2FWLA

The cytochrome c552/cua complex from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
129
structure length
129
Chain Sequence
DGAKIYAQCAGCHQQNGQGIPGAFPPLAGHVAEILAKEGGREYLILVLLYGLQGQIEVKGMKYNGVMSSFAQLKDEEIAAVLNHIATAWGDAKKVKGFKPFTAEEVKKLRAKKLTPQQVLAERKKLGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c-552
publication title The electron transfer complex between cytochrome c552 and the CuA domain of the Thermus thermophilus ba3 oxidase - a combined NMR and computational approach
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport/oxidoreductase
total genus 41
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2fwlA00
3RN0A 1FCDC 1H31A 4V2KA 4L3GA 1KB0A 1DIIC 3NWVA 1J3SA 1YIQA 3L75D 3L72D 1C6SA 1H1OA 2C1UA 2IBZD 2ZOOA 1H32A 1A56A 4AANA 1CC5A 1NNOA 1CO6A 1KX7A 4EIEA 2AXTV 1CIFA 2C8SA 3HQ8A 3CU4A 1NMIA 2GC4D 3SJLA 1LFMA 1A8CA 1S6VB 1DW1A 2BGVX 1GQ1A 4L1QA 5DF5A 1NMLA 1I8PA 1IRVA 1NTKD 5DFSA 4FAVA 1EZVD 2B4ZA 3CX5W 5CICB 3ZOXA 2C1VA 3A9FA 3DMIA 1FHBA 3JBTB 4FA1A 1C75A 4FANA 1AYGA 1KV9A 5DJQC 3H1JD 1F1CA 3SLEA 3L73D 1HZVA 4WQAA 1CHJA 5DJQB 4H0JA 3H1LD 1ETPA 2ORLA 1YFCA 4FB1A 1CIHA 1FOCA 3WUIA 1JDLA 4GEDB 3A0HV 2C1DA 2AIUA 2BLFB 1SQPD 1MZ4A 2YK3A 1P84D 2ZXYA 1FI3A 2YIUB 3NBTA 155CA 1AKKA 5GTIV 2C2CA 3ZOWA 2YQBA 1C7MA 3KZIV 4NFGB 2LIRA 1CIEA 1C2NA 1C52A 1N15A 4N0KA 5CIDB 3L4MA 2ZONG 2ZBOA 3WFDC 5TISV 2AI5A 1MG2D 2CE0A 1COTA 3WC8A 3CYTI 4KMGA 2FRCA 2FWLA 1GIWA 1ZRTD 4Y5RA 2OZ1B 2MHMA 1RAPA 4FA4A 1SQBD 4AAOA 3OA8A 1SQVD 2YCCA 4U3FD 2JTIB 5E79V 1CRGA 3L4OA 2BCCD 1U74B 3SVWA 4FA9A 2PACA 1DT1A 3X39A 2N18C 5CIHB 4WQ8A 1GJQA 5KLVD 1CCHA 1FI9A 1BL9A 5CIFB 2CA3B 2D0SA 4O1WA 2N18B 4WQDA 1CHIA 1LS9A 4K3IA 2CE1A 1M70A 4GYDA 1NTZD 1YCCA 1H32B 2EXVA 5B6QA 1YICA 1YNRA 2LITA 1W5CT 1DVHA 1OCDA 1C2RA 1DW0A 2N9IA 3ZIYA 2PCBB 2HV4A 2C9XB 4EICA 3L70D 1CRJA 1I8OA 3M97X 1YEBA 1CIGA 1LC1A 1QYZA 3HQ9A 4AAMA 2D0WA 3TYIA 3O0RC 1KX2A 2V08A 1CORA 1VYDA 2JQRA 3WFEC 1C6RA 1BE3D 1HH7A 3ZCFA 3TGUD 3RLMA 1H33B 1CNOA 4XYDB 1N9CA 2BH5X 4PW9B 4AX3A 4DY9A 3CP5A 3DP5A 1MG3D 1CEDA 4Q5PA 4J20A 5C0ZA 2QJPB 1HROA 4WQ9A 5KLIB 1IO3A 1OAEA 3H1HD 1YEAA 1U75B 1HJ4A 3OCDB 1CHHA 1N50A 3CWBD 5AURA 4D6TD 1HRCA 3NBSA 1I54A 3WFCC 1SQXD 2B10B 2CXBA 1CCRA 1DIQC 1L9BC 2QJYB 3VNWA 3ORVA 3PXWA 1BCCD 3PXTA 1PP9D 1KIBA 1BGYD 2ZZS1 1L9JC 1YTCA 1LMSA 5B5EV 2XTSB 3H1ID 1CSUA 2DGEA 4MU8A 1M6ZA 1QN2A 2FYUD 1GU2A 1L0LD 2I8FA 3CXHD 1R0QA 1SQQD 4FA5A 1F1FA 1CYJA 3WFBC 2OZ1A 5CYTR 1WEJF 351CA 1KYOD 3VYMA 3OA8B 2PCCB 1E8EA 1CSVA 1I55A 2BPBB 1M60A 1H31B 1HCMA 1CSWA 5C9MA 1CTYA 4WQ7A 5CIGB 1NIRA 3ZOYA 1QL4A 1K3GA 5H2FV 3H1KD 1CRIA 3L71D 2B0ZB 1CRCA 4PJ0V 1HJ3A 2GB8B 2BH4X 1AOFA 1NU1D 4PD4D 4IL6V 3RMZA 1H9XA 2QJKB 2N3YA 5KAFV 1I6DA 1H9YA 1CSXA 