2FWBA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89f from the acidophilic bacterium acetobacter aceti, at ph 8
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
b'SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAFLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
molecule tags Lyase
source organism Acetobacter aceti
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
total genus 49
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fwbA00
4GRDA 3OPQA 5C5DA 5CLJA 2FW8A 2FW1A 3TRHA 3OOWA 4ZMBA 5BORA 4YCCA 4ZK2A 2FWIA 1QCZA 3LP6A 5BOSA 2NSLA 2ATEA 2H31A 3KUUA 1U11A 2NSHA 4JA0A 2FWAA 4YCDA 2YWXA 5CLHA 5CVTA 4AY4A 4YCBA 4Z7JA 2FW7A 5CLFA 2FWBA 5CTJA 3RGGA 4ZJYA 4ZC8A 5CLGA 2NSJA 5BOSB 4B4KA 2FW6A 1D7AA 1XMPA 3ORSA 5CLIA 3RG8A 2FWJA 2FWPA 1O4VA 2FW9A 4AY3A 4YCJA
chains in the Genus database with same CATH superfamily
2WPDD 3RS7A 4A4DA 5KOHA 1V95A 1RJGA 1E64A 3MK31 5EJEA 1GUZA 1X9IA 1SA0A 3DG9A 3E2IA 4Q7LA 2IIQA 1QHSA 1G5QA 1ZEMA 3IXQA 4L4UA 2G70A 3VVCA 2DQSA 1C1DB 3VMMA 1KKLA 5EY5B 1H3EA 2ATVA 3SZMA 3UBTA 1T25A 1UIMA 4FX5A 3ZH2A 5IABA 2XI4A 1JDBC 3DZDA 2W6CX 1XYYA 3WLMA 4YC7A 3FTCA 1NE2A 1UJNA 3ZX5A 4D9NA 2CFIA 4PLWA 5DLYA 5FO0A 5LQNA 1C9DB 2LKDA 2E4VA 2QUHA 3GIDA 5A04A 3HYNA 5HM6A 1XDUA 2DGDA 3KSDO 4NOLA 1VIVA 2D5LA 4BE9A 2FZLA 5EEHA 4ZTUB 2ODWA 1M72A 4CMGA 5J4YA 4AJJA 4XVUA 3C1TA 5KTRA 1SNYA 4BFWA 4TKUB 3TSZA 1P2SA 4LC0A 1EK1A 3B5EA 3NRCA 5TQJA 4KVFA 2F9LA 2JW5A 5FBLB 1E5QA 5AK3A 2YVAA 4NZOA 4HVLA 3EISA 4EFLA 3RRJA 1CUXA 1VYHA 2IZ0A 1THMA 1DJLA 4YUAA 1QDEA 4KREA 2EL9A 3DOEA 2XE7A 4EGFA 1K6JA 1R5OA 3I34X 2ZUEA 3EFOB 4PC3A 3IDSA 2JATA 3U4DA 5HRUA 2WNIA 4PG4A 2WY2D 1WB4A 4H3KB 1H2YA 1R6DA 2B9EA 3KAJA 3TGPA 3T7KA 4QYIB 3NG1A 5DBOA 1NOIA 1QZTA 7ADHA 2RAUA 4DV0B 2CNNA 3IV7A 4UM9D 3IEMA 2H4YA 3QXHA 2GWRA 3E2PA 5FPQA 4HTFA 2J3IA 1IXKA 1DKRA 1SU7A 4PM4A 1K1EA 3QV2A 4RK5A 2JJ8A 2AWNA 4Z3KA 5E38A 1CUUA 3O3NB 5G0VA 4ZHQF 4UCWA 5CT8A 2IHUA 3WBBA 1E0KA 4EL0A 2HREA 2JS7A 1CJMA 3E0QA 3NVAA 2FNAA 4NULA 2JI9A 4WEOA 3UK6A 3VR6H 4RF3A 5AKHA 2GTIA 5JYEA 2FJPA 4NJEB 3FHCB 5ESWA 5JATA 3D64A 3L8ZA 5K8UA 5KYUA 4OXIA 2HA6A 5IZ4A 2MSDB 3FGPA 4L8GA 3C3CA 1P33A 1U0HC 4F86A 1KPIA 3CNQS 3KWLA 2I55A 1RJ9B 1HORA 4OIFA 5BORA 3WE7A 1Z28A 1ADYA 2QF7A 1ZJWA 3PFIA 1BNCA 2YWBA 3F5QA 3LT0A 9GPBA 4ECAA 4AY4A 3FDFA 4TT3D 2GPAA 1T5IA 1MC1A 2ZPUA 3EUFA 4J16A 3LUKA 4RZSA 4MB0A 2ZYAA 3OLYA 1E79A 1ZW6A 1XDBA 4P3OA 3I72A 5KYWB 2H7YA 2NW6A 2O0MA 4B3SB 3B2NA 3R0IA 4RH3A 5CA1F 1JIXA 2P8SA 4JJAA 2IA5A 2FKAA 1GFWA 4HGNA 5H1YA 3ZYCA 2ET6A 3Q40A 5EQJB 1EVQA 3TWOA 5EQTA 2OL4A 3RHFA 1ZGBA 4DCVA 1M66A 3B6IA 2JIPA 2AYXA 4RC9A 1AQLA 1LPNA 2QLTA 5TQ0B 5IAOA 1E7RA 1GA1A 2XR1A 2MSNA 4ICIA 4CLXA 4E6EA 4Y9DA 1Z8FA 2F55A 1ID8A 1JF8A 5JXWA 4RPHA 3E5HA 2VZ8A 1Q0SA 1YV9A 3SYNA 4LE1A 3FNEA 2QBYB 4EX6A 3Q9LA 5CJ2A 3MWEB 1S96A 1A3CA 1YB2A 3B8EA 1WPRA 2WSIA 1OC4A 2J1LA 2Z8YM 3P0EA 4RMGA 1E0SA 2UZ1A 3E22A 3KLOA 3M3DA 3TLKA 4I4NA 2D5CA 3KT3A 1PGJA 3WGJA 2JGLA 1G8YA 4YWHA 3U6KA 2GJ4A 3Q7IA 1C1XA 1NLUA 2Y66A 2BBSA 1R5NA 4RWZA 4YN3A 3BWYA 3G1UA 5DOZA 1HLGA 2AZXA 1XL0A 2JIBA 3MN1A 4QPDA 1NLFA 3LY9A 2VC2B 4HWTA 1FNCA 4LNUA 4GR5A 1N2BA 5EMJA 3M49A 2X0EA 4X63A 1MDFA 4KG7A 4QLBA 4CVNA 4XIIA 1FEZA 2ZIUB 1L5SA 3OQBA 4KQGA 4N5MA 2V3VA 4EKYA 1N7IA 3TR6A 3W7VA 4RQBA 1H5UA 4LZZA 3LPCA 4RBNA 4E5YA 1LBHA 1WQ4A 3MUEA 4MA0A 3RAFC 4OLAA 2X7XA 5L7WA 1J0DA 1P18A 2CMFA 4KQ9A 3GRZA 3KJEA 2GERA 1Y9JA 1UXGA 3H7AA 2QTHA 1VE5A 2F9MA 2FSPA 3RDPA 3SVLA 2NAFA 3KEMA 3QQ5A 4CKEB 4LGMA 2IHKA 2OHJA 5KNLA 3SI7A 2VT7A 4GU5A 4MHSA 1W5FA 3QLVC 3TQOA 2WILA 1NBHA 2RHCA 3VYSB 3WA6A 3THWA 1U1DA 1NP3A 2ST1A 4BX2A 1QYWA 3L0YA 1IN4A 2OBBA 2EZUA 1PJ8A 4MNTA 4YDSA 1EFPB 1NMEA 3EXEA 3O0DA 2AC2A 1KOFA 1VFNA 3OQ1A 2IIPA 4FN5A 3RVPA 4KUGA 2EIHA 2BGUA 3HABA 1OMOA 3PUHA 3Q8XB 4YCNA 1NT4A 2XPCA 4BLTA 3K9BA 4ILEA 1IEXA 1YZGA 4FR5A 4C3UA 1PQUA 4G0WA 3HJUA 1BXRA 3T1HB 4QUJA 5FXMA 1PW7A 1YQEA 4JJGA 5LP6B 2BEKA 1T10A 1GCOA 4DJJA 4QGAA 5BUZA 3H6HA 1E3QA 1YQ9A 3AESA 2R84A 3IP8A 1UP7A 4R7TA 2HCTA 4H27A 4KLAA 4AKGA 1WXDA 2PUTA 4L9AA 5C4GB 3T5BA 2YZGA 2XBLA 4CW7A 1ZM4A 4D44A 4D45A 4NBVA 4UTNA 3CZAA 2VTVA 4JOCA 1SPXA 1V47A 3THOA 3DLHA 4KDRA 2OXTA 2ONJA 4I2VA 3PG5A 5JSHA 1ADJA 3WWDA 1J2RA 1DDOA 4ZDWA 3AHEA 2C2ZA 4QT4A 3NH6A 2W11A 3K0EA 1GL3A 1JDUA 1L7PA 4MWGA 3WB0A 1G291 3DBLA 2PVPA 3TCKA 3NBYC 4CUKA 2XBMA 4N47A 2CHVA 3MCZA 3PKJA 3A1NA 1QP7A 5B1HA 3VKUA 2I8AA 3B9QA 3VHXB 3QU2A 4R68A 2CJFA 4KBFA 4OO3A 2Y0CA 2DBZA 5TEVA 3QMMA 4F6LA 3WWOA 3D6JA 2NTYC 3F1LA 4DLKA 4HEHA 2CBZA 1KMIY 5HE9A 3WL4A 1JBQA 1GILA 1M8FA 1XVLA 3U4CA 4CTMA 2DY0A 5JCXA 1NQTA 3ZCSA 2ZE6A 2ZI3A 1RWVA 4ABYA 1NRIA 4U02A 1OV6A 4X64B 2DJ5A 4RH1A 3HCPA 5LOVA 2QUAA 1A5AB 1F4VA 1T34A 4JBWA 4JVNA 2EFCB 3DV0A 1YJXA 2VSYA 4NZ9A 4QGHA 1YACA 4TZ0A 4Z5XA 1UJ6A 4HJRA 4X20B 3EIEA 3GJQA 5CLIA 5E6RA 5J63A 3JYPA 2AFVA 3TTVA 4CJXA 4D97A 4YV1A 1OX4A 2NO6A 1XMXA 4LYYA 3S1AA 3ZHVA 5J1TB 4O08A 4CFZA 2F8MA 2QMYA 5G40A 3TD6A 1SXJA 2RC6A 3I9FA 2J6BA 3SBEA 4KXQA 1C2YA 1MVLA 1R16A 4YBZA 2PRYA 3T7DA 