2FW7A

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, at ph 8
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
b'SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
total genus 48
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fw7A00
2FWPA 4ZJYA 4GRDA 4B4KA 1U11A 2H31A 3OPQA 5CLGA 4Z7JA 2FW1A 2YWXA 2FWBA 4YCBA 2FW7A 4AY4A 4ZMBA 5CLFA 2FWIA 5CVTA 1D7AA 5BORA 3KUUA 2NSLA 2NSHA 3RG8A 1XMPA 5CLHA 2FW9A 5CLIA 3TRHA 4AY3A 5CLJA 1O4VA 3LP6A 1QCZA 2ATEA 4ZK2A 5BOSB 5BOSA 2FWJA 5C5DA 2FW8A 3ORSA 4YCDA 5CTJA 2NSJA 4JA0A 4ZC8A 2FWAA 3RGGA 3OOWA 4YCCA 2FW6A 4YCJA
chains in the Genus database with same CATH superfamily
1F17A 1AKMA 2FEKA 3EEQA 4EPWA 2A92A 5J2TF 1L7VC 1I4LD 3NRBA 1AQLA 1UBKS 4QFBA 2FE1A 2BZ0A 2ZUTA 4EF6A 2C2MA 2R5FA 2I1WA 2Q45A 1LA2A 3H5TA 3MMZA 3DOFA 3UQZA 2O8FB 2WZDA 4IX9A 4LHYA 4V0NA 2I03A 4DS3A 1SU7A 4YJKA 5K8VA 2O8CB 3T4UA 2JGDB 2XTJA 1JI0A 5D3ZA 2EFEB 3S2YA 1IY0A 1NONA 3W2FA 2R2GA 2XSZA 1LRJA 3DV2A 5K05A 4YASA 4UE2A 1Z7BA 2ZRPA 5AMXA 3U9LA 4EFDA 3LHSA 1F7VA 3TWOA 5I7OA 2GBIA 1CIPA 3I3SR 1BN6A 3PS9A 5HHTA 2OQ2A 3U62A 4DV2B 2VBGA 2R1VB 2Q6VA 2C7GA 4DNXA 1T36B 1WUTA 4KO8A 5E7QA 1N77A 4ASUA 4JYCA 4BEVA 1XMOB 1QTNA 1CFJA 1ZHFA 3IB3A 3KEFA 4GI2A 2EKZA 1BFKA 1FYEA 2WF8A 4J43A 2AEFA 4MQ6A 4OO3A 4DNPA 4EUFA 5JCOC 2WLSA 5H5JA 3L0BA 1OH5A 3RG8A 1CZOA 3ED1A 1NBHA 1VCOA 3BQMB 4HWRA 3WISA 1DPGA 3VR1A 4GGPA 3GRRA 2O2ZA 2WEKA 4Y1EA 3DQQA 1EWTA 3F0TA 3G1UA 5A03A 3I6YA 2NU6A 5JCXA 1YCHA 1EVQA 1G8YA 3JQRA 4A1OA 3RVMA 1NVTA 4O4HF 1PJAA 2HCRA 2W2XA 5ISMA 3MOSA 1EQUA 1GNQA 2QA5A 3DLPX 3FCAA 3JXEA 3GN2A 4UM9B 3Q40A 2A6PA 5ALVA 2AT1A 4O25A 3ZCXA 1KI7A 1P31A 1ACJA 4MMZB 1H0SA 2PNFA 2NQTA 4DZRA 3I2HA 4Y2PA 2Z6VA 5JRZA 1JT9A 5JXHA 3INNA 3O26A 5BSGA 3EDOA 3VNBA 2G80A 4NBKA 4XUDA 5ENVA 3VZCA 1JZSA 3GPDG 3H2YA 3GFGA 3T5PA 1Q16A 3L43A 3EGOA 1MIHA 5SZHB 4QZVA 1G17A 4X7RA 3ZWBA 4B6SA 1MHPA 3UB3A 5F3WB 3BJEA 3BHNA 16PKA 3PPYA 4QLBA 4Y9TA 3HKBA 1WDMA 4HGZA 5KVQA 1VI2A 3OFNA 3OOYA 2OMEA 2PANA 3FBWA 2ZM6B 1C3JA 2IFTA 2YWJA 3MJFA 4DILA 4ITVA 3BMOB 5AW5A 3VR5H 3GBVA 2FZEA 3FZQA 4ENUA 4L22A 4L78A 4NNJA 4DIKA 1DCTA 4HQOA 1O8CA 2D2XA 4BP3A 1Z4NA 1M66A 1FX0A 5TF0A 4U2CA 4D6PA 1CPYA 4DCVA 1TJYA 4JLOA 3Q3GE 1M34A 1B4DA 1NSFA 1JS1X 4B5KA 3ZUPA 1JFRA 2ZRMA 3PLNA 5IN4A 4OQMA 1LBSA 4TYMA 3ZWAA 5FV4A 3W8RA 4RTOA 4UBOA 3UB2A 4R8RA 4KITB 5JANA 1DO0A 4C7OB 3V3KA 4U9IS 1G16A 1TKAA 4R05A 4AKGA 4BFVA 1G3QA 4OHOA 1P60A 4NDZA 4YMUA 1N6NA 4Q24A 5B1IA 1BDHA 5LBIA 3L8HA 1G9SA 1NW5A 4AP9A 4JLNA 2OXTA 3H1EA 5IC4A 4LC1A 1QWOA 4ETMA 3LNCA 3ZWWA 1QDUA 1JU3A 3JYOA 1ZRMA 3S99A 1VG1A 1ZISA 1GTRA 4GYWA 1XZKA 1AXEA 1PQUA 3IP5A 1FXSA 1T5IA 3B6EA 1WRBA 1Q0UA 2RHBA 4NATA 1HA3A 1U3UA 3IQZA 4UNIA 3HRKA 4BPRA 4BZWA 1S8NA 1E3WA 4J0QA 1E1CA 4B6RA 4C0XA 3DMPA 3E58A 3FFTA 4P86A 4D9JA 4QQKA 1UZLA 2NPIA 1CJSA 1JDSA 2IIBA 3NEAA 2Q46A 3SDZA 3ZZNA 2QRQA 2H5IA 3NM4A 3OPVA 1KDRA 2FWBA 4YGYA 4C20A 1DKMA 1OWOA 1YHNA 4NCJA 1EK0A 1RBQA 4H15A 3TRFA 4EX6A 3FYUB 4PQFA 2KWIA 3EAFA 3PUHA 1XZGA 1G4AE 1OI4A 3ER9A 2WFLA 3K5PA 2H06A 4DG9A 2VSXA 2XMDA 4MUFA 3PHIA 3FA2A 5C8YF 1X3SA 3QE4A 4DVGA 1EVZA 1Z2EA 4ZO9A 1MGPA 4F7DA 4CG0A 1T3GA 1OUMA 2VWPA 2Q3LA 4RJLA 4AURA 3RSGA 4EGCB 4YUXA 1JWBB 1YRAA 1EWQA 3HM2A 2OKGA 1BE0A 1YZFA 2I66A 1PG5A 4DADA 2BM9A 4BLRA 2CB0A 1E9CA 3SKVA 2IELA 4QLAA 1R74A 4XUGB 4OI1A 3BGSA 4P9NA 3BWDD 1CF2O 5CK4A 2C58A 3D0KA 3FPKA 4IQ4A 3RUDA 2BEKA 1M1NB 1TU0A 3AFGA 1T10A 1SVUA 1KE2A 4CM9D 5CYPA 4H18A 2EG5A 4FZ5A 4JX8A 3WR5A 4BNKA 2FMFA 3WSTA 2DFDA 4FW9A 1FOEB 1QPGA 2FK8A 4R81A 3UJ7A 1UPAA 1Y6RA 1MG5A 2F9MA 2YYSA 2DOKA 3OF5A 2QJFA 3C6QA 3IR5A 4JLAA 4TLBA 5CG1A 3CB4A 1X7HA 1ZD3A 3K94A 5F64A 3A10A 4H77A 3IP9A 1VA5A 3GRKA 1T0IA 1TM2A 2CNDA 3FKSA 5JS2A 3P9IA 3AR9A 4MITA 3WIOA 2XVAA 3WADA 1T5BA 2L2QA 4S3MA 5BW6B 1NJ8A 2XE6A 3W7VA 1KI8A 2YVQA 1X80B 4OQYA 2CN1A 3UWKA 1P7YA 2H17A 4JR0A 2IYOA 3EULA 3GLSA 1DX4A 3LYAA 4RIGA 1KO4A 3SZRA 1GPNA 1ZS9A 1W2HA 4XDHA 4N7RA 3I34X 4RIEA 1AE1A 1X8JA 3OAAD 4PZLA 2PG3A 2Q2NA 3UHAA 4ZMSA 3AHCA 1MR3F 1A95A 3KE9A 1QJ4A 3BHIA 4KU4A 4P6VF 4WY2A 4ETIA 4ZHQF 5JWRA 2FP4A 3O1LA 3HU2A 4GU5A 2P9GA 4YP0A 3GB9A 3HN2A 1KP3A 1Z4OA 3FFWA 3Q1LA 3KOUA 1X74A 1ZJJA 1TKRA 4II7A 3I2YX 1HLFA 4O5OA 1OR8A 3PYMA 2YHBA 4X1IB 2EFJA 3BILA 1HPLA 1AKEA 2BZGA 3K2BA 2W6CX 2ISQA 2BHLA 4JGGA 4QYXA 4ZT2A 4DB2A 2H5JA 4M9QA 5LNK1 1Q3HA 3EOZA 4F71A 1JLKA 4DQUA 2DPHA 4X24A 5KNLA 1W19A 1GZVA 2R7MA 3KYIB 4P38A 1XLVA 4HMOA 4NI5A 2AYYA 4AWAA 2CL5A 4PN7A 1BEUB 4XI9A 2QGZA 3NT2A 1VJTA 4JWKA 4PIPA 1TJ3A 3HCWA 1NVAA 1GTVA 2G5GX 3D5TA 3UJ6A 4N8SA 1ZGJA 2QLBA 1CZNA 3VX4A 3IERA 1H4QA 2O9JA 5D7BA 2O2SA 4XFJA 4URVR 3P9RA 5D01A 2QRPA 3QQPA 2RGNC 1TNDA 4EY8A 2QYOA 3MWEA 2EWVA 2CMFA 4FONA 2VHVA 5DRTA 3RFTA 3TLZA 4O2AA 2REXB 5KTRA 3FROA 3T3OA 4QXQA 1LSJA 4P93A 1E2FA 3NIFB 4X20B 1CIVA 1H9BA 1M2OA 2YNMD 1CUWA 4BATA 4R2MA 3BSYA 1XTJA 5IJ9B 2GCNA 5ELMA 4I81A 5ECDA 1NYTA 2J9XB 3EC1A 3L7CA 2EWWA 5CT9A 2JCYA 3IPXA 4OMCA 1QTRA 3DVLA 1VL2A 1M6VA 2E6KA 3HEMA 3AI1A 1L0BA 1UDWA 4MJXA 4PLGA 