2FWOA

Mhc class i h-2kd heavy chain in complex with beta-2microglobulin and peptide derived from influenza nucleoprotein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
275
structure length
275
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Structural Definition of the H-2Kd Peptide-binding Motif.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/viral protein
total genus 74
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fwoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2fwoA01
2VLJA 3O9WB 3SDDC 3BWUC 4PRPA 1UQSA 3KPNA 4QRRD 2WINA 1X7QA 1FZMA 1AGCB 3TBSB 5MEPB 1NEZB 5AAWA 5HHVL 1ZANH 5BV7H 1QFOA 3VXOB 3TA3C 2X42A 1I9RL 1QFWM 2W60A 2YRZA 5EZLA 2D7PA 2KQMA 3SKNA 4JRYD 4G6AD 2P4AB 3WDJA 4KK8D 3QCVL 5C08B 4G59A 4X4ME 2EKSA 5A1AA 5DURB 2K7PA 3CH8A 3S35X 4OLEA 3L3JB 1XGTB 1NSNH 3QXVA 1V8HA 1ONQB 4F2MB 4JKKA 5ADOH 5DR5L 1NAKH 5DUBB 2GT9A 5TDPB 3SCMB 3IETB 2ADIB 2MMXA 4OUUB 3MBEC 4JPVH 3ARDB 1KXTB 1R24A 3T0EC 1MNUL 2ORBH 2IBBA 3BGMA 4K8RC 3AGVA 5ICYA 1VKXA 1D6VL 1EJOL 1ACYH 3GHBH 4R0LA 2ICWA 3ULSB 1MRDL 2BMKB 5MEQB 5DWUL 4RA3A 3QJFB 3KPQA 4LIQH 4LVHB 1A64A 2HT3C 3KYOA 3SJVD 3DSNA 4IMLB 4WFFD 1AI1H 4Z77A 3B8YA 2LAGB 4F7CB 1C1EH 3MV9D 4OZGB 3MFGB 1HHJA 3VD7A 3U6RB 4I1NB 4O2CA 4X6DA 3MR9B 2CRIA 3SDDA 2GY7B 2P8MA 1M7IA 3U2SA 1HHIA 2XTJB 4OFIA 3OHXB 4XMPL 4PGDA 5C7XH 3BZEA 1DLFH 4NO2B 4IRJD 4OIBA 3ARYA 3S3PA 3G6JF 1FNGA 1OGTA 3TA3A 1UXSA 4FHBD 1P84J 1UENA 3MFFA 4OCXH 2D9QB 2BY0A 4RGND 3PIQA 4YHML 1J1OL 4BFEA 1KCUL 2Z31D 2DQTL 5C0FA 5C1MB 4NQCD 1XGRA 3HPLA 1I7ZA 2MQ3A 2NPLX 2E8ZA 4M3KB 5D72L 2A83B 3WN5B 2VE6B 4G3YH 5KOVC 3FO0L 2E27H 3DNKA 2HWZL 1LEKB 4ZS7H 5LXGL 1YN7A 2A74B 3H3KA 1UWEH 2X4PB 3PP4L 2EYSB 4TVPL 4PBVC 3T0EA 3MCLH 5KVEL 3GMQB 5FUCE 15C8L 2UZIH 5EUKB 5T1LD 5TQ2H 5E9DE 4RMSA 2GSGA 2OLDA 4HHAB 3ET9F 1J8HB 4HIJB 1OARH 3C5ZD 1BGXH 1F42A 4JQIH 4M7JH 4I0PB 5I66B 2NY3B 3WIIH 2OL3H 2XKSA 2EXWC 3HZKA 5B39B 4WU5A 5JHLL 4PB9L 3SGJC 3HPJB 1FAKT 4JFHD 4JM2B 4JVPA 1C5DA 5ETUB 2X4NB 5D2NC 5DRNA 3A6BH 5K33A 1HSAA 3E6HA 3B9DA 3MRQB 5F9JA 2IC2A 3FQUA 1QLRB 5E4EC 5AWNL 3G9AB 4EUPB 1JGEB 3TZVC 2CDEA 3BAEL 2IPKA 3C60D 3KLSA 2J5LC 3SE3A 1JPSH 4CNIA 4XCNB 1RULH 2VDLL 3KXFB 4P2QD 3BKCL 3SN6N 5T5NF 4LASL 4Q6IB 5E2TH 5C08E 1CE6B 4QNPE 4IHOB 4TVSa 2NXZC 4W6YB 2HLAA 1BZ7A 4MAUL 1OSPH 2ZUXA 5SX4I 4M7KL 1M7DB 1X5HA 2ITDA 4F58L 3NCJH 3JWOH 1NMAH 5FHBH 5DRWA 1YYLL 4M00A 3VFOB 5BJTA 2YKLH 1DCLA 3S96B 3DX6A 2FBJH 3VDAA 4O9HL 1JYWA 3L7FB 5IW6B 5A16A 4ZDHB 1IAOB 3HUJB 4LVOB 5HGHA 1BVLA 3KWWA 4QHLB 1WFUA 5IVOA 4GMSL 4QXGL 2LABA 2FJGA 2C1PA 5HHNA 3VWKB 3BKJL 4UMGA 5IJKA 3RZCD 1QUNA 1WSST 4GXUM 5C86A 1S7WB 1B0RA 5A2FA 4EQ2A 4PRAB 1CZ8H 4OZGE 4BQBA 4K23L 5TH2A 2K7QA 3SGJA 4D9RE 3CSYB 4P3DB 5IB1A 1DDHA 4MVBC 1T03H 4TTDC 1QLFB 4X4YA 3TZVA 1I3RB 1G0YR 1NGWB 2E8YA 2R2EA 4WW2B 1EO8H 3P4LA 5F97E 3JUYA 5DVOA 3NZHL 2EH8L 4LSTL 2DIJA 4FQ1H 4HK0B 4XPFL 1BZ9B 4JDTL 3VGAC 1T1YA 2GK0B 1FL6B 5KTEH 2PTTB 5IHUL 1J05A 3HI1A 5DHYA 5DJYB 1Z9MA 4O51B 3CX5J 4A2LA 4AK1A 5J4MA 2EDEA 3PWJA 4OBRA 4K9EH 4Y0GA 3UC0L 4ISVB 2A6DB 2V17L 4JFYA 2VUYA 1MFNA 4YHPA 3JXAA 3UP1A 4WTXA 3RY5A 4JDVA 1CWVA 2O26U 4KK9D 2WBJC 1AY1L 2VXSH 2ZOKA 4O58H 4BSVA 3ARUA 3ECBA 3SDXF 1RZFL 3FAXA 3QEUA 4LVEA 4IOFC 1RHFA 1VPOH 3BMWA 4Y4KA 1MCJA 1MCBA 4V1DB 1S9YA 4WI3A 1I9JL 1LK2B 5BS0B 1T1XA 1A6VL 3GI9H 1PYWB 1S7VA 3F5WA 2A6IB 1T6VN 5IESH 3PGCA 1PZ5B 1R3IL 2W65A 2VLME 4D94A 4R26H 4MVBA 4X9IA 1DLHB 1F4YL 2YA0A 1AQDB 5IR1A 4YWGL 4LHQB 1JZ7A 3EJYD 5BZWB 2F54A 3W9EA 1Z9OA 3EO1B 5EC1B 3M17B 5MEOB 1HHHB 4PLNC 3GKZA 1SJEB 3H7BA 4K8RH 5GRVL 4G9FE 3P9WB 4K2UH 4DW2L 2EDKA 4F15C 4FXGB 4MQ7B 5SWSD 3BT2H 2GJ6D 3D85D 2F58H 4PS4H 4CU7A 2QQLL 4PJAB 2APXA 3ZTJH 4MD4A 2BVYA 2VL5B 1MEXL 3KLDA 4HPOH 2QJDA 4KK6D 1MJ8L 5T1KA 4KZDH 1AD0B 4D2NA 3DRQA 5ISZE 2DQUH 3IXAA 3TYFA 4MWFB 3VXRB 4ODVL 5D71H 2WBJA 5I8KH 3GMRB 2O61A 3O8XA 1YPZA 3MV7A 4O02H 4OLYH 4K7PY 4W4OC 2A77L 3HA0A 2QHRL 1J0IA 4QRPD 4QXWA 4MCYA 3IU3A 5FYJE 4NRXA 2E6QA 3TH2T 3MOAL 4HKBB 4P5TD 1TLKA 4PJ7A 2HMIC 4LCYA 5HYSB 3MLYL 5FO9A 1ORSA 5JLZB 1CD9B 1TZHA 3OBAA 4NKDA 4NM8L 4XMLL 5D6CB 5FUZH 2ZUYA 4JHWH 5TDOA 4XWGL 1INQA 1OGAA 3UDWC 5EORH 3RL2B 3R8BB 4FNLL 5DQJA 5I1LA 4PYHA 4JFFA 5LBSH 2R9HD 1YY9C 3HFML 3OJMB 5ICZA 1XIWB 3QCUL 3BP4A 1V3MA 3QUMH 4JZJB 4OLZH 1ZVSA 2I24N 5CJ8A 2FZ3B 2UV3A 2C3WA 4JN2B 4QTIH 2C4XA 3IFPA 1WEJH 4L4JA 4OCMC 3R8QA 4OGAD 1T4KA 3EGSA 1W0WB 5KANI 2R1XB 2J88H 3WXWH 1OTSD 3OKNA 1Q9WB 3ULUD 1XFPA 3DRTB 4PG9B 3MRHA 4EIGB 4UT7L 5CBEB 1NEUA 3VFMA 1JWMB 3O45B 5IW3A 4G80B 2ARJB 2VDRL 3O6KH 2C7UA 1A14L 3UEZA 1EMTL 2YPLE 1UACH 1I8IB 2C3GA 2HVJB 4NRZA 3ESVF 3MLRL 2ILLA 1LP9B 4BQ8A 4FFVD 1F4XH 4U1KA 4W6WB 5ERWB 4P23C 4W4OA 4KGJA 3NPSC 2VH5L 4QRTB 5DRXA 4XP9H 4FQ2H 12E8H 4MXVF 3DXAD 4L8BA 4TQEH 4EBQH 3KPSE 3KPRB 2FDBP 4JZOB 3ARZA 5L6YH 3PV7A 3OG6B 4KHTH 2VXTH 4WHCA 1EUUA 4LEOB 1X5FA 3NFSL 3AS2A 2YD5A 3JZ7A 5HI4D 1P4BL 2IJ0C 5IB4A 3HG1D 3RKDC 5D1XA 3UDWA 1YNKH 1F58H 2P5EA 4S1QH 5DZNA 4MJ4A 1WISA 1TTUA 2E5EA 3P9LA 3HR5A 5CEXB 1DBAH 5B8CB 3G6JA 