1N90A 4JCGA 1B7VA 1PPJD 1L0ND 5IY51 3BCCD 1RZ6A 1RAQA 2BCNB 4LJIA 4O1QA 5KAIV 4AALA 1E2RA 4EIFA 1RZ5A 4WQBA 4RSZA 1A2SA 2L4DA 1DW3A 4P4QB 1HJ5A 1K3HA 1GKSA 3RN1A 3DR0A 1I5TA 3C2CA 1H33A 3MK7C 3CX5D 1FJ0A 2N3BA 1DW2A 2DVHA 3PXSA 2A06D 2FYNB 3MK7B 1EB7A 3PH2B 2B12B 1ZZHA 4YE1A 5CIEB 1AOQA 1HZUA 3VRDA 2C1DB 2MTAC 4PWAA 2B11B 1FI7A 1KB9D 3OCDA 4EIDA 1CXCA 1CTZA 2CA4B 1S5LV 2VHDA 1CYCA 1CYIA 2N9JA 1E29A 5B66V 1NTMD 1I6EA 3SXTA 4UB6V 3O20A 1IQCA 3HQ7A 2GC7D 3CXHW 3SWSA 4H0KA 4XXLA 3WU2V 3HQ6A 1GDVA 4WQCA 3ZOOA 1WVEC 1KYOW 4UB8V 2V07A 5EXQA 3A0BV 3ZBMA 4WQEA 5GTHV 1IZL0 1LC2A 1W2LA 1CXAA 2GIWA 3L74D 3O5CA 1C6OA 1QKSA 5CIBB 451CA 4QAOA 4L3HA 1DVVA 3O1YA 1CRYA 1CRHA 1QL3A 1IRWA 5KKZB 1CTJA
chains in the Genus database with same CATH superfamily
3RN0A 1FCDC 1H31A 4V2KA 4L3GA 1KB0A 1DIIC 3NWVA 1J3SA 1YIQA 3L75D 3L72D 1C6SA 1H1OA 2C1UA 2IBZD 2ZOOA 1H32A 1A56A 4AANA 1CC5A 1NNOA 1CO6A 1KX7A 4EIEA 2AXTV 1CIFA 2C8SA 3HQ8A 3CU4A 1NMIA 2GC4D 3SJLA 1LFMA 1A8CA 1S6VB 1DW1A 2BGVX 1GQ1A 4L1QA 5DF5A 1NMLA 1I8PA 1IRVA 1NTKD 5DFSA 4FAVA 1EZVD 2B4ZA 3CX5W 5CICB 3ZOXA 2C1VA 3A9FA 3DMIA 1FHBA 3JBTB 4FA1A 1C75A 4FANA 1AYGA 1KV9A 5DJQC 3H1JD 1F1CA 3SLEA 3L73D 1HZVA 4WQAA 1CHJA 5DJQB 4H0JA 3H1LD 1ETPA 2ORLA 1YFCA 4FB1A 1CIHA 1FOCA 3WUIA 1JDLA 4GEDB 3A0HV 2C1DA 2AIUA 2BLFB 1SQPD 1MZ4A 2YK3A 1P84D 2ZXYA 1FI3A 2YIUB 3NBTA 155CA 1AKKA 5GTIV 2C2CA 3ZOWA 2YQBA 1C7MA 3KZIV 4NFGB 2LIRA 1CIEA 1C2NA 1C52A 1N15A 4N0KA 5CIDB 3L4MA 2ZONG 2ZBOA 3WFDC 5TISV 2AI5A 1MG2D 2CE0A 1COTA 3WC8A 3CYTI 4KMGA 2FRCA 2FWLA 1GIWA 1ZRTD 4Y5RA 2OZ1B 2MHMA 1RAPA 4FA4A 1SQBD 4AAOA 3OA8A 1SQVD 2YCCA 4U3FD 2JTIB 5E79V 1CRGA 3L4OA 2BCCD 1U74B 3SVWA 4FA9A 2PACA 1DT1A 3X39A 2N18C 5CIHB 4WQ8A 1GJQA 5KLVD 1CCHA 1FI9A 1BL9A 5CIFB 2CA3B 2D0SA 4O1WA 2N18B 4WQDA 1CHIA 1LS9A 4K3IA 2CE1A 1M70A 4GYDA 1NTZD 1YCCA 1H32B 2EXVA 5B6QA 1YICA 1YNRA 2LITA 1W5CT 1DVHA 1OCDA 1C2RA 1DW0A 2N9IA 3ZIYA 2PCBB 2HV4A 2C9XB 4EICA 3L70D 1CRJA 1I8OA 3M97X 1YEBA 1CIGA 1LC1A 1QYZA 3HQ9A 4AAMA 2D0WA 3TYIA 3O0RC 1KX2A 2V08A 1CORA 1VYDA 3D0WA 2JQRA 3WFEC 1C6RA 1BE3D 1HH7A 3ZCFA 3TGUD 3RLMA 1H33B 1CNOA 4XYDB 1N9CA 2BH5X 4PW9B 4AX3A 4DY9A 3CP5A 3DP5A 1MG3D 1CEDA 4Q5PA 4J20A 5C0ZA 2QJPB 1HROA 4WQ9A 5KLIB 1IO3A 1OAEA 3H1HD 1YEAA 1U75B 1HJ4A 3OCDB 1CHHA 1N50A 3CWBD 5AURA 4D6TD 1HRCA 3NBSA 1I54A 3WFCC 1SQXD 2B10B 2CXBA 1CCRA 1DIQC 1L9BC 2QJYB 3VNWA 3ORVA 3PXWA 1BCCD 3PXTA 1PP9D 1KIBA 1BGYD 2ZZS1 1L9JC 1YTCA 1LMSA 5B5EV 2XTSB 3H1ID 1CSUA 2DGEA 4MU8A 1M6ZA 1QN2A 2FYUD 1GU2A 1L0LD 2I8FA 3CXHD 1R0QA 1SQQD 4FA5A 1F1FA 1CYJA 3WFBC 2OZ1A 5CYTR 1WEJF 351CA 1KYOD 3VYMA 3OA8B 2PCCB 1E8EA 1CSVA 1I55A 2BPBB 1M60A 1H31B 1HCMA 1CSWA 5C9MA 1CTYA 4WQ7A 5CIGB 1NIRA 3ZOYA 1QL4A 1K3GA 5H2FV 3H1KD 1CRIA 3L71D 