1Z38A 4UHEA 3U3ZA 1Y1RA 4EKYA 3AEXA 2QZSA 4LBZA 1IXKA 3C87A 4RD4A 421PA 1JG6A 1YMUA 4N41A 2ZS9A 3GVPA 5C3MA 1QIDA 3F5QA 4M1MA 2NACA 1AN0A 1NR1A 1I6MA 2PWYA 3ONWA 3PC6A 2IYXA 2WKPA 2XNDD 3TDMA 1JU9A 1G6HA 3CKKA 3T7EA 5DTIA 5J4HA 4FFVA 4MTLA 5EUCA 4HGRA 4WCDA 4PVDA 5JH7F 2BTQA 3EW7A 1GYRA 5JWHA 1ZY2A 5JARA 3M9LA 3NBFA 2IEYA 3OWOA 4OYRA 2CBGA 4ZDWA 3O5AA 1PJSA 4WXYB 5DIZA 5TGTA 5KAMA 3LF1A 3RS7A 5BRJA 4G37A 4RJJA 2NXCA 5L6LB 1TPZA 3VYSB 5TMEA 1GADO 2ANBA 1PZNA 3SNHA 4ZO7A 2EDCA 2IEBA 4XQ0A 1U3CA 3OMWA 1DJLA 2EBUA 3DHWC 3IXQA 3M81A 1RI5A 1E66A 2YWCA 1NBOA 4I4TA 2NVOA 3I64A 3ECSA 3H11A 4GR5A 4M21A 4L8VA 1M2NA 3LHIA 4HFRA 4OUDB 1AXGA 3VDRA 1QFXA 5CRIA 2D0DA 4MW4A 2BW0A 4EJMA 2PZGA 1FYFA 2QTHA 3HCRA 3LQRA 3ZLUA 1TT5A 3AW8A 5BSTA 1N1DA 2FQYA 1QR2A 2PUJA 3IEXA 4PM4A 4UFOA 4V02A 2EERA 2B5WA 1SKQA 2DC1A 3VVBA 3SHQA 4QE3A 4GBMA 1W44A 4GPTA 5FBRB 4UXHA 3WAKA 1F20A 1XZIA 1Z2CA 2PRIA 3DDZX 3EA4A 4QLOA 3ZE0B 4YRZA 3OEHD 1NE7A 1WZIA 1NP7A 2BEUB 2CWWA 2FPGA 3L1VA 2HMAA 1YR8A 2CDRA 5IDQA 5L6MB 1EFAA 4OBXA 2QMQA 3FNEA 4TV9A 5CUQA 3B1VA 4NPAA 1B7GO 1PR6A 1SBZA 3ANTA 3F6RA 4F4FA 9GPBA 3H3XA 3PKIA 3FNBA 1SCUA 2CXOA 3B1JA 4IIGA 2CLFB 4JFRA 4BB9A 5AJTA 4ND5A 5HRUA 3WQQA 3ZGVA 3HI4A 1XZCA 1FPMA 3H5NA 4J16C 1SR8A 4MZXA 4OKSA 4U6QA 4AX4A 3V4ZA 1SUPA 1ORWA 4TQ9A 2ATCA 3V6LA 4ZAYA 3WGQA 1T8TA 4U63A 2DVMA 3E61A 2LZ0A 5FTWA 4DMUB 1MCZA 1A88A 1LVGA 2I54A 3F7OA 3OUUA 2VUTA 4YQEA 3FOEC 3PICA 4R8LA 2FRVA 2WV9A 1VCIA 2HSGA 3MWYW 1OIWA 3NWJA 3UQYS 1N6RA 3ITNA 1W29A 4Z54A 1MAAA 1WW3A 4TUYF 2KQUA 2JFFA 1EUQA 2XY4A 1AY0A 2ZBRA 4LWQA 1W52X 2CXQA 3DO8A 3HKCA 5E2BA 3OLZA 4RHCA 3VYUB 4YAGA 3K96A 4HH4A 4M0EA 3L4BA 5JSHA 4DUYB 2HZ7A 3ZKAA 1QV9A 2NGRA 3NBXX 1X7YB 1P7WA 2XBUA 2W6IA 2X9LA 1IXRC 1W0CA 2B4TO 4YRBA 5A9SB 3SQNA 1GTMA 4U2GA 4C4OA 1NMSA 1N6PA 1E8NA 2D2FA 4G0YA 4D81A 4O33A 1DWOA 1FFSA 3OQBA 1I33A 2Q07A 1JIJA 2VATA 5EA2A 4Q4AA 5KQPA 3LLUA 5JDCA 1V71A 1FP6A 3QVGA 2GYYA 2GFQA 4DRXB 2FEXA 3EHDA 4KPUB 1OAOC 1BJKA 1R4MA 4ZALA 1FVOA 5KJCA 3ENVA 5CFRA 3BL8A 4HDAA 1NAHA 2GDJA 4B87A 4NZ9A 1JZQA 2G09A 5LWQA 3L6EA 1VI5A 1NC3A 2HJWA 4YBZA 1EB8A 2I6SA 1SQ5A 3UH1A 3ZZTA 4YAOA 1B43A 5FF9A 1X6VA 2V7VA 3G0IA 1TJ5A 1CUYA 4B4KA 4RYDA 2DQYA 1JQEA 5CVEA 1HTTA 3IQDB 3A04A 3A3PA 3LQYA 1A3CA 5EMLA 3RREA 1DQZA 5FBVB 2I8AA 2QN1A 3LXXA 4A2CA 1DEAA 4B4OA 3BA6A 3CF6R 3DZBA 1XTRA 2C2GA 2D74A 1IWOA 2ZUWA 3AU9A 4PG7A 5DW0A 1ST2A 3HEAA 4URYR 4XARA 4BO5A 4BP1A 2AUNA 1RWQA 2BI4A 2C82A 4F1JA 3QKTA 1L3IA 1KI6A 2ECKA 2VH5R 4KI7A 4LZZA 3KHTA 3OSZA 3HV0A 3SICE 3F8WA 3A1TA 4OFBA 4LJ8A 4GVLA 1HL7A 1OW3B 4RZQA 1LW7A 3ETEA 4HQNA 1OX6A 3RIGA 4E51A 3VH3A 1I9CA 3CT6A 1SC6A 1BGVA 3FHJA 4K87A 1LSOA 4MX8A 2ZK7A 1QLWA 3Q0IA 2BELA 3VUFA 5LMCA 1CSEE 1G5PA 2X3YA 3KIPA 4L28A 4LNAA 1SBTA 4D6XA 3QVXA 3B9BA 5D85A 4BFSA 1WXXA 5DT9A 2FSVC 3SM3A 2BMEA 3FMFA 3IGFA 4YCAA 2GH1A 1H42A 4NABA 4RL6A 3CNQS 4OXNA 4XGKA 1XYYA 2VP6A 3ZI7A 2P2DA 5GONB 5B4VA 4I5DA 2ZJ1A 3CSUA 4X54A 2C54A 3ZZ0A 3K9QO 4JLDA 1PNVA 3FMVA 4WN9A 3QBEA 4LNUB 4FXOA 2HA4A 4U5XA 3P9ZA 4M86A 5IM5A 1DRJA 4PIVA 3ZBUA 1I2BA 2FPRA 2MU1A 3A2LA 3UT5B 1DFIA 3FCSB 5BPFA 3W9BA 2DZDA 5CVUA 1UFRA 2VXCA 1XDDA 1FS6A 1KDPA 4LRYA 1EFPA 3W3AD 5T3UA 1HQDA 3DHYA 3PQ7A 5KSWB 2YWRA 1M6WA 2ACVA 2WNSA 3REFA 2O8EA 3MOIA 4CGZA 3D5QA 1TEHA 5AHWA 5CCDA 2FFAA 1DFGA 4C06A 1GA4A 3Q3EA 1DTEA 3ZWQA 1RRPA 1E1LA 2OFWA 2ET6A 4JHLA 1VP3A 2QVGA 4KDRA 2VC2B 2O50A 1CETA 4YMVA 4RXTA 1V7ZA 3AVXA 5DW3A 3QE2A 1TEXA 4L0MA 1H94A 2JEYA 4Q3CA 3GAZA 4D25A 1FP1D 1TFUA 4BNUA 1FVXA 1MQSA 2HTFA 2KB0A 5HMMA 2Q4EA 4HN9A 4J6EA 3ZHZA 2B1RA 2BEWB 4YAUA 2OBLA 3FNGA 5JS6A 5LB4A 4AI6A 2ADFA 1W6UA 3HDTA 3FUTA 4D45A 2X77A 1NZDA 5IKEA 2PUBA 2AEEA 1KU6A 5H4GA 1XQYA 5A2GA 1N0UA 1HDCA 2PX2A 3ILVA 4FLEA 4K0KB 3HJCA 4M99A 1Z35A 4ZD6A 4UBJA 1OGJA 3AMVA 3GRUA 3PQ6A 5K8LA 2PX6A 1MXHA 4TYNA 5ICMA 1IBCA 4PZEA 4ZARA 2CLLB 2QM0A 2HTEA 3H19A 3QGMA 5F3DA 2CK3A 2XWQA 3C7DB 4D3XA 4TTIA 1F8UA 1O94D 3G2JA 1M5TA 1SWVA 2NUPA 4O4IA 4DQVA 5HRCA 4ZCRA 2D6FA 3ZZMA 3EPRA 2DQ4A 4RVSA 3T0GA 2YYAA 3PE3A 4E14A 2P6UA 1YB7A 2B8TA 5ALUA 5HZKA 1E2LA 5IWAB 1G0NA 4CLDA 1QS0B 1PGNA 3LWDA 1H8HA 4EO7A 1ZOSA 2R6ZA 4BN4A 4J1NA 2VDPB 3D3WA 4X92A 5KYUB 3TEFA 1RM5A 1GCAA 1K6EA 3RI3A 3YASA 2TSYB 3G2OA 2ORYA 3I9NA 5DLEA 1NU6A 4JSTA 2VT7A 2IGBA 4MV4A 1CBUA 1QAMA 2BGMA 2WQZA 1A69A 2GPYA 4JLJA 4MUBA 5C1BA 1EQ2A 1WOMA 3B78A 1LKZA 1B0AA 1YR7A 2R97A 4CMEA 1JHQA 2LCQA 3INRA 1JEQA 4ESVA 4O08A 1IQUA 2I6XA 2VZ0A 3COZA 3M3PA 3ECAA 5AQEA 4QG3A 4B3MB 1YBHA 3FYTA 5C1DA 1AH2A 3MRSA 4RDCA 4XGRA 5EP1A 3WGIA 3GPLA 4HFMA 3ZC3A 4TYWA 3OTOB 2UYHA 3ZXSA 1EYZA 3JTEA 3AESB 1EINA 1WXHA 3SP1A 5BNIA 4I9NA 3ZWPA 4DLBA 1K8RA 4BNYA 4ROTA 1UBMS 3ABIA 2H92A 2X0FA 3ZU6A 2ZGVA 2VPQA 4UFPA 2AV6A 4O1MA 3EOBI 3OZ7A 3F96A 3K6KA 3O8OA 3ACDA 4D43A 2HZBA 4K6MA 5DI9A 1XTPA 3W2GA 2RHWA 4YN3A 2PL3A 2WKSA 1HDGO 2AVDA 4B48A 2ZBEA 3PUVA 3AVWA 3OETA 2OBFA 4OJYA 3A6LA 1GGKA 2W00A 2AKEA 2G63A 5FWXA 1JSLA 3WVNA 6LDHA 1UDAA 3PKJA 5J5VA 4MAFA 2NV6A 2B1GA 3PVZA 3SFVA 1UZMA 1RKBA 4U00A 3PX7A 