4F7PB 1L7IH 2VDKL 4E41E 3H42L 3NAAH 5DMJB 2FX8L 1UJ3B 3BQUB 5I6XC 1F6FB 1LHZA 4LDLB 4X7DC 4I4WA 2DTMH 3BZFB 1BD2A 5KSVA 1LNUA 3RIFK 5GZOD 1T7ZA 1LDPL 3MA7B 4IIQB 1B4JL 4QF1A 4LSQL 4MYWB 4RZCA 2X4TA 3OKEA 5I2IB 2W59A 4PJXB 3VXRE 2F8OA 3Q3GB 3GSNB 3QWQB 1RJYB 4FXKA 3CUPA 1T1ZB 1OAXH 4L8DB 4K3EH 4QHKI 4P4RB 2IADB 1GZPB 2Z9TA 3OF6A 1JNHA 1KPUB 4UQ2A 5MHSE 3IKKA 4LVNC 3L7EA 3TBYB 1S7XB 4G6KL 4XVSL 4D3CH 4PJ9A 1K9TA 1KPRB 4P23A 1A4JB 2CLZA 3ORJA 2AKRA 2ICES 1CDYA 3TN0B 3AU1A 3CVIL 1KCKA 4R2GC 3Q1SH 4JY5L 4MD0B 4XNXH 5DC0A 2ZUTA 4CN6A 3IJYA 3QJHA 1T3FB 2D7QA 1DN0B 3RWGA 2NY5L 2B8OT 3I75B 1EDQA 2HKHH 5IG7B 3WHXB 3WUZA 5FYLD 2H41A 4E42A 3D25B 3NCYS 1L4IA 3LN5A 4M4RA 3GSNL 4GRMA 4IDLA 2FYYA 4OKVB 1OD7A 4O5LH 4L5FH 3BIAX 3V6FB 5AZEH 3QXAA 4JKPH 1MCOH 4N5EC 4NQDA 4LPTA 3OB0H 4UDTA 1JMXA 1RK0B 3TWCL 4F7EB 2ZSVB 2Q86A 3QWOA 2G9HB 3RVTD 1N59B 4HUWA 3H9SD 3MLZH 5JORA 3H3PH 4YJZL 1DQLL 4P48A 3MUY1 3WLBA 1LP9E 1GZQB 3CSPA 3KPOB 3C5JB 4LLYA 3R0NA 2FD6H 1GJIA 5IKCA 2ICWI 3FFDA 1OSZB 4WJ5B 5IVZA 2IALB 3RIAK 5LAXA 5EN2A 3IAPA 5J06A 2HFGL 3ARED 1SJHA 5DQ9B 1NQBA 2VDMH 1ZE3C 3S35H 1UVQA 4XXDB 4RNRA 2XWBA 4NZDA 1KN2H 1XF4B 1XT5A 4EN3C 5C0RH 4J12A 1I3VA 4QGTA 2EZ0C 4MDIA 4OFKA 4M8QA 1G7IB 2CIKA 4WFHD 1WFOA 1EO5A 3CVHL 4ENEC 4JG0H 3V5DB 3QFDA 5J12C 5GSVB 2YC1B 2DL2A 1QNZH 1A1NA 3RWIB 3UTZB 4LOUC 4UNVA 1A7RH 4AEHL 1CGSL 2NZIA 4Z7WE 3ABZA 2J8UE 4XZUB 3G6DL 1FVDA 4I5BB 5F7EH 4XVUD 5E8DL 2X4OB 4XNZC 1GSMA 3VI3F 2GUOA 1IBGL 5SX5K 5HHXH 1MFCH 4DKDC 5M95B 5GGTL 3DBXA 3B9KA 2X7LB 4HJJH 1GGTA 4PJXE 4LNVA 5T1DL 4NO0A 5EPMB 1I1AB 3BX7C 4GAJH 4GUPA 1HZHL 2DM2A 4PRDB 3U4EA 4JFPB 3FONB 4P4KC 1HI6B 4ODUA 1PQZA 1KYOJ 1KJ2H 1GRWA 4HV8A 2IAMC 3SDXA 5GS2D 4GRLD 2YD8A 4KI5D 3EOTL 2J3SA 5L88L 4FZEH 1YEEL 3VG0H 2ICEA 3QZWA 1J1XL 5ACLA 4BZ2H 1MVUB 2ZUSA 4S2SB 4EN3A 4JO1H 5EZJA 5ESVB 4UIMA 3IVKB 2GCYB 1W2KT 2RGSA 1DQTA 4HZAA 5D1ZB 5HI3C 1ZWIB 4YBQC 4RA0C 4JHZA 5EOQH 4WNQA 4R7NB 2VUOA 4B50A 3UJIH 2Z35A 3A6OA 1QKZL 4U6HA 2Q8AH 3QDMA 1GYAA 3WFDH 1P5VA 2QKIA 2Y6SD 4PJGA 5MENB 5DUMH 4OFDA 3MV11 3DETD 5FCSH 1NFDF 1MQ8A 2EYRA 3X11A 1C5BL 5F9OL 1IGTA 2NY6D 1FO0L 4YHIA 3WSQL 3HAEB 4L3EB 4KTEH 4GRWF 4NJ9L 2HJKB 2DM7A 3BH9B 1F3DJ 3ZTNL 3FAWA 4KJWD 2V9RA 4IRSD 3QNYB 5MERA 2AABL 4YHZH 4U1HB 3TBWA 4DQOH 3LQAC 5J8OA 1G7MA 4ZFZB 1MIEH 4K7PX 1REIA 2PW1A 1IARB 4ZUVA 4M3JA 1A9BA 4WUKL 1LEGA 5E2VL 2Q76A 4KROB 2A6KA 1RUQH 3BD5A 2R23B 5ESQA 3ZL4L 3IJHA 3D39B 1UH2A 3DGGB 4AIXA 1CG9A 3X3GL 2NW2B 2O5XH 4PREB 4LGPB 1EFQA 3QAZB 5D7LB 1FVEB 5KS9B 1QLEL 3J8F7 1CU4L 4Z7UB 3QFJE 1X4ZA 2EH7H 1BBJA 3OGCB 1Z9SA 4WWKA 3FZUC 2VZUA 1E4XH 1TPXB 4L4VD 1C16A 1NGQL 1KB9J 2OJZL 3RWHA 5E56A 2I9LB 3OXSA 3W82A 4RFEB 4L9LB 1RZIA 3FQNB 2R0KL 3RTQB 3AS1A 2HT2D 3FB5B 5EU7C 4EDXB 2JJSC 3OL2A 4S1SH 4YEFA 3BPOC 5C3TA 4WW1A 4X8XA 5IMLA 3GBMH 4LGRB 2EXYD 5IB5A 1L6XA 5I1CL 4Y2OA 4PP1C 4AENA 1IQWH 4TTGA 4YQXH 1BEYL 3NZ8B 1QHOA 3HKFA 5EU3A 5E08L 4ZFFB 2XFXA 4U05A 3PWLA 5CKAA 4NQXB 5KVFL 3PXJA 2BCKB 3VWJD 2QQNH 1OAQH 2O5ZL 4D9QE 4Y1AB 5I15L 4G8GE 3MLTA 3BPCA 4NQEB 2GTWA 4F57L 1JZ2A 4OCRH 5IMMB 1HIML 4KKCD 5FIEA 3TIDB 3LN9A 1MH5B 3SDAD 2DWDA 1KNOB 1UZ6F 2Q7YB 2XI9A 3K0WA 4NOBA 4AL8H 2EKJA 1IAIH 3WFEH 5C0CB 1DQJB 4HJ0C 4FQXD 5IFAL 2HJFB 3PABA 3VD5A 3QDGD 5HVHC 2W9EL 2UY7A 5I1EL 3QXDA 1D5XB 1G7JB 1T5WB 3IDYC 3VGEA 3IKCB 1Y0LA 3SGDH 1NUNB 3BKMH 1EAPA 4JEGB 3GMPA 3ZDXF 3B9EA 1QSFB 4ZSOE 4NHUE 5ESAA 2F5BL 4WWID 1Q0XH 3EAKA 3K2UH 4P5MB 4X9FA 4F8TA 2B5IB 4M7LL 2FGWH 4UB0H 3VFTA 4G8EA 4RDQG 3VRLF 5I19H 4R7DB 3WE6B 4X9HA 1MHPL 2AV1B 2R1WA 1MHEA 4JREB 3Q5YA 3FFCD 4KTDH 4NNPL 2HRPH 2AERT 4JFXB 1FG9C 2Z8RA 3LKRA 3G04B 3L6FA 4Z78A 2GHWB 2WIMA 4XNYH 1SY6H 5GGRY 3SBWA 5E5UB 3K7UA 5IF0B 2R0ZH 1K6QH 4MX7A 3IU4L 5DUPL 2Z4QB 1WAAA 4NP4L 4ONGL 2VC2L 2FEDD 3IDIA 1KG0A 3ZDYF 3U0PA 3K2MC 5GJSH 4LAQH 1P4IL 2E7CA 1WBXA 5C0IA 3WIFB 2ZCLH 4JFZH 4PGCA 2UZXB 4FTVE 4X6FA 3S34L 1HHGA 1P7QA 3H0TB 4PJ8B 4V3EB 1QSEB 3KPLB 3D39E 1PLGH 3E2HC 4WUUD 2OZ4L 4JM4L 2NX5B 1XF2A 2DI7A 4YHYC 1BFOA 3JV6B 2GFBB 2VDQH 3DYMA 1A3RH 5M7QA 2NR6C 3QO1A 2G5BA 2BVPB 1A6TA 4OFPA 3ZDZE 4NQUA 3O9WD 4PJEB 4TUJA 2W9LA 5IQ9B 3WFZA 4UV7H 3GM8A 3PGDB 1MI5E 5FKPA 1I3GL 1E27A 5C6TH 2A1WL 4HIHA 5EBMA 4JM2F 1CYGA 3RVUC 4F80A 4QHMA 4M61B 3GSOB 3D2UA 4HKXA 3FN0L 2DQFB 1RURH 4ODBD 3MRBB 5BO1H 1Z3GL 5C08D 2ITCA 1E4WL 3F12B 4D0BB 1FSKC 3OWEA 2NY0C 2P7TA 4HUXA 4PP8C 3S88H 5E8NB 4WCYH 1FZJA 4MXQC 4TUOB 1Q0YL 3GKWH 4WEBL 4UINL 4OLXL 5E00B 2ZUQC 5EDXA 5GXBB 1AO7B 3IJSA 1FV1B 1AHWB 4UTBH 4Z0XA 4NKOB 3ZE2F 5KZCB 5TJWK 4HEME 5HHQA 1FFPB 3FQWB 1NCWL 5E7FA 3WXVL 3U0WH 1FLRH 1CL7H 5JW5A 2DIBA 1HCVA 1FH5H 4LSRH 5CD5D 1TMCA 4IS6B 3WIHL 1EXUB 4X6CF 5D7JA 1HH6A 2XPGB 5BZDB 3LKPA 5FM5M 3E2HA 3OJDA 3OR6A 3B2VH 2ADGB 3U79A 2EO9A 3PWPE 3Q6GL 3SKOB 1JPTL 3HUJF 3G5ZA 4FABH 1UM5L 3GBNL 4TVPD 4JKLA 3UTTA 1QSFE 1Q9KA 5CGYC 3VXSE 1MJUH 3KPMB 4OFYA 1EEQA 4XBEL 4RBPK 2H2PC 3UTQB 5CBAB 1Q9LB 3VFVA 3P11L 4OCYH 5D5MB 4UT6L 1N6QH 5E6IA 1LO0H 5I75C 1WZMA 1RUMH 4PJBE 5ANME 5I8CB 3LQAH 1IEAB 1TNMA 3ARBB 2DBLL 4E0RB 5DJ8B 