2B0ZB 1CRCA 4PJ0V 1HJ3A 2GB8B 2BH4X 1AOFA 1NU1D 4PD4D 4IL6V 3RMZA 1H9XA 2QJKB 2N3YA 5KAFV 1I6DA 1H9YA 1CSXA 1N90A 4JCGA 1B7VA 1PPJD 1L0ND 5IY51 3BCCD 1RZ6A 1RAQA 2BCNB 4LJIA 4O1QA 5KAIV 4AALA 1E2RA 4EIFA 1RZ5A 4WQBA 4RSZA 1A2SA 2L4DA 1DW3A 4P4QB 1HJ5A 1K3HA 1GKSA 3RN1A 3DR0A 1I5TA 3C2CA 1H33A 3MK7C 3CX5D 1FJ0A 2N3BA 1DW2A 2DVHA 3PXSA 2A06D 2FYNB 3MK7B 1EB7A 3PH2B 2B12B 1ZZHA 4YE1A 5CIEB 1AOQA 1HZUA 3VRDA 2C1DB 2MTAC 4PWAA 2B11B 1FI7A 1KB9D 3OCDA 4EIDA 1CXCA 1CTZA 2CA4B 1S5LV 2VHDA 1CYCA 1CYIA 2N9JA 1E29A 5B66V 1NTMD 1I6EA 3SXTA 4UB6V 3O20A 1IQCA 3HQ7A 2GC7D 3CXHW 3SWSA 4H0KA 4XXLA 3WU2V 3HQ6A 1GDVA 4WQCA 3ZOOA 1WVEC 1KYOW 4UB8V 2V07A 5EXQA 3A0BV 3ZBMA 4WQEA 5GTHV 1IZL0 1LC2A 1W2LA 1CXAA 2GIWA 3L74D 3O5CA 1C6OA 1QKSA 5CIBB 451CA 4QAOA 4L3HA 1DVVA 3O1YA 1CRYA 1CRHA 1QL3A 1IRWA 5KKZB 1CTJA
chains in the Genus database with same CATH topology
3RN0A 1FCDC 1H31A 4V2KA 4L3GA 1KB0A 1DIIC 3NWVA 1J3SA 1YIQA 3L75D 3L72D 1C6SA 1H1OA 2C1UA 2IBZD 2ZOOA 1H32A 1A56A 4AANA 1CC5A 1NNOA 1CO6A 1KX7A 4EIEA 2AXTV 1CIFA 2C8SA 3HQ8A 3CU4A 1NMIA 2GC4D 3SJLA 1LFMA 1A8CA 1S6VB 1DW1A 2BGVX 1GQ1A 4L1QA 5DF5A 1NMLA 1I8PA 1IRVA 1NTKD 5DFSA 4FAVA 1EZVD 2B4ZA 3CX5W 5CICB 3ZOXA 2C1VA 3A9FA 3DMIA 1FHBA 3JBTB 4FA1A 1C75A 4FANA 1AYGA 1KV9A 5DJQC 3H1JD 1F1CA 3SLEA 3L73D 1HZVA 4WQAA 1CHJA 5DJQB 4H0JA 3H1LD 1ETPA 2ORLA 1YFCA 4FB1A 1CIHA 1FOCA 3WUIA 1JDLA 4GEDB 3A0HV 2C1DA 2AIUA 2BLFB 1SQPD 1MZ4A 2YK3A 1P84D 2ZXYA 1FI3A 2YIUB 3NBTA 155CA 1AKKA 5GTIV 2C2CA 3ZOWA 2YQBA 1C7MA 3KZIV 4NFGB 2LIRA 1CIEA 1C2NA 1C52A 1N15A 4N0KA 5CIDB 3L4MA 2ZONG 2ZBOA 3WFDC 5TISV 2AI5A 1MG2D 2CE0A 1COTA 3WC8A 3CYTI 4KMGA 2FRCA 2FWLA 1GIWA 1ZRTD 4Y5RA 2OZ1B 2MHMA 1RAPA 4FA4A 1SQBD 4AAOA 3OA8A 1SQVD 2YCCA 4U3FD 2JTIB 5E79V 1CRGA 3L4OA 2BCCD 1U74B 3SVWA 4FA9A 2PACA 1DT1A 3X39A 2N18C 5CIHB 4WQ8A 1GJQA 5KLVD 1CCHA 1FI9A 1BL9A 5CIFB 2CA3B 2D0SA 4O1WA 2N18B 4WQDA 1CHIA 1LS9A 4K3IA 2CE1A 1M70A 4GYDA 1NTZD 1YCCA 1H32B 2EXVA 5B6QA 1YICA 1YNRA 2LITA 1W5CT 1DVHA 1OCDA 1C2RA 1DW0A 2N9IA 3ZIYA 2PCBB 2HV4A 2C9XB 4EICA 3L70D 1CRJA 1I8OA 3M97X 1YEBA 1CIGA 1LC1A 1QYZA 3HQ9A 4AAMA 2D0WA 3TYIA 3O0RC 1KX2A 2V08A 1CORA 1VYDA 2JQRA 3WFEC 1C6RA 1BE3D 1HH7A 3ZCFA 3TGUD 3RLMA 1H33B 1CNOA 4XYDB 1N9CA 2BH5X 4PW9B 4AX3A 4DY9A 3CP5A 3DP5A 1MG3D 1CEDA 4Q5PA 4J20A 5C0ZA 2QJPB 1HROA 4WQ9A 5KLIB 1IO3A 1OAEA 3H1HD 1YEAA 1U75B 1HJ4A 3OCDB 1CHHA 1N50A 3CWBD 5AURA 4D6TD 1HRCA 3NBSA 1I54A 3WFCC 1SQXD 2B10B 2CXBA 1CCRA 1DIQC 1L9BC 2QJYB 3VNWA 3ORVA 3PXWA 1BCCD 3PXTA 1PP9D 1KIBA 1BGYD 2ZZS1 1L9JC 1YTCA 1LMSA 5B5EV 2XTSB 3H1ID 1CSUA 2DGEA 4MU8A 1M6ZA 1QN2A 2FYUD 1GU2A 1L0LD 2I8FA 3CXHD 1R0QA 1SQQD 4FA5A 1F1FA 1CYJA 3WFBC 2OZ1A 5CYTR 1WEJF 351CA 1KYOD 3VYMA 3OA8B 2PCCB 1E8EA 1CSVA 1I55A 2BPBB 