1SY7A 2NSYA 3ABRB 3DBHA 3H84A 3GQBA 3K20A 3UAGA 3IV6A 4OBBA 4YCSA 1G0OA 1M2OB 1NXXA 5EZYF 2O2DA 4OHMA 5DSTA 1MDBA 4IJUA 2VYFA 4ENRA 1SHUX 3HU2A 1MRSA 1WCWA 3JVVA 3QBEA 5FO1A 1H1LB 2EW1A 2H1VA 1WV0A 4FKBA 5DI3A 2VRWA 3LQ4A 4FHZA 1ZZGA 1P4SA 2VNIA 3M6MD 3ODPA 5A3QA 4NECA 2BEJA 3HCEA 1RPNA 4E5SA 5I47A 1AUOA 3CFYA 5EESA 5CDGA 1UDXA 1XYGA 3MWDA 5JS8A 5CA0F 2F00A 3EG5A 1TM5E 1BAPA 1UJ4A 2PY6A 4RJLA 4J4HA 3PKZA 1E3WA 1G21B 4AWAA 4MQ5A 4KZKA 1EU1A 3NRBA 3VAYA 1KVTA 1DQZA 1TQ8A 2CZCA 1L7XA 4B17A 1M6YA 4ENUA 1N5OX 2Z04A 2ANCA 3SBDA 2FF7A 1CQWA 3MCTA 2YHAA 2YWFA 1BKYA 4YAWA 3I1IA 1TYBE 3F96A 1J90A 5K3BA 5IWAB 1HL3A 1V1JA 5T8KA 4NMHA 1M5TA 1FF9A 1M73E 4UUPA 2QE7D 2BEUB 2QRPA 2X6QA 1DAKA 2OGWA 5F2OA 2HSWA 2APJA 2FWJA 4LPKA 4C0KA 5CA1B 5IWCA 1VG1A 2LXNA 4G81A 5JT1A 3FKSA 3UUEA 2QPTA 1KJ9A 5I51A 3HEAA 4FYVA 4MDEA 1G5RA 1X7GA 5BSHA 2XVYA 2BGJA 2HAEA 1VL0A 3DD1A 2I3GA 3A37A 2AX4A 3MRVA 4URUR 4YMWA 3EARA 3T06B 4PHTA 1D4ZA 1PJSA 2AOTB 5M04A 4HDNB 4N7RA 3NI2A 3ORFA 1S4MA 3KOUA 4FQ8A 4AMUA 4MKGA 4CHTA 5I8WA 2KWIA 1N5IA 2BLLA 4CDNA 1EWVA 3EZFA 5B36A 1E3JA 2P40A 3KXIA 4N9WA 3Q12A 4XQ9A 5EP2A 2OO5C 5JCJD 3OSZA 3IVMA 1H0RA 2FTKE 4WLVA 4YMTA 3G2LA 2G40A 5TQ2A 4DOMA 4PY2A 3JD3A 2OV3A 1SMKA 3WO1A 3ZWAA 3PUIA 5LBTA 2WFZA 1PVVA 2B5OA 5CX1B 5GGXA 1GNPA 4JLDA 3WSVA 3WLLA 5L40A 4E6PA 4IWXA 2J59A 3ZCQA 3HKBB 1XPJA 5A7HA 1BE6A 3OTHA 4DNXA 5EHQA 1M1NA 4LFAB 1ZUWA 4KK4A 4BNIA 4KLRA 1B00A 1GUAA 2MR6A 4O2BB 1P19A 1ZOIA 3BFXA 3IJPA 1E6MA 2XVMA 3GNSA 4MKZA 2YWXA 5FBRB 3S2UA 3TEMA 2H08A 5JSQA 3PTAA 5FOTA 3NNSA 3AJDA 2FRVA 4CCSA 3YASA 1EGMB 2GZHA 4UCFA 5KJ6A 1P73A 1TMGE 2WINI 4HC4A 3CWZA 1DDGA 3HSKA 1QO0D 4ZXPA 3DTVD 3D8HA 3F6BX 1N8KA 4CIAA 2TMDA 2YRXA 3JWJA 3C8UA 1R66A 5JH7F 2EDCA 3DLBA 3BWMA 2OXIA 4M87A 3FG9A 5IAEA 3UA3A 1T0IA 1KFCB 2DAPA 2WHXA 1TIBA 3JPWA 3EY9A 4TV8A 4BIMA 2ZU6A 3N5CA 3KSAC 3MT7A 5EXSA 1ZGJA 3AVTA 3MSCA 3O1IC 4RLHA 2C77A 4UKDA 3BYZA 3QE9Y 5COBA 2FE1A 3SZUA 3AT1A 5EE9A 4F84A 4RTSA 3ZE2B 5J2TA 2BFEB 4HG2A 1MAVA 2IDJA 1DMRA 2ZT5A 2JA2A 5CR9A 1UBHS 2CL0X 4PXYA 1OV4A 2TMGA 4L8YA 2OO7A 3T95A 2YS7A 3ELBA 2OHFA 3OZTA 1RIFA 4GZ6A 5F9FA 4K6FA 4KXNA 1P6UA 2EKBA 2WA2A 4HKTA 1L7VC 2VKTA 2IFTA 2P4QA 5CNIA 3C5HA 3HDVA 1JEQA 5F5XA 3PTLA 5A7FA 1V6CA 3QFRA 2E1RA 3HE3A 4J2TA 2EJBA 5A1TA 3ZIAA 2JZCA 2PGJA 3D5QA 1A27A 4YP7A 1N0VC 1TVCA 2FW8A 3C7KA 4KMMA 3G5LA 3FOFC 5K0SA 1EGQA 3IUSA 1W6RA 2CYCA 4FT2A 1Y48E 3O03A 1UXIA 1YA8A 2PCLA 3DLTA 4G09A 4D9JA 3DQQA 1ACMA 2G9QA 3C4QA 4Y1EA 4B4WA 1L1EA 4R9RA 2VP9A 5LJLA 3SYTA 5DGXA 2IDKA 5IKPA 5IASA 4OUDB 1G9XA 4TL6A 2ZZMA 5ALFA 4Z1OA 2DH5A 2H59A 1E6WA 4JOQA 4YAEA 1FY2A 1D6SA 3EDCA 3FR7A 1GNQA 2BFEA 2J0UB 4I6JA 4QGBA 3C6XA 1PBNA 1R4MA 3QVWA 4YJGB 3A6JA 3T52A 4EP1A 4D4LA 1RKQA 2AN4A 5JCPA 4TXNA 2KS6A 5CDTA 1IZ8A 1KAEA 1IK6A 4M0DA 5DNWA 4OFWA 4IZOA 3TQIA 1JHUA 1M2VA 3K6SB 3TNLA 4R98A 5I9LA 2C7GA 3RF7A 3GY0A 5KYGA 1PK7A 3AXTA 2ZB3A 3EZ7A 4M99A 2JGMA 3M6FA 4P1ZA 4TUYA 1DAFA 3LXXA 1K7YA 3LQ1A 4HH0A 2XLBA 4AULA 3CCCA 3AR9A 4XRRA 3PNLA 5KDDA 4QEDA 4GI5A 2V6MA 3TNDA 1TE2A 1B8UA 4JYBA 3FPJA 3T94A 2Y1KA 2HXGA 2WYOA 3I2FA 4P7JA 4EHHA 3QYPA 1GR1A 1P77A 1M2VB 2X9NA 3GEMA 4MWEA 4ND8A 1DSSG 1V6SA 2JHFA 1ZAYA 3PT5A 4FNOA 1GLNA 3GJ6A 1B3RA 2FP4A 1CXZA 4MV0A 2QIOA 3KB2A 3ZN2A 1BROA 3GUZA 4RMJA 2VQ6A 2GJKA 2QPOA 2R7MA 3ELWA 2VDWA 4WN9A 2W37A 4HGPA 3KAKA 3K16A 2IOYA 3P97A 1Q0LA 3TOVA 3U3KA 2W6JD 4BAGA 1F5SA 3C15C 2XUJA 1TZJA 4D9GA 1RPTA 4DM7A 3H04A 5ALIA 2K4MA 3T38A 5JZBA 4OL0A 4JGGA 4NRDA 2P6UA 4DC9A 3D5TA 3NAZA 4ZVKA 1BS9A 2NX2A 2OHGA 1U7TA 4E4RA 4P84A 3P2IA 1A0OA 1GSAA 3T35A 2H2GA 3QUAA 3WV5A 5JSFA 1RZ3A 2BAGA 1N1GA 1QYVA 5BN3B 1HYBA 1YBAA 4PCLA 4TLLB 5ECWA 1UXKA 4AZ3A 3L7YA 3U80A 1KJQA 3NBFA 1B6RA 1G8SA 1HYQA 3CKLA 2C7QA 5C37A 1B3BA 4J4TA 4IDAA 3FB4A 1RAAA 3H6GA 4WX2B 3S29A 2P5YA 4FE3A 1NURA 1IPHA 4TKMA 1C2TA 3CISA 4MVCA 4B8ZA 4EFNA 1KTVA 1DFHA 2I71A 4QFMA 4YO7A 1Q7GA 3T1YB 4U8HA 4Z53A 1DMSA 1Q7EA 2NUBA 1NLMA 3MAGA 1LCIA 1GDDA 1ZVMA 3R4CA 1RYHA 5KNCH 2V6BA 4JP1A 3QOWA 2X15A 3A4NA 4R2KA 4F12A 3TLGA 1M34A 3B5IA 2EP7A 4S0XA 1VB3A 2P2YA 3CT6A 1B8PA 2HDHA 3D8UA 4KV9A 3SQDA 2XNHA 1CJSA 3OLCX 4EG6A 2WIFA 2QRVB 3UENA 3NDBB 3R7NA 1MX3A 2QX7A 1YTLA 1PAUA 2XWPA 2Q21A 2Y1FA 3E7DA 1G0NA 2WPNA 4NG4A 2VJYA 4R69A 2BHSA 5J2UB 1SVOA 2OCPA 2V6IA 3M33A 2V96A 4UMDA 1PF7E 4CR8A 4A2QA 1PO7A 4BNJA 1YB1A 5CYFA 1ISHA 3TXAA 2UUBB 5JXGA 4OKSA 1RADA 3VOSA 2FN8A 1JAIA 4QWWA 3TJZA 5EIOA 3BRSA 2W71A 4NU8X 4IZ6A 1OXBB 4ZMBA 5BURA 4KOEC 1DAHA 2WUVA 3PR1A 4YH1A 5EFZA 4LBZA 1T0BA 3IXMA 5T3YA 3A9TA 1P17A 3OCUA 3GGSA 1PFWA 2ICAA 3GYBA 4FPXA 1BGXT 2EJVA 3I04A 3TOSA 4B45A 2A0KA 1WKBA 3VR6A 4Q03A 4ZJZA 1FDOA 3F7MA 1KE1A 4L9WA 1XCMA 1C8LA 1KMNA 2WWXA 3RHSA 4MP3A 3UMJA 2PH5A 3OFKA 1PJLA 3BE4A 3R7AA 2EZ9A 3NETA 4B40A 4ETIA 4US1R 2ZUBA 1TL7C 2A9JA 4HGOA 4JZKA 5G1OA 1E9DA 2COUA 3K7EA 1A2BA 1EM6A 1IONA 2DQKA 2NN3C 1XHFA 3DMYA 1X1SA 2XDYA 2VJPA 3F6YA 3N70A 3AVPA 2I9KA 3MELA 3DNPA 3ZDRA 3GFPA 2J9XB 3KEOA 1UBTS 2QGZA 4MR9B 3MINA 4KFCA 1ZNQO 1CY4A 1HT3A 3H9UA 4RJ2A 4WUTA 5E6RB 3ISVA 2GHTA 