1S7SB 1JFQH 3S37X 2VZOA 2OBGA 3IDXL 4YDIL 2A73B 2OJEA 4NRYB 4FFYH 4HPYL 2B1HH 4G8IB 4CL7A 3LN4A 4UT9H 1YEGH 3WNKA 3SKJH 5DFWH 2P5WB 4WTZA 1E28A 4WW2F 4KZEH 3IS0X 3ROOA 1NJ9A 3GGWA 3SKMA 3L3IA 1NBVH 3TP4A 1Q9OB 4N8CL 3DX7B 4NIKB 1ND0B 5HD8C 3EYVA 4NT6A 4RX4A 3W2DH 1KTLA 2RR3A 5IEKA 3QIWD 2YD4A 1QSEE 2G5RA 5EWIL 2ZCKH 5TQ0H 1F3JB 4M9OA 2JJTC 3TF7A 3MRRB 2WZPD 1PJ9A 2NY1B 1J0JA 3UO1L 5ITFB 3LH2L 4BJLA 3NGBB 2JB5H 1V7MH 4I0PD 1UB6B 1YMHA 2P43B 3B6SB 4KVNL 2EEAA 3BP7B 5IK3B 25C8H 3WS6C 2FJHA 2F5AL 2BVQA 4PJEE 1T2QL 2G2RB 4WFEE 2OP4L 2IANB 3P77B 3KYKL 2J4WH 4D0DB 1Y6KR 2DKMA 1KN4H 2VLMD 5KSBB 3Q6FB 2A0LC 5I73B 1MHCB 4EOWL 4GW1B 2EYTA 5HY9A 1HQRB 4GG6B 5CJXC 1I85A 1EGJL 1QVOA 4ZS6D 1O7VA 1OP5K 4U1IB 4J8RB 4RWYH 3DUSA 3FHAA 1MCPL 2D2OA 1UZ8A 4G9FD 4KY1H 5KN5B 5D70L 3FMGH 4MNHB 4QHKJ 4XVTL 3GSVA 1NFDA 1N4XL 2GITB 4AZ8A 2N1KA 1BVKA 1MFBH 2XZZA 4LSSH 4G7VL 5T1MB 2HA1A 4CADB 5FO8B 4ZOAA 1E4XI 2F8VA 1A6AB 4G5ZH 2G60H 3JBG7 3DMMB 5FA4A 2NLJB 4X8JA 3VG9B 1DFBH 5LKNA 4N0FA 1IEBB 2Y1VA 1T7YA 4KUZH 1MREL 4LLDB 4PJAF 4OZ4B 5ISZD 4P0DA 3FB8B 1VGEL 4R97C 4XWOC 4Y4HC 2A9NH 1GAFH 4TUKL 3SOBH 3MRMB 3VWKD 1YY8B 5EC2B 4YX2H 1OF2B 1SBSL 3PWNA 4U1NB 1U93A 1IC4H 1ZTXL 1LILA 3PWVA 5D1QC 3W0WA 4ELMB 1YNLL 5JDSA 4PGEA 4OD2A 2BDNH 4WHYG 1TQBB 1NCAH 3WS6A 2IMMA 1EHNA 4FP8H 4PPTA 2ZNXA 5J57B 2VQUA 5HYEA 2JJWA 4G8FA 3CFDB 4N0CA 3QXWA 5EOTA 1OOAA 1G6RB 1XEDA 3WEXB 3VJ6A 2OTWA 1IAII 1RK1A 1KV3A 3O3BB 1MLBB 3O3AA 1JTPA 1IJ9A 1U3HB 2WIIB 2PYEA 3TNMA 1B6UA 1DE4B 1U8IB 1IGJB 3DTXB 3QG7H 2ICWJ 2DQIH 3L3HB 1EVUA 4U1SA 1AGCA 3V5KA 1IKFH 5FDWA 3SGDI 1SMOA 4L4VE 3BUTA 1JZ5A 1SHMA 4X5WA 3RUGA 3X13A 1BJMA 4F7TA 4E9LA 3HMXL 3QI9B 4HWBA 3W39A 3CCHB 4MB4A 5C3LD 3TNNB 1DBJL 3NACH 4OZFB 1AKJD 2AJ3A 4N90D 3O4OB 4MXWH 4QLRA 3MROA 4Y4HA 1AIFA 3FN9A 1QBML 5HSFA 1LVEA 3SDCB 3N06B 1RZGA 2DJ4A 1RZJH 1A9EB 2IANE 3O6FC 3NCMA 4JY6B 3OSKA 5I1KH 3QH3B 4D0CA 3IFNL 4QRUA 2C5DC 4HZLA 3TT1L 2DRUA 3KPSD 4DN4H 2QBWA 2EIDA 4R9HA 3I02A 5HDLA 4PBXA 4YHKL 3EZ8A 4QOKA 4GFTB 5FO7A 3KPTA 1TVHA 3MRKA 5CHNA 1JIBA 3VXUA 2R4RH 2BJML 3E6FB 1NC2B 2J8OA 4G6AC 2AJXL 2OTUB 4KK8C 2VABB 5DD3H 3GO1H 1RUPH 2B1AH 2C4FT 2CKBL 3S9DB 2F53E 5DQDL 2ZPKL 2HRLA 3LS5L 5B3JF 3EKCA 3WO4C 1T2JA 5C9JB 2AGJL 4E41D 4U33A 3VFWA 4YO0B 3BXNA 5IQ7L 1IM3B 2BVTA 5FF6B 4AM0B 2FX7H 2NY4D 1S7RA 2AJYL 4FFWD 4X7EC 3CH1B 5C0EB 1SVCP 5CWSB 1FIEA 2H2SD 5BXFA 1S7QA 4WU7B 5GIRB 1UXWA 4M6NL 1F2XK 1R5WA 4DEPB 3NABL 3QDJA 4H88H 2V7HB 1YQVH 2ZUWA 2Y5TB 3LIZL 4XNUL 3VXRD 2D9CA 1A8JH 5ALCH 1JGLL 1KPVA 5HYJE 2CDGB 1BWWA 4IRZL 1MF2H 4JO4L 4RMQA 2VLRB 1RQ5A 2C3VA 2PW2B 4PGJA 1GOGA 2VE6A 2BK8A 5MHSD 1SM3L 1EERB 5T3XL 5DFVD 5IT2L 5D2LE 5LWYL 5KSUA 1A2YA 1ZHBA 5CJ5A 3MCG1 1YECL 3HLAB 5IIEB 4LRNH 3O6FA 1YEKH 3VFPA 3PP3H 3BIKA 2AK4E 2PNDA 4UQ3B 5JOEA 3HC4H 2E7HA 4K3HA 3BDYH 1KT2A 4NC1C 4HLJA 4M5ZH 5DVNA 1CL7I 5J9PA 4K7PH 4G43A 1H8OA 5JQHC 3VDBA 3FO2A 3HRZB 4IRJC 1KJVB 3PQYE 4GKOA 4LLWB 5HDOA 3EOAB 1BBDH 2FO1A 2BNRA 4JRYA 3BW9B 3PG2A 1XIWD 4PBWD 3KR3L 4RGNC 1X3DA 3MACH 2F19L 2Z31C 3RKPA 4X98A 3O2WH 2HFFA 1PKQE 1T2XA 5H2BB 3EYUL 1IGCH 1XZ0A 4HT1L 3GB7B 5ALBH 3OKOB 3U83A 3PL6B 5I1IH 2VLKB 1YMMB 1DBMH 5F96H 2NY2B 4HGWA 3L5WB 3P4OB 1KIUA 1DBKH 4XCNA 2AQ1A 3KXFA 1KULA 1UB5B 3QZWG 3ZLQC 5DEZA 5IV2B 3U1SH 1E6JL 3FQRB 4XBPB 4YK4C 4LPWA 4ZUUB 2MKLC 3V6ZA 4C56A 1R3LA 2AP2A 4RAUB 3HNVH 4OM0H 1UEYA 4O4YH 3UZEA 4CAGA 1MIMH 3LPFA 2YMXH 3C5ZC 5HHMA 5H94B 4EI5B 4R4FL 1NSNL 4X6CA 1IGYB 5C0JB 3GI8H 4BQ6A 4IDJL 4HKZA 4XVJH 4ZUTA 2YD7A 2HFEB 35C8H 4JPVL 4RFNC 4HX1A 4PRHA 2XOTA 3HZMB 2ORBL 1NLBH 2P24B 2BX5A 1GPOL 2R4SH 3C60C 4I77H 3STZB 2RJMA 5BVPL 1ACYL 3GHBL 3HI5H 3UPAA 1CQYA 3MX0A 4O2EB 1OM3H 1HSBA 3PP3K 4HWBH 5HGBB 4BYHA 5MI0C 2XKNB 5DFTA 4KQ4H 3QSKB 3KS0H 1AI1L 1ADQH 2Z31A 1C1EL 4YDKH 5F8QC 3QIUD 3TCLB 4P9MH 3EOBA 4IOIB 4M1GL 4JGJA 2DI8A 1R3JB 2W0FB 5EUOE 2XN9E 3V5HB 2BXYA 2ESVA 3MJ7B 1MAJA 4XCEA 3CXHJ 2AJZA 3WHE1 1OY3B 5C7XL 1DLFL 3WKMH 2OL3B 2PR4H 4QTHB 3EJJX 2PCPA 3LRSB 5EFIA 1FL6A 1IFHL 3O4LE 2OXGA 5DK2B 5L8JB 5F3BB 4GG8B 5T1LA 1CDJA 4PGZA 2RQ8A 2VLRE 2V5YA 4FQIL 1MHHA 4UV4L 4CMMA 4JO3H 3NCEB 2ZJSH 4GBXC 4KI1A 5DTFA 3C8HA 4NZTH 3C5ZA 3RZCC 4P46D 4F3FB 1QYGL 2P8LA 2CGRH 4PV8B 5JHDB 4G3YL 2E27L 1T66D 1NMCB 3N1PC 4ZS7L 3TN0D 3FTGA 1LDSA 4X6EA 3IDMA 1OT2A 4NCC2 5JUEL 4Y4FA 2VITA 1ORQA 2VAAA 5IVXF 2R8SH 3IDGA 4OM1L 2Y07L 1JYXA 3MCLL 1FGVH 3C60A 2UZIL 1WCBB 1BAFH 3TJHD 5FCUH 5BVJA 4P2QA 4HQQL 3BSZH 2YUWA 4L4TA 4NUGL 5ILTL 4Y19A 5LVEA 2LVCA 4HIXL 4NM4L 1Z2KA 2YD2A 4Y7MA 1BGXL 3STBA 1Q72L 1K8IA 5JO5A 1VGKB 5I18L 4MDJA 4LCIL 3O11B 2VLJB 1U8NA 2X4QA 3NTCH 4PRPB 5GJTH 4NJAH 3PE9A 1UQSB 5IWLA 3KPNB 3A6BL 1DEEB 1KCVH 2WINB 4Z7VE 1X7QB 1FZMB 1V7NL 2HG5A 1EFXA 3ARFC 3K1DA 5F7DA 2APVA 2W60B 5EZLB 4RAHA 3SKNB 3RJQB 1JPSL 4AQ1B 1GOFA 3BD4A 4P2OA 5EU6A 4IJ3C 4KK9C 5E2TL 1FNSH 2EKSB 3JSSA 2WMPA 3B83A 5HVGB 2GSIA 4Z0BH 3B5HA 5B3NA 4YXLL 4GBXA 4ONFH 1NMAL 2RFXA 2GT9B 1CLOL 5C07A 4P59L 2ZG1A 3GHEH 2MCPH 1R24B 4WTWA 2MQCA 2JE8A 2UYLA 3BGMB 4Q9CA 5ICYB 1VKXB 3MGAA 2DJSA 1S9WA 4PB0L 4R0LB 