1M60A 1H31B 1HCMA 1CSWA 5C9MA 1CTYA 4WQ7A 5CIGB 1NIRA 3ZOYA 1QL4A 1K3GA 5H2FV 3H1KD 1CRIA 3L71D 2B0ZB 1CRCA 4PJ0V 1HJ3A 2GB8B 2BH4X 1AOFA 1NU1D 4PD4D 4IL6V 3RMZA 1H9XA 2QJKB 2N3YA 5KAFV 1I6DA 1H9YA 1CSXA 1N90A 4JCGA 1B7VA 1PPJD 1L0ND 5IY51 3BCCD 1RZ6A 1RAQA 2BCNB 4LJIA 4O1QA 5KAIV 4AALA 1E2RA 4EIFA 1RZ5A 4WQBA 4RSZA 1A2SA 2L4DA 1DW3A 4P4QB 1HJ5A 1K3HA 1GKSA 3RN1A 3DR0A 1I5TA 3C2CA 1H33A 3MK7C 3CX5D 1FJ0A 2N3BA 1DW2A 2DVHA 3PXSA 2A06D 2FYNB 3MK7B 1EB7A 3PH2B 2B12B 1ZZHA 4YE1A 5CIEB 1AOQA 1HZUA 3VRDA 2C1DB 2MTAC 4PWAA 2B11B 1FI7A 1KB9D 3OCDA 4EIDA 1CXCA 1CTZA 2CA4B 1S5LV 2VHDA 1CYCA 1CYIA 2N9JA 1E29A 5B66V 1NTMD 1I6EA 3SXTA 4UB6V 3O20A 1IQCA 3HQ7A 2GC7D 3CXHW 3SWSA 4H0KA 4XXLA 3WU2V 3HQ6A 1GDVA 4WQCA 3ZOOA 1WVEC 1KYOW 4UB8V 2V07A 5EXQA 3A0BV 3ZBMA 4WQEA 5GTHV 1IZL0 1LC2A 1W2LA 1CXAA 2GIWA 3L74D 3O5CA 1C6OA 1QKSA 5CIBB 451CA 4QAOA 4L3HA 1DVVA 3O1YA 1CRYA 1CRHA 1QL3A 1IRWA 5KKZB 1CTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN0 A;  1FCD C;  1H31 A;  4V2K A;  4L3G A;  1KB0 A;  1DII C;  3NWV A;  1J3S A;  1YIQ A;  3L75 D;  3L72 D;  1C6S A;  1H1O A;  2C1U A;  2IBZ D;  2ZOO A;  1H32 A;  1A56 A;  4AAN A;  1CC5 A;  1NNO A;  1CO6 A;  1KX7 A;  4EIE A;  2AXT V;  1CIF A;  2C8S A;  3HQ8 A;  3CU4 A;  1NMI A;  2GC4 D;  3SJL A;  1LFM A;  1A8C A;  1S6V B;  1DW1 A;  2BGV X;  1GQ1 A;  4L1Q A;  5DF5 A;  1NML A;  1I8P A;  1IRV A;  1NTK D;  5DFS A;  4FAV A;  1EZV D;  2B4Z A;  3CX5 W;  5CIC B;  3ZOX A;  2C1V A;  3A9F A;  3DMI A;  1FHB A;  3JBT B;  4FA1 A;  1C75 A;  4FAN A;  1AYG A;  1KV9 A;  5DJQ C;  3H1J D;  1F1C A;  3SLE A;  3L73 D;  1HZV A;  4WQA A;  1CHJ A;  5DJQ B;  4H0J A;  3H1L D;  1ETP A;  2ORL A;  1YFC A;  4FB1 A;  1CIH A;  1FOC A;  3WUI A;  1JDL A;  4GED B;  3A0H V;  2C1D A;  2AIU A;  2BLF B;  1SQP D;  1MZ4 A;  2YK3 A;  1P84 D;  2ZXY A;  1FI3 A;  2YIU B;  3NBT A;  155C A;  1AKK A;  5GTI V;  2C2C A;  3ZOW A;  2YQB A;  1C7M A;  3KZI V;  4NFG B;  2LIR A;  1CIE A;  1C2N A;  1C52 A;  1N15 A;  4N0K A;  5CID B;  3L4M A;  2ZON G;  2ZBO A;  3WFD C;  5TIS V;  2AI5 A;  1MG2 D;  2CE0 A;  1COT A;  3WC8 A;  3CYT I;  4KMG A;  2FRC A;  2FWL A;  1GIW A;  1ZRT D;  4Y5R A;  2OZ1 B;  2MHM A;  1RAP A;  4FA4 A;  1SQB D;  4AAO A;  3OA8 A;  1SQV D;  2YCC A;  4U3F D;  2JTI B;  5E79 V;  1CRG A;  3L4O A;  2BCC D;  1U74 B;  3SVW A;  4FA9 A;  2PAC A;  1DT1 A;  3X39 A;  2N18 C;  5CIH B;  4WQ8 A;  1GJQ A;  5KLV D;  1CCH A;  1FI9 A;  1BL9 A;  5CIF B;  2CA3 B;  2D0S A;  4O1W A;  2N18 B;  4WQD A;  1CHI A;  1LS9 A;  4K3I A;  2CE1 A;  1M70 A;  4GYD A;  1NTZ D;  1YCC A;  1H32 B;  2EXV A;  5B6Q A;  1YIC A;  1YNR A;  2LIT A;  1W5C T;  1DVH A;  1OCD A;  1C2R A;  1DW0 A;  2N9I A;  3ZIY A;  2PCB B;  2HV4 A;  2C9X B;  4EIC A;  3L70 