2FWJA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium acetobacter aceti, complexed with air (5-aminoimidazole ribonucleotide)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
total genus 51
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fwjA00
2FW1A 2H31A 5C5DA 1D7AA 2FWAA 2ATEA 5BORA 2NSHA 3RGGA 4B4KA 5CLIA 3ORSA 2FW8A 5CLGA 5BOSB 2FWJA 2FWIA 2NSLA 2FWPA 4JA0A 1QCZA 2FW6A 4GRDA 4YCJA 3OPQA 4ZK2A 4AY3A 1XMPA 5CLHA 5BOSA 1U11A 4ZMBA 5CLFA 3LP6A 2FWBA 4YCDA 3KUUA 2YWXA 2NSJA 4YCCA 5CLJA 1O4VA 2FW9A 3RG8A 4Z7JA 4ZC8A 5CTJA 5CVTA 3TRHA 2FW7A 4ZJYA 4YCBA 4AY4A 3OOWA
chains in the Genus database with same CATH superfamily
2ZI9A 4OA5A 2QRLA 3SDBA 1I6LA 1RKBA 2NT4A 2VP3A 4IDDA 3UJ6A 5IEJA 1J2TA 5A03A 1RDFA 5H9VA 3CWZA 2ZYAA 1UKAA 3RT9A 4BB0A 2GRAA 1QYRA 1UBUS 4RQBA 3HKCA 5DK6A 5EWJB 3FXAA 1XZEA 3ANNA 4L4UA 1EK1A 2PKCA 3N3BC 3ESYA 3QJGA 3L92A 3R1IA 1VLMA 4Z54A 1KO8A 1KVQA 3EHDA 2IZOA 5A7FA 5HUJA 4FNGA 4X9XA 1TI7A 3GJQA 1LLDA 4YFYA 2CXTA 3FYTA 4EY7A 3KTAA 3UHAA 3VZDA 4I5GA 5K09A 4US1R 1ECCA 1NYTA 2R7NA 1HEIA 1ADGA 3NKFA 1RYEA 1DX6A 5CNIA 1EZ4A 4BFXA 2OBBA 1MC5A 3G8DA 2RE8A 1LBTA 1Q20A 1K6EA 2VK1A 4B3XA 2J9RA 3CVJA 3F46A 4XASA 1O97D 2NV0A 3RSCA 3VR4H 5LOVA 1Z17A 3Q9NA 4WZBA 4RA9B 1P91A 3CH5A 3ITEA 1Z75A 3JQAA 1IVSA 2TMYA 1FYXA 1NR1A 3I8OA 1OFUX 4OU5A 2W6IA 3ANXA 3HKEB 2NYRA 2V58A 1AK9A 2P6MA 1IRXA 3HY4A 3FCOA 1E1RA 2ZUUA 3R77A 1GRQA 4DLWA 2HC9A 3AUAA 4WUVA 1J0DA 1D2NA 2EU8A 1ISGA 1NBEA 1EQAA 1PW5A 5FR1A 3DHNA 5UKDA 3CLRD 1ZMBA 2I22A 3MRVA 5CD9A 4AP9A 4I8IA 4D41A 4EA7A 3KB8A 3OZSA 1E2NA 1YQ9A 6CHYA 3AVXA 2EDCA 1EM6A 1RXUA 1S9HA 1VMIA 3E70C 3ZH9B 1A8IA 3ZDCA 1U7WA 2H8KA 3AESB 3WSTA 1NNEA 4Z4CA 2R66A 1JEYB 4FHGA 3WDLA 1CUGA 1IOVA 2NU9A 1PR0A 3Q0IA 3MJTA 3IA2A 4KV9A 2J07A 1II0A 1QQ7A 2PBZA 3FJ1A 4L4SA 5ICSA 1ZVVA 3CN9A 3V4ZA 3I09A 1G9TA 4UULA 1WQ3A 1G8PA 4AROA 1KFJB 5EP4A 1XD9A 1XLTA 3E9DA 1GL3A 3H13A 3HR4A 1IEQA 2XTAA 3GCGA 1P0IA 2PT6A 5H7XA 5I47A 2DETA 1H8ED 1G8FA 5GIOE 3M83A 4RA9A 3EE6A 3UOWA 1F4LA 4PU0A 4IJUA 5KTTA 1IDN1 3HEBA 1UJ5A 3BFVA 4B6RA 3I0MA 4K3VA 3TCXB 2AK3A 3MWEA 3SC6A 2ZB2A 3OU7A 5HQ3B 4E0BA 1IHDA 5H3HA 3H2ZA 2JIDA 2W8BA 3SOPA 4GFDA 1NXVA 1WPQA 1YR1A 3TQTA 1BAPA 2GF2A 2HA0A 1EDOA 4WX2B 1SNYA 5D51S 3WMGA 2EERA 5JLJA 4L78A 5MDHA 4NFSA 5TC4A 3D59A 5FOTA 4MWDA 4D3FA 2PUDA 4I50F 1X7GA 4J0QA 1KS9A 4AS1A 3GAMA 5B12A 5EIBD 5KQPA 2TSYB 2WWTA 1DOZA 2QPLA 5LA6F 2RCYA 1O94C 2HMTA 4NNOA 5IXYA 1VB5A 4RPKA 1W2WB 2HSEA 4CDNA 3GFGA 4TQUS 1M6VA 1NW4A 2QN6A 4YI5A 2EZUA 4ZD6A 3RTGA 5AI9A 3SZ3A 5AJZA 1Y3CE 5DLPA 2O8FB 5ICEA 3CZQA 1Z5ZA 4FZVA 5IAOA 2VATA 4D9BA 4D82A 1G291 4BGUA 4OIMA 2PWPA 1S2IA 1VE6A 2VDKB 4FCTA 4MO9A 3CISA 3FOEC 5EPOA 1PYGA 5EY5B 4FKMA 1T5IA 1CZOA 1KZ7B 1RHMA 3R3VA 4PICA 1FLVA 4EHIA 5CCBA 1C4OA 3RHFA 1DX9A 4QOJA 2IPNA 2J9FB 4FIDA 4JC0A 4AN0A 2Q4OA 2D5LA 4O2AB 5LNK6 5C51B 3IUPA 1DLJA 4M46A 4QGBA 4ML3A 1B0UA 5AO9A 1H9CA 2AXPA 1KYZA 1L4NA 3WB9A 4HNSA 2EGUA 4WVFA 4YRNA 4DQDA 1VLQA 1TAUA 5A0VA 1JI3A 1NVKA 3H5LA 1OB2A 3S44A 4FGWA 4P3PA 2C1ZA 4ZHQF 4IH4A 2D00A 2HX1A 4YC7A 1NVWQ 1DO8A 4YXWA 2VWGA 1UBGA 4X1YB 3OVMA 1PZGA 1YI1A 3QYAA 2HKIA 2RHRA 1KYTA 2X58A 3H1TA 3OLWA 3ZI0A 2CK3A 4DCNA 1UIMA 3FOFC 2I91A 5AK6A 1XELA 1XA0A 1N6HA 5GJWC 4YV2A 1A5ZA 3KZXA 4EJMA 1ZPDA 4XEHA 5FORA 3ED1A 3UANA 4ESEA 1U1DA 1Z5OA 3EH1A 2XXBA 3JS5A 4RMNA 4UJ3A 5F7XA 1JF8A 5JARA 3KLNA 2UYCA 1FFGA 4PX5A 4OF4A 1JMYA 4ZT5A 2VK8A 5JCPA 3HVUA 3ESCA 4K1XA 1J2EA 1UP6A 4O5AA 5HTOA 2HJVA 2C5HA 1I0ZA 1XNQB 3KFXA 5DM0A 5ED4A 1ZD9A 2PCJA 4ICIA 4RPCA 1IWBB 4G8DA 2GEVA 4MUFA 4MCAA 2DHCA 5T41A 1SZJG 5G0WA 2UYGA 2I4LA 3PNPA 5E6UB 1N78A 3KQLA 4ZYTA 3WLNA 3HDQA 3JQ8B 2NO0A 1EX9A 3GLVA 4J94A 2UUCB 2A1TS 4JJ4A 2FPSA 4YI3A 2RC6A 3AR6A 5TNXA 1PKEA 1DTEA 1E7QA 1EFUA 1CE8A 5EMHA 3FCXA 4D79A 3KVVA 5FO0A 3ZK9A 2CNWD 4H7EA 4JQOA 4FONA 3VR4A 3E9NA 3WRXA 3ILHA 3BT7A 1E3IA 2IGTA 3MS7A 4BP3A 4RF3A 1N2HA 3LCJA 1MMFB 1FL9A 2ORIA 3GRRA 3ZCQA 2O7NA 1SWWA 2R3SA 1U3GA 3EY9A 3IMGA 1SXJE 2TS1A 1YVRA 2YMLA 1VG0B 3AEUA 3BMOB 4IJ5A 1NPTO 4JLMA 2VDJA 1MGPA 3NORA 3FNEA 3PWSA 1UXOA 3WZLA 5B3LA 5CBPB 1V11A 4BU0A 4LQLA 5IFLA 1I4EB 4HDRA 4OK3A 3ZKAA 1QH8A 4BFYA 1ISHA 4TRRA 3UHOA 4ZDKA 2JDIA 3BORA 1EK0A 1I6KA 2HJRA 1EFDN 1J0BA 1JP7A 2OHVA 1PKXA 5F73A 1K97A 3TMKA 1IEWA 1OIWA 4BZZA 4JYBA 1MX5A 2K87A 5C4IA 3PDIA 1Q7TA 5ESRA 5T5QA 4NYJQ 1UK9A 2CSXA 3LKBA 4B48A 3GYGA 4YJDA 5DH9A 5JSYA 4AURA 2DWUA 3KQTA 5EXPA 4ZTBA 5EXDA 1ZNWA 5K6RA 2C7PA 1LSSA 1RXCA 1XZDA 5KHLB 3T6KA 1JB1A 2OGUA 4GOXA 1DAKA 1FDVA 4IIHA 2ODQA 1XCMA 2HAEA 2YJZA 5G0TA 3TTSA 1DGQA 3CE6A 2OM2A 2P6NA 2ZSUA 3G8CA 1AURA 1B93A 1GGKA 4I9FA 4ZQEA 4FGKA 4P4NA 4ER6A 3GDGA 4UTPA 5GTDA 1EFHA 4Z4QA 3H2JA 2JJMA 5HJ5A 4BV3A 2H9YA 2VL7A 2WM8A 4QNMA 3V42A 4KXFB 4BN4A 2UUAB 5AVKA 5EQTA 5HZMA 1PAUA 2XQVA 4RX1A 1G5PA 2OQIA 4Y1RB 2IBSA 1GQYA 1VCNA 2ERCA 1D9XA 2LDBA 2GA8A 4UQPA 1FXSA 1PWHA 1TK2A 2IXFA 3FWHA 1Y4SA 4M3NA 2OQVA 3VJLA 2JKVA 1E58A 4PG6A 5A3VA 4R1MA 2WJYA 4CW7A 5BN1A 5AK3A 1RD4A 1PEYA 4HAIA 5BV0A 1KH2A 5LBIA 1HFWA 