1C7SA 2ICWB 3ZE0E 3G5VA 4S0SD 1B9ZA 3QFJD 1FYTE 2X4SA 3CNKA 3EJYC 3KPQB 2I5YH 3RDTD 3HNSL 5FHAL 3QEQB 1G7LA 1DUYA 3KYOB 2HT4C 4OGYL 1KELH 1W72L 5LGHH 5KOMC 4Z77B 1GHFL 5KS9F 5H8DA 4Z7UF 1HHJB 2JCCA 1CZ8L 5I71C 2DLIA 1KCLA 2AEQL 1P1ZA 4O2CB 4X6DB 4K7FA 5C0ND 1ZLWH 3SDDB 2P8MB 1JV5A 2R0LL 1M7IB 3U2SB 1ULVA 3UJTH 1HHIB 3RL2A 4PGDB 4ORZC 3ARFA 3UBXA 3BZEB 3TA3B 1FNGB 1OGTB 1UXSB 3VXNA 3VXQA 3WMSA 3MFFB 1I1AD 4N8VG 4HK3J 3PIQB 3LEYH 2EDYA 4XC1H 5C0FB 4Y5VC 4D9QD 1XGRB 4G8GD 3HPLB 1I7ZB 3DV4A 3JV4A 2GJZA 3S37H 4UOW1 2Q1EA 2D31A 3DSFL 1YN7B 1WZLA 4P5TC 1Q1JH 4KJYA 4LKXA 3VD9A 1JK8A 5K9JL 3MQIA 3MLXH 1UJTA 3QR2A 1F5WA 4JFEE 3T0EB 3X3FH 3DHJA 4M5YH 2ENYA 1PVHA 4EEEA 1KCRL 3D0LA 1L8JA 5TFSL 2GSGB 1QRNE 4OF6A 5D1ZD 5IJVA 2VXSL 2MCG1 3FOLA 3BWAA 1TJHL 4XH2A 3CLEH 3F7RA 5GGRA 5AZ2L 1II4E 3MRPA 1T22A 1I75A 1I1RA 3HZKB 4CKVX 1VPOL 4EQ3A 4WU5B 4PLKD 2V6HA 5KVDH 4JGUA 1Y6NR 1C5DB 4KVCH 5DRNB 4LMQE 2CDFA 1HSAB 3E6HB 2GJ6A 5F9JB 3FQUB 3D85A 4OGAC 3KLHD 1NC4A 1HE7A 2CDEB 2IPKB 4U6VH 1KEMH 4L3ED 3ULUC 4CNIB 3I6GA 4PJ5A 3G6AA 1L6ZA 4YDLB 4GOSA 2X1OA 5A2JH 1NPUA 5CS7A 2HLAB 1BZ7B 3DJ9A 2YPVH 2V9TA 4K8RL 4OZIA 1HDMA 5SWQA 2ITDB 4Y5VA 1LQSR 4FFVC 4NKMA 5DRWB 1D5BA 4NHCH 4KH2A 4FTVD 2F58L 3DX6B 4PS4L 3BZFA 3D39D 2HVKA 5IB2A 1A4KA 4JGMA 3GNMH 3ES6A 4P5TA 1OAKH 5A16B 1IE5A 3HE6C 1NLDL 5HYIA 3MV8A 3I9GH 2HLFD 4OAWA 5HGHB 1BVLB 3NN8A 3KWWB 5DVLA 4WTZG 4BZ1H 4XNMA 4Z8FL 5HI4C 1ZS8A 2FJGB 2C1PB 3QUYA 5HHNB 5I8KL 5CIPA 2BSTA 4OCWH 4PJHA 4Q6YA 1B0RB 4RMUA 5TH2B 5IVNA 5HVWA 1JRHH 5I1JL 1U92A 4PRIA 2B7DT 1A47A 1DDHB 1QFPA 2B2XL 3KYAA 5IB1B 2QLVB 2DQCH 3H9ZA 5E4EB 5C0BA 4X4YB 2WLYA 3TZVB 4S0TD 2R2EB 4DUXA 5GZOC 4OCSL 3V0AC 1KCSH 5FUZL 1A0QL 5CLTA 5HYQA 5KVMC 1T1YB 4QWWC 3UYOD 1H5BC 1NAMA 4PJIE 2XIDA 2NXZB 4WI7A 3EO0A 5J3HD 4U0RC 3D9AL 5INCA 1CF8H 1J05B 1CICA 5FK9A 3RY6C 3HI1B 1VACA 5J1SC 5DHYB 3O2VL 4Q9RH 3QCTH 3T2PA 4LRIA 4KRNA 4QTIL 3PWJB 3Q2CA 1CIDA 4JFYB 5DJ2A 4YHPB 4PTTA 3KJ4C 4ZFOA 2IBGA 5GS1A 2GAZA 4JDVB 4LCWE 1LK3L 3HE6A 2YPKA 2ED9A 1NFKA 1DL7L 1P4LA 3PHQA 2DQGL 2ZOKB 4BSVB 1N6UA 1UA6H 3ECBB 1QSFD 3QEUB 3VXSD 2H8PA 1UACL 4Y4KB 4ZFGL 4DGYL 1F4XL 1S9YB 2OR7A 1UCBH 1T1XB 2WBKA 1KENL 1S7VB 3F5WB 2RBLA 4FQ2L 4PY8J 12E8L 3PGCB 5TF1L 5TE6H 4LCCC 3TFKD 2W65B 4MJIE 4PJCE 2IH3A 3C08H 1M7XA 4EBQL 5D5MF 3ZT5A 1GGYA 5L6YL 5IR1B 4DK3A 1UYWH 3ARSA 3VD3A 4WI4A 3CFBA 5JIHA 2F54B 5DVMA 3W9EB 3QIBD 2PXYD 3RVTC 3WFHA 4HH8A 3LAFA 3T3PE 2WW8A 4U2ZA 4KUCD 5SWZA 5I8EA 5TPWL 4S1QL 3H7BB 5F1KC 3VGAB 4RGOH 4P2RB 1MFDH 5IFHH 5CZKA 4L3AA 1OHQA 1ZXQA 1DBAL 2B4CC 4W70A 3QUXD 3S97C 1QSED 1CGWA 4JPWH 4MA8H 5L8KB 3G9VA 1AXTH 2RCSL 2VSDA 3AREC 4OI8A 3VGBA 2GJJA 4MD4B 5IHZA 3MRFA 2ZZUT 1CK0H 4NZRH 5K9KA 2EDHA 1PG7L 3NH7H 5JIIA 1IGMH 5T1KB 2OXHA 5JXAH 3WNOA 4NKIL 2R56H 3CD4A 5BOZG 1YJDC 1BF8A 3DRQB 1T89A 3IXAB 4Q97A 3TYFB 4TNWF 4QO1A 1LO4L 3NOIA 2WBJB 3OXRA 2O61B 3O8XB 1YPZB 3MV7B 4EDWL 4WFED 5TGBA 4NGHH 3VI4F 2NYYC 5IVXA 1NEZG 4Z95H 4MCYB 3IU3B 3LQMA 5GGQH 4A6YA 4NRXB 2XRAL 4D3CL 4PJ7B 2EICA 2P47B 5LQBH 3CMOH 4LCYB 3CDCA 5FO9B 1TJGH 1ORSB 4XVUC 4K71C 4OIAA 3ULVF 1TZHB 4NKDB 3RWEA 1OAYL 5KSBF 2W0LA 1XH3A 4S1DD 3U46A 4XPTL 5TDOB 1INQB 1OGAB 4F37F 4LF3A 3AMLA 5DQJB 5I1LB 3REVA 3QQ4A 4GG6F 4JFFB 4DUVA 5E8OA 1AO7D 5ICZB 2FJFA 3BP4B 4UIKH 5FGSA 4R4BB 1IGIL 5HDQH 1EEYA 1ZVSB 4NQSA 4R90L 1ITBB 1U8MA 1CCZA 3IFPB 5A3ID 2B39A 5CZVH 5INDA 4DUWA 5CIPH 4FFZH 5IBLD 3MLPA 1C08A 3TPKA 3EGSB 4KV5E 4ODTH 4O5LL 4J4PD 5A43C 4GRLC 2VDNL 3OKNB 4KI5C 5T5FL 4HC1A 4Z5RA 1NCDH 5AZEL 1HOCA 2QADB 1L7TH 4J3WA 2X4RA 3MRHB 1U3ZA 1G9EA 1UWXK 5HHPA 1P84K 2XY2A 3D87B 2E7LE 3ALPA 4OV5A 1RZKH 1KIPA 1EHXA 1UG9A 3GSXA 1BX2A 2VISA 3MLZL 5FAAA 1FG2A 4MA7H 3ULUH 3H3PL 3MMEA 4NRZB 4U1KB 4DGVL 1YQ2A 5I1GH 2R39A 3VA6A 1TQCC 2FD6L 5FM5O 5HGAA 4ELMF 1NAMH 3ARBD 3C8DA 3MJ9A 2NW2A 4PUBL 1WIOA 1GGIH 1MSPA 3P0VH 4ZPVA 2Y6SC 4Q9QH 2VDML 3S35L 3DETC 5F7UA 1A6WH 4Z7UA 5DF0A 5ITBL 1ZGLP 4Y5XC 4NWUL 2NY6C 5C0RL 2MKWA 1F90H 2F54E 2N56A 5IB4B 5EBWA 5D1XB 4GS7C 4LARH 3OJ2C 1N8ZA 2KZWA 2P5EB 4KJWC 4UAOC 4IRSC 1S9XA 4JG0L 1U9KA 3MV9E 2QQKH 1G9NL 1N7ML 3P9LB 3HR5B 4LKCA 1QNZL 3P4NA 1VFBA 1QPPA 5JIPA 1SYSA 3G6JB 3QPXL 3V6BR 1A7RL 3CIQA 4YUEL 5HPMA 3UZQA 2YUZA 1FC1A 1HEZA 3S36L 5JW3H 5E2JA 4AEEA 1FZKA 4NKQB 4I4WB 1BD2B 5KSVB 4J23A 4LLMA 1LNUB 3H8NA 4GRLA 5HHXL 3VRJA 1MRFH 5C0AA 5C0GA 1ZT4A 2OI9C 2X4TB 3OKEB 1FZOA 4NQCE 1YPZE 3MV7E 2YK1H 3ARTA 2NZ9C 4FXKB 3CUPB 2IAND 1W8OA 2HYMA 1MH5A 2GIYA 1JNHB 1MAKA 4UQ2B 4ZUWA 5HDBE 3L7EB 4PP2A 3P3YA 4PJ9B 4P23B 1ZGLM 2CLZB 5I1HL 1I8MA 1C8PA 1WBZA 4YHLH 2AKRB 2HT2C 3LHPL 1XGPA 4I18C 2AJSL 1YC8A 3AU1B 3IAGC 3F65A 3QUZD 3MNWA 4QKXB 1F02I 1M71A 2N4IA 3L5XH 4FZEL 3AB0C 5B4MD 2EXYC 1AP2A 3LDBC 1H3GA 3IKCA 4LSVH 4UILH 4HF5L 5SV3A 1OGAE 3PDOA 4XP6H 2CJUL 3IJYB 4Y5XA 3QJHB 2Q8BL 1AGDA 1T0MA 5SV4A 3RWGB 3ZKXC 5D96B 1FGNH 4N0YH 4J3UA 3A0OA 4IRSA 2YA1A 3KGRA 1GCFA 4JFHE 3GK8H 3E1F1 1E4JA 3B43A 2WNGA 1S8DA 4E42B 2WUCL 3BN3B 3MUHL 3LN5B 3DMMD 4KKAD 4P9HC 3B4NA 4GRMB 2FYYB 1CTOA 4KKCC 4URTB 2Q8AL 3UJJL 3WFDL 4DAGH 4TSCH 