D;  1CRJ A;  1I8O A;  3M97 X;  1YEB A;  1CIG A;  1LC1 A;  1QYZ A;  3HQ9 A;  4AAM A;  2D0W A;  3TYI A;  3O0R C;  1KX2 A;  2V08 A;  1COR A;  1VYD A;  2JQR A;  3WFE C;  1C6R A;  1BE3 D;  1HH7 A;  3ZCF A;  3TGU D;  3RLM A;  1H33 B;  1CNO A;  4XYD B;  1N9C A;  2BH5 X;  4PW9 B;  4AX3 A;  4DY9 A;  3CP5 A;  3DP5 A;  1MG3 D;  1CED A;  4Q5P A;  4J20 A;  5C0Z A;  2QJP B;  1HRO A;  4WQ9 A;  5KLI B;  1IO3 A;  1OAE A;  3H1H D;  1YEA A;  1U75 B;  1HJ4 A;  3OCD B;  1CHH A;  1N50 A;  3CWB D;  5AUR A;  4D6T D;  1HRC A;  3NBS A;  1I54 A;  3WFC C;  1SQX D;  2B10 B;  2CXB A;  1CCR A;  1DIQ C;  1L9B C;  2QJY B;  3VNW A;  3ORV A;  3PXW A;  1BCC D;  3PXT A;  1PP9 D;  1KIB A;  1BGY D;  2ZZS 1;  1L9J C;  1YTC A;  1LMS A;  5B5E V;  2XTS B;  3H1I D;  1CSU A;  2DGE A;  4MU8 A;  1M6Z A;  1QN2 A;  2FYU D;  1GU2 A;  1L0L D;  2I8F A;  3CXH D;  1R0Q A;  1SQQ D;  4FA5 A;  1F1F A;  1CYJ A;  3WFB C;  2OZ1 A;  5CYT R;  1WEJ F;  351C A;  1KYO D;  3VYM A;  3OA8 B;  2PCC B;  1E8E A;  1CSV A;  1I55 A;  2BPB B;  1M60 A;  1H31 B;  1HCM A;  1CSW A;  5C9M A;  1CTY A;  4WQ7 A;  5CIG B;  1NIR A;  3ZOY A;  1QL4 A;  1K3G A;  5H2F V;  3H1K D;  1CRI A;  3L71 D;  2B0Z B;  1CRC A;  4PJ0 V;  1HJ3 A;  2GB8 B;  2BH4 X;  1AOF A;  1NU1 D;  4PD4 D;  4IL6 V;  3RMZ A;  1H9X A;  2QJK B;  2N3Y A;  5KAF V;  1I6D A;  1H9Y A;  1CSX A;  1N90 A;  4JCG A;  1B7V A;  1PPJ D;  1L0N D;  5IY5 1;  3BCC D;  1RZ6 A;  1RAQ A;  2BCN B;  4LJI A;  4O1Q A;  5KAI V;  4AAL A;  1E2R A;  4EIF A;  1RZ5 A;  4WQB A;  4RSZ A;  1A2S A;  2L4D A;  1DW3 A;  4P4Q B;  1HJ5 A;  1K3H A;  1GKS A;  3RN1 A;  3DR0 A;  1I5T A;  3C2C A;  1H33 A;  3MK7 C;  3CX5 D;  1FJ0 A;  2N3B A;  1DW2 A;  2DVH A;  3PXS A;  2A06 D;  2FYN B;  3MK7 B;  1EB7 A;  3PH2 B;  2B12 B;  1ZZH A;  4YE1 A;  5CIE B;  1AOQ A;  1HZU A;  3VRD A;  2C1D B;  2MTA C;  4PWA A;  2B11 B;  1FI7 A;  1KB9 D;  3OCD A;  4EID A;  1CXC A;  1CTZ A;  2CA4 B;  1S5L V;  2VHD A;  1CYC A;  1CYI A;  2N9J A;  1E29 A;  5B66 V;  1NTM D;  1I6E A;  3SXT A;  4UB6 V;  3O20 A;  1IQC A;  3HQ7 A;  2GC7 D;  3CXH W;  3SWS A;  4H0K A;  4XXL A;  3WU2 V;  3HQ6 A;  1GDV A;  4WQC A;  3ZOO A;  1WVE C;  1KYO W;  4UB8 V;  2V07 A;  5EXQ A;  3A0B V;  3ZBM A;  4WQE A;  5GTH V;  1IZL 0;  1LC2 A;  1W2L A;  1CXA A;  2GIW A;  3L74 D;  3O5C A;  1C6O A;  1QKS A;  5CIB B;  451C A;  4QAO A;  4L3H A;  1DVV A;  3O1Y A;  1CRY A;  1CRH A;  1QL3 A;  1IRW A;  5KKZ B;  1CTJ A; 
#chains in the Genus database with same CATH topology