3IEUA 3BCUA 3PLRA 3SFVA 1E0JA 2RIRA 2WIBA 3QLUA 4RKEA 4PNPA 4M1OA 1G9TA 4BNFA 1UOPA 4YNBA 3ADCA 3TBHA 1R9JA 1JFFA 3WQSB 3IFSA 2OG1A 2R8PA 4HYEA 4TMWA 1ZMBA 4POAA 2IH2A 1RU3A 2H8GA 2BI8A 3BAFA 3EQ8A 4FFPA 5GOZA 2OCXA 5KQLA 4KFTA 5FF9A 3E5NA 5E6SB 3VU3A 4BFZA 1YE5A 4D7AA 3W06A 2JBWA 4NCXA 1DCMA 1NNEA 3PNQA 4R31A 4RD0A 5AVSA 4ACAA 1G8GA 1C7ZA 4UM5A 1CFZA 1QZUA 2NSLA 3O7WA 3QPAA 4L5JA 5DCYA 3DXYA 3RU3A 3BGWA 3VX4A 4Q93A 3ZGVA 2W2PA 2H57A 3MFQA 4FR2A 5E9JA 3WGHA 5E9WA 4EJ2A 1R0CA 1GEEA 1VQ1A 1A77A 2C9YA 2J5QA 2GN0A 2JIDA 4HNSA 4JBYA 1YJ5A 4M53A 4MUXA 4PGFA 1IY0A 4FS8A 4D80A 3S2ZA 3VSDA 2GQ0A 3VJMA 3E05A 5IU6A 4K6OA 1GG8A 3F8TA 2ZRDA 3ABIA 1NRWA 3CX8A 3FOCA 4RJJA 4IQGA 4IHJA 5TXGA 4AC9A 3DMRA 4KQXA 1Y6QA 2DBQA 3K3PA 1G38A 1Q5PA 4B7CA 2A5FA 1UINA 2WUWE 4MMXB 3PEEA 4KXFB 5ALLA 3A0UA 4U6NA 5FOUA 5DM60 4JUDX 4PEVA 2I3BA 4MV4A 3INRA 4D3DA 1BN6A 4P4SA 2HSDA 1OI4A 1D1PA 1VHQA 1HZJA 4QUBA 5AVZA 4BATA 1F5NA 1WUJS 3GRUA 3I0NA 5WRFA 4AMBA 1DIHA 121PA 1ILEA 1M67A 1P4RA 4NFLA 1ZOPA 4I4TA 5JCOC 4B35A 2ENUA 1QGDA 1MABB 1Z4OA 4B3XA 3FGNA 5C5EA 2ISCA 2BGNA 2FOIA 4G41A 1LS6A 2VQ3A 1ZCBA 4ARVA 2H1LA 4LHEA 1FQJA 1HM5A 4PZDA 5HIIA 3AM1A 2VUUA 1QVRA 4HSEA 5CYGA 3UVEA 2BFMA 2FPUA 5E8RA 2VS1A 1KEEB 2ACVA 2DY1A 3EUAA 4KVAA 2QT0A 4U39A 2WYHA 5BV1A 3RJZA 1H22A 4CKEA 5L3VA 3EA4A 1ABBA 1UK8A 1FMCA 3ILVA 3WAKA 3C45A 2Z6QA 3LF1A 1P4AA 3HHPA 1JXAA 3KLBA 1YZQA 1AY0A 5IJZA 4MX8A 5F7XA 3F47A 4RVHA 3J80A 3LS2A 3A4VA 4QYXA 1A7KA 1W35A 2AVNA 4KSCA 5EE1A 4ZRNA 1DTSA 1KU6A 2J9YB 3FNIA 5IJ9B 3JQGB 2PS9A 3WLNA 2ON6A 3BWBA 1BCSB 3RQIA 5JADA 5A0VA 3VQTA 2DETA 2FMUA 1NI5A 3I8OA 2P0AA 4YRCA 2VUHB 5AYVA 2BMVA 1Q3KA 5F2KA 2PS3A 3O92A 2ZRAA 4XLZA 3EXAA 5ES4B 4U2GA 5IEBA 1KJJA 1XTQA 1Q1AA 2WWIA 4NV0A 4XB1A 2D2FA 1MPTA 1HNZB 3NHSA 3PYLA 4F56A 1JKJA 2FMFA 2GFQA 2OORA 4IZHA 3LH5A 5B3JA 1T1RA 2F1KA 3U13A 3UH0A 1DXYA 1P7WA 2FFBA 2P3QA 2IEDA 3GCWA 3OSUA 4MYTA 4EGCB 5A4AA 2R00C 3GUUA 3LP8A 1A9TA 3O74A 3V1UA 1Y3DE 3SAJA 4B1FA 2W4MA 4L28A 3ENZA 2C96A 1JDPA 2VDQB 3LA6A 3H0KA 1C7JA 1X1CA 1T4MA 4YAUA 3H1AA 3ESAA 1IIRA 3QKTA 4ND3A 4GH5A 5IC5A 3E1GA 1NMQA 3IH5A 5EZ5A 1RDFA 1KRXA 1UFKA 4AICA 3U6BA 2GM4A 2NADA 2QN3A 2UVPB 4WKBA 1M0EA 3HCWA 3FTPA 4LDNA 3EFEA 2CJXA 3OFND 3GLHE 1EZZA 4QU8A 5JVDB 2BTOA 3EPRA 3CLTC 1TM2A 3OY2A 5JO9A 2N46A 4Y7CA 1I2BA 2GPNA 4Z1MA 3HXKA 3TLZA 1K9VF 1A8PA 1OC2A 2BGIA 5DWQA 1UKCA 1CUVA 1DDIA 1E3DA 4M8SA 4XGRA 5HDBB 3F8SA 1Q84A 1T5HX 3MIZA 4ZVNA 3ST7A 3RJ5A 4M8LA 1U6KA 2O19A 2EYQA 1Z6YA 3OPXA 1EIWA 3AHFA 3NT5A 3W5BA 5GZ3A 1TK2A 1DXOA 1J24A 1PL0A 1AXEA 1GIAA 1NQXA 3UK2A 1GXSA 4X41A 1TKCA 3W0LB 3ZE0B 4ENVA 1EWQA 2IUSA 2XCTB 4XWYA 3DR3A 1E79D 1FFDA 5EYPA 4R6XA 1OH7A 1FSGA 1N2OA 3LUGA 5J43A 4QJ5A 1T3ZA 1FNSA 4XZ3A 3SKVA 1H9AA 2DTDA 1OI7A 2ZJ2A 3CH4B 3E82A 3LLCA 2O0KA 2VYQA 1RI3A 1Z2DA 4GFDA 4Q3EA 1L9XA 3W90A 3B36A 3E58A 2B36A 3A4TA 4MQMA 5JV5A 3PNMA 5TT1A 1D2CA 4OB8A 1H5NA 1GP2A 2WP0A 1JUDA 4XOUA 4CKWA 2C29D 4G1UC 4FIZA 2CLMB 1UFVA 2FR8C 3KXDA 1CY7A 1ZG3A 3OJ0A 4X7RA 3ZPXA 5JZVA 2P77A 5G4KA 3A31A 3UMFA 4W1QA 4AJKA 3BXPA 5LMZA 4M54A 4MUYA 3AKEA 4A10A 4ZI7A 4F04A 6AT1A 3VV3A 4YRNA 2YJTD 2FPOA 1QCZA 4RD6A 4GWLA 4YROA 3SOZA 4LDZA 3G1WA 2X14A 2YQ5A 5BV2P 5A2GA 3NP7A 1OLUA 3BQNB 1ODTC 2Y71A 5GAJA 2GRUA 3UPDA 5MFZA 4PLZA 4Y9RA 1S4QA 3WQHA 4I9UA 3MW8A 1YJAA 3T4UA 1NPTO 4YQYA 1S89A 1XJQA 5HQ3A 4J0HA 2OK7A 1BHSA 1W5TA 4G5FA 1ZL2A 1IBMB 4M1ZA 4G65A 3C1UA 1Z4NA 1JDTA 1SHJA 3D2AA 4IS3A 4G6ZA 4EMSA 4O1MA 3FNGA 4QEZA 4M36A 4IR7A 3RRMA 1Q0PA 5JAUA 1JFFB 2QMHA 4KPGA 4H7KA 2ZBEA 4OFXA 3RIMA 1R9GA 1TGVA 1UDBA 3DFZA 3CZ5A 3KQQA 2A0FA 4IZIA 3KHUA 3T3HA 5CFOA 4MIEA 2CNDA 4LXXA 5IX8A 1PQ4A 1T0JB 1JG4A 1DRJA 2WIKA 1BYUA 2JK1A 2DKFA 1HDZA 1SVKA 3URMA 1RP1A 1TAHA 4AX4A 1EK2A 1VTKA 4JYMA 5U4XA 1LWOA 1X7ZA 4OV6B 4PR0A 4OFZA 4MPJA 5FOVA 4EYSA 1P6XA 2AG5A 2P90A 1E1QD 2IF0A 3NU1A 4KYUA 4A5OA 4BKRA 2ZDGA 2R79A 3U1TA 4A1OA 3INNA 1AQNA 1VBKA 4OY3A 5IBCA 1DIAA 3LG2A 4B33A 4YR9A 2QTTA 3QSYA 2BHNA 1XRMA 2BWJA 5K01A 4ENQA 1JFVA 3GUHA 1VFPA 3OPNA 1O94C 3L05A 4HNTA 1ZIXA 4TWZA 4FDTA 1WPQA 5LWHA 2CGEA 2PYIA 3DDOA 1N2HA 4Q9NA 2B4AA 4PRYA 4EX7A 3KUUA 3D4IA 2V58A 2JCYA 3G68A 1SR8A 2VQDA 2VF7A 4DA0A 2HRZA 1I30A 4EJSB 3AJAA 4B80A 4Z9XA 2J5KA 4BYGA 1TM7E 1FJGB 4O1IA 3WGNA 4Z4CA 5EKUA 3RYCA 1LBEA 1TEXA 1XNJA 5BV8A 3H2YA 2O7NA 2WPDA 3DONA 1I5EA 4NCKA 1H2HA 3HDYA 2GA9A 4DG8A 3ACCA 1XIVA 4TXMA 3U4HA 3MJEA 3MC1A 2RHTA 2OV6A 3PX7A 3ELYA 2HA4A 5BT8A 3VPSA 3LOQA 1DJMA 2QJRA 3ZE7A 2QX6A 2IEAA 4CM5A 1B4DA 3K9FC 1RPAA 3LW8A 4RXUA 3W79A 5T6BA 1BVYF 3GRVA 1DBPA 1Z5WA 4YCDA 3PUVA 3I73A 3TRFA 3WKEA 1UMDB 3H9JA 3HN6A 1ZK0A 3IQZA 2EJTA 4MR9A 3VJRA 3F6SA 1PV4A 3ZCVA 1KI4A 3HYSA 4MYHA 4BO4A 2XZOA 2GYVA 4GP9A 4D4HA 1JWLA 2W0MA 2J45A 2YQ4A 3CUVA 3F7NA 3VGPA 3KRTA 3NBXX 4RSHA 1TO6A 4XCVA 4WFQA 2I33A 1NW9B 4C04A 1E1MA 2BFDB 1CIJA 1T3LA 3GBVA 3HJBA 5KMGB 3L4KA 4E14A 3KTOA 1NRJB 1QGED 2FOXA 2CZGA 3KOMA 1S0UA 3CX4A 3L1KA 1PGOA 4UQOA 4CNQA 5FTKA 4GGMX 1VDMA 3KQNA 2AEJA 1EDDA 3WMFA 1KVQA 1UK7A 2QZJA 2BEVB 2VDPB 2BIFA 4Q66C 1V8PA 3UGQA 4X71A 5EIXA 