1JRHI 4JR9H 4NQDB 3VW3H 1MJ7H 2BRRH 4UDTB 5FYLH 3EJZD 1D5MA 1UWGL 3QWOB 4JRXE 4JPIA 2Q86B 4AQOA 4FQXC 4HUWB 2CO7B 2OI9A 5JORB 2UWEA 4HCRA 5DRZA 1U6AH 4N0RA 2FSEA 5BOPA 1KLUA 3WLBB 5HXMA 1MIEL 3AC0A 4LLYB 2EDNA 4Y5YC 5DEGA 4OCNC 2AK4D 5IKCB 4XP4H 4L4VA 4Z7QF 3FFDB 5DD0L 5IVZB 3O0RH 4LVNB 4RFOH 4JG1H 5EZIH 5F89A 5LAXB 5EN2B 2CK0H 1RUQL 1SJHB 1V3JA 2BHUA 1ACZA 1R6VA 1AXIB 1UVQB 4H8WL 4RNRB 2XWBB 4I18A 3PQYD 2JJUA 1T21A 2AEPH 2B4CH 1RZ7L 3MUZ1 2BVOA 4MDIB 4YFEA 4M8QB 2CIKB 1U3HD 4CRPA 3S6CA 3PF2A 3GM0A 2W0KA 1YUHA 3QFDB 4YBLC 2FEDC 4CUCA 4NBZB 3SGEH 3JWNC 5E94A 1A1NB 3T1FA 3U7YH 1I7TA 5TE4H 1FYHB 1YJDH 3UBXI 3G6JE 4PFEA 2CIIA 4XPGH 4ESKA 5JQ6H 2DYPD 2FEEL 5LCVH 1FVDB 3MRBA 2IPTH 4DFHA 4LP5A 1QPXA 1NGZA 4HFUH 4W81A 5FUCC 2GUOB 1D9KC 1I4FA 2FRGP 4POZD 1FL5A 1FNEA 3MJ9H 2P44B 1IQWL 3DBXB 3B9KB 2OK0L 3RWJA 1EZVY 4RGMC 4YC2C 1Z9LA 3NA4A 1VSCA 4NO0B 4J3XA 4NKOA 3MRCA 1KIRB 4GUPB 4L3CA 4KGLA 2QQNL 2XKUA 5GRJH 3ALWA 2VN7A 3U4EB 5AUMA 1K4CA 4Y5YA 4ODUB 1PQZB 3MTRA 5IBTL 3NA9L 4HV8B 3SDXB 4WFGE 4F9LC 2X89D 5F71A 5T3XD 3GJFA 3VFUA 1NC2D 4L1DA 4AL8L 5IEHA 5DMKA 3VGDA 2ICEB 3WFEL 4CVUA 3C6SA 3QZWB 5IMOA 4G6FB 1T04A 4X80L 4EN3B 5EZJB 1KC5L 1T7XA 3HB3D 4C4KO 2ZKHH 4I13B 4UIMB 1CXKA 1X4YA 1XR9A 5C6WH 5GS2H 2ZUVA 4NN6B 3BKML 3SPVA 3DGCR 2YOCA 3UTPE 4WNQB 1IT9H 5TE7L 1G9ML 2DMBA 4JFDA 3ARQA 4N1HB 2Z35B 5T33H 3K2UL 4ORGA 4UB0L 1ZT1A 3C9NA 5CINH 4U6HB 5D7IF 3QDMB 3VFSA 4ZXBD 2QKIB 4PJGB 2HAZA 1UM4L 2WP3T 5CD5C 4ELKA 4PG2C 2EYRB 3X11B 2HRPL 4XNZB 1IGTB 3O4LD 4MB3A 3WNPA 1IILE 4YHIB 2V2WA 1BIIA 3I85A 1D9KA 4X6BA 4S1RL 4XNYL 5E9DA 4LVHC 1JNNH 3BE1L 2VLRD 1DQMH 2R0ZL 3P30L 5MERB 4KJPD 1FPTL 5GISH 1PDKA 3TBWB 4LHUA 1G7MB 5EU4A 5SWSE 4LAQL 3GIVA 2PW1B 4ZUVB 1A9BB 5BMFL 1LEGB 1AJ7L 5C6PB 1JUFA 2Q76B 3WJLA 2A6KB 3Q5OA 4MS8A 5ESQB 1NGYA 1WQVT 3H6JA 3IJHB 3UBXG 4HWZB 2VQ1A 2BNQE 3TJEH 4U3CA 1FFOA 1PLGL 3FQTA 4F9LA 1FFNA 1KTRL 1CG9B 1ZVYA 5GZND 4DGIH 3BUYA 3BKYL 1MWAH 4KKNA 3T2NH 1GGBH 5DK3A 5DLML 1T83C 1BBJB 4WWKB 4MAYA 1A3RL 4I3RH 3BISA 3QEGL 1MQKH 1AGEA 4QRPE 3MRDA 3PL6D 4WHTA 2NY2D 3RWHB 3E8UH 3OXSB 1OAUL 2XZQL 4HCRH 1RZIB 3V0WL 5ADPL 1KJMA 2WM0A 1GIGH 3SDYH 5DD5L 1ZHNA 5AYQA 5IMLB 4WW1B 3QIWC 4R6UA 2P49B 4ZYKA 5IB5B 1RURL 4AENB 3P2TA 4DKFH 3MA9L 2WWMD 4KRPB 3RA7L 5EU3B 2XFXB 4Z7NE 5E70A 3PWLB 4EI5D 2HKFH 4I0PC 3FJTA 5I74C 4WCYL 3AUVA 3DO7A 1P7KA 4Q9BA 5CD3A 2LU4A 1OLZA 4U0QB 3MLTB 3BPCB 2GTWB 4BUGA 4FG6D 2O5YH 3MLUL 4H0IA 1RPQA 2DWDB 2X9WA 1I7UA 4XHQA 5I1DA 5F72S 1MCEA 3ZE1F 4OD3H 1BOGA 1FYTD 3L3KB 4GAGH 2PETA 1OL0A 2WV3A 4ZS6C 4N1CA 1ZSDA 3PABB 3B9VA 4P9HH 3B5GA 1LQVA 3QXDB 1B0WA 2EDXA 1Y0LB 4FABL 4ZPTA 1T83A 4Q0XL 1EAPB 4ODHL 3GMPB 2F9BT 5ESAB 2FECL 1A6PA 1XCTA 4U6XA 1UFUA 3KS0J 1MY5A 4XCCL 3VFTB 4G8EB 4YXKH 1PZUB 4YR6A 3QDME 5E99H 4FRWA 3ZKMD 1AGFA 1A3LL 1G6RA 2R1WB 1MHEB 3QO0A 4HXBH 1MCIA 4X6DF 3BPOB 3HZVA 4JJ5A 3QIWA 3LKRB 3L6FB 2RAMA 1ZVHA 4Z78B 4FFYL 1RHHA 2B1HL 1ETZA 4UT9L 3GJFH 4J3TA 4MX7B 3SKJL 3LRHA 2OSLA 3IDIB 1KG0B 3U0PB 4OKDA 5D8JL 3CXDH 2IF7A 2BY3A 1INEH 1NBVL 4GW4A 4OIIH 1WBXB 5C0IB 3T1WA 3D69A 3K4ZA 4NN7B 4PGCB 1OPGH 4LDEB 1A7NL 5EULV 4X6FB 1HHGB 1P7QB 5HHVH 5E0QA 3I6LE 3ILQD 1B3JA 4Z7OF 5FB8A 1CIUA 3HE7C 4MHHI 1QRND 1CBVH 4NDMA 1XF2B 3CFKA 1BFOB 4M93B 1ZLVK 5DZLA 1U58A 3UTSE 5HVHB 3QO1B 2G5BB 3B2UD 1A6TB 2YA2A 1F00I 5BRZB 4G9FA 2MPAH 2EE9A 2VLJD 25C8L 5DR5H 4TUJB 4PRPD 4YH6A 2J4WL 1CGTA 4MJ6A 4XP5L 5FKPB 1E27B 3FQXB 3P4MA 1KN4L 5EBMB 1MNUH 3EFDL 1WWAX 1CS6A 4QHMB 1RJLA 3D2UB 2W9DL 1CXFA 5AEAA 2ITCB 1TTFA 3WS3A 3K4DA 5F7HA 5CEZL 1MCHA 2P7TB 4HUXB 4YE4L 1ZGLA 3S3JA 4HJGA 1ZOXA 1QACA 2D0HA 1FZJB 2HTLD 2O93L 3HS0B 1OQOA 4M43H 5F7LB 2GY5A 3IJSB 3OKMA 4Z0XB 5F7YC 1CLYH 4H20L 5JW4R 4HIIA 1WTLA 1P6AB 1X5IA 4KKLD 5HHQB 1JCKA 2BFVL 5JW5B 4ZNEA 3SGEI 2PKDA 3IFLH 2OR9H 2J1KA 1KSRA 5FA3A 1TMCB 4LPCA 2ZP0T 1DFBL 4XMPH 5D7JB 1CR9L 3U9PL 1HH6B 3ZMRA 3LKPB 3E2HB 4YHNA 3OJDB 3OR6B 1IMHC 2XY1A 4UTAL 3HE7A 2FR4A 1DUZA 3H9SE 1N5YL 1GAFL 3SOBL 1CVRA 3G5ZB 5BQ7A 1J1OH 4MXVE 5JTWA 1KCUH 2DQTH 3HCVA 2EE6A 4YGVA 4CVWA 3NIGF 3OB8A 3UTTB 3QEHA 1CQKA 1Q9KB 5F93C 2R0WL 1TZGH 1BP3B 4W68A 5IGXL 3FO0H 1NCAL 2HWZH 5LXGH 3VFVB 4FP8L 2KKQA 5E6IB 2NY4C 5LJYH 4FFWC 1KYOK 1SEQL 2H2SC 3R4DA 4NZJA 4M4PA 4JB9L 5KVEH 3TIEA 4MD5A 5KSAD 4QHNA 2IH1A 15C8H 2ERJC 2WUBH 2OJEB 4PJDB 3O3UN 1ZHLA 4WFHE 4U7SA 3LN4B 1BFVL 1QBLH 5GGSY 1FSKB 3D3VA 3K46A 1E28B 1BQUA 5EA0H 5BCAA 1AKJA 2NY0B 3ROOB 1NJ9B 3GGWB 3SKMB 3LRGA 2YPLA 3L3IB 3SKUD 2XA8L 1U8OA 5DFVC 4RISH 5JHLH 4PB9H 3QG7L 3DO3A 1H3TA 4TNWK 2ZUQB 2DQIL 3MYJA 4GH7B 3JUZA 3EYVB 4NT6B 1XMWA 1B6DA 5CEZE 1KTLB 5AWNH 5IEKB 4ZTPH 5JOPD 4LCWD 2AV7A 3KPSA 4K8RD 1VERA 4YDVA 2VXQL 1NBYA 2VDLH 5IMKA 3BKCH 4LASH 3SE9H 3HNTH 4GKSA 3ZHDA 3WLWD 1KB5A 1XIWC 1YMHB 3F7VA 2MWCA 4JZJC 1BJ8A 4MAUH 2Z92A 4M7KH 2VOTA 4F37K 3U7WL 4F58H 4XB8A 2FJHB 2BVQB 1UGNA 4OTXL 5DEFA 5EO1A 3TO4D 1RZJL 1S9KC 5E5MA 1YYLH 1LO3H 3NMEA 5IW1A 2V2TA 1WWCA 3EIFA 4Z76A 3WYRA 4MJID 5KJRH 4E41A 5F3HA 1AE6L 2IGFL 3KYNA 1R3HA 2BXZA 5I75B 2EYTB 4O2EA 4POUB 5HY9B 3I50H 4RIRA 1TCRA 