1U1FA 3IBCA 2WOJA 1KR2A 4QAQA 2QJOA 2CE2X 2DCMA 4UUOA 4BECA 3SYNA 2C95A 3INTA 4EWLA 3T5MA 4QVIA 3QQ5A 4BYMA 5CAEA 1A9ZA 5DNDA 4M1EA 2F43A 4IUDS 3BSSA 4NYIR 3AM5A 1BWPA 1A1SA 3PBKA 2H63A 5L3VA 4OHXA 1FBTA 1V4VA 2IY7A 5H9WA 3LUGA 3QF4B 3JWGA 4FCCA 2JANA 3BS4A 1GQ2A 3L06A 2HLNA 3LQ4A 5FOUA 4AKTA 1FYDA 2RKWA 4L8LA 2MCFA 3DL7A 1MH1A 1YI8A 2DH5A 4ZT5A 5JT1A 2NVUA 1AGPA 1DKPA 1YK0A 4JJ8A 5DLDA 3R0ZA 4XX0B 5FAKA 3R9WA 2EATA 2QK4A 3C6BA 3IVRA 3X2FA 4XIFA 1KGSA 3WMFA 4KQHA 2HGSA 3HXOA 1HGXA 2J31A 4WWHA 2SBTA 3U7EB 1YS7A 4FDLA 1U1GA 2JCSA 1F0PA 1CQIB 3IX7A 3BJIC 4LOAA 1RJWA 2FGJA 1P62B 3DTVD 4LYHA 1O9HA 5K3FB 2ZPAA 1TCVA 3UMCA 1QE0A 1W9MA 5AVQA 1Y9DA 4OI4A 3I6ZA 4P7GA 2QN2A 4ZXFA 3WG9A 4MS3B 1SVKA 4H7KA 1QVAA 5I7UA 2FKNA 5B64A 4OJQA 2OEPA 1QK3A 3OD1A 4NJEA 2BV3A 1FSSA 3OC6A 1XRPA 2L0XA 5IHXA 1SUAA 5CFNA 3DBHB 2FQWA 1SZDA 1AS3A 1DJOA 5E6UA 2MINA 4YCDA 4C0WA 4AIIA 1CQPA 3LXMA 3S55A 3TOCA 1HTBA 1NMYA 2O0KA 3OZAA 2GXQA 1X2EA 2Q8PA 2I9KA 2E9SA 2DWPA 2H0AA 4ND1A 1VJGA 2JLYA 3BFKA 4KYVA 2JB9A 2PKCA 5F7XA 2PRZA 1ML4A 1ZYUA 4KJZA 5EJ7A 2I6TA 4AO6A 3P5BA 3L4KA 1GL7A 3KTOA 4AQDA 3NDBB 3KPUA 4PZ9A 4RULA 3K70B 3ETGA 4U7FA 1T2UA 3QH4A 4D9MA 4G1FA 3W8DA 2EJWA 4RA9B 4EZBA 5KTMA 3W6OA 4YRKA 3V7WA 1PD1A 3ISVA 3OQPA 2DR2A 4D5GA 2PMCA 5AKYA 2XNCA 4IS2A 3VU1A 4D41A 5BYKA 1KEEA 1EWVA 5LZ7A 5KSOA 1O5OA 2PGIA 1TZMA 4KQGA 2GHIA 1GL9B 3G5AA 3ZOKA 2NZ2A 3VHRA 3ZWNA 4WKGA 1E32A 5A3JA 5C5DA 4MWOA 4C0BA 2D2VA 4GZMA 1LPAB 4MV8A 5HUJA 5EQDA 2PPVA 1ZR4A 4EHFA 4L57A 5C8ZA 1PYOA 1LUAA 3ENQA 3LTNC 2FEOA 2WV7A 4JR1A 3GLGE 1ZJWA 5SYMA 1SHJA 2IXBA 1RQPA 1NXTA 3A6ZA 1JV2B 2HU2A 3D7RA 1U0NA 3CZ5A 1XQWA 1G21E 3B6ZA 1J9EA 2QX6A 2EL9A 3EGDB 1SVWA 3JQ8A 3ZY2A 2KLHA 4LVOA 2Y4NA 1LF0A 1Q1EA 4DLUA 3RUIA 3ZDDA 1K8XB 4KNVA 2OP0A 1XA0A 4X0EA 1FFCA 1Q74A 3L79A 2NU6B 3AJ9A 2CDAA 4JBIA 1ZZGA 1T3ZA 1NRIA 1KEVA 2IUTA 1DRWA 2GJ8A 1PJQA 4ZC8A 4ZJPA 4MP3A 1OIXA 2BI8A 5A4DA 2V3WA 4OK6A 5F77A 3PLRA 1L7XA 1OT5A 3T5DA 2PD3A 1T1RA 1BS2A 3NZEA 2ZEJA 4AJNA 1NOJA 1QFMA 3L9XA 4LJ4A 2AJLI 2JA2A 1J8MF 3HVRA 1SIOA 2JDIA 3FFBA 2JFBA 4MYHA 2PBLA 4TT3D 2BHTA 2C8JA 3QPBA 2WJAA 2XGJA 2CUKA 4RFSA 3HJGA 2PD6A 4G56A 1E2GA 4JLUA 4DR1B 1SHKA 4LWZA 4EK9A 3PQCA 2FEMA 4L1KA 5LJIA 1WPQA 3GUHA 3HKBB 3F8TA 4MDFA 5FA6A 2P0EA 3SMQA 3TSOA 2UXBB 4RZIA 2TRSB 1XVUA 2XKAA 1X1CA 1L5HA 4MA5A 4U7HA 3VR4H 1QP7A 3OCUA 1GFIA 1GTZA 3VZPA 1PP4A 3LVQE 1DC7A 1JXQA 3TL3A 2VDNB 3U7JA 3M4JA 2HL6A 5CM8B 3VJMA 1FX0B 2R60A 4PZ0A 4ZVOA 2XODA 2ZUFA 1TD9A 1BQEA 2FR0A 4IXWA 3T1NA 3OHSX 4BCCA 1D03A 5SY4A 4Q34A 1CUFA 1J0BA 5AKZA 1JEYA 1M34B 2PFKA 2QMEA 3OICA 3DTYA 4M0UA 5HYVA 3R5HA 4NJMA 1JVNA 5L7YA 1X14A 4J3JA 3NNNA 3DV9A 3L41A 2UAGA 4I3FA 1MC8A 1PL7A 1VJCA 4LX0A 1LSSA 5DHRA 3T0IA 1LNSA 1YNOA 2YWEA 3AF0A 3OKCA 4LISA 5AW1A 2DERA 1ZD8A 1ATZA 5LXTB 3W2EA 1RIIA 3D9QX 3DXFA 4ZU3A 2FMHA 3LC7O 1M5UA 3D8TA 3PEEA 3O4VA 4YJGA 1EXMA 2R8YA 4G85A 2BDEA 2X41A 3VNAA 1XL1A 2JI6A 4TN1A 1JR3E 2Q1SA 4KXYA 2G17A 1UBLS 1U2ZA 2LPMA 3OFVA 4INPA 4MQMA 4ZJZA 3THYA 2XT9A 3U7QA 1TIKA 2B8EA 3M6LA 2W2QA 2DE0X 2HK6A 3OEYA 4HEA1 2W71A 3FPGA 2SCUB 1E6MA 3IUEA 3L0CA 1Z3IX 2G0AA 3ZV5A 4DREA 4DUGD 2Q49A 3N8IA 4J7AA 4KWIA 4LRXA 2JFQA 2OXEA 3CUSA 2ID7A 4UBIA 3WQRA 3C0KA 3E9RA 3O3MB 3K0EA 5EP4A 1B8NA 1RRMA 3C3WA 2RH5A 1E1CB 1G8KA 1H23A 1B8VA 1LX6A 1YJ8A 2VOJA 1J2JA 3D64A 3F5FA 2GK7A 2C9MA 4EABA 3LCUA 3AERB 1GOTA 1U3WA 1UKYA 3IBFA 5DTEA 4KZKA 4CFZA 3UA4A 2BFMA 4AULA 1NOIA 2X8AA 2VDJA 5K0TA 5IM4A 1F5SA 1GKKA 1PUXA 3STWA 1OFVA 2H5EA 3MT7A 3HYTA 1V48A 2IX9A 3GUYA 3L7AA 2I1LA 4GX0A 3T4EA 2X1HA 4QYTA 3T15A 2R0QC 2FOXA 4HX9A 4WD3A 4KREA 4BNWA 4W7SA 5CLIA 3NGLA 4MIEA 1BE1A 1N6KA 4WE3A 4M88A 3BD7A 2DPXA 5K9ZA 4GMHA 1YVPA 3O8DA 1XCOA 1CK4A 2JFUA 4RY0A 4W99A 3T7AA 1NMQA 4MQUA 2JK1A 1JHRA 4S1PA 2QQFA 4KIUA 4C2AA 2XWJI 2INGX 2YV3A 2VJDA 4DARA 5HX7A 1FTWA 1IVYA 2O2JA 1YV9A 3O7WA 5EKDA 3E2MA 5JLAA 1ODJA 3EJ6A 5LYYA 4M54A 4UU1A 3V8EA 2YWBA 4EUHA 3JAWB 3WGKA 3VV3A 4PWZA 3A1SA 1P9WA 5DP2A 3KJGA 3E7XA 1DO2A 3PUIA 4S1WA 3AZPA 3LE8A 3NDJA 1XXHE 2YJ6A 3D0OA 5LUBA 3A11A 2XZLA 4GAEA 3WGOA 2V7QD 2P27A 2BOVA 2CBZA 3GLHE 3TQQA 3RYCA 2XW6A 3G0CA 1EWYA 3G9UA 3HZZA 2VUIB 1Q20A 2DPMA 3O1IC 1C50A 4TLMB 5TARA 1T4BA 3C3PA 1XD2A 2JFPA 1RLTA 4KCGA 5CVVA 5K51A 2NP7A 4AU1A 4C7XA 4DDKA 3PHGA 2FB9A 2UUOA 4HJXA 5AOCA 5ADWA 4W5OA 3IT1A 3OBBA 4U5QA 1N33B 2CD9A 1E3LA 1Z2DA 4YMSA 3V80A 1GDDA 2XMSA 4KXXA 4ZZ3A 4Z86A 3R5KA 1NT2A 3ZIAD 1G2IA 4Q7KA 3RSFA 4Z5XA 2XWPA 2P65A 4CF3A 2LBPA 1WWKA 5EUMA 3ERCA 2X5XA 1JA1A 2ZAIA 3ZCPA 1U3TA 2RE8A 1W59A 1JSZA 1X1AA 3BWCA 2BGJA 1PX2A 2AW3A 2GEDA 3D2CA 4JLBA 3TXXA 2DPGA 3OTHA 1IJFA 1Z4MA 5DEIA 3KEOA 4TMTA 3TIVA 5KMGB 3K09C 3KRTA 3QKWA 1W75A 1I9GA 4Q1VA 4RW0A 2AFIE 4RHUA 5CMLA 1EJBA 4EH1A 3DL2A 2ST1A 3OE7A 4JC4A 5EIWA 4QO8A 1U7OA 2H1WA 3ZX5A 1N5LA 2XE8A 4PLVA 4B44A 4IIJA 1LDMA 2MMGA 5JJKA 3I2JA 1CUEA 2C3OA 1CUIA 1QC5A 3G2QA 2Z57A 3C74A 4PTZA 4AAYA 3NAMA 3W77A 4CLRA 1G19A 5K6AC 4DA4A 3FUXA 1HNNA 4BKMA 1P1CA 2PGNA 4OB8A 1MO3A 3H86A 3K71B 1EXVA 1XD8A 3FTCA 5GPBA 2AHOA 