3SZOA 3G9UA 4FIZA 2VDWA 4TMZA 2Z8YA 4Q7EA 2YXDA 1WLYA 2JH3A 1ECGA 4OK6A 4C4PA 5JXHA 1EPUA 3PDCA 1V5WA 1T8YA 2XXJA 4DDMA 5KOJA 5KTNA 4NQZA 3LW8A 3WSWA 1V6CA 2JIZD 1YS4A 4UKDA 5GY7A 3NQ41 4DLUA 2V7UA 4D3XA 3O3MB 3BAFA 3R5XA 4IGFA 5FOSA 2JGJA 2YINC 2DCUA 2P3LA 1NBWB 1XDBA 2FUKA 2QLJA 3HDVA 1U02A 1L4YA 1V4VA 2ZRCA 2O0LA 3CA8A 3JV7A 4IDNA 1C7FA 4KTVE 4BJ6A 2LW7A 4DHWA 3ACDA 2E18A 4PFQA 3W4JA 4UTRA 2A30A 3GLIA 3NC0C 2OILA 4LZAA 4HN9A 2O7SA 4JVMA 2XGGA 4N5DA 4NNJA 4V0SA 3UUEA 1P31A 2HTFA 4FQ5A 4ZI3A 1BWQA 3HKBA 2O8EB 3DDUA 4JBXA 1EDEA 4RA6B 3HFRA 3O0TA 2QBYB 1G4AE 3QQ5A 3DDOA 2C9YA 1AZWA 2HQOA 1RWPA 5L45A 3SE0A 1V1MB 2FYTA 3CPHA 1ORTA 4M86A 5EUBA 2JRLA 4L0DA 4LYGA 3QXSA 4NHEA 5C3UA 2AQ8A 2A0YA 5JZMA 4DN6A 4KIGA 1J39A 4N5LA 1JJ7A 2IXAA 3I0NA 4JOSA 2ZE8A 2QJTA 1VSUA 3TZKA 4ZO9A 4JBWA 2K5UA 3JZIA 5LVAA 3E58A 4XWWA 3AR5A 4M37A 4EY5A 1X15A 2QGZA 4H0CA 1ZVQA 4FSDA 3B78A 1RXVA 3L84A 1J7JA 1VRWA 1XQ6A 3CLVA 3KSMA 1H5NA 3LTEA 3SNKA 1FZQA 2X40A 4NCAA 5FPHA 1A4IA 2C57A 2EGGA 2HLHA 3PT9A 4PZPA 1VL6A 2PX5A 3CRVA 4GGPA 1WS6A 3SR3A 3HK2A 4IO0A 1WKCA 3O3OB 5GQSA 3ZWDA 4BECA 3KXLA 3K9BA 3ZWWA 4DYHA 2R25B 4K40A 3JXEA 4N48A 1L4KA 4WE3A 3HJHA 1CY2A 3SVLA 4D9KA 3URMA 2WF6A 3GBVA 1F0NA 1U0SY 3PUIA 2C3PA 1MIOA 1ZNYA 3GPIA 4JJKA 3SHFA 4P38A 1DXYA 1SKYB 4CG3A 5GP1A 1IXZA 3H1PA 4DMFA 2BM1A 1FX0B 3BD8A 4LJYA 1BN6A 1F6BA 4TSFD 4X7PA 5FL7D 1BW9A 5DXJA 5TPZD 3ZX4A 3OIVA 5A4IS 5JQGF 2IUUA 2PKEA 2B5VA 2QRJA 4Q3EA 4C29A 3V7YA 2JHGA 3L6RA 2QGFA 1CUFA 3C8HA 3S2IA 4FFNA 3UYLA 2JFXA 3DAFA 4DLZA 1IOWA 2BTEA 2XRFA 3GEBA 4B4DA 4QPPA 1ODKA 5DBFA 4OHUA 5EIOA 2PS3A 4KIJA 3KQWA 4RORA 3DVAA 5AVTA 5IUKC 4A82A 1FFWA 5K9ZA 1UBOS 1RXIA 5KYUA 2BF7A 3AOGA 2NAFA 3LRPA 1P1IA 2QRGA 2X1LA 3IAS6 3L8YA 4U9UA 5HA5A 2BHRA 4NYMR 2XKAA 1K9SA 5ULLA 5JS1A 4Q3CA 3ETJA 3FMVA 4TYMA 1I1HA 5FP0A 5U9CA 1D2MA 4GLJA 3EVAA 3WBBA 5IVKA 1LLCA 1OPXA 4INPA 3DEKA 3L8HA 1JYSA 3MRSA 3N5KA 1R8QA 2ZIUB 3D7KA 4HWPA 4W8HA 1PGQA 1VLLA 3ZWBA 4PQYA 3RAGA 3AHCA 3WP1B 1GPAA 1T8UA 1VL0A 5F23A 1U0OC 1V8DA 2JI6A 5CDYA 1KJJA 2FF5A 3B48A 2EKPA 5I7FA 1JKIA 2OGSA 3WDMA 5CM8B 1WD5A 1SVNA 5F3RA 2PZEA 3SBOA 2FN7A 3QXGA 2X41A 3ZQKA 4BUZA 4J91A 2H4ZA 4Q9IA 3AF6A 1VA4A 3EPJA 4OI0A 1T29A 4XUEA 1FP6A 1YD7A 3UKJA 2OPHA 4WEOA 1E9BA 1CETA 1E9EA 3A4YA 1JFVA 3A9CA 2ZBDA 3HQ4O 3FDIA 5L4LA 1P2VA 1TEXA 3ESXA 4KQMA 4RPLA 1KSFX 1PDOA 2QNBA 2VBIA 3SS9X 4ASUD 5C5DA 3ITKA 4ABTA 4RESA 4Z4EA 3A8TA 4KI7A 5CIQA 1CUWA 3KKEA 4GR4A 2ZJYA 3JYHA 5MFPA 2JLCA 3DHYA 2AG1A 5IUNC 3GCZA 1B2RA 1UMCA 2Q3JA 1V3TA 1AKRA 3KE8A 4W7HA 3LCVB 5JNUA 1NP6A 3P9KA 4G25A 5IN4A 2V54A 3LPCA 2NTEA 3D4IA 1XN1A 2C2XA 4R9VA 4BLRA 4BMYA 4JUAA 5A2QA 1HURA 1O6BA 3HWX1 1Q3HA 4W9NA 3X43A 1E2FA 1M5RA 1IVNA 2NAPA 4IOLA 5FA5A 1T5SA 4DA9A 3EDCA 3HLKA 1BMTA 1FUKA 3BZWA 3CR7A 4BQNA 1QP4A 4TVOA 4DQLA 1P80A 2PPVA 4JENA 2HPZA 4OHFA 3RQIA 3S1LA 4DXDA 3DZFA 4ZAVA 1VHQA 4MIKA 1SU4A 4AK9A 5IXSA 4YRQA 1V9SA 5KVAA 3A9WA 3HVIA 3PQCA 4A5SA 4UVEA 3TMYA 1NONA 2XCLA 2BTQA 2ZUBA 5DN6A 2GCIA 1L8LA 4YYZA 3U40A 3VO8A 4EI8A 1P7YA 3EX7C 5BYKA 4TZKA 5ICFA 1NRIA 4BFCA 1MFPA 3DPUA 3QEMB 1EDZA 1O77A 1HG0A 2IYVA 3WL6A 1U65A 2JEOA 2RBGA 4A8PA 1E7WA 2D4AA 3CMCO 5AVJA 1TF7A 2IYUA 1W6UA 2ZUVA 3FY4A 2PUBA 3H6GA 4E07A 3AQIA 1A8UA 4LJ6A 5K3AA 1QFYA 4P82A 4QXAA 3M4XA 4BNZA 2FEAA 3RARA 4D3ZA 3KOZA 1EWKA 1Z34A 4H4EA 3TIGA 4ARUA 5DCYA 3I6MA 1KDTA 5KKNB 3QMVA 1Q7CA 4KPUB 1EJ0A 3M6UA 4IOKA 5IMBA 5BRAA 2E4AA 4FW9A 4DNOA 3NR2A 4C20A 3C1TA 4KFCA 4EFNA 2HEGA 2P9TA 3FPLA 2QXUA 5P8WA 2ZYUX 5I48A 3JQQA 4YVFA 1TT5B 3SKVA 2FPXA 4UVHA 3I9NA 1X1EA 4PYNA 1K5PA 1XD2A 2XIJA 3IR6A 2NTVA 2JAPA 2PGDA 4OP1A 4WFJA 3H11A 1WVIA 4I14A 1WMFA 2HY7A 4CLHA 3WK5A 2HMWA 4MQ6A 3W7AA 2D59A 1M6WA 4RMGA 3E3MA 4PTYA 3UXYA 1BMQA 1NQ5A 3KZKA 4LHVA 1YC2A 4PINA 3NWBA 5JBQA 1R5NA 3D3KA 4YJFA 4CWAA 2CXRA 1JAZA 1OFUA 3WSVA 4BCCA 4RKFA 5KKCA 2J09A 5LQNA 4W6QA 3IX7A 4LJAA 4D4LA 3IDSA 4X0EA 4TYYA 5C5IA 3VJRA 4X91A 3K6SB 5ALYA 4BATA 5KWJA 3MMPA 3V7UA 4IF6A 5CPBA 5HSGA 4BZPA 1RKXA 1ZBQA 1SELA 2EIXA 2XUJA 2CFOA 3C43A 4LYAA 1W5AA 1XV5A 1Z4JA 5ALSA 2FMTA 4K6KA 2WHXA 4YFVA 1M2NA 5JNRA 4EL5A 4F4FA 4B82A 2V7QD 1E2EA 2GPNA 2QYHA 3WTCA 1UK7A 2QTWB 4XYLA 1PE0A 1Q84A 3TZ6A 1IBKB 2O48X 3VSDA 4CM9A 1Z3CA 1TU4A 4LDJA 2H4JA 4HWSA 1COWA 2CJFA 2ONJA 3W6PA 4WZAB 2J4DA 4J16A 2AJLI 2D3TA 4EMBA 4CFSA 2Q5FA 4DYDA 3NPMA 1LI7A 1N0IA 4F56A 4EJFA 1XRNA 2B92A 1IB0A 1P2UA 2DZDA 2QN9A 3C7TA 2IQIA 2HPVA 3FHOA 1HGXA 2HPAA 3IAFA 3NW9A 2DKFA 3GLSA 1NXQA 1ZCZA 3DNFA 4HV4A 4HPXB 4P0TA 3WJ7A 8ADHA 3AKZA 2PSHA 1YRBA 3ESBA 4MQEA 1OH7A 2DPYA 1P60A 4UCQA 3G85A 3CYFA 1LTQA 4B43A 1IWPB 2OG2A 2BL4A 1IVYA 1LU9A 4IKEA 4JAVC 4BRWA 4DGQA 3MGAA 3GH3A 1RQXA 4LGCA 1R0LA 2Q50A 3CHYA 4W5NA 2IY9A 2FDXA 2WA1A 1B3BA 4MWOA 1YA4A 3TPCA 4KRYA 1K6MA 3CE9A 2P2SA 1K68A 2FPIA 2HZBA 4AMBA 5JDCC 5KX5F 5IDXA 3RV3A 1QQ6A 1E96A 3CF0A 3CLRC 3I5XA 1KBOA 1P9OA 3HNRA 5AK5A 3RFUA 1RRKA 3OHMA 1RWKA 3P9QA 1P8JA 2WVAA 3WAKA 1G7TA 5ICGA 2E85A 1SCBA 1TGVA 1YZ3A 2V59A 3MFQA 3QPAA 4JBHA 4TL8A 4WJLA 2HK6A 3D6AA 3VR1A 