1EV2E 2GKIA 1QVOB 3OAZK 1JJUA 4QRSA 3I3BA 2R4RL 3DUSB 4APQD 4QXGH 1BHGA 3DPBA 1OW0C 3TM6A 1JWUA 1UZ8B 4M1DL 5D7IA 1XCQA 5E6YA 1U8JA 1JI2A 3BKJH 3KVQA 5EB9A 3GSVB 1NFDB 1BQLH 1BVKB 5CMAA 3VXTA 2ZSWA 1KB9K 4JFQA 1QEWA 3O2DL 2FX7L 5FA4B 1RIHL 2OL3A 4X8JB 4N0FB 3DVNA 4H88L 1YQVL 1LWRA 3NZHH 2EH8H 1DTUA 5ALCL 3HTLX 3BN9D 3PWNB 1G0XA 1U93B 4JDTH 4XPFH 3W0WB 3PWVB 3FRPG 5AG8A 3UTTE 4PGEB 4OD2B 1RD6A 3DVFA 2YEZA 4OSUL 4X7FC 1LO2L 2AK1L 2ENSA 4KPHL 4RCAA 3QIUC 4HLZH 4WVRA 3TV3L 3UC0H 4NNYA 1FNAA 3RGVC 2AXGA 4G8FB 2V17H 1EHLH 2NY5C 5FYJH 1I3UA 1K8DA 4PJ7F 2KH2B 4K7PL 5EOTB 3K81A 5F6HI 4HS3A 3VJ6B 1AY1H 1RI8A 2OTWB 1T0PB 2NXZD 4JKWA 1RZFH 1YN6A 3CFEA 3O3AB 1F2QA 2PYEB 3MACL 3TNMB 4FZ8L 3VI3E 1DEEA 4P46C 3VXME 1IGCL 4UDUA 5FFLA 4U1SB 1I9JH 3V5KB 5FDWB 3GZKA 1A6VH 1OCWL 1ITCA 2OS7A 4KMLB 1T66C 4X5WB 2X2YA 3RUGB 3TN0C 5A2LH 3X13B 4F7TB 2Y25A 3GMLA 3W39B 4HH9A 4DN3L 1GC1C 3BMVA 3U1SL 4YWGH 1I1CA 4NCDA 1X4XA 2AJ3B 5CJQL 2H9GA 1NMBH 3IFOB 3MROB 4R97B 2XQYK 3TJHC 4Y4HB 3BRFA 1TENA 4PJBF 2EDWA 1AIFB 4Y4KD 5K9QG 5IOPA 1MIML 3QT2A 4N9GA 2YMXL 3LB6D 4AJ0A 1RZGB 4DW2H 4TNVF 3OMZA 3V52H 5EZOL 5FOJA 4D0CB 3V4PH 1MCCA 3MGTA 4U3XA 2K3TA 4QRUB 4Z7WA 4HZLB 2QQLH 2V5TA 1IQDA 2J8UA 3QG6A 3QIUA 2GW5A 3I02B 3C6LC 1VADA 1MEXH 4QOKB 1K4DA 3RGVA 5FO7B 1H3XA 1TVHB 3MRKB 4XC3L 3QEQA 1MJ8H 5CHNB 2F54D 1ZA6A 3C8KA 3VXUB 3QDGE 3DHMA 1IEHA 3HN3A 4ODVH 1MCWW 3SY0A 3NCFB 4XAWL 4KQ4L 2VZTA 1YYMH 2B20A 2A77H 2QHRH 1F4WL 1U8QA 1ED3A 1KB5H 4WO4D 3VFWB 2W91A 3BXNB 4GRWE 3MOAH 1WBYA 4P46A 1S5HA 1CGUA 7FABL 1S7RB 4XP1H 4PTUA 1A7PL 5BXFB 1S7QB 3JTSA 1TETH 5EOCH 1UXWB 3MOBL 3FFCE 5GS0L 1R5WB 3QDJB 1C12A 4XMLH 1J1PL 1EUTA 4BK5A 4XWGH 2WBJD 3O8XD 3MV7D 1KPVB 1I9EA 2R1YA 3RDTC 4XX1G 1O7SA 2C3VB 5CEYB 3QCUH 2VL4A 4JO3L 4LLQA 1EPFA 3QHTC 5KSUB 4M6ML 1A2YB 1SVZA 5IFJA 1ZHBB 4OLVL 1E6OH 3MBEA 4W4NA 2VRAA 3O6FB 3VFPB 3BIKB 2V5MA 1ROWA 5E5RB 2BP3A 5C0NC 4EXKA 4ONHA 1R0AL 4WUUE 1KT2B 2ZUUA 3GUTA 4J1UA 3CVHA 2YN3A 1OGAD 3C6LA 5J9PB 1X6NA 8FABA 4G43B 3FO2B 1S5IH 3Q48A 4WENB 3L1OL 4UT7H 4NWTH 1MVFA 1NGXA 3DUUA 2BNRB 1I1AC 4JRYB 3IS1X 4XXCC 4B7IA 3MGOA 1U8KA 2VDRH 1A14H 1EMTH 2PYEE 4ODXA 1G7PA 4X98B 2HFFB 2WWKO 2ZG2A 1XZ0B 3F62A 3BPNC 2VH5H 3OG4B 3WO4B 4HGWB 4M7LT 4NJAL 5C2BL 4LBEA 2QADD 2R29H 2BNUA 2UVEA 4JRXD 1B2WL 1CN4A 1ZT7A 2X05A 2YWZA 2VKWA 2D4DA 4G9DA 2VDOH 4U31A 4XI5D 1RV6X 3V6ZB 1P4BH 1Z6JT 4C56B 3WFBL 3GJEA 1R3LB 3THMH 2X1WL 1FNSL 4GSDL 3BOVA 3QFJA 4Y16D 4ZAKD 4DFIA 5C9KA 5HHMB 1UZ6E 3RDTA 3A6CH 4MZ2A 4X6CB 4NC2B 2YSSA 3U9UA 1F6AA 3IGAA 4HKZB 4PLKC 4YFLI 4ZUTB 1A1MA 2VDKH 3TGXA 3GHEL 5C09A 3UPRA 2KQNA 4K07A 3RWCA 4HIEA 4HX1B 2MCPL 4PRHB 3KLHC 3L3DA 3QUMA 1IAIM 4QOKE 3ZDXE 2ED7A 1FORL 5DSCA 1LDPH 5LGJA 4HKJA 4DTGL 5I76A 5D1XD 1B4JH 4LSQH 3WDIA 1HSBB 1MAML 4LHUG 3T4YB 3VRLE 4TVPE 1HYSD 4XXCA 3QBTB 1ZLUH 1T7VA 4RGNB 3NCYP 4QYOA 4XCFL 3NBNA 4G6MH 2NTSP 2Z31B 5DJDA 3BJLA 4ZOBA 2ZG3A 4G8GA 5D2NA 4G6KH 4XVSH 4XPHL 2XTJE 3EOBB 4MSWA 1ZV5A 4JO2H 1FO0A 4KFZC 1BD2D 5DMGC 4ETYA 2X1PA 2ESVB 3UJTL 3ZDYE 4XCEB 5DDHA 1DVFD 2AJZB 5TF0A 4JY5H 2HLFC 3HC0A 2E6PA 4POYA 5DJ6A 4YK4B 2PCPB 1MCLA 5EFIB 3TVMC 5DYOA 1A7QH 3BPLB 2A2QT 2XACC 1TTGA 5T1LB 3JWDL 3KAAA 1HH9A 2NY5H 4CMMB 1MHHB 2DF3A 3KHQA 3OF6D 5DTFB 5I30L 4MNQA 4ZSOA 3C5ZB 4NHUA 2AJVL 4K94L 1QOKA 5FEBA 4PJ9D 1U36A 2P8LB 4L9LC 1KGCE 1KUMA 1IZKA 1JN6B 4JQXC 1H3WM 4WFGD 1UEMA 3FTGB 4HUUA 4KHXL 4X6EB 5J7CC 3IDMB 1Q1JL 3MC0A 4Y4FB 1NH6A 2VITB 1ORQB 4OV6F 3VH8A 1NGPH 2VAAB 4RFNB 4JQVC 1MRCL 3IDGB 5DZOA 4PRBA 1J8HE 5F70A 3TWCH 3RJDA 2X4UA 4ZTOL 3C60B 5ICXA 1JTTA 1EHAA 4GKNA 2D7TL 4P2QB 5BVJB 2BNRE 2VMFA 1CFBA 4L4TB 3RAJL 2I60H 4Y19B 3TO2A 3UTPD 4ALAH 3MLSH 4D9LL 1YEFL 1DQLH 3LS4L 1K8IB 1ZEAL 1GC1H 3CLEL 4J6RL 5JO5B 5JR1L 5J3HC 1TZIA 3HRPA 1BIHA 4MDJB 3DYPA 2XG5A 1U8NB 2X4QB 5KVDL 2DQDH 2BC4A 4KVCL 3MCKA 4CJ1A 3RPIA 5KG9A 3BHBA 1RMFL 2HG5B 1EFXB 3KXFE 4YNYA 5CJBA 1K2DA 5F7DB 4U6VL 2JLLA 1CI5A 4PJGF 4P2OB 3ZE2E 4X0KA 1CD1A 5EU6B 3T3MF 3CVHH 4P2RA 3T2QA 3OZ9L 3TVMA 4JFOA 5HHME 2GSIB 3AXLA 5MP6L 2YPVL 4H1LA 4S0UC 3EW3B 4X6CE 5JDJA 4GBXB 2RFXB 2FB4L 1CGSH 2ZWLT 5C07B 2BNQD 5CZXD 1MI5A 3G6DH 3HUJE 3KJ6L 2XG4A 3F7YA 4PRHE 5CLWA 2UYLB 3WJJC 3GNML 1G6VK 3TFKC 1ZK9A 2W92A 4MJ2A 1S9WB 1UADC 2BRQA 3T4AA 4YZFF 3G5VB 2DICA 4WI9A 4ZMAT 2X4SB 3FOMA 1PAMA 3FB6A 3QIBC 1G7LB 4OQ1A 1M05A 2PXYC 3TYGL 4OQTL 1DUYB 1G7HA 4HGKC 4NBYB 3DV6A 1D5IL 1HZHH 1E4KC 2X40A 4OCWL 1R5VA 2JCCB 5F7MC 1FVCA 4P57A 3NCCB 1JRHL 1P1ZB 1ES0A 4OZFG 3QUXC 4K7FB 4TSAL 1JV5B 4WV1C 2EDOA 3EOTH 4HS8L 5L88H 2ESVE 1YEEH 2BSSA 3ARFB 2DWEA 3B9KD 3UBXB 5E03A 1J1XH 1VEPA 3VXNB 3VXQB 2EDRA 3ZHKA 3MRJA 5GSRA 3KDMA 3PWPA 2XZCL 2FIRT 4R4BA 2IQ9L 3F8UB 5JNYA 2XQYG 4DZBA 4V2CB 4FQCL 3DV4B 3JV4B 1QBAA 2GJZB 3VXSA 1IC7L 4HWEL 2D31B 5HVFB 2CLRA 1VFAA 3VRIA 5E8PA 5E95B 4AIOA 1QKZH 4P3WA 1CE1L 4KJYB 4LKXB 4PJBA 1JK8B 5ANMA 3GRWL 1B4RA 2DB8A 4V2BA 2X41A 3WJJA 5EIVA 4EN3D 3JV0A 1FO0H 4N90E 3FRUA 5ID0A 4S1DC 1HYRC 4NJ9H 1NCBL 1NCTA 3D0LB 3CU7A 1EEZA 3MXVL 1UH3A 1GL4B 4HLZG 1BJ1H 5IJVB 4L4TE 3D1MC 2DBJA 2AABH 