 3RN0 A;  1FCD C;  1H31 A;  4V2K A;  4L3G A;  1KB0 A;  1DII C;  3NWV A;  1J3S A;  1YIQ A;  3L75 D;  3L72 D;  1C6S A;  1H1O A;  2C1U A;  2IBZ D;  2ZOO A;  1H32 A;  1A56 A;  4AAN A;  1CC5 A;  1NNO A;  1CO6 A;  1KX7 A;  4EIE A;  2AXT V;  1CIF A;  2C8S A;  3HQ8 A;  3CU4 A;  1NMI A;  2GC4 D;  3SJL A;  1LFM A;  1A8C A;  1S6V B;  1DW1 A;  2BGV X;  1GQ1 A;  4L1Q A;  5DF5 A;  1NML A;  1I8P A;  1IRV A;  1NTK D;  5DFS A;  4FAV A;  1EZV D;  2B4Z A;  3CX5 W;  5CIC B;  3ZOX A;  2C1V A;  3A9F A;  3DMI A;  1FHB A;  3JBT B;  4FA1 A;  1C75 A;  4FAN A;  1AYG A;  1KV9 A;  5DJQ C;  3H1J D;  1F1C A;  3SLE A;  3L73 D;  1HZV A;  4WQA A;  1CHJ A;  5DJQ B;  4H0J A;  3H1L D;  1ETP A;  2ORL A;  1YFC A;  4FB1 A;  1CIH A;  1FOC A;  3WUI A;  1JDL A;  4GED B;  3A0H V;  2C1D A;  2AIU A;  2BLF B;  1SQP D;  1MZ4 A;  2YK3 A;  1P84 D;  2ZXY A;  1FI3 A;  2YIU B;  3NBT A;  155C A;  1AKK A;  5GTI V;  2C2C A;  3ZOW A;  2YQB A;  1C7M A;  3KZI V;  4NFG B;  2LIR A;  1CIE A;  1C2N A;  1C52 A;  1N15 A;  4N0K A;  5CID B;  3L4M A;  2ZON G;  2ZBO A;  3WFD C;  5TIS V;  2AI5 A;  1MG2 D;  2CE0 A;  1COT A;  3WC8 A;  3CYT I;  4KMG A;  2FRC A;  2FWL A;  1GIW A;  1ZRT D;  4Y5R A;  2OZ1 B;  2MHM A;  1RAP A;  4FA4 A;  1SQB D;  4AAO A;  3OA8 A;  1SQV D;  2YCC A;  4U3F D;  2JTI B;  5E79 V;  1CRG A;  3L4O A;  2BCC D;  1U74 B;  3SVW A;  4FA9 A;  2PAC A;  1DT1 A;  3X39 A;  2N18 C;  5CIH B;  4WQ8 A;  1GJQ A;  5KLV D;  1CCH A;  1FI9 A;  1BL9 A;  5CIF B;  2CA3 B;  2D0S A;  4O1W A;  2N18 B;  4WQD A;  1CHI A;  1LS9 A;  4K3I A;  2CE1 A;  1M70 A;  4GYD A;  1NTZ D;  1YCC A;  1H32 B;  2EXV A;  5B6Q A;  1YIC A;  1YNR A;  2LIT A;  1W5C T;  1DVH A;  1OCD A;  1C2R A;  1DW0 A;  2N9I A;  3ZIY A;  2PCB B;  2HV4 A;  2C9X B;  4EIC A;  3L70 D;  1CRJ A;  1I8O A;  3M97 X;  1YEB A;  1CIG A;  1LC1 A;  1QYZ A;  3HQ9 A;  4AAM A;  2D0W A;  3TYI A;  3O0R C;  1KX2 A;  2V08 A;  1COR A;  1VYD A;  3D0W A;  2JQR A;  3WFE C;  1C6R A;  1BE3 D;  1HH7 A;  3ZCF A;  3TGU D;  3RLM A;  1H33 B;  1CNO A;  4XYD B;  1N9C A;  2BH5 X;  4PW9 B;  4AX3 A;  4DY9 A;  3CP5 A;  3DP5 A;  1MG3 D;  1CED A;  4Q5P A;  4J20 A;  5C0Z A;  2QJP B;  1HRO A;  4WQ9 A;  5KLI B;  1IO3 A;  1OAE A;  3H1H D;  1YEA A;  1U75 B;  1HJ4 A;  3OCD B;  1CHH A;  1N50 A;  3CWB D;  5AUR A;  4D6T D;  1HRC A;  3NBS A;  1I54 A;  3WFC C;  1SQX D;  2B10 B;  2CXB A;  1CCR A;  1DIQ C;  1L9B C;  2QJY B;  3VNW A;  3ORV A;  3PXW A;  1BCC D;  3PXT A;  1PP9 D;  1KIB A;  1BGY D;  2ZZS 1;  1L9J C;  1YTC A;  1LMS A;  5B5E V;  2XTS B;  3H1I D;  1CSU A;  2DGE A;  4MU8 A;  1M6Z A;  1QN2 A;  2FYU D;  1GU2 A;  1L0L D;  2I8F A;  3CXH D;  1R0Q A;  1SQQ D;  4FA5 A;  1F1F A;  1CYJ A;  3WFB C;  2OZ1 A;  5CYT R;  1WEJ F;  351C A;  1KYO D;  3VYM A;  3OA8 B;  2PCC B;  1E8E A;  1CSV A;  1I55 A;  2BPB B;  1M60 A;  1H31 B;  1HCM A;  1CSW A;  5C9M A;  1CTY A;  4WQ7 A;  5CIG B;  1NIR A;  3ZOY A;  1QL4 A;  1K3G A;  5H2F V;  3H1K D;  1CRI A;  3L71 D;  2B0Z B;  1CRC A;  4PJ0 V;  1HJ3 A;  2GB8 B;  2BH4 X;  