1KEZA 1A2QA 3RNOA 1P3DA 4O4HA 4I9GA 5AKYA 4CMEC 1RLTA 1AMOA 1XU7A 3R0IA 4BO9A 3IKLA 5CVDA 5DXAA 4MWGA 3ZDBA 2C8JA 1OXXK 1WB5A 2E55A 3K6KA 1I7DA 4O4IA 5DKFA 1V4BA 2HA4A 3KAPA 2VHCA 3UVEA 3GDOA 3WLMA 1PQUA 1DBWA 1Z5WA 1JPNA 4JUCA 2NUPB 4F3YA 5LJLA 2P40A 1NE2A 2E5FA 1M2KA 1RWQA 3IB3A 4L0CA 2F67A 3B1WA 4Q7JB 4X65B 3R4VA 1BS1A 1EJ2A 3U7RA 1OE0A 2RDMA 2VEOA 4HGYA 2I1WA 1XRPA 2PD4A 4RFSA 4RSRA 5H4HA 3OPXA 1UC9A 4MUHA 3TR6A 3OOJA 3I62A 1Y8CA 1B16A 3DEJA 5A05A 2ZTHA 3ZCUA 1Y5NA 1RSZA 2H92A 3RPEA 4R01A 3ROEA 5GINE 3Q40A 4S1PA 2Q1SA 5IARA 2GQ0A 5E1MA 1V16B 1M67A 3O2QB 1IOLA 4HB4A 1K7CA 4D4KA 1MO4A 3IDQA 4KV7A 2FSFA 2Q62A 2W2LA 5CM2Z 3PE6A 4HQNA 3GLHB 1VI6A 1CUEA 2C8VA 2ZETA 3TDNA 4G0UA 1FTQA 3A0UA 1U9CA 2VJLA 5KHAA 1HDXA 5FUBA 1KIAA 1ZXLA 2H1HA 2YMPA 1AS3A 1W76A 4KO8A 3RVJA 1RPZA 1HV8A 4JXKA 4QYSA 5J5AA 1VJ0A 3AJAA 3SICE 4DRXB 1VE5A 3BFXA 2ATVA 3MWDA 1SXPA 1ACMA 4DPKA 4A16A 1AQNA 4ZCLA 4AQ7A 4D4JA 5JTUA 1C9KA 1Q19A 3FF1A 2C07A 1SZDA 3UNXA 1FQJA 4JU8A 2PD6A 4QEKA 1G9SA 5I9NA 5C32A 1DINA 1OC4A 1KJWA 4YCAA 4DV4B 3DUFB 1G55A 2M9MA 4JKIA 2ZJFA 2WJVA 1YZLA 4P7FA 2WD7B 4LE0A 5FYDA 2WMOB 5KU1A 3BF8A 1KMHB 1ZCAA 3BE5A 4E6EA 2FWIA 2GAOA 4YUXA 4C87A 1LDYA 1KR5A 1Q83A 1GEEA 4MVYA 3KOXA 5BYBA 4P0PB 3OCCA 1CB0A 2FPOA 4G0YA 4MVJH 4WXYB 1KYIA 2R8BA 4KKVA 3TQSA 1ZL2A 1DKPA 1XRRA 3P2KA 4YCCA 2UZAA 4GLBA 1JDVA 2AC7A 2WWHA 1EP9A 2O8CA 2RJOA 5ADVA 5EXXA 1RXEA 1YS7A 2C42A 2OCXA 3G7UA 4EENA 4EMSA 4RCYA 2ZYHA 1UBCA 3LD9A 1U4NA 3U4AA 5KOYA 5LCXA 5HEKA 1LZLA 1PZHA 2JIRA 2ZBGA 1A7JA 1CS4C 4C0KA 5DXFA 4FQ8A 4R31A 2ANBA 2AK2A 1DNPA 4DMGA 2EFHB 2W2PA 3TOCA 5JS7A 4UAJA 4NZZA 3GGOA 1G3UA 4NQRA 5FTWA 3FBWA 3RSSA 5CB4B 5LP6A 2O5EA 1CY4A 1N7GA 1N57A 1QCYA 3AKEA 1GNQA 4AJEA 4HAWA 1ZSNA 1AKWA 1SHJA 1U8EA 4Y9RA 4ZHSA 1KA9H 3G9XA 3AFOA 2CC2A 3G88A 3MJ4A 3ZOKA 2PUGA 1MVOA 1BGWA 2G5GX 5BT8A 4H7JA 4CGZA 3JQAB 1PQ4A 3IXQA 1GL6A 4J75A 2BDTA 2FEXA 3GCDA 4NMLA 2ZJAA 1EM8B 1NNUA 2EOAA 2H5JA 3LQ1A 3LUFA 2UDPA 5F1KA 4KMMA 4O4LB 4Z4GA 4LY0A 3SI7A 2C7OA 2JCSA 1WCIB 1GKUB 4ETWA 4GWGA 4FD3A 3GYBA 4Q93A 4HUJA 3A37A 3T3NA 3DMRA 4D81A 1W581 2I03A 1SN7A 4PSUA 4X1YA 4B32A 1SUDA 4ALMA 2VP2A 3AF2A 3AUXA 4GYJA 5BQXA 5ICMA 3MPOA 2A5FA 2G82A 1S1MA 2FEPA 1XNGA 3EDMA 2EJBA 1USGA 4ZHQB 1EXDA 1AUXA 2HCFA 3HYLA 3LWDA 4KRXA 4MOWA 3DYVA 4MS1B 3W2FA 3S2UA 3NDIA 4L3OA 3KQQA 3AVWA 4V0RA 2QTCA 3KKLA 4NYMQ 3RS9A 3ZGVA 5AXBA 1CHDA 3OQ1A 4J2HA 1F3LA 3VYRB 2NU9B 3G2LA 3FLEA 3N2ZB 1LY1A 3LLUA 2LTAA 1ESNA 3LK7A 3M1LA 3LGAA 3IPCA 2DHEA 2WHRA 4RVHA 4MV9A 2A9KA 3UAOA 2V6JA 1DTWA 1WXEA 3UEOA 1XG5A 4FN4A 2I3GA 2IOYA 4AAYA 2Y3IA 5KINB 3HKDA 3OQVA 2LCQA 3S68A 1Y4AE 1GKLA 1JJAA 1YVDA 3JQ7B 3BJEA 1H2RS 2VYCA 5TPWB 3FZGA 3QMPA 5KJEA 1HPLA 2XUPA 1ODLA 5LD2C 1QFMA 1LGYA 1LVHA 3K2QA 4U3JB 4Q05A 3K9GA 4Z49A 3F73A 3K3PA 2DFDA 3NFRA 3NWPA 4BGVA 4G5RA 2G8NA 2ZIXA 2O8BB 3V8EA 1DB3A 1GRCA 4M9CA 3KL4A 3MTDA 2PH7A 2J45A 3DBLB 4ON9A 1NURA 4K3UA 1U4SA 2AMLA 1TO1E 4V1CB 2V6IA 5I3CA 1FMFA 2FOLA 4ZEXA 3FNQA 4D0RA 3H16A 4YJKA 1KWKA 5J23A 2GN1A 3GFOA 1GPDG 1RNLA 4U39A 1E32A 3DLPX 1GZ5A 4ZV4A 2D13A 1N8KA 5AI8A 4K88A 1HQYE 3GRPA 4BNTA 2OFXA 4ZJUA 3SEAA 1OT5A 1HOXA 3BXXA 4KX3A 1ZUNB 3BSWA 4L50A 4LK3A 3RSGA 3IXMA 2V7VA 3D4PA 2QLMA 4G9BA 2J59A 4A8HA 1KRWA 4RPGA 4E6PA 2C2KA 3WKEA 3FVQA 1JKJA 4UDXX 1E4OA 2LBPA 1KY3A 1P0CA 2JI9A 2O2JA 4JH0A 1R8SA 4NFYA 2JAXA 4V2IA 3F7OA 1FCJA 1R0KA 3W3AA 2X8WA 3JQPA 5TEVA 4A3SA 1E4VA 3ZU2A 5ERGB 2JAUA 1AO0A 1FXUA 1TJNA 3UTCA 4HH0A 1CEEA 2CDCA 1BDMA 1BU8A 3GRYA 2VQ6A 2XGOA 5IDVA 3KJNA 4N1AA 1AKEA 1XSEA 4WJKB 2FW8A 2VHVA 3RV4A 4Q37A 1V16A 3DB2A 4B9EA 4HKTA 3F2VA 2NO6A 2XXAA 3LKDA 4LA4A 1JDSA 2GAJA 3NOOA 5CX1B 4D0SA 1ZKDA 1UKCA 1OAOC 4JJZA 3O4VA 4GM4A 4PZ0A 2YQ5A 3DAYA 5CFPA 4F8YA 3ISJA 1KJIA 4QRHA 2C82A 4LDQA 1AU9A 2ZYVX 3CUVA 3AB3A 3CKMA 2P9EA 2YHUA 4DAEA 4OHKA 2YWFA 3L40A 3BD9A 4NU5A 3TLYA 3MCZA 4C9BA 3CVVA 4D9IA 4WV3A 1T91A 4OQXA 1MGOA 1PWYE 4ZAZA 3RU2A 1CQXA 4O4JA 4RKYA 2O6LA 5FL3A 3DEIA 2QE7D 3ZWQA 1QYCA 4D9NA 4L76A 1X13A 2DT5A 1QOZA 2SECE 2W6QA 3L4KA 3IOYA 4Q4HA 3F2IA 2ZWAA 1ZISA 5JWRA 1XZMA 1T8PA 5B7PA 4QHYA 2A57A 5FULA 1ORWA 4ZKDA 3OBIA 3KBBA 2YZ7A 2HRDA 1J1IA 4V3BA 4DWWA 4HDKB 4JJEA 1DPFA 4MV5A 5DYYA 2QSYA 1NLMA 3JQBC 3TLZA 4WCFC 1L5MA 2PXAA 4XGNA 4MR7B 4NJEB 5C7YA 1SVKA 1JQAA 3T54A 5BPFA 3K1JA 3IVCA 4KN8A 4K9KA 4K05A 4LCEA 3R7AA 3SSMA 2HDWA 3I2YX 4DANA 1L2TA 4E33A 4ENUA 5E6RB 4RM2A 4TQAA 1J23A 1TLTA 4YMTA 2QQEA 3TAXA 4DA6A 1H1LB 4GXQA 3ZDAA 1F20A 1ZRNA 2CVHA 2I2XB 4LWPA 4XJSA 5E2BA 1V3UA 5F2KA 3F5SA 4YK7A 4JLJA 2ATIA 3HJCA 3LBYA 1ZHHA 4GBMA 1V7CA 2I6SA 4H1UA 4H7IA 1DBRA 2EZ4A 3RYFB 4KG7A 1GGEA 2J7KA 3OWOA 3U81A 4H15A 2GNOA 4TMXA 3E3AA 3DZ8A 1PSWA 3OZEA 4M88A 1HSZA 3QHPA 1XN4A 1N2CA 4UDYX 4F60A 3BMNA 3OX3A 2GZ2A 3E9ZA 1FY2A 3ZDQA 3SIPA 1I9CA 4C7JA 5AVUA 3OMLA 4OSPA 4ZI7F 1R0CA 1NOJA 3EF3A 3K0KA 2MSCB 3IPRA 1W59A 2WFLA 1T9DA 2AZMA 2IHKA 3LXRA 3NO4A 4TKUB 2K2QB 4RXUA 2GJKA 4QTYA 4PYMA 7ABPA 5A3RA 1BX3A 5BY2A 1T3SA 4OHRA 1U3WA 3WGLA 1RMQA 3JQGB 4KWCA 3B1JA 4B45A 4FMDF 3MTJA 1RYNA 