4D3DA 4MVWA 1J97A 2QL7A 3MWEB 1KJIA 2AG0A 3CEAA 3QI7A 3H13A 1GAEO 4O2AB 5BSWA 1OKKD 3ESDA 5CW2A 5ILGA 2PMWB 4I1VA 3SHVA 3N7TA 4CDMA 1C0LA 4OHYA 4I8IA 4LHSA 2NO5A 4HRVA 2WU3A 4GLBA 4PC1A 1N7IA 1M8FA 1L1EA 1T8SA 2Q8NA 3F7NA 3NHWA 2BMWA 4J1QA 2XRMA 2LXNA 5EVCA 3T5GA 4C1BA 3CX8A 2QRZA 3KK0A 3ND8A 4MKIA 2IY8A 3DXXA 3ZXYA 3DLBA 4LV6A 4DCPA 4Q93A 2PXCA 3VTKA 3WLSA 1ZUHA 4JR2A 5LLDA 3AFMA 2X2OA 1Z6AA 3KOZA 4UCXA 1P73A 4IJMA 4RVOA 1BDIA 3P5SA 3UXYA 5DCLA 2QYTA 3E82A 1VKNA 2G6BA 5F23A 1CDEA 4JVSB 4R84A 3WGGA 1P5ZB 2ZI9A 4TSFA 5ALPA 4Q48A 3ZKWA 3MBIA 4UMEA 2F1IA 2MSKA 2O8VA 2XMGA 3HJHA 2JGLA 3LUAA 3EVGA 3PD7A 3PFNA 4QAJA 4C3UA 5KTKA 3P9NA 3PQDA 1U0TA 3QXCA 1DRUA 4HJRA 4M76B 4ZCPA 4V0RA 1UT6A 3DOHA 3BGOS 3IMCA 3NWEA 2QUAA 4REQB 4FN5A 1SHLA 2BTQB 2FZ4A 8ABPA 4PYRA 1X13A 3ZBPA 1J23A 3K32A 3OF2A 2SNIE 4Q7EA 1WB4A 2ZOSA 4X00A 2ZYRA 5FO0A 2PU7A 4N0QA 1L5NA 5I3CA 1QNLA 2FYTA 3KR0A 2RIRA 5AKKA 3S4YA 3KSZO 2O8DB 1NJ2A 2ZROA 4MVXA 2G72A 3CVYA 1S89A 2DBQA 1NQAO 1EK6A 2MIIA 4EUEA 1HFEL 4NMXB 4Y2VA 3H11B 4QUAA 2JIDA 1J1IA 1T9HA 3LKDA 3GT4A 5CX1A 4B4DA 5JU6A 2AD5A 1Q1AA 2FPIA 3I1IA 1DVRA 1MQ8B 3R0IA 5FA5A 3PQFA 3OLVA 4YCCA 5FWNA 1K3UB 3D8HA 1I4OA 3F3YA 2CJWA 3IDQA 5BP7A 4OYHA 3KO8A 2O7NA 3U4AA 3G8CA 5K8IA 3AM1A 4R2IA 3MINA 2NLOA 4P58A 1E1RD 2IOHA 4PZZA 1XE3A 3TVYA 1CQZA 1OZAA 1A9PA 3GDFA 4MYTA 4KOEC 3LAWA 1WLYA 3JQCA 2KYRA 3T7CA 3U3DA 4C43A 2XKJE 1E2BA 2HB6A 3U2QA 2OB2A 1AGNA 3CKLA 2RHCA 3PB3A 4J4BA 2Q6TA 3FDZA 4EDFA 1C7FA 2BKEA 2FPGB 3AQ4A 4O2BA 4LF8B 2O1WA 4J1SA 1MEJA 4IMPA 4B6PA 4TV9B 5E7IA 4B4UA 2CL0X 5ENDA 3BIWA 4YHHB 4FX2A 1U81A 1V35A 2FOIA 3BF8A 4PSVA 5ALKA 4ZDKA 1P0IA 4PVCA 3B3AA 4V0QA 4W4TA 4ZV7A 3TJRA 3AKEA 5IVKA 1LPOA 1GUAA 1WB5A 4Q0MA 3VI3B 1UJ2A 2VF7A 2WJYA 2IPLA 2UYGA 2RBKA 3A6FA 4WOJA 3SJ7A 1U2RA 4QT0A 4RGQA 3TZKA 1B0UA 2P6OA 4YQYA 2V55B 2XKKA 1M8PA 3DVRX 4H1VA 2VCEA 3SS7X 4CKEA 2OOSA 4DV3B 2V58A 4WQMA 4E1BA 5MDHA 4YQZA 3C5WP 3KSDO 3S1AA 3NAGA 3A4TA 1RI2A 1XSEA 4F6RA 3TI7A 4WNCA 4OU4A 4UE3S 3HB1A 5KPJA 1NNEA 1I4TD 3T8YA 4KTVE 2ZI4A 5M3BA 3TW8B 1QHEA 4EJSC 4IYJA 5KQSA 1RJ9A 3CX3A 2XOKD 4A2QA 5C35A 1QTIA 1MX3A 2EP7A 3KKQA 4V1CI 4V2IA 3SMVA 5DM1A 4FYHA 4DM3A 1QGYA 3G8BA 1RZRD 3VOTA 1CDZA 5JD3A 1UXJA 1U5AA 3HB7A 2FFRA 4Z3KA 4YEDA 1L7OA 1T8UA 1GZUA 2Y1EA 3LBYA 4Q03A 2QQ5A 7YASA 3OOJA 5AK3A 2YVLA 3WK4A 3DEAA 5JVDB 1BZYA 1NMXA 2D1SA 2EDAA 3SLRA 3KM0A 1A1VA 1TF5A 1WSAA 2VPYA 1N3IA 1H4TA 2ZYUX 1RRVA 3ENWA 5CXQA 4C05A 1L1QA 2BJVA 3UF0A 5KU1A 3DZ8A 2TMGA 3KQHA 1UBFA 3Q9SA 4B40A 4EECA 1CVRA 4IJWA 2COEA 2NTNA 3JYHA 1QO0A 1ECPA 2SKDA 3N0TA 2NSDA 1KS2A 3DKPA 4JP2A 1SBIA 1VIYA 4F93B 1T0PA 1PT5A 1DV1A 1YRQA 4HD8A 3MTBA 1TM7E 3BF7A 3OPYI 3FH0A 5E0KB 5GONF 1BRMA 2AMFA 1HF3A 1RD4A 1UBRS 1UDBA 2H52A 3HEBA 3SQDA 2AS0A 4JUCA 3SX2A 2XDQA 2OFOA 4X41A 4BNJA 3VKVA 4ZVQA 4CF7A 3RTGA 3DBRA 2Z09A 5EIEA 3H5AA 2XQFA 4RXMA 1DZIA 1ZM3A 2OGTA 4JBLA 4YJ3A 3KWMA 1IY1A 3TSWA 1UKZA 4S2EA 3W06A 4KO2S 1K97A 1KZ9A 1OYVA 1AA6A 1GPKA 1I1OA 3MGAA 5D86A 3E4DA 2PS3A 3QUSA 1XAHA 4HYTA 1KXZA 3O4IA 4M9UA 3ZLVA 4HRAA 3GRCA 4NEGA 4MW6A 2AL7A 1SCBA 2H0QA 4R1QA 1U04A 5AT1A 2BFWA 2DF8A 2HXGA 2J7PA 3S5JA 3IJRA 5JAPA 3USZA 3FZYA 1N6IA 1OBFO 1PR9A 3R5XA 3DBOB 4P53A 3UMSA 1AQNA 1S3GA 1ZINA 4YMIA 4BLSA 5AM2A 1ST3A 1MBZA 5J40A 2ZB4A 4PYKA 5E7JA 1IJBA 3EY9A 3ROKA 4KW7A 1NM5A 4OH1A 2OM2A 2Y0EA 3L3BA 5ALGA 3PL5A 3QEKA 2XUHA 4LOHA 3MCWA 3UFBA 1W36B 1DOHA 2AFVA 1Y1LA 4YRJA 3T3GA 1GQYA 4D9CA 1XCMA 3AW9A 5JEEA 3N6XA 5SYNA 3N39C 3GUUA 4HEJA 1AURA 5I7WA 3TPFA 3DZGA 4WN9B 1E9RA 1D2RA 2MYUA 4O8ZA 4Y9RA 1OWPA 5IC5A 4OLJA 2Z1NA 4Z4EA 2Q41A 1SXJC 5EXXA 3EFHA 4MRRA 3CLUC 1ZBQA 4NENA 3SVLA 1Q1NA 2XMQA 4FDVA 3Q6NA 4B4VA 5J63A 1RM4A 2RHJA 2V7EA 1PS8A 4G0QA 1X0XA 3RIXA 3TK1A 1SBNE 1EFPB 1E58A 3HSSA 4TS1A 4YRNA 1UK8A 3NBZC 5KKNB 1CRWG 4IVPA 4MV6A 3Q88A 1T0UA 2EQBA 4LQDA 4UW9A 4RTLA 5LMNB 3D6NB 2NTJA 1I6LA 3CZ9A 4KSBA 2IF2A 3HYCA 5DGCA 3E1SA 1Y48E 5GQSA 1VYVA 1JF8A 2YC2C 2WTNA 1OB5A 4WL0A 2BY4A 7MDHA 2BFEB 1GSHA 1RE0A 1WBBA 1H2XA 3GLGA 3A1FA 3T12A 2ZR7A 3PEWA 2C59A 4IDQA 1QX4A 4QC2A 1UAGA 3RDPA 1VSBA 3BWEA 1KK1A 1G21A 3FZGA 5B4TA 2W8ZA 1NI5A 1RHJA 1ZN7A 3NFYA 1RHQA 4YI5A 3ICOA 5A05A 4FKBA 4EKGA 4BNDA 1F51E 1PFGA 2I6QA 5DHSA 4ETWA 1FXWF 3ZDZB 1SQSA 3MK31 5KZMB 3ITKA 1LS6A 1QIHA 1K3FA 2HCBA 2IHBA 3QU2A 2FPPB 4IHKA 4J49A 3EBPA 4NV0A 3HCBA 2I29A 4S1NA 4KYUA 5THXA 4QYSA 3HYRA 1Z0JA 4I4IA 1ADGA 1VA4A 4I6GA 4JLVA 2M6SA 3KKOA 3T3NA 3FMOB 4RZUA 3QTBA 5CT4A 4ENWA 1US8B 4TV8A 5FFFA 1A76A 4L6CA 3MQ2A 4QPPA 3MAJA 3V1MA 4Z4CA 3JWHA 4CTKA 1P91A 5C81A 2IS4A 1UKBA 5ALOA 3ZHVA 2ODWA 5IAAA 1NZJA 4HWTA 2REBA 1ZCFA 4OQZA 2RKBA 3AI2A 3ODPA 3WNCA 3OCJA 2NUPB 2PR7A 3H5LA 1RTTA 1XNJA 4IUCS 4O4IB 1L9XA 3PXBA 2J6HA 1O57A 5KYVA 2V03A 2HRRA 1TYBE 3EXAA 4CT4B 4DXAA 3HADA 3EQ7A 5DCUA 3SR0A 2I22A 5EKXA 2OG2A 3G0HA 1DG3A 1NFQA 3E9ZA 3L0IB 4K9QA 4B45A 2AJCA 3P8ZA 3CHYA 4GZ6A 4HNVA 3K1TA 4G5GA 2CDBA 1V9LA 1XOIA 5L8VA 4ARVA 1XBTA 4FLFA 2BISA 2WIBA 2XH8A 1ZMTA 2IYVA 5LQAA 1VMDA 3ZY3A 3KZKA 3IESA 4XB6B 4DEYA 4C5AA 1YIAA 