1TOAA 2X23A 5ALYA 4ZZIA 4QZVA 1CZHA 1H6DA 2VP2A 1WX1A 3ZS9A 1T6NA 4OKIA 3Q9SA 4J9UE 3UV7A 3ILHA 2W9XA 1U63A 1UZMA 1WW8A 3TB4A 2GUGA 2OYRA 2X19A 1BTOA 4IYRA 2CLIB 4L07A 4Y1GA 4YACA 4CQLB 2JKVA 3K1TA 1K7FB 4MVJF 4D0NA 2HPHA 4J1TA 3ILSA 3ZWPA 1I0LA 1OTXA 4OM7A 1I3KA 4E4TA 5JSZA 4PSAA 4AT1A 5HS6A 2W42A 4B3BA 1P3Y1 5IJAA 2ROQA 3AF0A 1R2QA 2C3YA 3K4PA 1B0PA 2BH9A 5H3HA 3RVRA 2P41A 4B34A 4B71A 3Q1KA 4L5AA 2KE5A 1U1GA 3AEYA 2Z5FA 3P2KA 2OGUA 4B83A 3IQIX 1KQPA 4GAEA 1G8PA 3ND6A 3AVQA 2O57A 5JROA 3QVGA 3TTTA 3U31A 2RHDA 3E6AA 4D1YA 1Y6JA 1OHHD 3QWHA 4HRAA 1P5JA 4Q9KA 4AF6A 4A6DA 1AT1A 3CA8A 4M37A 3WMGA 3FIUA 1X1EA 1D6JA 4KO8A 4HZUB 2AKEA 2FPGB 4IMIB 3OJLA 3UYKA 4YPVA 4MI3A 1TT5B 4CQMB 4GRAA 2CF5A 2CFTA 3ODGA 4NDZA 1NF8A 3UMBA 2RE8A 2CHFA 3AFOA 3CZPA 5CITA 1J22A 3HFSA 1CS4C 3U0BA 3EC2A 3OESA 5CXUA 3U56A 4RQAA 1NYQA 2PL3A 3ZXUB 3NEJA 4ZOQI 5DCWA 3OQMA 1ONNA 1N2CE 4JYZA 4R2JA 4X1KA 3UWDA 3K72B 4D81A 4P0TA 3AZPA 3GLFE 3AKDA 1O5OA 2I6SA 2WWVD 3L06A 1BQ4A 4H0NA 1H94A 2Q2QA 1JGTA 1IE3A 3CLRD 4PG6A 1R8SA 4BMDA 5JD5A 2ZE7A 1OREA 2J3EA 2J3HA 3JVEA 3ITEA 3LWNA 4NZYA 1CX9B 3OKPA 5FBZA 5GJVC 4GDFA 1YFZA 4LYGA 2I87A 3GLUA 2FDRA 4XDGA 3DFMA 3EN0A 3DBIA 4Y2VA 3VNSA 4BNVA 5AUPB 1DCFA 2FUNB 3PC4A 8AT1A 1DAPA 3D59A 2JGRA 4KKXB 1NR5A 3N07A 4RACA 2QRUA 5EHZA 3SZOA 1JHVA 2VWHA 1A04A 3HP1A 4IV0A 2XQFA 4TVOA 4U9UA 3NIBA 4XM2A 2XYGA 3HRKA 1UWVA 1AUXA 2Q4OA 4ZAZA 2R65A 2HJGA 3V4PB 3R0ZA 4PBTA 5G0TA 4X8HA 2HRQA 3GJZA 1KKMA 3D02A 2I65A 1EI9A 1QQ6A 4UUQA 4B79A 5AESA 4Y2PA 4UD6A 4HBGA 4IXWA 2JLQA 4HNHA 4YJFA 4QUAA 2I3AA 4X3CA 2IY7A 5KYYB 3ZDBA 1PFGA 4Q1VA 2PAAA 3G79A 3NUZA 4UDOA 1N2IA 5CGQB 3A2MA 3ABOB 3ENVA 4AB1A 1DC8A 3GPCA 3EGDB 4PLTA 3ZCTA 2C2HA 4IO1A 2Q29A 1X86B 4WA8A 4ACBA 2FPRA 1ZXBA 3DMFA 3Q0IA 2PNJA 3ROKA 4JSYA 4ARSA 4B84A 3PQFA 2ZYUX 1R4MB 1XOIA 4P5EA 4TQAA 4OXXA 2NTVA 3GD7A 2WICA 5TT0A 1DXHA 2H3EA 2ZG6A 3TUZC 3G7SA 1RWWA 4IFEA 1MBZA 4G9EA 2XCQA 2IPNA 4WJLA 4YRZA 4N41A 1N78A 4FLMA 2MINB 2G8NA 1I6KA 4DIFA 3GLHB 4L8VA 4MR7A 4ZU1X 1S3GA 5DO9A 5DULA 3AUYA 1UC8A 4L6AA 3U44B 4ZAXA 2FR8A 2GEDA 4W8HA 2FP3A 2R47A 3IELA 1STOA 1S7CA 2HFJA 1KDPA 1PZFA 2PMCA 3WYAA 5LQDA 4JL8A 4N01A 3A58B 5AKYA 4R1LA 3Q0EA 3LBAA 3D0RA 5F1PA 1BJTA 3AUSA 3FVTA 3GBSA 3OOSA 4ZQBA 3TR5A 4DWOA 1W0CA 3DDNA 3A6LA 3PEWA 1TW2A 4EG4A 1D03A 3JAKA 1IRIA 4DRZA 1FQKA 2WKRA 3ETGA 3WGLA 4D6PA 4B6RA 1S01A 3KBBA 3F3KA 4G0QA 1KFBB 2QUJA 5CFRA 1BS1A 4MW4A 2Q4BA 3OX4A 5EE5B 4JR1A 3T5DA 4DLAA 4BECA 2DWOA 4IRUB 2I5PO 1YKSA 3K53A 3V1KA 2OFXA 5C18A 3PFCA 3H1EA 4MGIR 4MI6A 1MHPA 5K51A 2YOFA 4KYVA 5CH5A 1HURA 5ECGC 1QVAA 1GKIA 1VC2A 3IR5A 2JIRA 2J0UA 2ZJFA 4FGZA 4RLFA 3DD5A 1BRTA 5IPFA 3B2QA 4IXMA 1I4WA 1NVFA 2P2NA 1DAGA 3UWPA 4TSFA 3C5CA 2FWBA 5CTJA 4F38A 1G17A 3N9IA 4X1KB 3L0ZA 2R48A 2ZI4A 5CFLA 3LFTA 2WM3A 2Q50A 2ZQ5A 1ZD4A 5ANRB 1YL6A 1IZYA 1NAIA 1W4LA 3WFIA 5K0TA 4J6FA 5GONA 2HSJA 3CLKA 1SQ0A 4S24A 3KYDB 3STWA 2P1DA 3OF3A 5CB8A 5TEWA 3AYZB 5AUQA 2OHVA 1AA9A 2V54A 4Q16A 2ZYRA 4CL8A 3PNYA 1YQUA 4XXHA 2HIGA 1Y0BA 2GOYA 3A2NA 3OKFA 1TF2A 2C1EA 1VPLA 3PA8A 4JA2A 4LJ4A 3SKXA 2W6IA 1R7RA 1GSOA 2OBXA 3WL7A 5BPHA 2JC3A 3FSGD 2GEUA 2PX0A 3C3AA 5B3JC 2ESRA 3V1LA 4V1CA 5K6TA 4PSKA 3J7AC 3BAZA 3TIVA 1IC6A 4D56A 1ZNZA 3UWKA 1EXNA 1WF3A 4LWQA 1PLLA 2TMKA 2WAXA 1NHGA 3FYDA 3FFWA 1Z4IA 1D2NA 2ECQA 2VH1A 5ALPA 1SM4A 1AXRA 1U0SY 2AWOA 3AM5A 3TIIA 1U1CA 3II6X 3A1VA 4MVJP 4D3SA 4U7GA 2XZTA 1P8JA 1WDKA 3I83A 5ERGB 4XWTA 2WIAA 1XRQA 2VZEA 1DRUA 4IHKA 4YPFA 2AJTA 2YNMC 3DB2A 3JS5A 5FNVF 5CDFA 2NSHA 4E12A 3KELA 5JU6A 4HNAA 4HEA1 5F2NA 4HLUC 1YDWA 2VK4A 2ZUTA 4G1EB 4C0XA 2C78A 5AWFC 4RTQA 2IH5A 3E3LA 4MPDA 4N3CA 2OO3A 4MGZR 3DZKA 3KUDA 1XQ1A 1FUYB 1ZA2A 1RXWA 2HKIA 2FFRA 2EG9A 1QUFA 3FHJA 2AOVA 4IX9A 4XEHA 2O07A 4NYIQ 1NXOA 1R4NB 1SUPA 4YMIA 3KFLA 3ZGOA 4E3ZA 3G5UA 3X3HA 4F3CA 3FB1A 2GZAA 3U39A 1RYZA 4LJKA 2WHYA 4RYDA 5AKZA 2UYCA 3ZKWA 3C5VA 4JJ6A 4YRKA 5G41A 1RQPA 1H1LA 3GZNB 4BFLA 1MVOA 1QH8A 3H86A 2Q3DA 3AKZA 3OTWA 4B2YA 3PUXA 3O38A 5M5BA 1P8AA 5CT5A 3WLIA 1DIRA 1O95C 2QTBA 4V3BA 4IRMA 1NUUA 4NFYA 4EENA 1I4EB 1Y9ZA 2ONCA 4TLMB 1FTYA 2VXBA 1HLFA 4Q4LA 4G4IA 4QSMA 5IP5A 3GLSA 3OIYA 5LMNB 2QVGA 5JJCA 1RXSA 3OQVA 1FS4A 1KAMA 2FR0A 2QZPA 4JT4A 5H83A 5LYJA 3RG8A 5JNSA 4DJDC 1X94A 1ZH6A 2VSNA 4O63O 4GLBA 4Q7JB 1KKUA 1O96A 4YCJA 2XRYA 5PGMA 4OYHA 5JXIA 5DYGA 2R66A 2BFBA 4AM8A 1HFJA 2HXYA 3MBKA 4A3SA 4C2BA 1W0JA 4PHCA 5BWLA 3TTSA 3GZ4A 4P08A 2QJOA 4N6OA 4NMMA 1W2GA 3FA2A 1Z5PA 3KZKA 3ORRA 5DVZA 5DTIA 5FAKA 4YO8A 3UOGA 3RROA 3VH4A 4DMCA 1KMCA 1K8YB 2VJQA 2XOKA 2HU5A 4KFSA 2PA3A 4PX2A 4F5ZA 3QTBA 2CUKA 4WAUA 1ZBQA 3P96A 1CDOA 1J42A 3MBOA 3QOYA 5SYNA 1TTQB 2M6KA 4DIDA 4KRGA 4K1LA 4CMBA 5I48A 1C9NA 2CBXA 2G80A 1QHGA 3C3BA 1PD0A 1NW8A 2O0LA 4RL4A 3D6VA 1UANA 2O7SA 4S12A 5EA2A 3SVZA 2QGFA 1XT6A 2XEDA 1PGQA 3RREA 3OPQA 3TMAA 4EKGA 4YV0A 3O84A 3TIXB 1YMVA 2J6CA 1UKYA 5HS4A 4GE0A 1BJRE 3ZWYA 4FW9A 3RRXA 1A5SB 2WYWA 1NUAA 5JH7A 1BO6A 3HNPA 4XVQA 4MKFA 1YCFA 2H54A 5B4TA 1XEXA 2VI5A 3AR5A 3RV3A 1JH8A 5DHRA 1PUJA 1BOOA 4DE5A 1GUDA 3JVDA 3R8XA 