4WCFB 3LL4A 2AR9A 4JU9A 5T8KC 1OJLA 2DF8A 10MHA 1A95A 1UFQA 3CLUD 4D2IA 2FI1A 5JNVA 2J46A 1NF2A 3LKZA 4INOA 3C48A 2AFRA 3FLAA 3AVVA 1XL1A 4UD6A 3LH5A 1YKGA 1Y81A 2AE1A 3HVHA 3WGUA 3DW3X 1M2EA 1UOOA 2EKBA 2XOEA 2ZKLA 1D1TA 3X1DA 4BLWA 2PL1A 1NASA 2XY4A 3EA5A 3V34A 3R9WA 3PXBA 2XF2A 4DARA 2MYTA 5C1PA 4BNGA 1VJ1A 4XZ3A 4DCVA 3C97A 4JXZA 2P78A 3HJUA 3O4JA 3P5BA 4C3OB 3RTCA 1F0KA 4P53A 4IFBA 4R5HA 4DCPA 3DBRA 2KB0A 1FBNA 3J80A 2XYGA 1HZJA 4ALKA 5DWVA 4G37A 3FDFA 5LFAA 1UXGA 3HKDB 3HB1A 4DVGA 3K5HA 2JGKA 3VHXB 4MQ4A 1MO6A 4RDXA 1QGOA 5K0SA 2C54A 1SBCA 2J5KA 5C7LO 1ND5A 5FOQA 1YBHA 1ZVMA 4OEHA 5JD3A 1IJKA 1IU9A 1Q74A 2O4UX 2P7HA 3KUKA 3O91A 3JD3A 4OL9A 2VSQA 1IZ0A 4UBJA 2P0EA 4BV8A 1F4PA 4QU5A 1VPVA 2QQGA 4UBKA 2C2ZA 3UZUA 4CV2A 5CHEA 2ZQ5A 4FKZA 4JXJA 3KD2A 1Z62A 3V8MA 4O2BF 3L0IB 1YJAA 1ZUWA 1OJ7A 3QPVA 1SIWA 3OKCA 1N34B 1GQRA 4H77A 4BLUA 2ZAOA 3ABSB 3Q3CA 4QWWA 3IE1A 2NO1A 1TZMA 2BEVB 4R83A 2MINA 5EZYA 3CC8A 4J03A 3H4VA 4MMZB 5DMHA 1VLVA 2AYZA 4I1RA 4ZEWA 4CN8A 2G08A 1NXTA 3DHEA 3EEFA 3GGCA 4E15A 5KWIA 1JEQB 1CCWA 1K8XB 1D7AA 4Z5XA 3RU9A 2QTVB 4YV1A 4RTQA 3P9XA 1YZFA 4H0FA 5LDHA 5CHYA 3VRHA 1JR3A 4HPJB 4IG9A 4AT1A 1DJPA 4HZGA 3H2SA 4A03A 2QP4A 5AVSA 3PQ5A 4HH4A 4UCXA 2NVOA 3PDIB 5T4FA 1D9ZA 4KR3A 1P75A 2EFJA 2V7PA 2X7XA 1Z08A 3GDHA 4QTUB 3U48A 4E46A 1TD9A 3WLIA 3CVXA 3MGGA 3TJRA 1FB5A 3E03A 3CH6A 2YVAA 3PLNA 4RZ3A 3VTFA 2ATCA 1HETA 1LDBA 1MEJA 3GN2A 5EKSA 3LPLA 4ZQCB 5FO1A 5IK2A 1BE6A 3FOCA 2NPFA 4AZ3A 4KO2S 1QH0A 3L6BA 4YAOA 5CNMA 4K9NA 3WXBA 2JGIA 3MXOA 1BVRA 2P68A 1V48A 1BCRA 1P61B 4QICA 4EYKA 5B1YA 4EHLA 2V03A 4PIPA 3WYDA 1E2DA 2XNJA 5EJ5A 5KTKA 4FDVA 4R98A 3WS7A 3ICPA 3L07A 3RGGA 3DJFA 5KX5B 3GRCA 4WXMA 5EZSA 4MEJA 4NWIA 3PB3A 4NBNA 1G5FA 1F1JA 2SCUA 2Q9BA 1RYHA 3GCXA 3NUZA 4QYWA 2ZAIA 1B4DA 1GXSB 3ZE7A 3HI6A 1X1QA 1AA9A 5EMNA 1DBIA 4O5OA 1VP9A 1O2DA 2BGMA 4V3CA 3Q5DA 5DSTA 1RI4A 1HFJA 4BBAA 3O3NB 4TXLA 1G21A 3FTNA 5EPUA 5CEFA 5BPHA 1U5BA 1SD2A 3K0AA 4IEIA 3SC2B 2B9EA 4HS9A 1DJMA 2J3QA 4OKSA 3N70A 1LSJA 2I4MA 3PF9A 2HCTA 1QKJA 3EQ9A 1U31A 4K28A 4QTTB 2GESA 1HMPA 1HYBA 3C45A 1BXZA 4TUYB 6AT1A 4KAAA 1H23A 2HF7A 3PJEA 4MHTA 1CR2A 2VF2A 2OV3A 3NHRA 1XMOB 4A36A 3KAQA 4TV9A 5BV1A 2H0RA 3RUCA 1JDNA 2V5VA 1RKUA 5KYUB 4U2DA 3WO1A 3UW1A 4J2OA 3V46A 3ZNQA 1N9GA 4CKWA 3IUQA 1G8MA 5KS2A 4QM6A 1ODSA 3LCCA 3FM9A 4JP1A 1K7SN 4B6EA 3UT6A 4GPBA 5BWMA 2ZR9A 5AK0A 4MB2A 4AO7A 5JXJA 5A04A 1UP4A 4MWEA 3FNGA 1YCFA 3OE7D 3TNYA 5AUNB 3MW8A 4G5QA 1M34A 2X5NA 5B4UA 5JJLA 5CLLA 3TX6A 4QNNA 2JJ1A 4GLFA 5ITSA 4YAEA 4PGMA 4Q3OA 4DC9A 3KKMA 1BMDA 4YJFB 2EW8A 1C3EA 1PNVA 4DNQA 4Y1FA 2I71A 2F3PA 3VR5A 1E8MA 2FK7A 4JR0A 3NWJA 1FDWA 5BSEA 1U0EA 4BLQA 4XQGA 1P8AA 3FB1A 1CUIA 2XCIA 2YIMA 3G9ZA 2QU7A 5NULA 3RVPA 3UMRA 2YZGA 3ZCSA 3ZCPA 1KYYA 3HXLA 2WJ6A 4PZCA 1MJ5A 2FP4B 2G9VA 3RBXA 1NL3A 3ESAA 1CLEA 3FRHA 3TR5A 3ZR4B 4UAUA 5K0EA 3AERA 3H8SA 3G0HA 3DZDA 2K4MA 5IDYA 3D4OA 1QGUA 3WTBA 2Z4TA 5CDSA 1ZR2A 1ISRA 4OGKA 1FMCA 2J5XA 3MBIA 4OQ4A 5H3CA 1PT6A 4P9NA 2Y0CA 4NK4A 5E6UA 1WW3A 2RHDA 1NTOA 2WJ4A 1JAHA 5E4YA 4B6OA 2QWXA 1QG4A 3QE2A 2GK4A 2NVBA 2VNJA 4CQLB 4R1OA 4DZZA 4KMSA 3WE7A 5KIAA 1PL8A 3F5DA 2CJPA 2W9XA 5HBRA 3MWFA 2B94A 4KPYA 2XHZA 4C4XA 2XOXA 3FNRA 5L3QB 2O5RA 1UFOA 4LI3X 4DZRA 1G0NA 2JCXA 1RADA 1OY1A 3WY9A 2OMKA 2P91A 3UAWA 4KAJA 3KQNA 3HDHA 3SS7X 1GAEO 1MAUA 2AYXA 2GXSA 1Q0UA 2G1KA 2WTMA 3MMNA 4YMWA 3WWPA 3HN6A 4QREA 1L1EA 1ENPA 4GX0A 4R1PA 3C3PA 1P9LA 4TS1A 2I0FA 1QHHA 1JPVA 1DQRA 4EHNA 3WFIA 3GVIA 3RYTC 1WMAA 5TQJA 1V1RA 2ZRLA 5A3SA 1IY2A 4Q4AB 4WESA 1YQXA 5LB4A 3FF4A 2HK8A 1NNI1 3HO6A 3NS7A 1N2JA 3SP1A 2CJWB 1YDWA 2ZB4A 1MZPA 2QG9A 2IEIA 5AKHA 5ECGC 4MKRA 2JG3A 4CCSA 3AV0B 3CRNA 3DFKA 3SAJA 4F1KA 4YCSA 2IA5A 3O9VA 3PHHA 3G49A 6YASA 4X1KB 4NPAA 4EJ2A 3HEMA 4BRZA 1Y9ZA 3G6KA 4TOIA 1RAIA 5DM4A 3FVWA 1W96A 4UMEA 1FDSA 3FMFA 3DJYA 2NVUB 3JWEA 3P94A 4QPNA 2DEUA 2YJ3A 4MCIA 4KZPA 4A2WA 1YQTA 4MYDA 1GZVA 3CJQA 5CVUA 2YW2A 2ODPA 4CDMA 3C5WP 3LK6A 4MW6A 1KAEA 2EX1A 1WHSA 3EXIB 4AJHA 4DJTA 5JBNA 2YWCA 1X42A 3LECA 4CMIB 1JB9A 5EEHA 3KELA 4JMPA 1JYFA 4YMVA 1FDRA 2G09A 1OI7A 3I2KA 1DP4A 4QOIA 1JTFA 2HDOA 2QN2A 3RROA 3TKLA 4DMLA 1YA6A 3RVLA 2X8BA 2DBYA 3FFWA 3UUFA 1MLDA 2C96A 3D0KA 3H1BA 2QTZA 1R37A 1IN5A 2E4XA 3AIKA 1THTA 3V1KA 1C0EA 2RH9B 4BV9A 1FUEA 1LF0A 2YVLA 1V1JA 4MX8A 4DDTA 4JDUA 4QTZA 1AUQA 3VNUA 1MAWA 2RARA 5F77A 3IRVA 5CB4F 5SY4A 3M3DA 2OA0A 5HZGA 4EA8A 1WUIS 2IUTA 3AHGA 3AUFA 4Z1OA 5LZ4A 1YE5A 3AUUA 1AD2A 2DSNA 1VIDA 2ZJBA 4LTNA 4MICA 2Z5FA 4UOQA 2R84A 1XALA 1M2GA 2AX4A 2YFQA 3KVRA 5GGYA 4PO1A 4UBNA 1EUCA 5EHQA 5DHQA 4KIFA 4RV4A 3VQTA 1JT2A 4UTZA 4ENSA 2HCRA 3E9YA 1YR2A 5BNTA 2JNWA 2HJHA 2Q6KA 3ENWA 2X6TA 4LXUA 4L5IA 1T2AA 1FP7A 4L7VA 3TDMA 1JN0A 4PYOA 4A1OA 1KJ9A 1YS2X 2Q28A 4F4HA 2P0YA 1CP2A 1C30A 2AFIE 3R4CA 5A06A 4XQCA 2B1IA 1UXHA 3IVMA 3CRW1 1ZMRA 1X39A 2GZMA 3K70D 2QBYA 4M36A 2F90A 3BS4A 2L69A 1WSDA 3QVKA 3WV5A 4I55B 4K7JA 3FPAA 4OHVA 4E11A 4YMGA 3TL6A 3EIUA 3A6KA 4M2LA 4E2WA 2KI5A 3W78A 3HY3A 1Y8QB 1EVLA 4RHYA 1CY0A 