LEV A;  4PC9 A;  1NV2 A;  4OVP A;  5ET8 A;  2XXK A;  1FPD A;  4H46 A;  4MEV A;  4GBW A;  3RPL A;  4PFI A;  4P3L A;  4PAK A;  4HE1 A;  2CZH A;  1FPG A;  4LN5 A;  4PBQ A;  2FIX A;  1LBV A;  2VT5 A;  4HCY A;  2QVR A;  4F18 A;  1NV4 A;  3KC0 A;  1G0I A;  4X8R A;  4X9T A;  5T3J A;  1LBY A;  4MMP A;  4FBP A;  5DW8 A;  1FBH A;  2DVZ A;  4MCO A;  1Q9D A;  1FPB A;  5EQA A;  5IGA A;  4O7I A;  5FBP A;  4PGP A;  2CZI A;  3HFU A;  2XWO A;  5A5L A;  4O8M A;  4PTK A;  1FPL A;  2OWZ A;  3KC1 A;  1NUW A;  3GYY A;  1FBF A;  4PF6 A;  4GWZ A;  2QPQ A;  3ROJ A;  3RYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...