1B1AA 1WB6A 4LCBA 1YNSA 1O6GA 4RF2A 3T4EA 2FX3A 3BJRA 4EG0A 2G36A 2LCQA 2QTWB 3ASZA 4I99A 3ESRA 1RZRA 5T3UA 2EX4A 3MT8A 4Q9IA 3HFGA 4EGJA 1UBLS 3QKRA 3RYFA 4ESEA 1NBME 2W70A 5D00A 1FZTA 1P0MA 1WDLA 4ITVA 3U4AA 1L8XA 2PH3A 1EJBA 4GPAA 3AO0B 4RVOA 2I4RA 4F4HA 3ZCPA 2WU1A 3IT0A 3LVBA 1L4FA 3VNUA 5GVSA 1U2DC 1YS1X 1ISGA 2XCLA 2R8BA 2NO5A 1KS9A 1FVFA 1EJ6A 1K92A 4RD1A 1JTEA 2RGNA 3ESDA 4BO7A 4YMLA 1C8VB 4KQWA 3SM3A 3PFBA 3DEFA 2J5BA 5EKTA 3Q8WA 2VPQA 3H0EA 3A1DA 4MWSA 3WFZA 4GLFA 1H5QA 4X9XA 3JD0A 2OB1A 2Q0XA 1VIYA 4OAPA 1BN7A 1UK9A 3A3NA 1MJGA 2H06A 2V7TA 2Q3MA 4FKMA 5DTQA 2VBGA 4OQMA 3BGOS 4QVGA 5EIBD 1PCXA 3BD9A 1U8XX 3FJ1A 1C81A 4L4SA 5IM5A 3ZV7A 3QU9A 5EGSA 3VJKA 3HUFA 1CR0A 4MGHA 4YMVA 2XTJA 4QUIA 4AJLA 2YIMA 3OLQA 4QREA 4UCQA 2WWYA 1IOVA 3WHLA 3O26A 4UHCA 5BOVA 3CB4A 4BGUA 3E70C 2F3RA 5JC8A 1IY2A 1SVNA 3W6PA 5K6AC 2W6NA 1A5BB 2QZ4A 1VLLA 1SCKA 5FI3A 2X4DA 2BEWB 5C80A 2OMEA 4WERA 1DTWB 2QR3A 3L9XA 3P4YA 3SX2A 4Z7OB 4ARZA 1RS0A 1RYMA 2A9OA 4P34A 1U1FA 3V8NA 4ZJYA 4C9BA 3RODA 4OX9Y 1TX4B 3LSYA 3G1TA 1F3LA 3NHWA 3R8CA 3TJRA 4H18A 3JQEA 1P9OA 4DTIA 1O6BA 4LE2A 3JU3A 5BO5A 2QQEA 2NUAB 3TLYA 3KQKA 1X9GA 3QLVA 1CB7A 1MO5A 2MYPA 1E20A 1JHAA 1O58A 4OU5A 4OLHA 1NM5C 3EZGA 3JALA 1DX4A 1HDYA 4CRWB 1LEHA 1RCTE 3ESCA 3IQGX 3HU5A 3VPBA 1WXFA 4F46A 2JIOA 1OB5A 2IBSA 3M82A 4XFJA 5JMWA 1PT8A 3E7FA 2Q49A 4PRLA 2GCOA 1CE8A 2X8AA 2N1BA 2LW7A 3OKCA 3WRYA 3X1ZA 1SWVA 1HC7A 4GPD1 1VRVA 1GADO 4C2AA 3LBHA 2L0XA 1W4RA 3SOPA 2G25A 2Y2UA 5AJWA 2DPMA 1TEVA 4L51A 4HAXA 4NIMA 3KAPA 4YJ2B 5DM4A 5L7YA 3GDFA 2PJZA 1G6Q1 2XUFA 3I1FA 4KAJA 5LL6P 3FMPB 1NNSA 1AGRA 1SZCA 1PLJA 4GLOA 3K0CA 3D1LA 1JG6A 3ENNA 2O0JA 1R37A 4RHYA 4D25A 4HAWA 5CNKA 1PJCA 4H4CA 3E8XA 3S0JA 3ZZUA 3RAPR 1TJ3A 4RFLA 4BV3A 2DFVA 1MORA 1UOEA 3BH6A 5TE9A 2CT8A 1QG0A 4BUJA 4QXQA 1XZLA 2OXCA 3EY4A 3IPAA 4U7DA 5AW3A 3LX6A 4QBTA 4RZQA 5TF4A 2PYDA 2ZRHA 3DPIA 3CLTD 2WJGA 3TQHA 4CCWA 5K0CA 2C2YA 4OSOA 2I2AA 5A9TA 3S1SA 3ZQKA 5TPZD 3T7TA 2CNKA 4MSUA 2ZSAA 3F9CA 1OXSC 2BFCA 2A1TR 2PX3A 3ZDDA 4YAIA 2WUEA 2QVCA 3B48A 5TR9A 1QQ5A 2A3NA 4MUMA 2ZQYA 5AM4A 1LVUA 3ORQA 1UC5B 3F1KA 2D1QA 3OEYA 3F5SA 1VJTA 3KWJA 4M7OA 3TW0A 3VSCA 4EKNB 3HY6A 5K3OA 1YQQA 3TCNA 1T2DA 1WDTA 5FAXA 4ECEA 4X65B 3CO5A 1M34E 4ZOAA 3PJFA 3I0ZA 4K9PA 3WWPA 4P22A 1ISFA 1EDOA 4LGYA 3PB3A 3L6EA 3ND7A 4J16C 2XMRA 2Q6VA 2RGEA 5SV2A 4JI8B 2VPIA 5IULC 2IVZA 1U0OC 1TA4A 1URPA 2RK4A 3CW2A 1BOFA 2VRCA 4HX5A 1GN9A 4BWFB 2MDTA 4BJ6A 1Y7LA 1SOWA 1U7XA 2JLAA 1FNBA 5A1JA 2JJ2D 1U3DA 3KHSA 4FYKA 5T5QA 1BFKA 4AP6A 5CEEA 3CX6A 3HXPA 4RSRA 3D9QX 1JFLA 2SHKA 2W6JA 1UMCB 3IV9A 3TR0A 3ZLUA 2WJVA 1GN8A 4DR7B 2YN0A 2I1VB 4YREA 4JLVA 3I61A 4NPAA 1BGVA 1Y1RA 3GDOA 4ZCLA 1ARZA 1OI3A 2EAUA 4NBNA 4S3MA 2RKOA 5DRYA 3GLIE 1QFZA 4ZKDA 1BA3A 1XJWA 5E1BA 3USCS 1YMUA 2ID4A 3HV0A 1FDRA 3E7XA 3HKCB 4R8LA 1PR0A 1B41A 2FOLA 1G2PA 1FMLA 3LZDA 1Q92A 1XN4A 2V7XA 3BB4A 1EUZA 2IXFA 4KOAA 2L42A 3T99A 1ODIA 4CM4B 2WFLB 3THXB 4G4JA 2O50A 2Z8ZA 2XZPA 2YFKA 2I4MA 1W1UA 3GT4A 1JW9B 4BGEA 4IEIA 1DLIA 3AC0A 5JY6A 5IT4A 2P6PA 3BKWA 1V3QE 2X8LA 1VECA 3EULA 3F6RA 3MGGA 3Q4GA 4WHMA 5H81A 1J7JA 3GPLA 2OOKA 2FW0A 2TYSB 3F4BA 5HSGA 1CUHA 5I7OA 1N8TA 3AY6A 3K0KA 4MPPA 1HDXA 5FI0B 4BNYA 3OQOA 1T6XA 3QZUA 3LGSA 1DPGA 2NU6A 2X8BA 3CTMA 4C6TB 4BJ3A 4OSEA 4W5QA 3R0VA 3OLZA 4NJMA 5F4ZA 2C5BA 5HUHA 1HI9A 1VPWA 4AZTA 1UPCA 4O1HA 3KVVA 5FPTA 4ZAFA 5JAQA 2V3CC 1G3QA 1QH8B 4AL4A 3G2MA 1HLDA 1WD5A 2GO1A 2UV8A 4BX3A 5FOSA 5IK2A 1VLQA 1QTNA 3S4YA 2A9KA 1XO1A 3O2QB 2FEOA 2OD9A 4FGKA 4I5DA 2PJDA 2UXBB 1FPMA 1U1EA 1DP4A 4OYLA 1ZM9A 4F7DA 3DDCA 4KNVA 4X1IA 2QUKA 1NF9A 4WZAB 4DSTA 2BM8A 3DGFC 3KD3A 2P1RA 1IOLA 4XWOA 3UXEA 5K2OA 2G3YA 3FOBA 2EF0A 1L5OA 3F2VA 3FM9A 4K1XA 3BCHA 4AMVA 2JDID 3P2MA 4MINA 3FTEA 2CXNA 3PZRA 2GEVA 2NXJA 1XHEA 3NTUA 4J8PA 2WK1A 4LXIA 3RRYA 2JCSA 1H6CA 3MGKA 1Z33A 1NLYA 4PTYA 5A5GA 2PUCA 3GJRA 4GI7A 1BE1A 2QN1A 3CE6A 3A10A 5LMCA 1JQDA 1XU7A 2PS0A 3R6LA 4GZ3A 4ZYZA 1PZMA 4TKUA 1UJBA 3VSEA 2WAAA 3NBQA 1E32A 1PEAA 3CONA 3UC9A 1P7ZA 2UVDA 2WHEA 1S3SA 2DFPA 5DGTA 5AR1A 2CCJA 4WA7A 4YP1A 5JS1A 4V0LA 4DEXA 2HA3A 4D2IA 2OPHA 2XCRB 1QO0A 5K09A 3S68A 2I0FA 2FSVC 4BMSA 3EZNA 3FH0A 3W5VA 2DFKB 4EB8A 5KJ1A 2GYUA 5REQB 1R0ZA 3WVNA 1OZ0A 2PGDA 3NTQA 4LMRA 2I6FA 5M34A 4DV5B 1N2ZA 2UAGA 4UTXA 2OZPA 1N25A 4MDYA 5I7WA 3T61A 2CDBA 2YH2A 2ZRGA 2P2LA 4Q7EA 1GYPA 2B5VA 1V25A 3EW9A 4H7IA 3UK1A 4EFKA 5BUSA 3PLAE 3GD5A 3EAFA 3JQCA 5EZYA 2YOHA 5LSAA 4ESVA 2VBFA 2J9RA 3D3NA 1SFRA 1M10A 1ZJYA 4KGVA 4O4LB 5DGHA 2XLCA 5EMHA 1FRNA 5AVTA 1MUUA 4NKRA 1XZKA 2VZ0A 3L8CA 2B99A 4EPVA 4P3NA 3JAMA 4M1QA 1DT3A 1VKHA 2HQSA 2H51A 2WWFA 4GPBA 3QPCA 4IINA 3RFCA 2FW1A 5KTPA 4M3NA 2CL7X 2FFQA 3JASB 4P81A 1NFFA 4X95A 4KN6A 3SQXA 1J1IA 5BN4A 2BM1A 2WJWA 2AC7A 1ZK3A 4Y2RA 1RRFA 2CLSA 2XMSA 3DVLA 3OTIA 3O75A 3AKYA 2FW7A 1U2DA 4DMUB 4LF8B 2ZBFA 3P9KA 3UKOA 3VVLA 1L7EA 2IS1A 1K97A 2QGNA 4CG1A 3SVTA 2PXCA 4L3VA 1GRVA 5F51A 5K8CA 4ZVVA 3EAGA 1GAEO 2VYVA 3FD8A 3U3RA 3W4IA 4EPRA 5F23A 5KNCD 2O8DA 3G6KA 4PF1A 5FBHA 4H6WA 3ZLBA 3GF4A 4DLRA 3AEKB 