1AOF A;  1NU1 D;  4PD4 D;  4IL6 V;  3RMZ A;  1H9X A;  2QJK B;  2N3Y A;  5KAF V;  1I6D A;  1H9Y A;  1CSX A;  1N90 A;  4JCG A;  1B7V A;  1PPJ D;  1L0N D;  5IY5 1;  3BCC D;  1RZ6 A;  1RAQ A;  2BCN B;  4LJI A;  4O1Q A;  5KAI V;  4AAL A;  1E2R A;  4EIF A;  1RZ5 A;  4WQB A;  4RSZ A;  1A2S A;  2L4D A;  1DW3 A;  4P4Q B;  1HJ5 A;  1K3H A;  1GKS A;  3RN1 A;  3DR0 A;  1I5T A;  3C2C A;  1H33 A;  3MK7 C;  3CX5 D;  1FJ0 A;  2N3B A;  1DW2 A;  2DVH A;  3PXS A;  2A06 D;  2FYN B;  3MK7 B;  1EB7 A;  3PH2 B;  2B12 B;  1ZZH A;  4YE1 A;  5CIE B;  1AOQ A;  1HZU A;  3VRD A;  2C1D B;  2MTA C;  4PWA A;  2B11 B;  1FI7 A;  1KB9 D;  3OCD A;  4EID A;  1CXC A;  1CTZ A;  2CA4 B;  1S5L V;  2VHD A;  1CYC A;  1CYI A;  2N9J A;  1E29 A;  5B66 V;  1NTM D;  1I6E A;  3SXT A;  4UB6 V;  3O20 A;  1IQC A;  3HQ7 A;  2GC7 D;  3CXH W;  3SWS A;  4H0K A;  4XXL A;  3WU2 V;  3HQ6 A;  1GDV A;  4WQC A;  3ZOO A;  1WVE C;  1KYO W;  4UB8 V;  2V07 A;  5EXQ A;  3A0B V;  3ZBM A;  4WQE A;  5GTH V;  1IZL 0;  1LC2 A;  1W2L A;  1CXA A;  2GIW A;  3L74 D;  3O5C A;  1C6O A;  1QKS A;  5CIB B;  451C A;  4QAO A;  4L3H A;  1DVV A;  3O1Y A;  1CRY A;  1CRH A;  1QL3 A;  1IRW A;  5KKZ B;  1CTJ A; 
#chains in the Genus database with same CATH homology
 3RN0 A;  1FCD C;  1H31 A;  4V2K A;  4L3G A;  1KB0 A;  1DII C;  3NWV A;  1J3S A;  1YIQ A;  3L75 D;  3L72 D;  1C6S A;  1H1O A;  2C1U A;  2IBZ D;  2ZOO A;  1H32 A;  1A56 A;  4AAN A;  1CC5 A;  1NNO A;  1CO6 A;  1KX7 A;  4EIE A;  2AXT V;  1CIF A;  2C8S A;  3HQ8 A;  3CU4 A;  1NMI A;  2GC4 D;  3SJL A;  1LFM A;  1A8C A;  1S6V B;  1DW1 A;  2BGV X;  1GQ1 A;  4L1Q A;  5DF5 A;  1NML A;  1I8P A;  1IRV A;  1NTK D;  5DFS A;  4FAV A;  1EZV D;  2B4Z A;  3CX5 W;  5CIC B;  3ZOX A;  2C1V A;  3A9F A;  3DMI A;  1FHB A;  3JBT B;  4FA1 A;  1C75 A;  4FAN A;  1AYG A;  1KV9 A;  5DJQ C;  3H1J D;  1F1C A;  3SLE A;  3L73 D;  1HZV A;  4WQA A;  1CHJ A;  5DJQ B;  4H0J A;  3H1L D;  1ETP A;  2ORL A;  1YFC A;  4FB1 A;  1CIH A;  1FOC A;  3WUI A;  1JDL A;  4GED B;  3A0H V;  2C1D A;  2AIU A;  2BLF B;  1SQP D;  1MZ4 A;  2YK3 A;  1P84 D;  2ZXY A;  1FI3 A;  2YIU B;  3NBT A;  155C A;  1AKK A;  5GTI V;  2C2C A;  3ZOW A;  2YQB A;  1C7M A;  3KZI V;  4NFG B;  2LIR A;  1CIE A;  1C2N A;  1C52 A;  1N15 A;  4N0K A;  5CID B;  3L4M A;  2ZON G;  2ZBO A;  3WFD C;  5TIS V;  2AI5 A;  1MG2 D;  2CE0 A;  1COT A;  3WC8 A;  3CYT I;  4KMG A;  2FRC A;  2FWL A;  1GIW A;  1ZRT D;  4Y5R A;  2OZ1 B;  2MHM A;  1RAP A;  4FA4 A;  1SQB D;  4AAO A;  3OA8 A;  1SQV D;  2YCC A;  4U3F D;  2JTI B;  5E79 V;  1CRG A;  3L4O A;  2BCC D;  1U74 B;  3SVW A;  4FA9 A;  2PAC A;  1DT1 A;  3X39 A;  2N18 C;  5CIH B;  4WQ8 A;  1GJQ A;  5KLV D;  1CCH A;  1FI9 A;  1BL9 A;  5CIF B;  2CA3 B;  2D0S A;  