1JEQB 2VG8A 4IDGA 1E4VA 3TLMA 4FZJA 3NDPA 4FIZA 1WCWA 2OD9A 4FWBA 3ZS9A 3AV3A 3QUCA 3OU6A 1ULHA 1FSGA 2BKVA 4RF5A 1HV8A 2PT5A 2AJ8A 1U2DA 4P5PA 1RAAA 1SMKA 3CPHA 3DVAA 3SY8A 1A7KA 1PJLA 4GVPA 4UTZA 5B3AA 1BSVA 2FN7A 1EESA 4IKPA 2OHXA 2V5AA 3COJA 2LD4A 2C3MA 2QUIA 1MD9A 3AF3A 1U2GC 4JKIA 4IDDA 3ABOB 1H5UA 2R84A 3CMCO 5AH0A 5D3KA 1T9BA 3ADCA 2DHCA 3DZFA 1ZWKA 2HBRA 4OK3A 5LD2C 1JR3A 4QECA 4RTKA 1XAIA 5FWXB 2ZU6A 2WKWA 4NE9A 3AIOA 4ZT3A 1OROA 2O4UX 1SC9A 1KVRA 3K2IA 4WXHA 5HIMA 3N2YA 1UEJA 4UOQA 3BCUA 2Q2WA 3DDCA 1SVSA 3E1GA 3EIUA 3G2PA 3GW8A 2W2LA 3LU1A 4JC8A 1I01A 1VBMA 2RK6A 5CAEB 5A6SA 2XD9A 5TQVA 4BO3A 3G6WA 5DTQA 1GILA 4ZCMA 1HFWA 3RJMA 5CJJA 3PDHA 4C21A 2D06A 6AT1A 4H7EA 3KDSE 4Q18A 5FPHA 2BFFA 5DN6D 3R7BA 3H8JA 3PQEA 2YJGA 4K28A 2E4WA 4OLBA 1HEYA 2V7BA 4YYZA 5CDHA 4KEAA 1ISFA 3GMTA 4MI6A 2VPZA 3DGEC 4NHOA 1X1DA 3WQHA 3I6QA 2O59A 5JV5A 2XTAA 5ADUS 3ON5A 3MJ4A 3NKVA 2PUVA 1T5OA 2YDXA 3A1NA 4ND3A 4PGGA 1IK6A 1OLUA 2W4MA 5EWJA 3ZNPA 3O2NA 3TAUA 4TVOA 4FXPA 4H0FA 3HUTA 4LMBA 3TNJA 3L04A 3TIXB 3TOXA 3U61B 1Z6YA 3K8ZA 3WWCA 4CQNA 2ZB2A 4DM7A 1ZZEA 2GN1A 4D9GA 1UBCA 3WWZA 1MNQA 5A4MS 2WHYA 4WNAB 3QBDA 1AF4A 3M33A 2BEVA 2F55A 4DDHA 2PJZA 4EKIA 3NCTA 4IH4A 1AKYA 1SZJG 4NJEB 1WZNA 1HZZA 2NU9A 3KV3O 1XCBA 2HXYA 4LGMA 3RGWS 1KFEB 2VNSA 3TAHA 3MJTA 4LK2A 3MB5A 1Q0HA 3E22A 2YIJA 2MINB 1C0KA 3F9RA 1V11A 4JWTA 4ZOLA 5KWSA 1Y3HA 3QFSA 3D7LA 4GP9A 4RANA 5DYGA 3W6UA 4JT2A 5K45A 3F73A 3U40A 3W3AH 4BNZA 2C57A 2QW1A 4CMCA 2GZDA 1NF8A 4D80A 4LZOA 1GUYA 4DCOA 1V2HE 1EP3B 2CCGA 2L42A 3EUAA 3OZRA 4L75A 1D0VA 1O97C 1OHHD 2B1IA 2P3QA 3ST7A 3VPSA 4KDFA 1T0HB 4BLPA 3NDRA 1XTIA 2CMHA 1POXA 2IU4A 1NN5A 2KS6A 3BXFA 1JX6A 3EYAA 4BJ1A 4QGSA 4BX0A 3OZEA 4AROA 3OY2A 3L07A 1FRVA 5BSRA 4BKOA 4QREA 5ALDA 1DXOA 1UKEA 2WSBA 3ACCA 1R6VA 4CKZA 1GHTA 3GJYA 1JWAB 5KU7A 1P1BA 1UWVA 4OREX 3C3YA 4G2TA 2C2YA 1U6KA 4R1PA 5BSUA 3IKJA 3V34A 3TW6A 2YOHA 4Q9JA 3GZJA 1L4FA 4XWGA 3RVRA 3I0NA 4R3WA 4G8JA 4J0DA 5KC8A 1QHIA 5KOJA 3SI7A 3IXMA 2P30A 3TMKA 1ZRSA 3C85A 2YHAA 4PY2A 1RQ2A 2AFIA 1NN1A 2XCUA 3PU6A 4MR8A 1C9DB 4PC7A 1JDBB 2XWBF 3EF0A 3D7NA 3D0QA 5CYGA 1KEKA 2HYDA 2PSDA 5F7OA 3BCHA 1H8EA 3VM6A 2WYWA 3Q3VA 3UJCA 1ISHA 3JQ8B 1G8FA 2R4UA 4JP8A 5KOYA 1K9SA 5EHGA 4D8YA 3GPBA 4KKXB 4R1UA 1J0AA 3QBVA 3AKZA 3JW8A 3JV7A 4A6XA 4E1AA 2AKYA 5DNVA 4ZVTA 4BO7A 5TQ0B 2CFIA 4OXXA 1B73A 1RXYA 2D1FA 2YCLA 4ER3A 1D9XA 1RW4A 1F4LA 4JJ4A 2JGAA 5BWCA 4HYQA 3EW9A 4RIHA 3LVBA 2C8LA 2HK9A 5BN3A 4JVOA 1JT2A 2DP4E 3I28A 3BK1A 4F8JA 4KE6A 3MELA 2G6TA 2WB4A 3DVSX 3V3TA 2Q21A 3N9IA 3GGDA 4E31A 4R4JA 5AW4A 1K2VN 3SEAA 5BVHA 5LQUA 5I9IA 4ZPJA 3FMPB 1Y6QA 1BHQ1 5IAJA 5LXTF 2WWHA 1XUOA 3T3IA 4LXIA 1T1EA 3IHLA 3T1YB 1DIHA 1D7AA 3AR4A 2YCBA 3HS3A 3K8YA 5K3SA 3UH0A 3BE4A 4RY2A 2BKAA 2GM5A 4RFSB 1UBNA 3HQ4O 2BH2A 1NXXA 1Y7TA 1NF9A 5JYBA 4QUDA 3TUIC 2YHIA 3E81A 5HKBA 4YV2A 1Y5LA 3QTLA 2NPOA 2BBOA 3F46A 1JAHA 1L8XA 3K72B 4NBTA 3UMGA 3GFBA 4W63A 3JALA 5TJHA 3U9SA 1AHHA 2EFGA 3WL6A 2EBFX 4E5KA 3AH8A 3OM9A 3BB4A 1PLJA 5KHAA 1NLUA 4IJKA 1X1BA 2NYAA 5JMOA 4WDQA 5AI8A 3H2ZA 3REQA 2JLXA 4AIRA 3QKRB 3T1HB 3F2VA 4JV5B 3QVWA 2F7SA 3EVCA 1NZFA 2YXDA 4O3FA 1R9JA 2GARA 1VCNA 2GFHA 3GXOA 1JEYB 2AC4A 1SOWA 4DR3B 3AGPA 4LE0A 3U1BA 4NJMB 1GEEA 1TQ6A 2O5RA 3KTFA 4EARA 1RPZA 1Z4PX 3JSAA 4X66B 4OVKA 2R85A 1COWD 3D3KA 2GBLC 2RK4A 1M2VA 1U3GA 4ZP1A 1H1TA 2B78A 3RYIA 2W2TA 1E2PA 1JALA 4M0CA 4BVEA 5I3ZA 2C07A 2F4NA 1SNYA 4KPEC 3C7CB 2B6HA 5LN1A 1XEWY 3HVHA 3NHMA 4R9NA 3K0AB 1J6UA 3KR9A 1KVTA 4MS4B 2CLHB 2O2CA 1Q0LA 1NU8A 4IY1A 3SEQA 3TOZA 1NOKA 3P9XA 2R8EA 3C4QA 4FYIA 3L4EA 4WZ6A 3RUCA 3LC1O 1A97A 5BN4A 5C5CA 1TUBB 2QG6A 4AFNA 4MQBA 4AN1A 1UR5A 1ZGZA 1U1CA 1X92A 2PX3A 1MC1A 4RF3A 3N2IA 4PGFA 1QHHA 5HIJA 1LV7A 1C7ZA 2BMVA 1Z0SA 3C6MA 3W2IA 3PNYA 3DG9A 4E5PA 1JEDA 4LMPA 1ENZA 1ZXLA 3DUFA 5JFOA 4YROA 4S04A 1JIXA 3HWRA 1GT6A 4O4JA 4Z9AA 1GU0A 4HN2A 4H7PA 3TXYA 3W90A 4BLWA 4ZCTA 1J9GA 4CMIA 2QU8A 1UP6A 4MQEA 5KTYA 2FZLA 2QVYX 4ZCIA 3CPEA 1T3SA 3DV0A 3AR5A 1KK3A 4DR2B 5CFZA 4DVJA 5IF3A 3W5BA 3WTBA 2YXBA 5CFQA 1PZHA 3ONNA 2B4YA 1FJHA 3AONB 5IAEA 3M5DA 4DLWA 4YCMA 1FDTA 5IYZB 1IHOA 3MRXA 1E0AA 1I0IA 2HLDD 2V9CA 3ICEA 3BK2A 2BLNA 4MS1B 3KTAA 4H4CA 2O2DA 4PRKA 4AJ4A 3S2UA 2GGSA 5IVDA 5GIOE 1I2CA 5L3QB 2XCQA 3CJQA 4AN0A 1LCIA 4L3VA 4JNCA 2YXLA 3E0XA 4TSKA 2ODPA 4B71A 2IBTA 3ZCUA 4EZEA 1U7UA 1Y80A 4YMHA 3R1IA 2D7CA 1MW9X 1KOFA 4CT5A 5SZKB 3L7JA 9LDBA 1IZ8A 1GG8A 3OLXA 1GXSA 4GX2A 1ZK1A 1GEGA 3RQSA 1BKDR 4IO0A 2QRGA 4DLAA 1XZ8A 1J5XA 1QIKA 2GZMA 2QKYA 3EZ7A 4M0KA 5PGMA 1VJ5A 1PR4A 3RANA 5AW2A 4AMBA 5CEJA 1DHRA 2GAOA 2ZYIA 3QLJA 2UZ0A 3VH1A 2AKAB 5CXXA 1Y1PA 3UOAB 3RYCB 2UDPA 3R3SA 3U3XA 3IR6A 1UXKA 3HPQA 4WNIA 1M2FA 1XRMA 3KOWA 1QHXA 3S81A 3STYA 3DM5A 4EIWA 1DC8A 1JHAA 1FFYA 1M1YE 1W0JD 1OWLA 3NB0A 1MC5A 2AQ8A 4GEKA 4HLNA 4C4SA 1FDUA 4GBED 2PT7A 4B6EA 3E3MA 1B93A 3CTMA 3DPSA 3P9CA 4O2AF 1CZLA 5K6RA 5JNWA 3KSBC 2PRYA 1HDEA 4AY2A 2G0TA 1NW8A 1G4HA 1Q0PA 1EUCB 3UMFA 1UC9A 1TZKA 2N75A 4DLZA 2VQFB 2ZB8A 4L8GA 4KN8A 4FB5A 