1I10A 4NBSA 5GWXA 1HMPA 1SBIA 1T91A 1Z16A 2WAYA 3OJOA 5TVGA 4OIMA 3CZRA 2QR5A 1NVDA 3RUCA 3CRQA 2X2EA 4HB4A 1ST2A 4IHAA 4X85A 4E03A 2BE9A 2BMEA 2G28A 2JFOA 4PS1A 4AFNA 2MMGA 5AVOA 4DEYA 2YN4A 4D9CA 1IY8A 3UT0A 1RXYA 4V0RA 3K5IA 3WLEA 4RFSA 4G9BA 2OEPA 1YDMA 1DELA 1LKZA 2QRQA 4C88A 5LUAA 3DUWA 3ZLJA 1AKUA 3K9GA 4M9UA 3R5JA 1T6BY 5ICSA 2F1RA 1LQTA 4BEVA 1R6AA 2B5WA 1P2DA 3CLVA 2AHRA 4QM7A 3PGXA 3IX7A 1RYFA 2E21A 4KO2S 3LLVA 5BOSB 3HM9A 1KETA 2M98A 1KIMA 2XB4A 2WJZB 2ZRMA 1DQPA 3BDAA 4EY7A 1DBWA 2Y1LA 5AT1A 2A33A 1CHDA 1V35A 3LCJA 4NICA 2H1IA 3B1XA 5K03A 1SELA 3RABA 1SUCA 2JI8A 2WSYB 3W5AA 3NYQA 3M6VA 4RV9A 5KI6A 3H2IA 4MUKA 1O87A 2CHGA 3LCMA 4HAUA 2XA1A 1OAAA 1NBEA 1S02A 1V11B 2VN8A 3OWHA 3M4NA 1CRLA 4QEKA 1J8VA 4CU2A 1CD5A 1NC3A 1PS8A 2JDIA 4FEGA 1QYRA 1QKKA 2P1ZA 4M55A 1E94E 2CDAA 2ZSEA 4JI5B 2ZJ8A 1G8JA 4UU8A 3BFPA 4M2LA 3TOXA 3ZGXA 4DV7B 3SC2B 1G3UA 1NW6A 1XU4A 4LK2A 5L3QB 3GARA 5DGIA 2GAFA 3HBNA 4HAIA 4CM8B 5GV7A 2Q5CA 3C8ZA 4PE5B 3TSAA 1DJOA 4WN3A 1R88A 2ZGVA 4EO4A 4YXWD 1FYEA 1AO0A 4X45A 2JGIA 4J0IA 2R1VB 1NY6A 4HTAA 4IXNA 4KWCA 2DE0X 3LXUX 4FZVA 4II2A 1NQAO 2V5UA 1IZ7A 1CZLA 1N5JA 3FCCA 1IH8A 3SDZA 5B1IA 5AJTA 2CHQA 1YONA 2BW0A 5KYYA 3V9PA 2MSWA 4FFBA 3SR0A 1JBKA 1NSFA 1OZAA 1S3FA 4WMLA 1UUFA 5ER9A 2RD2A 1TD1A 3SN6A 2Z08A 2OCBA 2ZYHA 1NXQA 1KPGA 1YVDA 1RAEA 2A0XA 3MD9A 5SICE 5I4IA 2DUWA 1AGYA 2Q3CA 3ZV4A 5K4GA 1RAFA 2B7LA 1QG4A 2WA1A 2JLUA 3WLAA 3ITDA 2YZKA 2PT9A 4E46A 4Z49A 5C5IA 2I4NA 4TTRA 1Y9EA 4LZJA 3L0DA 4PSUA 2ERYA 4FLEA 5CB0A 2JVJA 2GHQA 2B3TA 1JU3A 3PC6A 4W6ZA 1NDQA 1A50B 3WRYC 1JIJA 5F98A 5BN4B 1AQUA 1Z8DA 3S2IA 4BVGA 1J5EB 3RC9A 1P45A 1HT1E 3WL5A 4IW3B 1SBYA 4O3FA 1EHYA 5AVVA 1Y81A 5T4EA 5IKMA 3A9RA 3M1YA 1F3OA 4U4AA 1AZWA 3HI6A 2ZRPA 3E35A 1KY4A 4DLUA 4RZXA 1FNNA 1E1LA 2VWPA 4BU0A 3GP5A 3F5DA 2J7PD 1PJ4A 2PKYX 1TPYA 4H7JA 4JR2A 4NK4A 4X5OA 3KOOA 4MQLA 5TQ2B 2KMLA 1KZ7B 3BL6A 5G02A 2BCGY 4PYKA 4CTJA 3IBFA 1RLMA 4RWEA 4X6YA 1O03A 1P1HA 3OIGA 2NPFA 1ZNYA 2PR7A 4ND4A 5HE8A 3HP7A 1UR5A 2QRNA 1UPXA 3I39X 3L43A 2X8WA 4FCVA 4KP7A 3O94A 1NV8A 4HL6A 2RAFA 4M6WA 3NRJA 1A4UA 1FFXB 4FGWA 2FV8A 5LA6B 1UKVY 5CDUA 5BSWA 3MWYW 3H4MA 3MAJA 2RBEA 1ONPA 4DBZA 2NU7B 3MLEA 3BGSA 4GX5A 3PS9A 4AO6A 2ZCJA 4CFYA 1H2RS 3OU2A 4EB3A 4WADA 5DT2A 2RKWA 3HRHA 4RM2A 4KR9A 5IG2A 4UAUA 5ALMA 1G6HA 3ZVRA 3LYAA 5CA1A 1IN6A 4JD5A 5DEOA 2UUOA 5CA0B 4B6FA 3IALA 3NM5A 4TTVA 3BXXA 2PFGA 4QXRA 5AK0A 5DW3A 4GPEA 5F12A 4KPFC 3EVEA 1LPAB 4KVGA 2QJTA 3D6MA 5LDDC 3BXGA 3AIIA 3GFVA 3BC1A 4JZYA 3L8YA 4QPPA 3HCRA 4KNYA 3KTAB 4X54A 3PL1A 3QMWA 4C0HA 5HZMA 2PZLA 1TAGA 4EBBA 3C24A 3EWIA 3Q15C 1JPUA 4JKIA 1GTL1 2Q5OA 3FYSA 3OZCA 4J4BA 1R8JA 4KRYA 4MJ7A 3O1LA 5MGBA 2G63A 3ERCA 4UTVA 1W5BA 3ASVA 2RI0A 1FBNA 4L74A 2QXUA 5DIZA 4G5XA 4H9GA 3EF3A 3VKGA 4XIJA 5CX1A 4Q3KA 3O3CA 4UUNA 2X0DA 4BB6A 1QB8A 1VHLA 1NY5A 2Y6VA 3IDAA 1O77A 1DRWA 4I66A 4YQZA 5LZ8A 3F4LA 2AC4A 4FQ7A 4XDHA 3V7NA 3IUMA 1W8IA 1C30A 1MFPA 1SKYB 3PXUA 4XPZA 5ED0A 4HDCA 4F9EA 1OAOA 5K3EA 1KH3A 1QHHB 4OHFA 4DJAA 2O8BA 4H16A 4BFCA 1BX3A 1FRZA 4BUCA 2WYIA 1EX1A 3SKYA 1M2OA 3BSSA 3HI4A 3NBAA 3LBIA 3O93A 4IH1A 4N0MA 4QDTA 1Y4SA 1PNRA 2OR3A 1E1CA 1XVUA 3QKSA 4CUZA 2IX9A 4FOTA 4EZEA 4J0FA 2Z3ZA 1H4TA 3RSGA 2Q5LA 1AHPA 1GPYA 1A4IA 5AIBA 2GZRA 3JWHA 1FZQA 3R6DA 2ZUVA 5EJ8A 3C74A 1YHZA 4ZP1A 1FYXA 1K8RA 3JQ8A 4MLPA 4M1YA 1I3MA 4JLOA 4HFRA 1LBIA 1XCLA 1SK8A 2Q4EA 3PF8A 4UXHA 5JECA 5LKAA 1XYVA 2OHHA 3LYLA 4FN4A 2GBPA 2Y2VA 4UCXA 2NU6B 1FFSA 2P4SA 3K09C 1OLXA 3OM1A 4RZ3A 3WG9A 4EI2A 3HWRA 2GHIA 4JIGA 5T7BA 3CZ9A 2XXBA 4KXWA 4ND1A 4NJMB 4NS4A 3VZPA 1V2HE 2VH5R 3GWGA 4CM1A 3C3JA 5I9MA 4E5MA 1HT2E 1SCDA 3EF1A 5CMLA 2JHAA 2OCAA 4ZQEA 1EUCB 4C0LA 3TQFA 4AO7A 4JJFA 1UJ5A 5I7AA 1NMYA 4UNRA 1F6WA 4FKZA 2H07A 2AD5A 2YV4A 2OXEA 4ALNA 3THSA 4M83A 5DU2A 5AP9A 2E0IA 2Q5HA 5MN6A 1KQFA 2XODA 3BSWA 3PQ2A 4J7XA 5EKSA 4LF9B 1T1IA 2Z43A 3VZDA 2ZJAA 2NP6A 2OCYC 3R74A 1BSVA 2B30A 4K03A 5THXA 5AM5A 1XZNA 2XT9A 2ZIEA 3UMRA 4ZI7B 5L3RA 3A70A 1RM0A 3GU3A 1Z6GA 3MA0A 3BHMA 3OPYI 3OWXA 3OWOA 3PRJA 4BZZA 1SIUA 2EHJA 2BGMA 1YZKA 3SS9X 1MVNA 4H6XA 1KF0A 4BMVA 2O3UA 1Q95A 3JAWB 5BQPA 4Z3OA 2JANA 1VHTA 4NBTA 3L5OA 1VCIA 2HT1A 4Y6QA 4AJNA 4O4LF 1LA2A 1DJNA 1J8YF 2QI9F 3PRKE 4A0GA 1F2UB 1Z12A 2D5AA 2FZEA 3AB7A 3QLJA 4K81B 1T5BA 1WL8A 2XYVA 3SNHA 3UJDA 3VPAA 5M2QA 5LYJB 3UJPA 4AURA 5FNZA 4I1OA 1OH8A 2FUG1 3H9CA 3LCRA 1FDVA 4Z9BA 2C7PA 2RI6A 2EL7A 5HGXA 1XAHA 3U7JA 3OETA 2CNLA 4ZO8A 2EKPA 2IEZA 1UT5A 2ZIXB 2W2NA 3GUVA 1PZHA 2ZRIA 1DX6A 2NSJA 3OFVA 2GESA 4GZMA 4MUJA 1PWZA 2DX7A 5JNUA 1ZRMA 4BCCA 3QU4A 4TKLA 4FYXA 3W7BA 1Y1SA 1FDIA 1GGKA 1FU7A 4ZGWA 5C8DA 1Z75A 2FE4A 4CQNA 4NESA 2DTEA 4YLGA 1E8MA 3OE4A 5AI9A 2JRLA 5U1PA 3K0AB 1EFPA 1WSWA 1WP9A 1ZIDA 2WF8A 2WF7A 2PLNA 2XV1A 3ABZA 4LYDA 3DVAA 5EMNA 1X7XA 3W2GA 2GX6A 1GV0A 1RBYA 4L15A 2XNCA 2MSKA 3LPAA 1M83A 1E9RA 3AEQB 4HLQB 4TLEA 4F92B 3ZOKA 1SXQA 1K63A 3H1GA 1DO8A 3QITA 2XTZA 2ZPTX 2QL9A 4FJ2A 1WDWB 2R1TB 1N2CA 3PJDA 4A73A 5JG7A 3A6PC 1ECCA 4ZV9A 1M2EA 2ZZNA 1QAMA 3JQ7B 2AXPA 5ALGA 1KK3A 1XEFA 