1U7HA 3GHYA 4XYBA 4ZOQI 3TINA 3A7DA 5IASA 1FW8A 4L75A 4URUR 1UKYA 3AIIA 4JNKA 3WIUA 4BQSA 1LDEA 3D8BA 4DDUA 5LA6A 1SKYE 4D9CA 4MVJI 4YDSA 4CMKA 4CPDA 1RJDA 2DKOA 4ZO8A 4YUVA 2M6KA 3RC2A 1OTXA 1W25A 2VJNA 3G2MA 4IO1A 3FFBA 3NOXA 4HTFA 3KSZO 4G1BA 4LIPD 3TW0A 3AYXB 3D5EA 1PEDA 2I7CA 1A8SA 2P1ZA 4HEA6 4C7XA 4DSAA 5I4BA 5J4VA 3WA7A 3WYNA 2OXEA 3D4LA 4M1OA 1QV7A 1D03A 4DMCA 4NEQA 4TMTA 3MRXA 1ZKMA 4CNBA 3NV9A 1L0BA 4UATA 1NLUA 4IRXA 2VTKA 1D0VA 2G9ZA 2I6XA 2JIQA 2VPYA 3C70A 3IXLA 4W99A 1KRXA 4Z9XA 2IEYA 1Z28A 3BMCB 1TUBB 3RO7A 1NSFA 1EUZA 5G40A 1YL5A 1EX6A 3PEVA 2B0JA 2VBGA 1W87A 4EY6A 1MH1A 2FSVC 3FIUA 5IAAA 4HZUB 1X80B 1BHO1 2KLBA 3F49S 2ECOA 2FFBA 1BVYF 2HL6A 1W93A 4LXGA 4OI1A 3ZJYA 5AKLA 5J4YA 2PMBA 1SU8A 4UCFA 1WVMA 3VR6A 4F7WA 5DBEX 4PN7A 1M10A 1X86B 1YR8A 4UREA 5IDQA 2E6KA 1BEUB 1UZAA 2HQRA 4C89A 1ZI6A 5A4DA 3DKVA 5JW6A 3PJGA 1MEEA 4J6EA 3NJ8A 1K3UB 4LBWA 5DJ5A 1WTAA 1KI9A 3C3AA 4BVHA 4OJYA 3QXHA 1S2DA 5CK5A 5KYYA 2D4HA 3A3NA 1JLLB 2WLSA 4BNXA 3RVNA 2O59A 1LKZA 2REQA 1Z0IA 1DEOA 3HCFA 3HV2A 3HWRA 4K26A 4XE5A 1VIVA 2C3YA 4OAPA 3WQSB 4BRSA 3D5TA 3M6LA 3O6VA 4G09A 3DLBA 1DTSA 3EGDB 1C8VB 3IYLW 3A4MA 3RAPR 2FZ5A 2C00A 4Q3LA 2PQ6A 5LYYA 3JYLA 1KZ4A 1L7VC 1SXJB 2WTNA 1GNRA 3QYFA 4OCZA 2G1PA 4QU0A 1VYUA 4PHGA 4F71A 2GXUA 4UVDA 3SJBA 9LDBA 1H3EA 1C80A 2HI0A 3BXOA 4J0DA 5BR7A 4PGAA 4QBGB 4WKNA 4Z9BA 3O84A 2F1IA 2ISCA 3TB6A 2FDRA 5JH7A 2XE7A 3ZWMA 5BSRA 2XRYA 2H63A 4QDKA 3NGLA 3AFGA 1NW9B 1E18A 1TJ5A 3NGMA 3OUZA 4U7GA 4L8FA 4YNBA 4KTTE 5HF9A 4B17A 3SPXA 1Z4OA 3RUFA 4RIGA 3UMGA 4WIAA 1Z0KA 3LC0A 4ZDWA 5BSWA 5L3SA 1TA0A 1JIJA 1KK0A 1T8SA 5SYMA 1RBQA 4HMOA 1AF7A 1NUQA 3HA7A 4LTMA 1YVPA 2FSVA 4YEDA 4IP0A 4NVRA 4ZVUA 3T4PA 3OC0A 5B5SA 3V2HA 5H80A 2GEUA 3UY4A 1IG0A 1M6HA 1N7HA 2XE8A 3ZJ5A 3ITDA 1YOVA 4FMBB 4N0QA 4IMJB 4JK3A 1W2GA 3NASA 1UMCB 3ROMA 5JVDF 4PSCA 3U7JA 3AF4A 1DG3A 2DECA 2FZ4A 2IUYA 4MW2A 4YDRA 2HFJA 3O1HB 2DM6A 2OE2A 3PC8C 7GPBA 5JNLA 1DUVG 3Q2OA 3MWDB 5IU6A 3C7KA 4I1UA 1Y5IA 2CB9A 4MUXA 2QA5A 2Y05A 4XOUA 2FE4A 1WEHA 2FK8A 3OLXA 1DG9A 1NPYA 2IYEA 3HLTA 1HA3A 2CWWA 3GN1A 3RYIA 3ZV5A 2PKWA 1B0PA 3VU8A 5KDDA 2XTNA 3P9PA 4MVCA 2NSJA 5EJIA 2D1QA 3EMKA 1AQJA 3KDSE 5THXA 3SM9A 4F85A 1L4GA 4CLEA 3N1UA 1C1XA 4QU9A 4L4RA 5ELXA 4CEJA 3DUFA 1SCKA 3VU9B 4KN6A 2DJ5A 1GU7A 5JO9A 1PR6A 1Z2EA 2GX6A 1W9MA 1PJCA 2E6UX 3RS7A 4YYEA 1VE9A 1YL7A 3DXFA 1M0TA 3D4BA 4EM6A 4NENA 3EZNA 2V65A 4NOMA 1ATZA 2DU8A 3WGMA 1JU4A 2ZT7A 1W88A 1KFBB 1PN3A 5BV2P 3KG2A 4MGYR 1QFZA 2GKGA 1F51E 3S8EA 1FEZA 1GD1O 5E1OA 1FFEA 1UBHS 1HEUA 2W90A 3IT0A 4S1TA 4OJTA 3S1AA 4AZSA 1QTNA 4GC9A 5EPEA 1DMSA 3I9LA 2RKWA 3GLHA 3PQ8A 1Z26A 5J5CA 4M9RA 1U2QA 4WLEA 3HVKA 3L4BC 4BU1A 2P11A 4B81A 3L7OA 2MHCA 1ZHOA 4YDQA 1XZFA 1Y8AA 3DDNA 3WIDA 5HFJA 3ILSA 4BTVA 1FYFA 3BXEA 3RVSA 3ETHA 1G20B 2AOXA 3W5DA 2ZSIA 4MNTA 2AMYA 1SKUA 5C9ZA 1EUDA 1RJEA 4M0KA 3L1IA 2J7PD 2XUAA 1H2BA 3DP7A 3ZOZA 1C50A 1HTWA 1P18A 2AXNA 1L7NA 3AJRA 3I1YA 2GK7A 4RAQA 3T3GA 4GDMA 3I8SA 4MYTA 5KJ6A 5BWCA 5ETJA 1OCEA 3NKVA 4BTEA 3DMPA 3K9FC 1GAQA 1BCSB 4OX9Y 4FEEA 1I7LA 1I1OA 4UDOA 3PA8A 4LV5B 1L8OA 1ZRMA 4FXPA 3VOAA 4X24A 1C1YA 1BS2A 2REXB 1TFUA 2O1EA 4MKHA 2CYCA 4O4LA 3PQ7A 2JHCA 3ZU6A 4LOKA 2GA9A 3O5AA 5JPDA 4Z7NB 1OGIA 3ZI7A 4S1OA 4YAJA 3BG5A 1CG6A 2P41A 1C0IA 1GUFA 4GOLD 5F1PA 5B53A 2YY6A 4JI6B 4KACA 3QV1A 2EG9A 5DHPA 4I4LA 1S2NA 3Q5GA 4U2EA 2NV6A 3H0CA 3Q8WA 5AM0A 4B33A 4DCOA 1E6CA 3KS9A 4FBLA 3IEXA 4INJA 4DRZA 1KQGA 2HF2A 3NHFA 1KQNA 4ZOEA 1YJ5A 1KHTA 5DYTA 4YRRA 3RIMA 1J1UA 4LZLA 1RCUA 1QHGA 3E84A 1A88A 5ENZA 3VSCA 1CIJA 2ZG6A 3I12A 2Z8ZA 2DP4E 1Z15A 1GV1A 1KC3A 3Q7RA 3OY2A 4U1RA 4ZVKA 1EBUA 3NHBA 3PUYA 4UEQA 5FFFA 1NQOA 5L9AA 3VKGA 2OV6A 1MG0A 3VUEA 2ZKIA 4KLRA 2I3ZA 2XQGA 3G5LA 4EG5A 4K9QA 4WT7A 4MQEB 2WKSA 5EE9A 4ZI5A 2NZWA 2QT0A 3LDFA 3VDQA 3M1YA 3BIWA 4J0IA 3PHIA 1S3GA 1RPNA 4FPXA 3BWDD 3NTRA 2C3MA 3ND5A 4Z3KA 1ZW1A 2NXCA 4NONA 221PA 4HDAA 4WCFA 5JRZA 1A1SA 1JHUA 3LCRA 5JYCA 2Q5LA 4BC0A 4B5KA 1XBTA 4HJXA 1VHJA 2ZIWB 4B3IA 5INTA 1B00A 4JXXA 1ZEMA 1FS6A 4I19A 2WT8A 1T0PA 3ZGZA 1QHSA 1U5AA 4G97A 1JRLA 4YQEA 4TL9A 4XGQA 1G2PA 2F6RA 1I4WA 1YOBA 2Y67A 1X7XB 4NV0A 4YRTA 5FBZA 5AUPB 2EV9A 1QPGA 4GH5A 2VCHA 2H9AA 2G63A 3NIBA 4PW0A 1FVOA 1JYEA 4N12A 3IP8A 1XD8A 2B8NA 3TSOA 2R8XA 3ST7A 5TQVA 3TD2A 2NUTB 1OX4A 3BYZA 2IYAA 4ZMBA 1R0XA 2QENA 3RJ9A 1UC5B 5EWLA 3UFXB 3H65A 2VLBA 3T7DA 2ZROA 3GGJA 1YHNA 2NU7B 5FHRA 1G16A 4TPKA 4Z9AA 1JIXA 3VU0A 4BKMA 1GZHB 5IKMA 2ZJ4A 1H9AA 3GRFA 1E94E 3INTA 4IJQA 5GV8A 1GNSA 3LUKA 4I9NA 4ZANA 1S8OA 1QYIA 2WW8A 3DKKA 1TIPA 3EASA 5HIMA 3WKAA 1C0PA 2V0GA 1AGXA 2Z83A 3EF0A 2P9YA 3EQ6A 4X7RA 1PEKE 2GERA 1OIXA 3KU1A 3CVYA 2WP0A 5E95A 3KZMA 2IKSA 4GX5A 1YAHA 1YHZA 1DIRA 5AJUA 2ADOA 1H6BA 1RXYA 3ZIUA 3QLTA 1CJSA 2CHGA 2OK8A 3GD5A 3OTQA 4KQKA 1ETUA 1E9FA 3KLOA 1Y4ZA 3OZVA 4KBGA 1Z6TA 1OYWA 1OI3A 1FJ2A 3GVCA 4G56A 1MU0A 1T13A 1T9GR 2BEKA 2N9UA 2WF8A 1XMJA 5E6RA 5HWSA 5LLDA 3IBSA 4XDZA 2G80A 4HLCA 5KTOA 1C9YA 5G1OA 2YVQA 3B20A 2ID9A 4LPSA 5EJ6A 4EKEA 1TFRA 2VYND 4CTOA 1H2AS 