1E6EA 4UARA 2IC5A 4CDGA 1L7MA 2QRVA 1H5QA 2J9FA 2LE0A 2ZI6A 3RYFA 1NNLA 1A8SA 3RLFA 3WLLA 4Z8YA 5LQSA 1NL3A 4H3HB 1ZHOA 7ADHA 3I1FA 2J4FA 4AT1A 4TWAA 1SUEA 2AOTA 3OAAA 2YN4A 3SGLA 3A3OA 5K0ZA 5DEOA 1RCUA 1P2GA 3C98A 1JQBA 2FFQA 4IIJB 4Z4FA 1Y3AA 1DAFA 1BCRA 1N1MA 2YRWA 4CLRB 4XVCA 2H9YA 2CHQA 4YUWA 3QRWA 5FLXA 4V0SA 1QCCA 5J5CA 1FE8A 1YB5A 2BSXA 3I9KA 4D74A 5DIFA 4YCBA 5CB6A 1PFKA 3FCYA 1XDBA 2LDBA 4UJ3A 3FGNA 2I3DA 5CPFA 5KVVA 2E82A 3BC1A 1USIA 1J00A 4N3CA 3NJ4A 3D8BA 4HTFA 2P5SA 4G0ZA 1Y3BE 3OZFA 4GZ5A 1E7QA 1RFGE 1KO8A 1QYIA 1RYBA 5FADA 3MIIA 3RABA 5EXEA 621PA 2POCA 2ZYVX 1AXRA 4F38A 2OE2A 3N8HA 5CH8A 2PA3A 3M5WA 5HF6A 3RAFC 3LTEA 4UXIA 4FOOA 3DE3X 2ZIXA 2MR5A 3OJLA 1CP2A 4RKYA 4TM7A 1C8LA 3GV0A 4BYGA 4PQEA 3FYHA 1PZGA 5IK2D 1FFAA 3WLHA 1BWRA 1EXWA 3ETHA 3FDFA 4PQRA 4Y67A 3FTQA 4I8XA 4RCVA 2IYWA 5DT2A 4TKVA 2C2HA 2YNMA 3AI3A 4KVFA 1M73E 3ONDA 4I3GA 5REQB 2C0QA 2EYUA 2YJ5A 2YFQA 2Y05A 1YUNA 4Y2XA 2HNKA 4LYYA 5B57C 5EJEA 3DHNA 2HXSA 1PFQA 4NULA 4BNXA 4NHEA 4QICA 2I2BA 3PUWA 4RAOA 4WI1A 3X0DA 1N7JA 2H9AA 1FYWA 1QPZA 4CM4B 1JJVA 4CUKA 5EYPA 1SB9A 4CF4A 4TV9F 2X9VA 4FFDA 4RCYA 4X8HA 1QAOA 4ZYXA 3JATA 3K0SA 1MVOA 1N2BA 1Z18A 4XSGA 1CJKC 2ZUUA 1EBFA 3P4UA 3CLTC 3N75A 5ECYA 1WTCA 4A0QA 3ESBA 4BQSA 2XZTA 4DBLC 3PHHA 2Q4BA 2XUKA 2C03A 2QGNA 4NV1A 4FYKA 4UD6A 1AD2A 4GECA 2XNDA 4O0MA 1KK2A 2ZYGA 3R0VA 1CNFA 4R54A 4E7PA 4PSKA 3RC2A 4KN9S 1USGA 2FH5B 5CD1A 1MNAA 4WOPA 1Y9EA 3KQOA 2QTWB 3NBKA 4QHSA 4ZYLA 1QH8B 2FQ1A 2HUNA 5CX1B 4EPYA 2PLNA 1Z56C 2Y27A 2CVHA 3PNSA 5G41A 4BBAA 3R44A 4LXGA 2CJWB 1YJ5A 2VRCD 2ZE6A 3SE7A 4JVLA 4GNKA 4CIVA 4KACA 3MINB 2XOEA 1WHTA 2FMIA 2ECQA 5FOVA 4EO9A 1NBAA 4RTQA 4NG5A 5BQPA 3H2KA 4O8CA 2F3RA 2VYVD 1SXQA 1A4XA 3PE6A 1NKSA 3FDZB 5IDYA 5BVGA 4PPGA 2GPJA 3BOSA 4O2BB 1D5CA 3CBQA 1BTOA 4DZZA 5JVDF 1GG9A 3D4PA 4UUQA 5EC8A 2BFDB 3L84A 2ANCA 4HEQA 1FDIA 4ZI7B 1ZI9A 1U0JA 2CKMA 2FCRA 3E3OA 4JOSA 3MOGA 5G3ZA 1E8DA 3IILA 2WKRA 1RC1A 1AB6A 2XADA 1BDBA 4YRQA 2H29A 3ASVA 1LBEA 1S4QA 1GPMA 3OEHA 4ZT4A 4X65B 3EEOA 4P0QB 2DQSA 1I3CA 3K0FA 1RZVA 3SQMA 3V00A 4NCKA 4ZHSA 2YQ4A 5ECWA 2ZSFA 3C16C 2C8KA 3K9WA 1V5WA 4XYEA 4ZKEA 3ASZA 1R0BA 3S1AB 3FR7A 4F6RB 4URXR 2MYPA 3DE1X 3FSRA 3NYQA 1AMNA 1ADBA 1W34A 4L5AA 1KJWA 3UFXA 2F3TA 3KL4A 3OLQA 3GEGA 4OHUA 1RJ9B 3GGCA 3THOA 3SQLA 2NU8A 1O8BA 1BQ3A 2QUJA 2YJ4A 3FNHA 3QUTA 2XVZA 1PV1A 3RBZA 4F85A 1XEFA 4DDTA 2GHTA 1A4IA 1ZNWA 3PEUA 4HYYA 4LDNA 4OH7A 2GAIA 2BCGY 2V7GA 5EZYB 4AM8A 3DD1A 2GEFA 1Q1ZA 2WW8A 4KLAA 2PT9A 3LV8A 1TT7A 1NHWA 1WY5A 2OCAA 3LCJA 4UOZA 2X5OA 2FPSA 2P41A 2DFPA 1KHHA 2ZB7A 4D0SA 5IHPA 2NV2B 3VU8A 3GFRA 2CHVA 5K3BA 3VVLA 4OKIA 1O95C 3X2SA 2GAAA 3V8BA 3UBTA 4MPJA 3EB9A 3VISA 3K0CA 2H00A 1BXGA 2HQ1A 4R98A 4XIIA 3K1ZA 5UKDA 3CNEA 3ZHOA 1WY7A 2OO7A 3M82A 3U3JA 5IXJA 3E84A 4N6OA 3W5HA 1G63A 4DIDA 4MV0A 1JVSA 5AVVA 1EUDB 2O3QA 1Y8RA 2HKIA 4WLNA 1U8AA 4YJ3B 1YBVA 1DLIA 1PDVA 5B1SA 1Q6YA 4OHFA 3P27A 1U4SA 2GAJA 4WK6A 1IY8A 2IXGA 2NZJA 3RSLA 1PDWA 3VGPA 4ZI2A 5BWBA 2ZUEA 2VR1A 4PLTA 3S1SA 2C9OA 2QPOA 4Y2UA 4QD3A 5AIAA 2EX4A 4PLYA 2OHJA 2C5BA 2YHSA 3AG6A 5HQ3B 3NHPA 4IIYA 2IYEA 1UKVY 3GLRA 1YBMA 3H7IA 3IQFA 4EYKA 1YUMA 1G59A 4CI9A 4HZIA 1X8XA 3R7NA 1JN0A 3QFRA 4H17A 1FFWA 1RABA 2JCGA 2E4VA 3BXEA 4KQXA 3G17A 4NJOA 5DWDA 2VTDA 3WB0A 4YRGA 5DN9A 1VSTA 2GLUA 3GJ5A 5CH5A 1GSAA 4Y98A 2CFTA 4RMGA 4G5FA 1L8OA 2Z2IA 1G5RA 3DLAA 2Q4TA 2VF8A 4CN9A 4R1NA 1U8TA 4MRPA 5EKTA 4AZVA 1OLXA 4FN4A 5KVSA 1B8PA 2H51A 3MJVA 1K4KA 2V97A 3RKRA 3K8QA 4BLQA 1VZ3A 2PJRA 2XQKA 3BHMA 3MUNA 3G2LA 2Y0CA 3O2QB 3T9EA 1U80A 4QPDA 1Z0DA 3QG5A 1G64A 1BN7A 4FU0A 5E2AA 3RC1A 2QM3A 3ZH9B 2YINC 4MP8A 4EEZA 5HM6A 4XVRA 3NYRA 4KWCA 1YIDA 4G0VA 5F2KA 5H83A 3ASYA 5LKAA 2PV7A 2QLFA 2GT1A 3HFJA 4L4YA 4LY0A 1JH8A 3VZSA 1SKMA 2HBZA 4S1OA 5EPOA 1RBZA 5AM4A 4H27A 1MDFA 1ZM7A 1DEXA 4ZVMA 1CVIA 1ESEA 1SA0A 3DCJA 4L9WA 2JG3A 3WGMA 1YK1A 2HSZA 2UYOA 2XYVA 4Z0HO 5IT0A 3O8RA 5LQRA 1HEIA 2PCJA 4LC9A 1XCJA 3G79A 4INOA 5TMDA 2P6RA 3WMEA 4O4IF 2XTZA 3EEFA 2ZBUA 2ZANA 2VZLA 3HFRA 4JQOA 4PEVA 1AGXA 4C29A 1JAZA 1DBVO 2D59A 2DRIA 2WILA 4FLMA 4WZBB 4BVFA 3EX7C 4HAIA 4A6PA 3NMUF 2E4ZA 2VS1A 1SN7A 3N2NA 2J0SA 3NC0C 4MB6A 2MSLA 2BUAA 3FM9A 4HZUA 4QPNA 3WRXC 2W11A 3WSWA 1T2EA 3EIWA 4Y0AA 5DF1A 1WNFA 1QX3A 5DU2A 4ZQGA 4G9GA 4YJ2B 3JX9A 4O6VA 4A6DA 1SVLA 5GJWC 4XPZA 3SS8A 2EGUA 5KB3A 3RB8A 1E1YA 1GYQA 3L0SA 4UVEA 2J3IA 2XJ9A 2MSEB 3WTCA 3LP5A 1CLEA 4D9BA 2PMFA 4X8MA 4ZPXA 3PD0A 4KRFA 3PFWO 1ARZA 1NW4A 4PAOA 3ADOA 4I36A 1W30A 2Z2XA 2RGEA 5K4HA 4OL0A 4CBVA 1OPXA 5BMVB 2DYKA 4QDXA 1U2PA 3LQKA 4TV8B 2P79A 1M7BA 5IMSA 1MA0A 1OAAA 3A1UA 2G8NA 2XRYA 1U9IC 1XD9A 1FZTA 4KIJA 4N48A 4IG9A 1C2TA 2Y93A 8ATCA 5DWQA 4GRIA 4EHJA 3NR2A 3SAJA 2OBBA 3QHAA 1V2GA 3C3KA 3DO5A 1JPNA 2Z3WA 4MWCA 4OQ4A 4TKUA 4XA8A 4ZQBA 4M7OA 2R751 2B0JA 4PX2A 4JLKA 5BOVA 5DM0A 4C0LA 1E3MA 2REQA 2WT4A 3W8NA 3M6IA 4N7JA 4WZAA 3UW1A 3TOSA 3GT0A 2BEJA 4WLFA 4ZCLA 5A71A 4M0MA 4ER6A 3M6AA 1Z62A 1B2LA 2E6UX 5KWVA 4MPPA 5AOAA 3ZBTA 3V48A 1EG2A 3CNNA 1KVSA 1CRLA 4FDAA 