2I2DA 2PH1A 1E2LA 4F8EA 1Q16A 4EA7A 4Q9DA 5ICMA 2XXAA 1RVV1 2AMFA 3N0TA 2BFAA 5BQ5A 5HP4A 3N75A 3B6KA 3FPSA 5IK2D 4CEHA 1CT9A 2A9QA 4UDXX 1VE9A 5SZKB 2FF5A 1M6WA 2VHTA 5G4KB 1CRQA 1QTQA 3ADPA 1NMZA 3SHOA 4YYEA 2DKNA 5CGZA 3GYGA 4W5JA 5A3JA 3LDFA 3HXMA 1QF6A 4L8WB 4N8EA 1LK7A 3AHHA 2XUAA 1Z38A 4RE5A 4ZVTA 3EXG2 3MTAA 2EU8A 1ECGA 2XYQA 4FBLA 1EFVB 4BNZA 4E1BA 5L4LA 3D6UA 1OJLA 1RYBA 2AMJA 2ZQZA 4GWKA 3QHQA 2CLLB 5FJJA 4A2CA 2QSZA 2ZJ7A 3UJBA 1CNMA 2GXAA 2H1OA 2C84A 2XSZA 3DAHA 4AKTA 1M2JA 1WSAA 3DTYA 3RB8A 4FWBA 6GPBA 5AKKA 3T54A 4ZEWA 3AY3A 4O2AF 3R75A 4HEQA 1DTWA 1P9NA 3L41A 3URKA 3T6KA 4EHDA 4X6XA 3SZGA 1ZSVA 5LZ5A 4KH1A 4IXDA 4BVFA 4DARA 2H1HA 1KC3A 1J2TA 3HR8A 3L7AA 5IN5A 4A23A 4YYZA 5TGZA 3M0EA 4QNRA 3B8HA 4HRXA 5T6MA 4PLCA 2ZREA 2ZXFA 3IAEA 3MRXA 1MGPA 2ZJBA 3WB9A 1DQYA 3WS7A 3BIXA 5EXDA 4GECA 4IV8A 2BL4A 5C1BA 1XTKA 1JT9A 2XD4A 1CERA 1HWYA 2HK6A 2YC4C 4M0FA 3BSFA 3QX9A 3OLVA 2GZ3A 5BW8A 2BZGA 3V8MA 1WM1A 1E6CA 1DXQA 2OESA 1PHRA 2XE4A 2Y05A 1ABFA 5FWNA 2D62A 2CVZA 3QU7A 4RQTA 2VHVA 3Q7PA 1Z3IX 4AVYA 1BCRB 2E6UX 3NLLA 4KIUA 2G9UA 3FUWA 4UEKA 3TFWA 2GNPA 2NMVA 5EKDA 4ZT5A 4QNNA 3JYOA 4NNPA 2IS4A 1D6MA 3OJCA 4GVXA 2PLWA 2VHEA 3IMKA 1VMKA 1S8AA 2BBWA 1Q17A 1CK4A 3KDAA 3ZYZA 2GS9A 2AZMA 2WU3A 5TNXA 3ZZ0A 4ALIA 3KLMX 2Z5GA 1L5LA 4ZRMA 4B2PA 3FZGA 4J90A 4QC2A 5IMBA 3RIGA 3DHVA 1M6EX 3ZNQA 4DMLA 4YHHB 3Q87B 1VCNA 4H7HA 1NU8A 1QGUA 1L5HB 4L78A 3W77A 4AXBA 3QKRB 3RYFB 1YRWA 2YUTA 5CAEB 5CCEA 4MKIA 4QYIA 3PQ8A 4KWIA 1VI6A 4I8IA 3W4KA 3FE2A 1JZQA 4QTYA 4A91A 5HIMA 4G89A 4E5UA 2X9LA 3I2HA 3N8DA 1DKOA 1A8UA 2DVMA 4NR0A 4RVUA 1ORHA 821PA 1X3LA 2RGBA 4ZQFA 2DFNA 5JTUA 2GETA 1XDSA 3SQOA 3MCAA 3NKVA 2HGZA 3A6FA 1PVOA 1ZU4A 2P9JA 4LZOA 3N2IA 2QM7A 2PCJA 1WU7A 2QTNA 3F6CA 4MUHA 1SUBA 2EQ5A 2AN3A 3FXAA 4MV5A 3T9CA 2VT3A 3E4CA 3PGKA 4NP6A 2DU8A 2FWIA 4L0DA 3UAVA 2YYAA 2BR3A 1XQ9A 5FYQA 3U7EB 4FYPA 4L02A 4QOIA 2PX6A 2A9VA 1W85A 4HX9A 4MRMA 4GIBA 4YAJA 4I46A 4U0KA 4Z7JA 4C7OB 4ND5A 5CK5A 3B1WA 2G7MC 3O8RA 3GO4A 3REOA 4JASB 4PZYA 3T7RA 2DMRA 4HP8A 1EFDN 1OT5A 3E1KA 3OZUA 2R8RA 1CTQA 2BTQA 5C8YF 4OGLA 2NTNA 4X1OA 5E3HA 1IEQA 4KNWA 2OLKA 4P4SB 1KFKB 3WKDA 1C3JA 3NHLA 1U4SA 1G16A 5CB4B 5KX5B 4KIGA 3S2SA 3KSZO 5J3JA 1IWPB 2FGKA 1T9AA 8ATCA 3VISA 5IARA 2PBRA 3O2JA 3ZVLA 3CEHA 3T3MB 2IXTA 2ZB7A 4TN5A 4D6YA 2PM8A 2X5XA 3DAYA 1ULUA 3K6KA 3UV3A 3OCJA 3HL0A 4D57A 2DRIA 2W8ZA 3WWCA 4ZDJA 5K8TA 3WLFA 1SZJG 4M8NE 1CRWG 3IMEA 1H2XA 1XD8A 2V7VA 3OT5A 4MW5A 3E9EA 2I03A 4I9HA 4P5PA 4RAOA 4RV4A 4H1TA 1Y3AA 3IODA 3VU9B 2VPXA 4AD8A 4KQJA 1RLJA 1R0SA 4M0UA 5B30A 1LZLA 1ODCA 4G5QA 2XQIA 3A1WA 4HGZA 3NT2A 2HSGA 3H9QA 4EHKA 3C8DA 3H87A 3HHEA 5HILA 1UEIA 4US0R 3KQLA 4NYMR 4GOXA 2OYSA 2PKXA 3LT5A 5JBQA 3QY9A 4QGGA 3ANMA 1Q2XA 1Z0SA 2HCRA 3AR2A 4ZYXA 4WOJA 1DBVO 1NVBA 3E9QA 2DQZA 2PO5A 2R1ZA 5CPBA 3N2GA 4D3YA 3ZDQA 1JVNA 5FL7D 2PPVA 3T1TA 4OI1A 2GDJA 1ORWA 1XJCA 4E15A 1TLTA 4WBXC 2IW1A 1B2LA 3EVNA 4JBGA 3PR3A 3W6ZA 4BKQA 2Q2NA 2CHUA 3KTAA 3QFSA 1R6XA 4FUTA 2PV7A 2IELA 1PTJC 4C6HA 2C4VA 4NK5A 4ZVSA 5CEJA 1CUDA 5ERXA 1M8GA 2XDQB 3GLIB 2YTZA 3KO8A 3JWIA 1P5FA 3HVRA 3OU6A 4E88A 2W6QA 3NM4A 3FW1A 3T3DA 4GRDA 3FSRA 5DOVA 2HSEA 2O06A 2VHUA 4NFSA 3PQDA 2GCGA 4LS3A 1N6HA 4TMYA 5F1YA 1DBQA 4ZU6X 3BREA 2G4LA 1FTWA 3CF4A 3IRUA 4WCFC 4UDYX 1FLVA 3T15A 3VR4A 2J4FA 5ERYA 4UVDA 4ZCTA 3FDZB 3WHKA 9ATCA 1ULBA 4FYWA 2C0CA 1FNDA 5ESXA 1IQPA 2QZZA 4JXZA 3N8KA 2JGKA 2BMFA 2O8BB 1V43A 3QBVA 2IHTA 4A6XA 4CG0A 1PYGA 2H7XA 4LXQA 2DLCX 3NFRA 1DKLA 4HXYA 2H5LA 3IT3A 4U6SA 3CLUC 2X9QA 1N3YA 1RZUA 1H4VB 2JAOA 4CDMA 5BSKA 4II3A 5BUQA 1G19A 2FG5A 1SD5A 4WACA 3KPYA 2O0HA 1FFEA 4WT7A 1X13A 3RSQA 3UMSA 1EBUA 2G9RA 4XGKA 4EW1A 4WXRA 5AKEA 5FPKA 1W94A 2HV8A 4E2WA 3J81A 1MQAA 3ZWOA 1AS2A 2X0IA 3W2HA 2C3PA 2I1WA 3WNBA 2GT1A 1BD3A 4D02A 4LF6B 3FJOA 3EXHA 4ZYUA 4H6PA 3K1AB 2AMYA 3M5PA 3SHTA 3RNOA 1NBMA 3IAUA 3QVSA 2BMAA 3FF4A 4UHBA 4BNKA 3H5IA 2G5PA 2PX4A 2YYSA 1IWBB 5I9NA 1L7BA 4WOBA 3UBMA 2JFGA 4WVFA 3UAWA 1JYEA 3IE1A 3L1JA 4BEBA 1EGVB 1MH1A 5DHTA 2A5JA 1BE0A 2WT8A 4C14A 1DAEA 1P2BA 1GGEA 2OILA 3SSMA 3IAXA 1JQJC 2FAXA 3ZXXA 4KLNA 1MW8X 4RK7A 2UDPA 2IXDA 2EWVA 1SCQA 2E6KA 3C8HA 1T35A 3RGWS 4PYQA 3D7RA 5BSMA 4BVBA 4D8UA 2JH8A 3EZ2A 1GU7A 4E1VA 5A3SA 1KMQA 16PKA 1XA3A 1XMVA 4D4IA 3P94A 2WYVA 5CVUA 3N6VA 1DEAA 1C7FA 2E3JA 3UH1A 2NV0A 3K9WA 5ALDA 1OFTA 3RFXA 1FYWA 5FWYA 1L1FA 5FA8A 1RLTA 3UC5A 4LDPA 2O2XA 5J23A 3GGDA 3MXOA 4TQUS 1AHHA 5IT9A 1JEQB 4PQGA 4RY8A 3IP6A 3TEJA 4HQKA 1OOEA 1I8TA 4B7XA 1IN5A 1JS1X 1QC5A 1E2PA 3S27A 3R6TA 1KHTA 4LY9A 5ELXA 5DLPA 3RS0A 4ZEMA 2HD4A 2YWDA 1E98A 3G8DA 3LD9A 4FBMA 3FNFA 1C9YA 3WGOA 4DJFC 3RS2A 4HGQA 1FMJA 3IAM6 4KI0A 1IK4A 3EEOA 3JW8A 3QUBA 1K75A 4M1TA 4YJFB 5D3QA 3OAAD 5EOVA 5DP1A 2GFIA 1QOPB 1Q44A 1OGIA 1Z26A 2B94A 2R5NA 3L7LA 5A62A 1BE8A 2WM9B 4HYTA 3IEKA 3ZZ1A 4UTRA 1ZN7A 4R7ZA 2NZ2A 1CUFA 2HBQA 1ZYUA 1INLA 3V46A 1G2QA 1C5KA 2X3YA 4BNNA 1P1IA 1GQOA 1XXHE 2P7HA 4QQ8A 5FFFA 3C16C 1W73A 5ESRA 3MVEA 4EUHA 1NI4A 4DABA 5CT4A 3GFBA 4P7FA 1O4WA 3CSSA 4F93B 3MWGA 2IJGX 2QK4A 