3GJ7A 5DASA 4DDHA 4M6WA 4AU1A 3VMMA 1CR6A 1NUAA 3L7DA 3N05A 2LZ0A 3DE6X 4M8LA 4LRUA 4WHMA 1Z2AA 2WU3A 1Y6JA 1JEQA 2YXBA 3EDOA 3B82A 1TTTA 2WPNA 2GPSA 1RYZA 1M1XB 1ATIA 4KPEC 3KQVA 5D5PA 4JYPA 3DT8A 4E5KA 5B2FA 1PX0A 3EGIA 2BGWA 4NS4A 3HJRA 2ZBVA 5AHOA 1NVTA 1I33A 4O2AA 2DLDA 3NH9A 4Z4IA 2G71A 3RUPA 1ZD3A 2WP8J 3OQIA 3ZBPA 5JAMA 4WK2B 4CR8A 1KO4A 2JJQA 3SIXA 3HFJA 2I87A 4PX2A 1OXUA 1ULTA 1AX9A 1W85B 4P80A 3FMIA 2QS9A 2YWBA 4JIMA 4PN3A 2FSPA 4LUCA 2HA7A 4IXMA 1KIMA 2VTDA 4KJZA 3QK7A 2X8JB 1H4QA 2OLEA 2R96A 2QX7A 2R1TB 4JJFA 1LSOA 4P6VF 2C04A 4AP6A 2XOKD 3GHHA 3UUWA 2IQ5A 1NG9A 2HK7A 3H42B 4CUJA 2M1ZA 1IRIA 4RGYA 3VR5H 4C6TA 3NBXX 2DFPA 1D2RA 2VDLB 1QV6A 3R74A 3OWXA 1T34A 4A0HA 3TVTA 2GCOB 5ALKA 2Q3EA 3KB6A 5FWXA 4GKKB 3BIJA 1OWMA 3ADPA 3W8RA 5TMEA 4YRKA 3EMBA 3JQRA 1EGHA 3R8XA 1LZKA 1L3CA 4MXDA 4KLNA 2RI1A 4JHLA 5DLEA 3ZE1B 3QWHA 3UH0A 3QLUC 3MOSA 2PZMA 4QVIA 1OWLA 4FDLA 3DVQX 3ECCA 2O2SA 3Q2IA 3R6LA 2H4XA 1V96A 1E59A 1Y9DA 4MQFA 3SD7A 1QUFA 1D2AA 3ONWA 2YV5A 2P2CA 3OEHD 3C85A 3WL3A 2ZW9A 1U3VA 1JIKA 1U8YA 3SXPA 4LGYA 3RWMB 3ADBA 4CLOA 1DEHA 2ODTX 1U6KA 5C3MA 3VU3A 3ABIA 1W5EA 5JQWA 4YJ3B 3FR8A 5A7HA 3ANSA 3FN4A 1ZO8A 3CV3A 3WLQA 1TB4A 3MWJA 2WNIA 3JZAA 2WV9A 1N0UA 3IDAA 3UMCA 4B46A 1NAHA 4ZZ3A 2J3EA 3ZJTA 2ZK7A 4PAWA 3RUDA 3VVMA 1JEYA 4KMOA 1QK4A 2EBUA 1M83A 4GI2A 3TJZA 2J5RA 1QF9A 1LFDB 5HMMA 4D0GA 4ZDJA 1L1QA 1KO7A 4GZ5A 2J1LA 4I8DA 4LC9A 2V7EA 5HGXA 5JV5A 2GZ3A 4OI2A 1X1AA 3OZ7A 4X5OA 1Y8RB 5F35A 1W49A 4QAQA 1ZOOA 1Q0ZA 3JR3A 3HI4A 1PW7A 3LT4A 3U17A 1XZHA 3X1WA 3T9BA 2I2DA 3DCIA 1AQUA 5AJHA 4DNPA 3K6JA 3V4LA 1E2JA 1YZTA 2QU8A 3SMQA 3P2YA 4L9AA 3A1UA 2CLIB 4G07A 4PCLA 1D6JA 3IAHA 3EAGA 2RGEA 1KSGA 1KJQA 2WD9A 2ZI5A 4BYMA 2OVFA 2D06A 4ZYWA 3AO0B 3DF7A 2W8BB 2XBLA 3Q1LA 4FCWA 4CF5A 2H2AA 2VF7A 4BL5A 2HJ9A 4O0MA 3H8VA 5JXGA 4D5EA 2IH2A 1C9EA 1IJEA 2AUMA 2AC2A 1CNEA 1J0XO 1RAAA 1U0FA 2X13A 4OI4A 1XZLA 3H83A 4XCXA 3TI7A 3K8YA 4CIWA 5FWYA 3GAZA 3C6XA 3MSCA 3UA3A 4KDCA 4AWAA 2GBCA 1QBGA 4MUAA 2ZE7A 5T8KA 1MT3A 4G0MA 1VRVA 5JJKA 4N0EA 2IV2X 4NBSA 5JQGB 4F86A 4B34A 4EW6A 2NYVA 1SKAA 1UANA 4LHZA 3QEBZ 4M1TA 3ZE2B 3QY9A 3ENZA 4C07A 2XKJE 3R6GA 3MTAA 1X7HA 1HKUA 5B30A 4OREX 2H08A 3T4UA 5F98A 1KFEB 4LF7B 4I08A 4M54A 2GBPA 5CYFA 5IT4A 1T3LA 4HDQB 4XSGA 3OZFA 4TLLB 1TW2A 4KPFC 4A0FA 2O1WA 4OFZA 4UQLA 3DOHA 2RHTA 2J9FA 2O0MA 3GIWA 3OFVA 5DX8A 4EVIA 3DC2A 1XLTC 2HRRA 4ZJPA 5ELLA 1IMJA 3CRQA 2JLXA 3DFFA 5D5QA 4XFDA 4FFWA 3UXHA 3ZDFA 1L5HA 4EKDA 4CQMB 4J0CA 4OYYA 5EJ4A 4S3MA 3QTBA 3V2IA 4EJSA 4INAA 1HLFA 4C0XA 4ZAGA 3IQZA 2IYOA 3EIHA 4QA9A 1Z56C 3NIDB 3SLKA 1T2FA 1PGPA 1Q6ZA 4I1SA 2DPHA 3GAAA 1YCDA 1H22A 4S12A 2J67A 1ZM2A 4RMHA 4EGQA 2JD0A 3FFXA 4Q1VA 5FWYB 3R7NA 4BX8A 4EABA 1KI6A 4EPTA 4ES6A 4S35A 2XEDA 1AK2A 2ZYGA 4GVPA 3IBFA 4Q1CA 2RGWA 2R87A 4BNYA 3AKCA 1JVBA 3U4IA 1DS6A 3E5HA 1MOPA 1XGKA 4FT4A 1TQDA 1VOTA 2YZKA 4QVGA 3FWPA 1Z5NA 4JLWA 5JLAA 2HU5A 2MMGA 4ZOLF 3IDZA 1GILA 5D86A 1A2OA 1NI4A 1RP7A 2CNKA 4IIDA 2QVYX 1JBQA 2HV8A 1E2QA 1OKKA 1X9HA 3CH4B 4PG5A 1WL8A 1JDJA 3JAWA 3BMXA 4LSZA 4M7PA 4TM7A 5DVZA 4UOZA 3D6FA 4URHA 1CZNA 1OH6A 1DC6A 1EU1A 2PUCA 4LEIA 4H3HB 4EGJA 1P73A 3SVTA 1GY8A 4JX8A 4K6HA 4MVJF 4AY5A 2V1UA 4Q48A 3U39A 4NBWA 2A9OA 4D57A 4YQYA 2A59A 1QR6A 5DLQC 1ZJ4A 3RK4A 3F1KA 4G0NA 1SHZA 3ROXA 5CITA 1RYBA 2VHWA 3GJYA 3ND9A 5LZ7A 4BMCA 4IV8A 8LDHA 3NANA 5WRFA 1USUA 3HJAA 2A14A 4ZCIA 4G4SP 4TKLA 3SWWA 1E6LA 3RLFA 3M6IA 2P9BA 1Z0ZA 3I5AA 4AIIA 1ZMTA 1LPBB 3BD7A 4OJNA 1KARA 3WGZA 1BCRB 2CL6X 5ECDA 5F4BA 2QRMA 4KK3A 4QUDA 5JZSA 3K9HA 3EBLA 3PNSA 1L7DA 3OF3A 1QK5A 1CUYA 1DBQA 1UBMS 2FUG6 5AHKA 3RRXA 4BUCA 4CKZA 4BLSA 2F4NA 2VA9A 3OFSA 4EF6A 3ELUA 3EUWA 3OPYB 3BXGA 4TWJA 4UPEA 3OY7A 1LWNA 3ILVA 4V0NA 3S7TA 3QA3E 5ES3A 3VTKA 4EPYA 1BKDR 2G77B 3OM8A 4J9UE 1J6UA 1E5XA 2BLLA 3F6SA 4MQFB 4LFCB 3TVYA 4ZEVA 2WTUA 3W8NA 2CT8A 2E89A 1XLUA 3PTLA 2QSJA 1GCOA 1YI0A 4YT4A 1T1EA 4MEBA 1O57A 2ZAYA 4OHWA 4DXHA 3I76A 5A5FA 3K6SA 1M1UA 2XDYA 4Z0HO 4Y2TA 3OZWA 1LTHR 4I2NA 3ZLBA 1U90A 2NNLD 2RI0A 3F74A 4BIIA 4F72A 4TUYA 2HNKA 1F4VA 1OF1A 4ZI2A 2FQQA 1J0AA 4F06A 1ZD8A 5J1SB 2BFFB 1P2FA 1V26A 2R6FA 3PCTA 1UJCA 2X3UA 3ZV7A 1J09A 4I99A 1EDDA 1NRJB 1K2WA 3R3HA 2C5BA 3L4BA 1WG8A 5JCOA 3ROZA 4BGIA 3KK0A 1MJFA 1B1CA 1VG1A 2HXSA 1ZQ9A 2REOA 4AN4A 1OA1A 4ZODA 2J41A 1IIBA 2DWQA 4L3VA 4WZBE 3ZE9A 1F6WA 3IDOA 4JODA 2IZ7A 4H7DA 5D01A 2VP9A 3S99A 4N6NA 1M1YE 4HDCA 4CKBB 4MI6A 2N46A 5EP3A 1OXKB 4FJ2A 3WBFA 2FPPB 2AFHA 2YMMA 3B9PA 3MYYA 5J59A 4UTNA 1J49A 1SCJA 3GUUA 3FI0A 1MVNA 3D2BA 2C84A 1R4ZA 3HGTA 4OQEA 3ERCA 3NMUF 1I4DD 1J8VA 1X74A 3L6EA 3N9IA 4WBXC 2Q5JA 3LPNA 2EZ9A 3PG5A 4JMLA 4KQ6A 1CZHA 2B21A 1G7SA 2HJWA 5GZ1A 3DPSA 2PIAA 2WT9A 4RZSA 2JFFA 3DBRB 5I8WA 2RK4A 4CCAA 1GNPA 3GGSA 4KXUA 4EPRA 5TSDA 4K9DA 4WZZA 1AUVA 5IM4F 1Z7WA 2QD1A 3JW8A 1LQ2A 1ODFA 4I4TF 3LC2O 1P1BA 1P2GA 2VRBA 3TSZA 1EA7A 4PR3A 4KGZA 1PVDA 1CJCA 2QZ9A 4JYCA 4Y9SA 1RI2A 3A27A 5GONF 5JSZA 1M54A 1KOJA 3QKWA 4FNOA 3FRJA 2W4MA 3KV3O 2ZPUA 4MIOA 3LY5A 4FVTA 5K4HA 3IRUA 421PA 