4H08A 5FKJA 4O3MA 1P3DA 4ONEA 4X1KA 4I08A 4IXNA 2RHTA 4DWJA 1YFZA 2Y77A 4FK8A 4H4DA 2H08A 3UG6A 1J8FA 2DULA 1PNOA 3B2NA 1SXJE 4AUEA 3UA3A 1MORA 1K7XB 4FI3C 3O8QA 3M5CA 4FSDA 3WYEA 4KI0A 4KQMA 3K70D 1VI6A 5IW8A 4EPVA 2RH9B 4W9NC 3WL5A 1RLUA 4PO8A 3P9PA 5JAZA 4HB3A 3DVAB 3UBMA 4RORA 5ADHA 4F4DA 3ANLA 3OZUA 3WHIA 2W2NA 4RO0A 1X38A 5F2OA 4P36A 1I13A 2JIPA 1ADJA 2QMZA 3E9DA 4GXTA 4XWAA 2HRZA 3GGOA 2HU7A 3F49S 2G5TA 5DX0A 1GFZA 2Z3VA 4UOEA 2X4GA 5TV2A 1NBEA 4ZQFA 5EZ6B 4CL2A 3U4QA 4PSCA 5KTSA 2QTNA 4PAQA 2Z4TA 1S1MA 1G38A 4W5WA 1JJAA 1Q15A 4IGAA 1OTHA 1N7GA 1WSWA 2I67A 4UASA 4JEIA 4IGEA 5EMMA 4ATNA 4KZPA 1K7FB 1HY3A 1P8AA 4FGJA 1D7OA 4QEKA 4QELA 1RLOA 4WBSA 5AP9A 2XTMA 1W5SA 5B1YA 2BF7A 3U19A 3UMJA 3DTNA 2N9UA 2JD0A 2JC3A 3H42B 5A6SB 2JRLA 1RP7A 3AL3A 2OQRA 3EZGA 4RENA 2P9FA 1S2DA 4J9UE 4BZQA 1LI4A 2IKSA 1X94A 3EDRA 3QMWA 3BZUA 5B4UA 2Z9CA 2C2OA 5F1KA 4MR7A 3HCNA 2ZDGA 1DTWA 1X70A 2B1QA 2IEDA 2CVZA 2ZJAA 1CEXA 1VJ1A 2C4MA 3CF0A 3D6FA 3GGSA 5JD5A 3VV2A 3HXKA 3I9V6 4QFMA 3WLQA 4EEXA 4EQ6A 1XMQB 3P1JA 5TJ9A 1MVLA 4H0CA 2NG1A 4BLTA 1CZKA 1D6NA 3DNFA 3SDBA 2R4TA 3FLMA 1AV7A 2YIDA 2BZSA 2GAFA 2WDZA 4MKRA 5FWAA 4LC0A 3S7TA 4B75A 4JB3A 1TECE 1GAXA 1V6CA 1EDDA 1BG6A 2F1RA 3L7BA 1K7SN 1PS0A 4JB0A 3OTQA 1LBTA 2IJGX 2A5YB 4TMFA 2WJIA 5TEWA 4QEZA 4MYDA 4GOLD 1YVRA 2ZPTX 3SU8A 3G9TA 4FZ3A 3QEBZ 3VHLB 1M6NA 3BDIA 3K9LA 2WJHA 2C96A 2GXSA 3CWQA 1H5NA 3PDIB 2X1VA 2NU9B 5IUKC 1OXMA 1AKNA 1N0VC 4N5DA 3ADKA 3RVPA 4IZHA 4V0OA 5EI5A 4RD6A 5I4KA 1RVDA 4FS3A 4RESA 4JYPA 5F9HA 3LP8A 2PRKA 3DT8A 3MJRA 4ZZ0A 1DZ3A 4BQFA 4ZOLB 1RJDA 1TVCA 2JD1A 2JIRA 2C2ZA 3WNDA 3O2JA 1E61A 5E7MA 4H7FA 2WUDA 5L95A 4CXMA 4PCVA 5F9MA 3URKA 4QXAA 1VSUA 4PNPA 4RVFA 4D9NA 2J5KA 3QU7A 1M1YA 2JASA 2VP2A 3OM8A 4NMHA 1CYDA 1C0PA 3CRVA 4K2HA 2MYNA 4CRWB 2P2LA 4J76A 4XJXA 1G2QA 1VHTA 4JJ7A 2WAMA 2II6A 2HWKA 2FFBA 4CLOB 5K6TA 3F98A 2XCIA 4EI9A 3T5AA 4I0WB 5TT0A 2XQIA 3CLRD 3DZKA 1U4NA 1AUQA 2JEOA 1G1AA 1QK4A 4EO4A 5AKJA 3KKNA 5FOXA 1M2JA 3IQIX 4ZV9A 3DW3X 3EAGA 1BOOA 1JMVA 1KFKB 1IPHA 1VTKA 2D0PB 1OU0A 2I4RA 2RHMA 3ZQKA 1NX6A 2VFAA 4RACA 1P39A 2RHRA 1T1GA 2ZSJA 5KOJB 3TQSA 5DM60 4C07A 5JJCA 3HBNA 4QQ8A 2OFPA 3IOYA 3RRBA 5JNLA 4D3FA 4AW9A 2AFIB 2OC4A 3E9QA 4MR8B 3T1QA 4XLLA 3TR6A 1I7QB 4LFAB 2DT5A 2GD1O 3EZFA 3FHOA 4NMMA 1PCXA 3GWGA 4REOA 2UVQA 4UDYX 1RCFA 2ZJFA 4Y2TA 3TQCA 1T91A 3K70C 3LOUA 3CH4B 4EB8A 4F2GA 2WQ6A 2JL1A 2ZTLA 1IATA 2OSVA 3JQDA 3UO8B 1RPNA 1O9GA 3A9UA 1M2HA 1NYLA 1ZUWA 1NLMA 1ZH6A 1QGUB 2NSHA 3GLQA 3G2NA 1I3NA 4DV0B 2ZCUA 5F51A 3MD0A 3I04M 5JC1A 3AXSA 5BRNA 2HJ9A 3DEKA 4KXMA 4EM6A 3N07A 3H9EO 1WTAA 2O2EA 1O5IA 2A0FA 5TX7A 1CUGA 4GSKA 2OTCA 2WJPA 2WWRA 4I14A 4ND8B 1SCQA 1KJYA 2JATA 3ONFA 3A6HA 5L3RA 2EXXA 1YKGA 1WZEA 2O2XA 4IDHA 1KA9H 1C7IA 5ALFA 4TWIA 4G4JA 5BWOA 1D6MA 1H9AA 3O90A 5KNCD 4IOKA 4E7OA 1PBNA 4L4RA 2FX2A 1XZFA 3PE4A 4J7CA 4RVGA 3ZHYA 4BGEA 4NCBA 1JFLA 5EJAA 2A2ZA 4JAVC 1FFXA 1F6WA 1UBUS 2F8SA 4ZN6A 2BCJQ 2E4UA 4XJTA 5HCUA 5LP6A 5J59A 3QXHA 1UFQA 2FW9A 4FJ1A 1T4DA 4HDOB 1QCZA 1QDEA 2B25A 1XIVA 3AFHA 3H99A 2A1UB 2C2BA 4FGSA 3HHPA 4EL0A 4GLLA 3OM0A 3ORFA 1DG9A 1XNGA 2OSBA 1E5LA 3L8DA 3PK0A 1G41A 4TT3A 4Y1RA 4ZC1A 1QH0A 1SELA 4H0NA 1ZMBA 1DB3A 3D7SA 1NG1A 1G8PA 4U3JB 5CLGA 3ZDQA 3CW9A 3I6MA 5B2EA 2FOLA 3BIFA 1YB2A 4DMMA 3ANMA 4UHBA 5IM4F 4FD2A 3BN3A 1KYYA 3G9XA 3H84A 5LU8A 1IOZA 1W2GA 4FCTA 3WL8A 1W6RA 5AHKA 2E5LB 3OU7A 3PWKA 1V43A 2VYFA 5FPQA 4G26A 2C9CA 1ULSA 2XUIA 3G5TA 2PKQO 3HYNA 3GLFB 3L0OA 2RG1A 5IYZF 3ZV4A 2HSWA 5A7GA 1M2VB 3OOEA 1N2EA 4S24A 1T2NA 1RJFA 2DTDA 4TXLA 5ESDA 4UQPA 3NDIA 3TD6A 5I7HA 3DZCA 2V45A 2GBPA 2A1IA 4F7WA 3EISA 3VHQA 1VE9A 1PHRA 3FNIA 3GRYA 1A2KC 2BFAA 4KGDA 2ZDQA 4A73A 5A1TA 5C4GB 5EESA 5LP1A 3I0ZA 5BT8A 2RAVA 2WWXA 5C8YA 2CNWD 3KLPX 3QXGA 4Q3BA 4ZT6A 4DG8A 4KR7A 1TEVA 1V1JA 4P22A 4RKWA 3EQ8A 5BN4B 2HHJA 1DSSG 3KUKA 3LXRA 4TWZA 5JFTA 1I14A 4W7HA 1U0HC 1P1KA 3RJ5A 4XGIA 4CL8A 4QGGA 1VL1A 3Q5DA 2ZJ0A 3CG4A 3BFVA 2ZAGA 4LS3A 4X3OA 2P69A 2WFMA 2BP7A 1X7WA 3DUFB 3AV0B 3DYIA 5FD8A 4W7IA 2Z8YM 3I09A 1JG7A 4YY3B 3MMSA 5EAIA 1PEDA 4HDRA 5EJGA 5IT9A 2EFYA 3I04A 4CMIB 3U49A 3HDGA 4DUGA 3LA6A 1NVEA 2QX9A 2EL7A 3OZBA 4WGGA 1F4VA 3DV0B 4R2JA 5BYJA 4BLVA 3LQ1A 1E7WA 2NTYC 2Q3CA 5ALNA 1C1YA 2I8LA 3LXUX 1EAYA 3VSEA 2O2GA 4EA9A 3RAJA 1RQRA 4PPQA 5HJ7A 1XN4A 4HRXA 4B47A 2VHZA 3AOGA 1M54A 4DTIA 1XKXA 2YWFA 1LDYA 4HN4B 1ACLA 2QTLA 2BGIA 4K81B 4KO3S 1QGED 1QPBA 4X3PA 1KOGA 2DFNA 2JPDA 3PR3A 5FBLB 4BQNA 3ZWDA 5CYOA 1W1IA 2D7DA 3EEIA 1TF7A 2BUCA 2PK3A 3G3EA 5IMBA 4ZHQA 4ZZ1A 2QRJA 3UT0A 2G7ZA 4GRDA 4TXHA 2ASVA 3ZV7A 3PYXA 4IIJF 3TPCA 4D4KA 4XH9B 2ZBDA 3BYZA 3RTBA 4B85A 4OLAA 1SB8A 3VAAA 2J41A 3IO3A 4BP9A 5EUQB 3AHEA 1BVRA 1L7NA 2B82A 2CLCX 2FSHA 3OURA 3MLBA 3L40A 4GKKB 1DAKA 2H85A 4LF7B 2OCLA 1KWKA 5LWHA 3QLUA 1O0CA 2QG9A 2TYSB 4ARCA 1YOBA 3WB9A 3CLVA 1GQFA 3ZVKA 2NXEA 3DAFA 1QUFA 5U4QA 4BV8A 2IV3A 2GBCA 4WERA 1ZSYA 1SK8A 3KSAC 1P2BA 1YQEA 1HFKA 3G2IA 4MA0A 4HPXB 3QIVA 3FUWA 1K8YB 1KGDA 1T4MA 5HTKA 2V7QA 3R6GA 4FW8A 4LYGA 4JGIA 