4O1W A;  2N18 B;  4WQD A;  1CHI A;  1LS9 A;  4K3I A;  2CE1 A;  1M70 A;  4GYD A;  1NTZ D;  1YCC A;  1H32 B;  2EXV A;  5B6Q A;  1YIC A;  1YNR A;  2LIT A;  1W5C T;  1DVH A;  1OCD A;  1C2R A;  1DW0 A;  2N9I A;  3ZIY A;  2PCB B;  2HV4 A;  2C9X B;  4EIC A;  3L70 D;  1CRJ A;  1I8O A;  3M97 X;  1YEB A;  1CIG A;  1LC1 A;  1QYZ A;  3HQ9 A;  4AAM A;  2D0W A;  3TYI A;  3O0R C;  1KX2 A;  2V08 A;  1COR A;  1VYD A;  2JQR A;  3WFE C;  1C6R A;  1BE3 D;  1HH7 A;  3ZCF A;  3TGU D;  3RLM A;  1H33 B;  1CNO A;  4XYD B;  1N9C A;  2BH5 X;  4PW9 B;  4AX3 A;  4DY9 A;  3CP5 A;  3DP5 A;  1MG3 D;  1CED A;  4Q5P A;  4J20 A;  5C0Z A;  2QJP B;  1HRO A;  4WQ9 A;  5KLI B;  1IO3 A;  1OAE A;  3H1H D;  1YEA A;  1U75 B;  1HJ4 A;  3OCD B;  1CHH A;  1N50 A;  3CWB D;  5AUR A;  4D6T D;  1HRC A;  3NBS A;  1I54 A;  3WFC C;  1SQX D;  2B10 B;  2CXB A;  1CCR A;  1DIQ C;  1L9B C;  2QJY B;  3VNW A;  3ORV A;  3PXW A;  1BCC D;  3PXT A;  1PP9 D;  1KIB A;  1BGY D;  2ZZS 1;  1L9J C;  1YTC A;  1LMS A;  5B5E V;  2XTS B;  3H1I D;  1CSU A;  2DGE A;  4MU8 A;  1M6Z A;  1QN2 A;  2FYU D;  1GU2 A;  1L0L D;  2I8F A;  3CXH D;  1R0Q A;  1SQQ D;  4FA5 A;  1F1F A;  1CYJ A;  3WFB C;  2OZ1 A;  5CYT R;  1WEJ F;  351C A;  1KYO D;  3VYM A;  3OA8 B;  2PCC B;  1E8E A;  1CSV A;  1I55 A;  2BPB B;  1M60 A;  1H31 B;  1HCM A;  1CSW A;  5C9M A;  1CTY A;  4WQ7 A;  5CIG B;  1NIR A;  3ZOY A;  1QL4 A;  1K3G A;  5H2F V;  3H1K D;  1CRI A;  3L71 D;  2B0Z B;  1CRC A;  4PJ0 V;  1HJ3 A;  2GB8 B;  2BH4 X;  1AOF A;  1NU1 D;  4PD4 D;  4IL6 V;  3RMZ A;  1H9X A;  2QJK B;  2N3Y A;  5KAF V;  1I6D A;  1H9Y A;  1CSX A;  1N90 A;  4JCG A;  1B7V A;  1PPJ D;  1L0N D;  5IY5 1;  3BCC D;  1RZ6 A;  1RAQ A;  2BCN B;  4LJI A;  4O1Q A;  5KAI V;  4AAL A;  1E2R A;  4EIF A;  1RZ5 A;  4WQB A;  4RSZ A;  1A2S A;  2L4D A;  1DW3 A;  4P4Q B;  1HJ5 A;  1K3H A;  1GKS A;  3RN1 A;  3DR0 A;  1I5T A;  3C2C A;  1H33 A;  3MK7 C;  3CX5 D;  1FJ0 A;  2N3B A;  1DW2 A;  2DVH A;  3PXS A;  2A06 D;  2FYN B;  3MK7 B;  1EB7 A;  3PH2 B;  2B12 B;  1ZZH A;  4YE1 A;  5CIE B;  1AOQ A;  1HZU A;  3VRD A;  2C1D B;  2MTA C;  4PWA A;  2B11 B;  1FI7 A;  1KB9 D;  3OCD A;  4EID A;  1CXC A;  1CTZ A;  2CA4 B;  1S5L V;  2VHD A;  1CYC A;  1CYI A;  2N9J A;  1E29 A;  5B66 V;  1NTM D;  1I6E A;  3SXT A;  4UB6 V;  3O20 A;  1IQC A;  3HQ7 A;  2GC7 D;  3CXH W;  3SWS A;  4H0K A;  4XXL A;  3WU2 V;  3HQ6 A;  1GDV A;  4WQC A;  3ZOO A;  1WVE C;  1KYO W;  4UB8 V;  2V07 A;  5EXQ A;  3A0B V;  3ZBM A;  4WQE A;  5GTH V;  1IZL 0;  1LC2 A;  1W2L A;  1CXA A;  2GIW A;  3L74 D;  3O5C A;  1C6O A;  1QKS A;  5CIB B;  451C A;  4QAO A;  4L3H A;  1DVV A;  3O1Y A;  1CRY A;  1CRH A;  1QL3 A;  1IRW A;  5KKZ B;  1CTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...