1GGVA 2EQ5A 3CLHA 3G7NA 3G79A 3JAKB 3OLZA 4ZPXA 3G5UA 2O3JA 2QUKA 1NJ5A 2B7LA 3PNKA 4CKBA 4BEVA 5FAKA 1VBMA 1KEEA 1RFLA 4DVJA 4F2PA 4QAJA 4D26A 4MV6A 5HE8A 5DGTA 4RUKA 2FWAA 1P9WA 2X9NA 2ZPAA 1QVZA 1DC5A 2VPZA 4JP2A 5AXCA 3A25A 1HL7A 2X4DA 2QN3A 3AVOA 3ZHQA 3CNLA 3IV7A 3RKSA 2FJPA 1RLUA 2IXGA 4KQFA 2VUUA 4IR7A 2C83A 3L7NA 3D8HA 1U2PA 2BFCA 1N8TA 3PJRA 2XIQA 1E61A 4UNPA 1LNSA 4G4GA 4P84A 1SCNE 2VWHA 1CQJB 4NCXA 3OAAD 5IVIA 4U0KA 1V6AA 2FOIA 1RP1A 1JIQA 2Q41A 4PNPA 3C6MA 2RGUA 1JPUA 2QN7A 3K5WA 1MJHA 2FGKA 3OICA 3B1YA 4WLFA 5IAKA 1JWBB 5F76A 1TCCA 1IZZA 1AV7A 4REQB 4KDRA 3W6UA 4J0EA 3KCQA 4KPUA 4EYGA 2IDMA 2FZCA 5HPYB 1NIPA 2FRXA 4PPQA 2BJVA 3P97A 1QRSA 3A3OA 2CNDA 5KSPA 1ONSA 2ABWA 4ZCPA 1XQXA 3LZCA 3N75A 3ES9A 3NM6B 1DQNA 2W37A 4JUFA 5THKA 4B8ZA 5JSFA 2N1MA 2C4TA 2IK8A 1L1FA 4DXAA 4FMPA 2MTBA 2ZT8A 4XX0A 1E8DA 2CSUA 4IDCA 1XLVA 2BN4A 5FCDA 5FAXA 2YTZA 3RSLA 3CWCA 3EXIA 4F4JA 2BELA 3KUUA 4KYIB 1GEGA 3P0EA 2A1UB 4HQFA 4YAIA 4HNUA 3RADC 1OLUB 3RWOA 3HU5A 2B98A 3E35A 5F21A 5DIFA 1BO6A 4AY4A 3WHPA 3M5CA 5HIIA 4HVCA 4RH0A 4HGNA 3MJCA 1NJ6A 1NOKA 2HT1A 1CF4A 2GM9A 3DKIA 3P9SA 2Y6UA 5E7QA 3VKHA 2MSKA 4RZIA 1SG6A 1DRUA 1OX6A 1JIIA 1EXVA 5F9FA 2E48A 1NGSA 1R9NA 2PO5A 1WUJS 4ZT4A 2NUBA 4DLYA 3KETA 3RHZA 3JVVA 1T8WA 2OYSA 3L0SA 3E4DA 5IFKA 5F3WB 3NB0A 4GX2A 2QXTA 1KPGA 3KPYA 3FGPA 5BUCA 5JY1A 3IAUA 4IH1A 1EVIA 2C1XA 2O7RA 4WNYA 3GQBA 4EAAA 4HVTA 5G3ZA 3QI7A 4CMCA 4NCHA 1A2KC 3RUIA 2E5WA 1N9GB 3EPRA 1OGYA 4PQGA 4J1NA 2EX0A 4CGYA 1HE1C 1JZTA 1W75A 4FCVA 2AVDA 1XOIA 2GARA 2YDYA 3MVEA 4P2BA 3WDSA 1YBVA 4PXSA 4K03A 1KDRA 2ZR7A 3FPJA 5E0KB 3FWYA 5BW6B 1QG2A 1E79D 1W8DA 2IPAB 3DZKA 1JGTA 4MULA 3T1OA 4BQFA 5H4GA 2EFDB 4DKJA 4RNCA 3H9JA 3QP9A 3MUEA 3ASVA 1LBQA 4N3NA 1RWNA 4QT0A 1C2TA 2GEKA 1XTUA 1FDOA 1QYVA 4QODA 1O96A 4RK7A 4PZZA 3K32A 4RYLA 1UK6A 1CLUA 1RMYA 3AEXA 1UFVA 3UW3A 2DPMA 1O9GA 4FFPA 4NPHA 4JJ7A 4TGLA 4MUGA 3GI1A 2GBFA 4CG0A 2JW5A 1EGVB 4DUGD 1UJNA 1BCSA 2R7AA 2HF9A 1PIWA 1TRHA 1E4EA 4B71A 2INGX 4E88A 3VPBA 3QXXA 2QVCA 4DREA 1EM8A 2Y6VA 3WMWA 2YHIA 4GDFA 1MQ9A 2AEJA 2DUMA 3A9VA 4X6XA 5CLGA 4DLPA 2A9VA 1T3GA 2XD9A 1ZR4A 5JCJD 4M1KA 4FHEA 4GE0A 4UM9B 3A9UA 1YJCA 3ANLA 4NRDA 4RY8A 3LNCA 3R8FA 3QBJA 4G84A 2ZTUA 1UOQA 4B85A 2BWJA 2G0AA 1XU9A 4B6FA 1DKRA 3EYAA 4AKSA 3F4BA 2LPMA 2ISSD 3H87A 3N3AC 2X77A 3O8BA 4ENQA 5F2NA 4BMSA 9MHTA 4QNRA 2JCBA 5JH7B 3A6LA 5DNAA 1JQ5A 1EKXA 3W34A 5JATA 4AMYA 2WKQA 4HRXA 1Z6PA 4FOSA 1FSPA 4MRSA 3ZGLA 2BRUC 4OXKA 2VTEA 5C31A 4U5XA 3M70A 1VKJA 1U1FA 3U6KA 1YQGA 2QJRA 3ZQUA 1M73E 3K4HA 3REQA 1WTCA 1GDDA 2XWQA 4BQQA 2UYYA 5CVJA 2PJRA 3GQVA 3I23A 3BSSA 4R5MA 3LFTA 4TN1A 1UQTA 1C1XB 2ZRAA 4RXMA 4EFMA 4BO4A 4CEJB 4NCKA 3MUNA 4D9FA 5HF8A 1P7CA 1C7RA 1C41A 3PNQA 4U5QA 2ADMA 1KPIA 3B8HA 1XHEA 3ZUPA 2GK6A 5DLDA 5EUMA 1Z4PX 3CW8X 5AICA 4BZXA 4P32A 3T5MA 1DO0A 3BRSA 3G5AA 3RAEC 5SV2A 4GP7A 1JLLA 3DVRX 1PJQA 1N6RA 3H9BA 3PSHA 1XL0A 5F7JA 3UMBA 4RTMA 1C8KA 2I8LA 3Q4GA 1ZU4A 5IAEA 4TLAA 3MWYW 1UZUA 4ZWNA 3BB1A 4UHCA 3W6ZA 4RL4A 1V39A 3W3AD 1DAFA 4DFDA 4EO9A 4WCDA 2R6ZA 5JD5A 5KOIA 4O3MA 3UWMA 5DNEA 2I2CA 4Z9YA 5K8LA 2YZ2A 1UMKA 2W42A 1BA3A 3VJMA 1ESCA 1CTQA 3UC9A 4A6DA 5IUJC 3ZY5A 3AHJA 4FFSA 3ID6C 5FHQA 3RS2A 4XVQA 2BFCB 1BWPA 1VI2A 3HADA 5K8UA 1CUJA 1MAVA 1HC7A 1QVWA 2Q2OA 4PM4A 3STUA 3WXMA 3ESZA 3OKAA 1T2VA 4WRRA 1TQ6A 3V8RA 3Q85A 2OR3A 5LQUA 3REQB 3QG5A 3A3KA 4X6UA 3GLFE 5BN3A 3E18A 3UB3A 2Q5CA 1EUDB 4HN2A 4D99A 3KU4A 4YMUA 2OY0A 3JASA 1KEUA 5A0TA 1P0FA 4TRMA 5BQOA 1ADFA 2JHFA 4LYFA 5HE9A 1BXRB 1C2YA 1P2SA 1VYTA 1GCGA 2CN1A 5U1PA 3ON5A 4LDZA 1GPKA 4PGFA 4RLFA 3S1AB 5I7UA 2XQIA 2HHCA 1J4AA 2P5YA 3A4LA 1QFJA 4H59A 2YNMC 4W82A 4ZKEA 3ZGOA 2GXQA 3F7NA 3ZLVA 3B6EA 2GILA 3PHJA 2QLLA 1V5GA 4MWBA 4NK5A 1RRVA 4PCAA 3GVXA 1YUNA 1DCFA 1LW7A 1TZ2A 2ZR8A 2I7XA 3W4IA 3L0BA 5A9TA 1Y89A 4NYIQ 5ALUA 4ED9A 1OYYA 1G4UR 1WF3A 5FPYA 4HN4B 2AFVA 3E27A 4KQGA 1QF7A 4LX0A 4D8WA 2QL7A 4CNQA 1HDYA 1KVRA 1MD9A 3Q41A 1RPTA 4PBTA 2EP7A 1KMQA 2G25A 3A2KA 3D8RA 4U6SA 3RHTA 1QP0A 1FFHA 2BGRA 3VU9A 3ANTA 3WMEA 2J3HA 3ZH2A 5CJJA 4L22A 3FYUC 1QO0A 3GROA 4LDRA 4PLGA 4WDRA 5BO5A 3ZWKA 4L16A 3NHJA 4OY3A 4UUNA 2WHYA 1U8TA 2H7XA 3ORHA 5E2AA 3R0XA 1XXHE 5ILOA 1MV5A 3X2FA 5DNYB 2IUFA 3LT2A 5KB3A 4EG3A 4O29A 5FTMA 2ZBEA 2VSOA 4B73A 3JTMA 4E32A 3EVNA 2DGDA 3OCXA 2OAQ1 3FB4A 1RHJA 2DH5A 1MABA 3IQFA 4UUOA 2G1UA 2H16A 3KJIA 3U3DA 4D46A 5DHAA 4BAGA 4CTKA 2FWPA 1AN9A 1KO5A 3U26A 2ZREA 3TM4A 3AMVA 3HYNA 3AIOA 4XD7A 1YRHA 1BRMA 4RANA 2C03A 2YZNA 4IDHA 4NEGA 3Q12A 2AB0A 5IYZB 2ID4A 4KN9S 1DUSA 3V1UA 3NV7A 1U7DA 1LK5A 1QC5B 4TT8A 4O8CA 5IH3A 3QMWA 4RK6A 1K4KA 1B8OA 1QDEA 2BONA 1CF9A 2C1EA 5B37A 4DIMA 3HVJA 1UKEA 4HATA 1HTTA 1HE4A 2QSUA 2Y9MB 1M7GA 3A3PA 3S2SA 4IHKA 3U0VA 3K92A 5BOSB 4ZCMA 4QKQA 1JS1X 2PWZA 5JISA 2IHNA 2WVGA 1QU2A 4LOAA 3W9BA 1GKYA 1WXDA 1MRNA 2PVPA 4WFQA 4AWXA 3VSBA 1H2ZA 5T67A 1NN3A 2DQZA 2VXYA 1B8NA 4A7PA 5HKKA 5K0ZA 4GWLA 2BCJQ 1D1SA 3FLBA 3FZYA 1OV4A 4L51A 4O4JF 1WCYA 4WOCA 3RT1A 1TM5E 3AZQA 4ESOA 1SGWA 2F17A 2CXUA 1XJWA 