3FOLB 4V1DE 3BWAB 4Y2DD 3MRNA 4XH2B 3QIBA 2PXYA 1YNTA 5GGRB 5BS0E 2IEPA 1KIQA 3MRPB 4GW5A 4X99A 1T22B 2VB5A 4EKXA 2F8XC 4WUKH 3QDMD 4DVRL 5E2VH 2CDFB 1OD9A 5A3IC 1V3LA 4BQCA 5I71B 2ADFH 2GJ6B 5IBLC 3D85B 1NC4B 2AI0L 3QUXA 2QV2A 5EBLA 5I16A 5FM8A 4WV1A 2YZ1A 3X3GH 1JHTA 4EVNA 3I6GB 4PJ5B 1FLTX 3G6AB 2WWKT 4TOYH 5F1IA 4U7MA 5HGDA 4BFIA 1QLEH 1CU4H 1KJ2A 1CFSB 1RIVH 3F6IA 1G0DA 3C09B 1N2RA 1PFCA 5L7XH 1V5JA 1CFTA 2HH0L 4OZIB 1HDMB 5SWQB 3L5JA 2APBA 4Y5VB 1KTKE 4RGOL 4KKBD 1YC7A 4PJAE 1WAAF 2OJZH 1MFDL 2FBOJ 4NKMB 2PO6C 1D5BB 5C07E 2VIRA 4GXVL 2GEEA 2HVKB 3I6LD 5IB2B 3ARBC 1A4KB 4JPWL 2E6JA 2Q87A 3ES6B 4P5TB 4U1LA 3MV8B 4NZRL 4OAWB 5I1CH 3NN8B 1HNFA 1W8NA 2ARWA 3E0GA 3SQOH 3UTSD 2DLFL 4WWKD 4XNMB 1ZS8B 1WF5A 2R56L 2VZ1A 4R3SA 2XA3A 4CDHA 3QUYB 4I0CC 5KVFH 3U7AA 2D03L 5CIPB 4YBQD 2E7BA 4NGHL 2AXHA 2BSTB 2O5ZH 3LZFL 4PJHB 3WV0A 4LQFL 5I15H 3V2AR 3ARVA 3MODL 1XGYL 5GGQL 3CFIC 1U92B 4PRIB 1EVTC 1EX0A 4H1LH 1NDGA 4YHOL 5EIIA 4XPBL 1OQXA 4O2FA 5KANG 5C0BB 4KRPD 3MRGA 2R2BA 2BERA 5EO0A 2P45B 1PSKL 3MBXL 5HYQB 3T8XA 5I1EH 1G7QA 1YA5A 4ONOA 5GRUH 1NAMB 3EO0B 4AMKL 5INCB 3REWA 1CICB 2F5BH 5FK9B 4YGAB 1MJJA 1J87A 1VACB 3RGHA 3K8LA 4U7KA 5GRZA 5F6IC 2PO6A 4FFZL 3V6OE 2J2ZA 5EIQA 1MHPH 5DJ2B 4PTTB 4ZFOB 5GS1B 3QUZC 3O3DA 4NNPH 5F6HJ 2GAZB 5B4MC 3EOYG 3CXHK 3HE6B 2YPKB 3ZKSD 1P4LB 5CJOL 3PHQB 5DD6A 4U6YA 4M1CC 2MJWA 1CDCA 5I1AA 1RZKL 2ZCHL 4ONGH 5K9OA 2WBWB 2VC2H 2APTA 5D9SA 2H8PB 4M48H 4MA7L 1P4IH 1UM6H 4NOFA 4TULH 5GGSA 2HTKD 2MHAA 3PJSA 2CRMA 3RVWD 5I1GL 1L0XA 1EGJA 3KPRE 1J0KA 3GIZL 4KKAC 1A1OA 4C59B 4MNGB 3VG9C 3S34H 1JMZA 1ZA3A 4DVBA 2IH3B 1BLNA 1W0YT 3BFOA 1NANH 5B3JE 3H3BC 1U8LA 4PP1D 1A6WL 1AQKH 2WQ8A 2BOBA 4YIQA 3E3QC 3EJZC 4MQXD 3CFBB 3QWRA 1IGFL 1BM3L 3WFHB 3BZ4A 4TSBH 1LE9A 4ZFOL 5EBGA 1FIGH 4PJDF 5I8EB 5SWZB 2WK2A 5DGQA 3OKDA 2Z93A 1JP5A 1QFUL 2FWOA 1H5BB 4U0RB 2DLTA 5CEZD 5GPRA 2IFFH 5L2KA 1CTNA 1JFMA 5JZ7D 1I3GH 1H3UA 2A1WH 3I2CL 3EBAA 5JW3L 1CT8A 4N5EA 1I7RA 4NBXB 5IHZB 3MRFB 2LV4A 5C70A 5K9KB 3FN0H 1Z3GH 5HYFA 1J5OH 1E4WH 1HINH 3KJ4B 5JXED 3QUZA 3G08A 1KIRA 2LVEA 4OT1H 3OB0K 3EO9H 1RU9L 3OXRB 1U3HC 1N3NA 1BQHA 3RBSA 5TGBB 2YK1L 2F53A 4WEBH 4UINH 4OLXH 3P73A 5IVXB 4ODSL 5LGKA 1IC5L 4A6YB 5EU5A 1SY6A 3U48A 4H0GA 5AYUL 3WXVH 4PRIE 1CLZL 4OD1L 1L9NA 2ZOLA 3D2UD 2FLBT 3MJ8B 4XNQA 1INDL 4J2XA 2C26A 3WIHH 2W38A 3ARWA 5F9WB 5C0BE 3RWEB 3U4BL 1XH3B 3U46B 4LSVL 3H7LA 4LF3B 4N5UA 3REVB 3QQ4B 1JPTH 2E3VA 3WD5L 5E8OB 5HYJA 4MCZA 3GBNH 4OLWL 1Z0MA 2VWEE 1FGNL 2FJFB 3KG5A 1EEYB 4NQSB 5D2LA 1KOAA 1U8MB 3GK8L 4XBEH 1MUJA 4XCYA 5INDB 4UT6H 3ZSSA 2EDQA 2AK4A 4TNVK 1YEIH 1DANU 1C08B 5D7JD 3MYZA 2DBLH 4DAGL 4K3JL 4A6YL 4Z5RB 4HUMB 1SEBA 2NXYC 3OAYH 4JR9L 1HOCB 4JPKH 4NFCA 3QXTA 3IDXH 4YDIH 2X4RB 5FKAA 4HPYH 1YZZA 5HHPB 4BSJA 3BGAA 4KJQD 1RAMA 3I6KA 3PQYA 3HI6L 3UTOA 1NCCL 4OV5B 4UU9B 3HB3C 4QHUA 1BOYA 3T77A 3UTTD 1KIPB 4CVXA 3ZYOA 3GSXB 1BX2B 2VISB 1FG2B 1U42A 4OFYD 2X70A 3MMEB 1U6AL 3T2OA 2MFNA 4N8CH 1PKQA 6FABH 4KQ3L 4P4KA 5E6ID 4HWZA 5HGAB 4YAQA 2IAMA 3O0RL 4QRQA 4RFOL 3SO3C 2QSCL 2JK5A 3ILPA 4ZXBC 2YS4A 4ZPVB 2DYPA 3CAFA 5EWIH 2NTFA 2CKBA 4DKEH 1D6EA 2YD6A 3OAUL 4K71B 2G75A 2JKXA 3UO1H 1T0NA 2NY0D 5EBWB 5FUOL 1N8ZB 1P6FA 3ARGC 4HC1L 3TBVA 5SWZE 2JJVA 1S9XB 4R4ND 3VXMD 2F5AH 4LKCB 2OP4H 3P4NB 1VFBB 1MPAH 3KYKH 3VMPA 3LEVH 1SYSB 5TE4L 1YJDL 3IF1A 5HPMB 3L95A 1HEZB 1P5UA 3QQ3A 4X7TA 1FZKB 4EI6A 4EOWH 2I9TA 3DVIA 4QCIA 3FT3A 4LLMB 1TFHA 1EGJH 2CPCA 4GRLB 3RUGF 4L8CA 1J88A 4OGXL 5GZNC 3PWUA 3VRJB 5DS8A 3M8OL 3LD8C 5C0AB 1JPST 3ZTJG 5C0GB 1ZT4B 1QD0A 4JAMA 1MCPH 6CGTA 2EIZA 2JIXD 1FZOB 3IXTA 5DK0A 2EDDA 2X44D 3INUL 2GTZA 1AFVH 1N4XH 5LG1A 5IVXE 3C2AH 4ZUWB 3PL6C 5E8EB 4PP2B 1U3JA 3LQZA 5B22A 4BA8A 2R69H 1I8MB 1WBZB 3L3KA 4HBCL 1XGPB 5EUOA 2XN9A 4NYLA 3MNWB 4I3SL 5M94B 3N85L 1M71B 4YLQT 4ZXBA 1UKQA 1AP2B 3BGFB 5C0DA 1H15A 4IBLT 1W0VA 1CGXA 3PDOB 4AYFA 1FE8L 4Y5XB 3O4LA 1SBSH 2NY6B 1AGDB 1T0MB 2ZKHL 5GRYA 4GS7B 1ZTXH 4KMTH 3ARGA 5ID1A 1GGCL 1YNLH 4GO6B 4UAOB 4IRSB 4I48A 2YD1A 5I8OL 1S8DB 1IT9L 5HD8D 5MENE 1XF5A 3O6LL 2JJSA 3V7AE 4KDTC 1MWAB 4RMRA 4P99A 3STLA 3RWDA 4L3EE 3F58L 3BO8A 2ATKA 1D5MB 4JPIB 2IQAA 2H26A 1X6LA 2I07A 2VZSA 1JNNL 1WWWX 5JPMA 2OI9B 3QISA 2UWEB 5DRZB 1QP1A 3RVVD 2FSEB 3MSPA 3CFCL 1KLUB 3MUGA 5ELIA 2KUTA 1OT1A 3S4SA 5DEGB 4L4VB 2AEIT 1OVZA 4N0CD 5F89B 3R1GL 1NBZA 4Z7VA 3O3EA 4LU5L 4HXAL 1EIBA 5HGGS 3T65A 5K59F 1C7TA 5D7LE 1A5FL 4I18B 5KS9E 1T21B 1DBJH 4Z7UE 4ZUSA 4NN5B 4DGIL 3AB0B 1KLFA 2H1PL 4XT1C 3LDBB 1RVFH 2BVOB 1GGBL 5BRZA 1VDGA 3BH8A 5J6GA 2PYED 1QR4A 3FT4A 3N9GL 1FAIH 5E2WL 1QBMH 1YUHB 3KHOA 2VTFA 4I3RL 3ZKXB 1A6UL 5E94B 2NY7L 1HQ4A 2IPUG 4NO3A 1HILA 3T1FB 3FQXA 1I7TB 3EYSL 1NMCC 2CIIB 3IFNH 4JE4B 3TT1H 3VH8G 4WIQA 1GIGL 3B3IA 4YHKH 3NFNA 1NGZB 5DURD 4LNRA 3ILQC 1I4FB 5GHWL 1KJ3L 2DDQH 1FL5B 1FNEB 2Q6WA 2AJXH 4Y4HD 1KEGH 5C0AE 3HS0A 3RWJB 5J11C 3SCMD 3W9DA 1MCQA 2CKBH 1NANI 4Y1AE 5DJCA 2HKFL 5DGRA 4YPGA 3MRCB 5DQDH 1PG7X 2ZPKH 3ARDD 3B2UC 5GS0D 4NQEE 5FXCH 4L3CB 3LS5H 5CSBA 1ZLSH 4BELD 1J9CT 4QXUH 2AGJH 1XF1A 5AUMB 