4R0VA 3T7IA 4B1FA 2JLCA 3BXOA 1V9SA 1N5IA 2ID8A 2XV1A 3N70A 4J29A 1JIIA 5H3CA 4TVSA 1JRLA 3K9CA 1IHPA 2J9FB 2JH9A 3L1JA 4JEHA 3NO4A 3HA7A 2IS2A 1Z5WA 5FHQA 2C98A 1P6XA 1HFJA 2I4TA 1XJWA 1JSCA 2IQIA 3ICCA 4OXKA 1AUVA 3WZLA 4DABA 3ZIAA 1C4KA 4MWDA 3O91A 2OCXA 3W5UA 4L9AA 3JQ6A 3FBTA 3THXA 1EP2B 1NNSA 3QENA 1AKUA 1BCRB 4I50A 3SYKA 5A7HA 4G41A 4E5YA 4DDUA 4WFJA 2DM6A 3QVLA 3PWTA 1SCAA 1YB4A 5TIIA 1XMVA 3UMMA 4CIYA 3PXAA 5D87A 1RAHA 2GD2A 1FLNA 4F4IA 2VPWA 2OV1A 1P3JA 2P7IA 3ZJ5A 1WHSA 5CBPA 4OEHA 2PEYA 4HNSA 1KI4A 2BM1A 1WXQA 2I2AA 2WJ6A 2Z8YA 3HO6A 5D00A 1KSGA 5AVTA 5EHQA 1NBMD 4HTFB 4WSOA 2F8TA 2WJ3A 3CCFA 1D07A 1Y3IA 3M6WA 4FYJA 1NXOA 3CLSC 5ICFA 3S2EA 4DJAA 5GZ3A 1WEKA 5DOVA 5KNBH 5JY6A 2R6FA 4MV1A 2ZI5A 4CV3A 3RWBA 4CQMD 3U09A 3H1PA 4EJSA 5IZ4A 2ON6A 4K1LA 1Z06A 1CS4C 2ZIXB 4TGLA 3T34A 3ZWMA 3OQHA 3R20A 1Z5OA 4EMSA 5JH7A 1N2CB 4XB1A 4N47A 3VU3A 3L4SO 2Q5CA 3CE9A 3H04A 4MI9A 4NP6A 4GOOD 4JP3A 5FIUA 1OXBB 5C18A 4TQUS 3B48A 3GF4A 1BFDA 4DMCA 1QR6A 2EARA 1OKKA 1R0XA 3M9XA 4KPGA 5JHHB 3IOCA 2XPCA 3GUZA 1D1TA 5CIWA 3L6CA 4TKVB 1N0IA 1ZUIA 4MVJD 3SF8A 5KNDD 1JEAA 3I61A 4M7PA 3ZCVA 3GQVA 4G5RA 3C4JA 1TAQA 3PC4A 3QHPA 4NTZA 1OYWA 5KWEA 4FQ8A 4WX2B 1E77A 2WM9B 3JQPA 5AM1A 1ISMA 3UMVA 1SULA 3ANSA 1TQ4A 2QD5A 5DYYA 3GP3A 5M2QA 3HRHA 4UEOA 1NFFA 2WUGA 4YVFA 1JBKA 2BHNA 4FSXA 4O2BF 4XDZA 5B6IA 1ZVKA 1YXMA 1E62A 2AXPA 5EYPB 2EAUA 1TM4E 3CRQA 4CL3A 2D2EA 1VL5A 3ZLTA 2PYDA 2ZSBA 4YAFA 1L5KA 2HWWA 2QR2A 4FCWA 4ZI7F 5AW8A 3NTUA 1Q84A 1APBA 1FF9A 2A0WA 4PS0A 1A5SB 4FYWA 4IMRA 1EX6A 1TYEB 1U0RA 3DOOA 5CLLA 3BE8A 1ONOA 5FBHA 3I5UA 4WA8A 2JBAB 4YREA 3K0KA 5D6OA 1ZMOA 4GC5A 4I1UA 3UUGA 4BRWA 1YIOA 2PX4A 3B1FA 3RC8A 4OKNA 1QZUA 5AJXA 4BVGA 4RE5A 1V5IA 1FTNA 5K0LA 2O6LA 3R4VA 2ZIWB 2C2KA 4FCVA 1XZQA 1D2MA 5AJYA 3PFFA 5G53C 3EZLA 4WNYA 2QR5A 3GEIA 5I7FA 5JXJA 3IEVA 5AFSA 1RS0A 2KPOA 6GPBA 3OLWA 4Z0TA 2V8BA 2ZYWX 5CLQA 4L8YA 3GZTB 3NOQA 1UKAA 3BTVA 1WR8A 4HCJA 3V1KA 3QNWA 4FOLA 3C3XA 4HQ0A 3SZOA 1C9YA 3COPA 2GXAA 721PA 2NW6A 3KT6A 4NS4A 2BWJA 3UV7A 2IOQA 2ZXEA 4DV7B 2G9QA 4L0QA 3RTDA 1ZVQA 4GYKA 4N5MA 5ALTA 3L4JA 2PBZA 2J0QA 1GRVA 2BE7A 5C80A 4BGVA 1W5BA 4RHTA 3RUPA 4FYVA 1PWXA 5A0VA 5BVGB 1IBLB 3A6GA 4GC9A 4MCJA 2QY6A 1QBKC 5EE9A 5EZYF 1CRZA 3L49A 5AVJA 5EE5B 3C4VA 4MQFA 2P3OA 2HWXA 2NZ8A 3KKKA 1B6TA 2KLBA 2PUHA 2WVJA 2PN1A 2ZREA 1J8VA 5ER6A 3RM3A 2ASEA 1E1RA 1B1AA 4G0XA 1J70A 3ELUA 1CE8A 2OC9A 2D4AA 3GJ8A 3QU5A 2IZ7A 1P5JA 1BKYA 1SBQA 2B37A 3UZUA 4TYQA 4BXOA 4KMRA 3BTOA 4BNMA 5G3YA 1S8AA 2IHYA 4RYLA 2OAGA 4C0SA 1XZAA 1SXJA 1QZ3A 2CJXA 2WZBA 2ZRGA 4IVRA 5FL3A 4YWJA 1PJBA 1PJ8A 2AE1A 1SXPA 2WABA 1A9YA 4A8JB 1KO7A 4BZPA 5JISA 3FPFA 2BGWA 1NKVA 1ZOPA 3DMGA 3IULA 4QUGA 1JSXA 4CJXA 3SVTA 2OAP1 2E49A 5EXSA 4RSRA 3LS2A 5H16A 3ZNNA 1FUYB 4YJ3F 2AG6A 2ZJ3A 5T8KA 4G86A 4A2WA 4Q1EA 4R9RA 2QOEA 5F9FA 3UFXB 3NEYA 1DIBA 4LAFA 3QKIA 2QE7D 5KYWA 3R7WA 2NU8B 2W42A 1EX1A 1TCBA 3TYXA 2R00A 1FJ2A 1W88B 3VTZA 2IIVA 1J2UA 1SCDA 2R1TA 3NOOA 3RS5A 3AJDA 4PO9A 4DBLE 4UNPA 3EVAA 1JDVA 2YJNA 1FP7A 1XYGA 5FBQB 2YJZA 4JJFA 1SFRA 4OCZA 4Q02A 1R5NA 2K2QB 3QOXA 5KTTA 2R6AA 2VTVA 1D2NA 2RHOA 2UYQA 1BU5A 2GOYA 2XOKA 3IMKA 2X4LA 1NYQA 3BB1A 3LUJA 5B37A 4BVAA 4AJ9A 1YZHA 4ED9A 1UDCA 4CM7A 1AK9A 1B3RA 1M1ZA 5FORA 4M46A 3QNMA 3L1IA 4XM0A 2WUFA 1K5GA 2VT6A 1WV1A 1AHIA 3AKCA 4XDGA 1SBHA 5LNK6 2GK6A 5IZCC 4LOLA 4BMVA 1I0LA 1MIOA 4LJRA 4MSUA 1BXGB 3NASA 5LB2A 3SQWA 3N8DA 4CM8A 5JJIA 4OHVA 4AB1A 3FAKA 1NSYA 3I42A 3J81A 1E0SA 3KKPA 1RRKA 4IBOA 3FCEA 4YV1A 1Y8RB 4IM7A 4M87A 2QRLA 4HVCA 2I34A 2FXIA 4WKOA 5AXCA 2F4VB 1V3VA 5G4LA 4RKFA 2L17A 3N2LA 3ZG6A 2NOAA 2YZMA 4LJ9A 4AN4A 2N1MA 5EWMA 4Z4QA 2YBDA 4UAVA 1LPSA 3NT5A 1UBSB 4U2KA 1SURA 3D2AA 5JDCC 2AMYA 1E3EA 2ATIA 3MWJA 1O96A 3VR6D 2ORWA 1PAUA 2ZRFA 4C2TA 1XRJA 3JARA 1NV8A 1RWKA 3FW1A 2I0FA 2JJ1A 3GCGA 5EXPA 3JQAB 4BN5A 3ZDRA 3NYIA 4EMTA 4EYGA 5L9AA 2OORA 1YF3A 5EIFA 4M4SA 3FDIA 3HGTA 3CH5A 4GPBA 1GUZA 3R76A 4F3YA 3EPKA 4JP1A 1PVOA 2I4LA 1XL0A 2YV5A 2ONJA 2Q1XA 4TTRA 3NALA 4MR9A 5JSFA 4BO8A 3HXQA 1JJ7A 4FHGA 3WIVA 4QBFA 1K0UA 1LI5A 1WX1A 2FW6A 5CDTA 5AXAA 3DDOA 1JILA 1QH1A 3M1IA 5IFLA 1OLXB 4YJ2F 1YJQA 2D62A 4ARIA 1JG2A 1T2CA 2VKQA 3BZWA 1TJNA 5C53B 3CT4A 2Y99A 4C01A 5EZ5A 4RAQA 2ZUDA 1MRZA 2BDUA 2XHEA 3IBGA 2GJKA 2PLFA 3I2GA 1QAQA 2P2NA 1JTFA 5BORA 3UN1A 4UM8B 3M8KA 7AT1A 1R5BA 2NYVA 4XWOA 1CDOA 2H1IA 2ZTSA 5BMVF 4QIHA 4A27A 1FK8A 3BEOA 2C4WA 4N8DA 3HXTA 4TV8F 4DYHA 5I7EA 4LX8A 5CW1A 2BBWA 2J87A 2VHQA 4F92B 1SA0B 2QTCA 4PS1A 1F2UA 4NOJA 3F1KA 1GTL1 3H4TA 4NLLA 2QJWA 2EJUA 4ZYUA 5B6JA 3CRZA 2HHAA 4RMNA 3O3NB 3UJAA 4LCBA 3GEHA 3IQWA 3PCRB 4CNQA 1ZG3A 4QJ3A 2C04A 4Q9AA 1O6FA 4L85A 2QXUA 1NLYA 3R41A 4LGVA 3UW3A 5FTJA 4BFTA 4XLZA 4QOGA 3OC0A 3VR5D 4CV0A 4BX3A 1ID8A 4W6QA 4X45A 1W36C 3E48A 4LY3A 2AG8A 1E4OA 3I4CA 3IHTA 3VDNB 4O1HA 3WQSB 1AK1A 3FCOA 3I92A 1KAQA 1KI2A 2HJSA 4LXQA 1RXCA 5AQ1A 3CX7A 3KOXA 1N9GA 2FUG1 4UUNA 4GI7A 5EP3A 5EMKA 1V7PC 3AY7A 2DJIA 3OZXA 3QFCA 4C89A 2JLRA 3B6MA 3LT5A 2NZVG 4I1RA 3V8NA 3BREA 5LIRA