4HYYA 1MB9A 4ZC1A 3KZMA 3PNPA 3LDHA 1L5GB 5FV4A 4UZSA 1QC5B 2ZRFA 3EG9B 4A8JA 4L75A 1UAGA 4QM6A 4NYMQ 3A4IA 3UMVA 3L40A 3R40A 1KYVA 4ID9A 2XWJI 4IDOA 2X7JA 2V9PA 4DV1B 1EPUA 1Z56C 2XA2A 4O2LA 4CV3A 4XH9B 1RT9A 4P58A 3HS3A 4ILKA 3QEBZ 3UJAA 5DNCA 4FINA 1SOVA 4JI7B 2IV3A 4E08A 4HWSA 4TQ9A 5KHLB 4QAJA 1K8QA 1PJAA 4GYYA 2Z8XA 1ZRSA 3OE7A 2V3WA 3HJGA 3OCXA 1NA5A 3BWDD 2AFIA 2DR0A 2WWHA 1IBLB 3HY4A 4HQ6A 4J3NA 2Q45A 2WTNA 2C1XA 5IUKC 3V4ZA 3NIFB 1B0ZA 4RY2A 2QTCA 4XSVA 4E21A 5A6VA 3SF0A 3BWVA 2A0UA 2OSVA 4NC9A 3BCRA 4ZVLA 3S6JA 1VJ1A 3EA5A 2NG1A 4JP3A 3DWIA 3B82A 2A30A 5BYKA 1NULA 4CKCB 3UCXA 2Q4RA 3VPCA 1KRWA 2IH4A 2JEYA 4KDCA 4MCAA 3TH5A 3QF4B 1FFYA 4ALMA 1UBFA 4ZK2A 3UGKA 4JLSA 4ZI7F 1IXZA 2IZ6A 3MJSA 3JY6A 1IU9A 4MQBA 3ECCA 3VX3A 2X0RA 4R84A 4ZOCA 4XAQA 1QOQB 3O21A 4PAMA 3FZQA 4DCGA 5DNYB 1K6IA 2EHDA 1UP6A 5DM1A 3CCFA 4LGCA 1JKMA 3AVXA 1DT5A 2NYVA 1DRVA 4KX5A 2FGJA 3A4YA 3SCZA 4W5NA 1XQYA 5FLKA 1QDLB 3V6LA 4KLCA 3SBXA 1H0SA 1GOTA 1I3OA 1KRHA 3Q6NA 5BR7A 2XUPA 1ACLA 1DWUA 5T4HA 1JDBB 4YV2A 2F7SA 1P1FA 1V8BA 3IKLA 4G36A 4H3SA 2CF6A 2R8OA 5FP0A 2ZUFA 5TVKA 4NE2A 2QOEA 3NQ41 2LPMA 1PWXA 1YZTA 2QM0A 5AQ1A 2WJ4A 4PZ9A 1W7AA 2RI1A 1QO7A 1U04A 2I9PA 2Y4OA 3AL2A 4XUGB 1E2MA 1JDSA 2AG6A 4IOJA 2PX2A 1SXJE 5DSZA 1T3TA 4RIHA 4TWIA 4EW6A 1NSYA 1N0WA 1EJ0A 4ZAYA 1SIBE 1TQHA 1P1CA 2HMUA 3AF4A 4NJOA 1N57A 2GVZC 1IY9A 1KHHA 2UYOA 3BZUA 4Q39A 5DIFA 2ODTX 4R6WA 4DV3B 3VZRA 4KAXA 1TK3A 5KTOA 3I01M 1XR3A 3GLVA 3MSXA 4F3KA 3ITNA 2IPMA 3CMMA 4F97A 3HDQA 4BGIA 1J09A 1CF4A 3NYWA 2Z6AA 1R8YA 3HJAA 5HKKD 3DVSX 2WZDA 2QN8A 1YFLA 1QORA 3OP1A 4U5XA 1J9EA 3MOGA 2A0YA 4LPSA 1BMQA 3L6OO 4OMDA 5IJ0A 4LW8A 3BGIA 3KL2A 4J1QA 4AN0A 3IQHX 5BXYA 1KP3A 2FJUA 2PBZA 2VLBA 4OSPA 4BO2A 4F11A 3CPEA 1PFYA 2Z5VA 2XUIA 4H3HB 4KPUB 4U2EA 3VZBA 1CULC 4OK6A 5HF8A 2PT5A 4W5WA 1Y5RA 4HGYA 1YS9A 4EUNA 1BW9B 4OQFA 4ZREA 3GMSA 1BEEA 2BE7A 2NUPA 4UNPA 5KSZA 1NG1A 4G07A 2PMFA 1TCUA 3MWDB 4N03A 1NFQA 4ZI3A 1U6IA 3GGCA 2CXOA 3V33A 2PU5A 1OU0A 2XCOA 4C1NA 1DOHA 1OY1A 2WE7A 3R24A 1D2AA 3LW7A 3VNQA 1AQYA 4KR7A 4DDHA 1QIGA 4DNOA 1GGHA 2HHJA 4Y2SA 3DWGA 5P21A 1I6WA 4D8WA 1JR6A 2GSWA 4MDFA 2DXIA 1FFWA 1P61B 5TQVA 1N5RA 4YRBA 4UEWA 1QF7A 2LRHA 4OB7A 5KC8A 4ZA2A 4QKQA 4F4JA 3S5JA 2YKGA 3KYJB 3A3KA 1R64A 3S8MA 3STHA 5JI2E 2JZOA 3ZC3A 1SXJB 4BFSA 2CE7A 4F72A 1GL9B 2FEAA 2QRMA 3OJEA 1P2VA 4U7HA 4Z4EA 5H9WA 4KI7A 4UOZA 4URXR 2VQEB 3DBHB 4A8JC 5KWEA 2DUMA 5MN5A 3L79A 1QYXA 5DKFA 3AU8A 4BNDB 3PXDA 3FUTA 2JAUA 3JV7A 5FI5A 1FOEB 1ZAKA 4C2UA 3QTTA 4ALKA 1QX4A 4X92A 1UP4A 3FPFA 4BDSA 4DADA 4MB6A 1W1IA 4KFUA 2CJYA 4FOPA 2FMTA 4Z8XA 3UICA 1U1IA 4RXTA 3L8GA 5AKIA 3LXRA 1WXIA 2OPBA 5L7TA 1ZO8A 2IT1A 3L0OA 1QOZA 4LDRA 2RFLA 5EHXA 5JPIA 1FP2A 2Y0BA 5CJPA 1QIEA 1N5DA 3SXUB 3W9UA 3DBRB 5DNAA 5JNWA 1YT5A 4MXDA 4XIYA 4PZPA 2DC1A 3CN9A 3F6PA 4H7FA 2CEKA 4WCVA 3P4XA 3AI1A 5JIBA 4C7VA 2VZLA 3CT4A 3GFGA 1HSOA 2I4IA 4JP8A 3TZEA 1Y8RA 3UJ7A 2BDEA 3G0GA 4O4JB 1G7SA 4D26A 2NZVG 3KFXA 4GGPA 4AQ7A 3LQ2A 4JUFA 4KSYA 1EG2A 4EJSA 4QG3A 2AR0A 6ABPA 2I6TA 4Y9UA 1Z82A 2WU4A 4ZYYA 1CV2A 5C81A 2QZSA 1I4OA 3L4EA 3C2QA 3QENA 4I9FA 4LSMA 3VHXA 4CT0A 1A9XB 2YOGA 4FI3F 3ZTTA 4TSKA 1ELOA 4UD2A 3K09A 2EFYA 3ASYA 1WQ1R 2CYBA 3FNHA 2LTAA 3FMVA 3DWEX 4PC7A 3TNFA 2XT0A 3DB1A 3D6FA 4P8RA 2KPOA 1OU4A 1PR4A 3IKJA 2OAQ1 3M9XA 3A27A 4L8LA 3N87A 2J7PA 2VJBA 4G8JA 1SC9A 2IXEA 4JLPA 2CXXA 1LDMA 4IHJF 2CJWA 2IEBA 3BE6A 1BWRA 3IMGA 4D92A 2N0SA 3RVBA 1DC3A 2HPZA 2Y68A 5EL0A 2EV9A 4OMUA 4NOKA 1DBIA 3GG9A 1TC2A 3L0CA 3B38A 2VPTA 2R751 1GXSB 3M6AA 1EGAA 2CLEB 3AETB 3WI7A 4QXMA 1F60A 3RSSA 4F1KA 5B5SA 3U3DA 1ZLYA 2CVPA 1PVDA 1QVWA 3W3AA 4WGGA 2UXDB 2R0QC 5KPDA 2JLSA 5F3DA 1IWOA 1ODKA 1TTHA 3OTGA 1EEHA 3ZI4A 4WH0A 3K5PA 4JB0A 3QXGA 5E6UB 3PKIA 3RSFA 4XPIA 3ZJYA 4AJ9A 5JNRA 2XIQA 3HO1A 2ZVJA 4PGHA 2NVUB 5LIRA 1Q7CA 3E18A 3FAKA 1WD7A 2E89A 5IKOA 5EJ2A 4O0LA 2Q62A 1FJXA 1V41E 4ITUA 1NYTA 1J97A 1SGWA 1X77A 5ENDA 3EW7A 4M46A 1NXVA 3WL6A 3OCWA 3G59A 3BBPA 3TMKA 1ZJ4A 3W7AA 3RIHA 1J06A 1DWQA 1OFIA 1JQ3A 1HDOA 2EZTA 1Z6AA 1EFAA 3U37A 1ICEA 1NRXA 3SE7A 3ML1A 1YJCA 1Z7WA 2ODAA 3MB5A 3S2EA 5KJCA 3HA5A 3NYIA 2FCRA 3DOFA 5D3MA 4MIKA 5FT9A 1I9CA 2H00A 4K5QA 4QECA 2IC5A 4Z4IA 4JYCA 1LRLA 2JNWA 2GCOB 2X0JA 4KQEA 2BCEA 2JGEA 2ZWOA 3HJHA 1ZGHA 2YIDA 2YNMD 4ES6A 3T4XA 2Y67A 3NO4A 3E5RA 1MJGM 4WCFA 5IBQA 3DEIA 1RXUA 1VPDA 5A06A 2WDZA 4S04A 3F78A 2J6IA 4I5EA 2AW3A 4B43A 4UBMA 1HE8B 1QO9A 3GEGA 5B7QA 3FYHA 2QBYA 2XRMA 5EPEA 3FIJA 2CLHB 4NE9A 3V00A 3ET5A 3HVHA 1SB8A 1UBMS 2HMYB 5AUNB 5KTMA 3D8SA 4IIBA 5BNFA 3HXLA 3PQ7A 1ZMXA 3ULKA 1FFBA 1JJVA 4MWZA 4JP2A 2GAAA 2XB9A 1O8CA 1G7TA 3EFOA 4NNJA 3L0BA 4QODA 1W6UA 2NVWA 2Q6LA 2Z56A 1FVHA 4QO8A 3CJRA 3UB2A 3V8QA 4WBNA 3FFBA 4B8WA 1GPAA 1HH4A 1SVUA 1N8SA 4UAVA 2BGRA 3A1TA 4O4JA 2IYXA 1MNQA 1SN7A 3TGLA 1YKGA 4RHFA 2OLEA 3X1WA 4OLJA 1CJUC 4HJXA 3I01A 1U2SA 4BJ5A 2WFAA 3BEDA 1CR1A 3DQZA 3NAQA 3PIRA 3ZOZA 2B78A 3UJ6A 2RH8A 5A4MS 3EUWA 3C43A 1BX0A 3W1VA 3ER8A 3LM8A 4OJKA 1JB9A 3W1EA 3SZ3A 4LIPD 1Y1PA 3OEWA 2R3SA 2OXFA 2XUGA 1ZN9A 3EAQA 3P1JA