3NIFF 1K4CB 5IQ7H 4Y5YB 3BDXA 4QOKD 4NFDA 5C0CE 1FBIL 3D18A 1A7OL 4M6NH 1AR2A 2CMRL 3GJFB 3VFUB 5IEHB 5DMKB 3LIZH 3C6SB 1OTTD 3U0TA 3WUWA 5IMOB 1T04B 4P9HL 3LMJH 1JGLH 3R06A 1XR9B 43C9A 4H1LG 4IRZH 4JO4H 1MFEL 5KVGL 2HTLC 4PV9A 5I17A 3CPLA 1SM3H 3SPVB 5IT2H 4NZUL 4YBLB 4NPYA 1QA9A 3ROLA 4FQJH 2XTJD 4JFDB 4FN0A 3LEXA 1YEJL 4ORGB 4KKLC 1JZ8A 1ZT1B 3C9NB 2CH8A 4YXKL 1CVSC 1FL3A 5EG6C 3VFSB 1J0HA 3QDJD 3LPGA 4PJDA 2FL5A 5JIKA 4ELKB 5D7SL 3Q5TA 3IRPX 4G6JL 4JFEA 1PGRB 2HN7A 5EOCJ 2V2WB 1BIIB 3MNZA 1D9KB 4X6BB 3WO3B 4M6OH 5E9DB 2C3XA 2E9JA 3QQ9D 4C83A 5DJZA 4MXQA 3AS0A 2CUMA 4OI9A 1L0YA 4RGMB 4YC2B 4JN1L 4LHUB 5EU4B 1KGCD 1KFAL 3CXDL 3EYUH 1N26A 3HC3H 3GIVB 4L9DA 4U1GC 4HT1H 1QSVA 3O6FD 4OIIL 3MJGX 1JUFB 2Y36L 2Z0BA 3DOSA 1OPGL 1NGYB 2NX5E 1J8HD 2VQ1B 4QY8A 1N0XH 1FFOB 3MO1A 3FQTB 5T3ZL 1FFNB 1E6JH 2NY3D 3BUYB 5KSAC 1W72A 3DIFA 1CBVL 2BNRD 5J0BA 2DQEH 2P48B 3BD3A 3CSBA 1JF1A 4NFBA 1EBPA 2KL6A 4JM2D 1CGYA 2DD8L 2BOCA 2EDBA 4MAYB 1V3KA 4R4FH 2WAHA 1AGEB 4XX1E 3MRDB 5B38A 1S7UA 3P0YL 5E2UL 2MPAL 4WHTB 1JHLL 1Q94A 4IDJH 1KBGL 3KXFD 3TCXA 1KJMB 4HG4K 5HJ3A 4DCQA 4ETQA 3QRGL 1ZHNB 3T0DA 2DJUA 3TBTA 4ZYKB 1GPOH 4C56D 5BVPH 2Y5EA 4OUOA 1OAZL 4JHAL 5KAQF 3WBDA 1HCFX 3S36X 5HHMD 1AO7E 3WLWC 2CRYA 1WCQA 4M43L 1JNLL 3CDFA 1P7KB 3DO7B 1VESA 1URLA 3W11D 1Q38A 2Z8WC 3TO4C 5CD3B 1CLYL 3BDBA 3PGFL 3FO1A 4X7SL 1HN1A 1X5LA 4PRHD 4M1GH 1I7UB 5C71A 3S3SA 5I1DB 3IFLL 2OR9L 3QNZA 3ULVL 2JJTA 3SE3C 4OLUL 1BOGB 2DQJH 1JHKL 3OKLA 3VFGL 3LKQA 1ZSDB 4YDLC 2H6PA 1K5NA 1T80A 4UBDD 5KSAA 1IFHH 4APQC 2A9MH 3V4UL 3UCRA 4UV4H 4FQIH 4ZPTB 3QA3A 5DHVA 4PJIA 2WY3A 1XCTB 5D5ME 4HULB 4FQLL 1OB1A 1QYGH 4U6XB 4BM7A 4JFDE 1TZGL 2CQVA 3VFRA 5T3ZE 4YR6B 4LSDA 2FO4A 2ESVD 1JWSA 4JCMA 4X9BA 4FXLA 2XXCB 2JCCF 2DQHL 1MCWM 2NW3A 5JUEH 1AGFB 4KAQH 5CJXA 1VA9A 3QO0B 4OM1H 2Y07H 4CW1A 3HZVB 4JJ5B 3P0GB 3QIWB 3IDNA 2P5WE 4LCWA 2WUBL 1RHHB 1ETZB 4M62H 5HI5C 4HQQH 3MRIA 4NUGH 3MOQA 5AAMA 1QBLL 5ILTH 2VSCA 4HIXH 3BN9C 4NM4H 5EA0L 5IJKC 4HUNB 2OSLB 5GRXG 3H9YA 1Q72H 5I74B 1IM9A 3UYRL 5I18H 4LCIH 4GW4B 4RISL 3B5TA 1U41A 2M8XA 3D69B 4R8WL 3TO4A 3PV6A 4Y4FD 4G7YL 3L3GA 1V7NH 3SE8H 3O81A 1A3QA 4MJIA 4PJCA 1VEMA 4ZTPL 2VN4A 1F8TH 3VI4E 1ADQA 5FB8B 5DO2C 4HGMA 3IFOA 3GMMB 5L2JA 3GFUA 4NDMB 3X14A 4CJ0A 5GGVY 3CFKB 4L4TD 1KACB 4Y19D 5DD1H 4V1DD 4XGZA 3SE9L 3RWFA 1U58B 1KTDA 5BS0D 1G6RL 3HNTL 5D1QA 3DVGA 4XPAL 3MLWL 2FCBA 1U8PA 4APQA 3P9MA 4Q2ZA 5D7KD 4G9FB 1P2CA 4YXLH 1I8KA 5DMIH 5DT1H 3ULVE 5KSBE 3O6ML 1JBJA 1PW3A 1YEHL 1CLOH 3X12A 1QTYT 4MJ6B 1LO3L 4P59H 1EFXD 4C55A 5HHOA 1TJIL 1U91A 4GG6E 3P4MB 2ATPA 5KJRL 1DSFL 4HDIA 4Q7DA 4JLRA 1RJLB 4CN1A 3L3OA 4P2OD 1OP3H 1N5AA 3I50L 4PB0H 5EU6D 5FYKL 3WL9A 3WS3B 1XR8A 1RFDH 3QUKA 1XF3A 2D0FA 1V05A 2BY2A 2B0SL 2E7LC 3HNSH 3CMGA 5FHAH 5ISZB 1ZGLB 1FRGL 3DARA 4HJGB 3CLFL 3K4AA 4U2YA 4OGYH 4BSWA 1W72H 4Y4KC 2E9WA 4GBXD 1GHFH 3LB6C 2IG2H 3OKMB 5C07D 2ICCA 1BQLL 4F8QA 1IAKA 4HIIB 2X1XR 4OZIF 2AEQH 2LTQC 3A67H 4XMKL 2R0LH 5FA3B 5H35A 3ARRA 1RIUL 2IWGA 3E3QE 4N1EA 4YHNB 1TVBA 3HE7B 4MA1C 2FR4B 1DUZB 5CEYA 4X5XA 5KW9L 4ELME 5BQ7B 3JTTA 2CXGA 3HCVB 4YGVB 5BV7B 2DM4A 2EC8A 3QEHB 4M8VA 3EDJA 2JELL 4TRPH 4OB5H 3DSFH 5IUSA 1JYNA 4WO4C 4RQQA 3MREA 4QRRA 4PJHF 1HHKA 4Z7NF 5K9JH 3L5IA 3ARFD 4QT5A 2CXKA 1EHLL 5FYJL 3I3DA 3TIEB 4MD5B 4QHNB 3JV5A 2J6EL 2IH1B 2DS4A 1KCRH 5TFSH 1BQHG 1ZHLB 4ZD3L 1OP9A 4FFEX 3O8XC 3D3VB 5IHBA 2E7LA 4WEMB 3PXHA 1AKJB 4LHJB 5CCKH 3ULUF 1TJHH 3F6LA 2APWA 5AZ2H 1OP3K 2YPLB 3LSOA 2CO6B 2XZAH 1U8OB 4LPVA 4Z6AT 1IVLA 1YDPA 3MYJB 5F88A 2WLZA 1U2CA 5F9DC 5FYKE 1ZANL 5DHVH 5BV7L 2FHFA 1D5ZA 3V8CA 43CAA 2AV7B 4F33A 3KPSB 3OJVC 4YDVB 3PHSA 4WGWB 3U30B 1NBYB 3FT2A 5IMKB 5CSZA 3TPUA 1KXVC 4RSVA 1AD9A 3M45A 1NUFA 4GKSB 4GAYA 1NMBL 2FX9H 1KB5B 3SJVA 2HT4D 5ADOL 3F7VB 2DKSA 2X9XA 1NAKL 1BJ1J 3LPWA 2Z92B 3MV9A 2C9AA 2Z91A 5D93C 5DEFB 5EO1B 1F11A 3KPRD 2P42B 4AG4H 1E0OB 4WI5A 3V52L 5E5MB 1X5KA 5IW1B 2V2TB 3V4PL 3GMNA 4Z76B 4UNTA 1NC4D 2A6JA 4E41B 1WK0A 5F3HB 4LQ1A 4WO4A 4PGBA 3KYNB 1R3HB 4ZO8A 5T3XE 2NY4B 1NLDH 2QADC 4PJ5D 3ESUF 4MMZC 4RIRB 3DECA 1TCRB 1G9NC 3QULA 4IRJA 3T4YA 4LIQL 3HR6A 4I0KA 4HFWA 1SYVA 4QRSB 4XI5C 4LLUA 4Z8FH 2ERJB 1JWUB 4X83A 4PD4J 5D7IB 4RMVA 4B7LA 1XCQB 1U8JB 3LV3B 4NQCA 4Y16C 4ZAKC 1B0GA 4KXZH 1FDLH 4WY7H 1YYML 3DX8A 3V4VH 2XWJA 3BQUD 5CMAB 3VXTB 2ZSWB 4AT6A 5CILH 4JFQB 1QEWB 1KB5L 5I1JH 3TESA 1Z5LA 4ZNEE 2B2XH 1YEDB 3D0VB 3MV8D 4XP1L 2AQ3A 4DWHA 3EYOA 1TETL 5EOCL 3DVNB 4OCXL 4P5KA 4H5SA 4OCSH 3Q0HA 4QEGA 1A0QH 1QQDA 1WVZA 5D1XC 4Z7QE 3BRGC 3QUYD 4OZHF 4TYUA 4RRPA 1HYSC 1JN6A 1QO3A 3D9AH 3VU2A 1CFNA 4CMHB 2YEZB 3O2VH 4PRID 2GQHA 2D7NA 4FQQA 1UWEL 3VE0A 1E6OL 4NNYB 5C0BD 4JANA 2AXGB 4F7MA 1I9IH 5TQ2L 1K8DB 1DVFC 1LK3H 1DL7H 3BVNA 1OARL 4HS3B 1S5IL 3RL1A 4JRXA 2I27N 2L0DA 1KCGC 4JQIL 2DQGH 4M7JL 4NWTL 5JOFA 3WIIL 1OLLA 2OL3L 3D3VE 2EC9U 1WC7A 2YD3A 4JZNA 1YN6B 3CFEB 1CICD 4AEIH 1DBBH 3NIDF 1YMME 2VLKE 4Y16A 4ZAKA 3VGGA 4ZFGH 4DGYH 4UDUB 4PJ9C 3MNVA 1KENH 4P3CH 4LIQE 3C87A 2VKXA 3OR7A 1BZQK 5TF1H 5JW4N 1RULL 3GMLB 4CVZA 3HE6D 2R29L