2FTKE 5TS3A 4CVNA 3ZD7A 1TJ3A 3A6ZA 1U81A 2P2GA 2AL7A 1XZGA 3X2SA 5IWCA 5KJFA 4AZTA 3QEOA 3V6MA 2EQBA 2B99A 3TOSA 3ANMA 4TWIA 3VUFA 3DL4A 2PAAA 3PCXA 4JLKA 2PGLA 3RH0A 1VE7A 4POOA 1SA0A 1U94A 3FSRA 4Y9UA 3ZHYA 2VQEB 1SOAA 4C3UA 2PWYA 4PLWA 4CKCA 2V8OA 4MWCA 3RBVA 2H0QA 2NZ8A 1YUBA 1P1KA 4A0RA 1R16A 1WBJB 2FR8C 5FTJA 4YPVA 1DQPA 2B82A 3D1JA 1C7ZA 2WU1A 2X9VA 5CBKA 3MCAA 3OPVA 4NU6A 4ZK2A 3LQ4A 8MHTA 1L9KA 1J5XA 1KJZA 5J43A 5DP2A 3ZVNA 1Y0BA 1MW8X 2C4MA 4MRVA 2HMSA 3ZYZA 2XVYA 4Z7JA 5AW2A 3GRAA 1U0NA 4BO1A 1D04A 4NX2A 5K3CA 3D1VA 3REGA 3W9SA 3UOAB 2FF7A 4AJ9A 3N0TA 1S3FA 1WEKA 2PEYA 3K9CA 3MNFA 5EXEA 1UEXC 3A9RA 5BORA 5JI3E 1GRNA 1N4DA 4K86A 4KH0A 3RCBA 3V55A 2LP4Y 1NQUA 3G1WA 4KXLA 3MJDA 1F7UA 3OKFA 1DIGA 4MVJG 5I7SA 4JLSA 1PGOA 3B9RA 3VJKA 3FKSA 3D3JA 4DT1B 2VYFA 3GXOA 2G0TA 2AOWA 2ZAGA 1C7EA 2HO4A 1NXXA 4ZVNA 1FFYA 4GXTA 2YVKA 4NH0A 1X6VA 4Q16A 4CODB 3EFOA 2HMAA 2V7TA 2WB2A 2AMFA 2WM2A 1IM5A 4MZDA 3EEYA 5LPNA 3H17A 2DE0X 3EIOA 3QE4A 4HH1A 4MO2A 3UICA 2Q6OA 3IQXA 1U2ZA 4JEMA 1RQGA 1X1RA 1PZNA 3P4UA 3O74A 4Y6OA 1QYWA 5T3UA 3TLMA 4CM4A 1RQ7A 2C7VA 2Y8EA 5AKEA 2FXVA 2H1VA 3BTVA 3Q11A 5MHTA 3OFND 3FOWA 4GRAA 1C8BA 2H5EA 4IF4A 4KE6A 2R6JA 1NQXA 1QUEA 3H75A 4LGVA 4ONEA 1L5KA 4AD8A 3V32A 2IOQA 2PIDA 5K5EA 2FSSA 2ZANA 3OIFA 4IUBS 1HLPA 1E6WA 1C1DA 2COEA 1DAHA 1FFCA 3GB9A 1GPUA 1Y80A 1QB7A 1I7SB 1T35A 1KMCA 3D7LA 4IXTA 4ZJZA 4F3TA 2X0NA 4MS4A 2UV8A 3HVRA 1V71A 2O23A 2J32A 2Z2ZA 4TYPA 1OTYA 5GMOA 4WN3A 4C88A 2VUHB 3TBKA 3TLEA 3GIDA 1XEFA 4ADSG 2CYBA 1B1AA 3KSRA 5CNJA 2CEKA 1FQKA 2QRUA 4KGVA 3RT7A 4PNZA 5F33A 5HKLA 1AZSC 4XIJA 2XMRA 4XJVA 4JVSB 3OG9A 1SHKA 4EI9A 4ZVLA 2H0AA 3M4ZA 1I3NA 3NBQA 4LZNA 3S2GA 1XTRA 1ILWA 3U4QA 4Y2SA 3A11A 1JEAA 3F6EX 5K0FA 2ZBUA 3SJCA 2ZM5A 3JALA 3LUCA 2XAAA 3CF4G 1VZ3A 2WI8A 1J8MF 1LRKA 1BIFA 4WD3A 3ROTA 3U3MA 4WA7A 3KEGA 1Q16A 2BF4A 1UM9B 5DSXA 3IA7A 2ICAA 1VCHA 3MB5A 2W2KA 1FTSA 5AYVA 1Z0FA 4F3CA 3T34A 2BI4A 1O8BA 5IZCC 3IIMA 1ZG3A 1SOVA 5FT9A 1HX7A 3WNVA 2AG8A 1BKYA 1EE1A 3UHFA 1D4FA 2H9IA 3Q9LA 5EKDA 4F5WA 3OESA 2VO1A 6PFKA 3LBAA 2Y0PA 1QRTA 3L5OA 4L4ZA 1OWOA 2XLCA 3TTXA 5L53A 4FFBB 2F4VB 1S7GA 3DVLA 3SF8A 3GMDA 3X1MA 2DTXA 3UN1A 2JI8A 2PYDA 4XW2A 4UU0A 1X1CA 2W83A 3B5IA 3UJCA 3ZXIA 3AR7A 2VHEA 4FOTA 4ZCTA 1JEDA 4M55A 4N01A 5PNTA 2V7QA 3QNWA 4QX6A 5I7HA 2HK9A 2PU5A 3QW2A 3ZS9A 1K4YA 3BPSA 5EA2A 3I2IA 1IC6A 3ZHRA 4BMPB 1UZLA 3N0WA 1X87A 1YFJA 5CX1A 4QYMA 4GQIA 4MPTA 4G85A 3L8ZA 2ONCA 4ZVTA 4HEHA 3RFTA 3MUFA 3SGLA 1U7XA 1BWSA 4JDPA 3U4HA 3VZSA 5KSZA 2O8CB 2VAWA 1M2VB 2ZXFA 3KJHA 1YQQA 2ZTMA 2HM7A 3L01A 4G5SA 2W2KB 2QRVA 4RJJA 2XGJA 2FW7A 5JYDA 4JSRA 1UPAA 3B70A 3ISTA 3HZHA 1WOYA 2I80A 4KE7A 3WGYA 4LX8A 3K4QA 2FR8A 1VIAA 4IUDS 4CEIB 3G2IA 3DM5A 3OPYA 3IQHX 3NAGA 3LX8A 1WMSA 4P93A 2TECE 3IQGX 2PLRA 3SF0A 3UMJA 5FDFA 2OFWA 1Y8ZA 3G89A 5BNFA 4YA6A 2DQ4A 2ZRNA 3IMKA 1NVUQ 3JATA 3LP5A 3VVCA 1SB9A 3GBPA 3ZU5A 3OZUA 4IFTA 1GGHA 1Z47A 2YJ6A 3B3AA 2IC5A 3LSYA 4HQ6A 4V0QA 3JRWA 2RGNA 2Z09A 4V1CI 5JAHA 2ZRHA 1DBVO 2QORA 1RABA 3Q3JB 5EE1A 2PN1A 5JD4A 1MAAA 1R0YA 4FFLA 3HB7A 4LHSA 3EOBI 4PXYA 2X8LA 4ZPJA 5EHIA 3VTAA 3ZKWB 1FS4A 1NYQA 1XI2A 1EZZA 5BUQA 3M6WA 3WYBA 4EUSA 5K3FB 3VH1A 2BEUB 1WAMA 3AI7A 3MYRA 3ORQA 4GZLA 1IG3A 1QVVA 4IDOA 4ZQFA 1FSZA 3TNFA 4KO3S 4CQMA 4YTEA 3CN7A 3LKVA 5AVXA 1JLSA 3N6VA 2WWRA 3QVSA 1GLVA 1J2RA 2P6PA 4IDPA 3GELA 2C7QA 2X0DA 5ALEA 1F8YA 1IQPA 3LUHA 5C34B 2F8TA 3D6MA 1L5OA 3WWOA 1HNXB 3SG0A 3EPPA 5TR9A 3QLJA 1HLDA 2GJ4A 2C4WA 3C87A 3D7RA 3DL0A 5AW6A 1N1EA 2RH5A 4FTWA 1SXHA 2Z57A 3KQSA 4G89A 3PGMA 3KJEA 3VR5D 3L82B 4D96A 1ZX1A 1BJTA 1QGAA 5H81A 4DMKA 1N5OX 4FZRA 3C3YA 3KKOA 5BN5B 4MQMA 5FTNA 5KO2A 3A10A 2X6QA 4QJ3A 1HYEA 2FG5A 2PUTA 2R1UA 1E2PA 2ZYRA 1P4JA 1UUFA 3QLUA 3SQOA 3WZMA 5HNKA 2OFFA 2WAMA 1QMGA 1ZWLA 3CLTC 1QORA 3E2IA 4AKHA 4N8SA 1SM4A 1DDOA 2A67A 4OQDA 4X54A 4YALA 4P3NA 2WB4A 4E5MA 2B69A 2B6HA 4XFKA 4F2HA 2GUWA 3D0RA 3EXHC 2E5LB 3BH0A 2R751 3KHUA 3VDNB 2IZZA 3DBLA 2W6JA 4N76A 3VNRA 2AJCA 4Q1DA 2ILVA 1HDCA 1M7HA 2BMAA 5LQSA 3THOA 1VFPA 4GL2A 2J0QA 2WUGA 4DWJA 5JZVA 1B26A 3M2TA 4M53A 3BUSA 3DO6A 1IAVA 3CO5A 2QW1A 4MV7A 4OKIA 2E37A 2RGBA 2W4QA 4BQOA 2NMVA 3PNMA 3QXJA 2C7RA 2Z1DA 2E4ZA 2WPDD 4PZDA 3RYHA 1KEKA 4EIWA 3NYIA 4ZZ1A 1N2BA 1WPRA 4G8BA 2WM9B 2EARA 1O3YA 2A94A 3CCFA 2JANA 2FZGA 5TQ0B 1GZUA 3WRWA 3ZN2A 5J3JA 1KP3A 2X6RA 5BYAA 2JLYA 2R4TA 4GP9A 2G72A 2FV8A 2QHXA 4DCJA 1U7OA 1U5BB 3K0AB 4MUJA 3AKYA 1DRJA 3CLSC 4YT8A 2FMIA 1KH3A 1EB8A 3T9AA 2YWJA 4DGSA 2CHUA 3GEDA 1G21E 1LW6E 3E1KA 2GBGA 1QONA 1W5TA 2QUJA 3I5YA 3GLIB 3NEJA 2GO1A 4MIEA 4UUQA 1OGJA 1YRAA 5LUAA 1W85A 1TQHA 4OSOA 2WAOA 3QOYA 4P22A 4Z4FA 2O5CA 3C0KA 4BO7A 4JNCA 2B4KA 2F1HA 1YMUA 4QPDA 2F9FA 2HMVA 4IS2A 4EQZA 1J06A 3PQDA 2BFOA 2WYWA 1YKSA 3VPSA 1Z0UA 4I46A 2F1KA 2R62A 3JAMA 3MC1A 3V00A 1GCUA 3NPAA 2IFTA 2ZQZA 1O4WA 3GU3A 5CAEB 2UXCB 3SJZA 4N40A 2C99A 2OGZA 1EFVA 4QFCA 1C30B 1EBFA 1PRYA 3Q7SA 3FTCA 4R51A 4RHFA 2Z2IA 1Z6AA 3BFJA 3FE2A 3DE2X 3CUSA 4P36A 2ZBPA 4HNAB 2J3KA 4Y7DA 3EEQA 2R8OA 1MT0A