2FWOA

Mhc class i h-2kd heavy chain in complex with beta-2microglobulin and peptide derived from influenza nucleoprotein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
275
structure length
275
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Structural Definition of the H-2Kd Peptide-binding Motif.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/viral protein
total genus 74
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fwoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2fwoA01
5DDHA 4ZUSA 4ZFFB 4ODSL 3VGEA 4Y19E 5EBWB 4XNZB 4YBLC 3GKWH 1CBVL 4HF5L 1FZKB 4EQ3A 2C3VA 4ERSL 1UA6H 5E8NA 5B8CB 1NANI 4OT1H 3JXAA 4L4TE 4U6HB 4OZFH 1QRNB 4CDHA 1S7VB 1A3QA 3BISA 3QNZA 2VB5A 3BDBA 1K9TA 4XCEB 2YSSA 4ZXBA 2CRYA 2P42B 3QUZB 4IJ3C 1ZLWK 2DQDL 3PUCA 1F2QA 2GQHA 4HWBH 5GGSB 2AQ1A 5IFAL 1OTSC 3C5ZD 4HFUL 3Q1SL 5HVHB 3SE9H 3TT1L 4J3UA 1EK3A 5CJXC 1TJHL 3RPIA 1FRGH 2FZ3B 5TH2A 2EE3A 1T80A 4DFHA 5JA9A 2BHZA 2R4SH 5C0JB 2RCSL 3RKDC 4M6NL 3X11A 4PY8J 1KN2L 3GSNB 3T1FA 2X4QB 4PJEF 5IHLB 4RX4A 5E5MB 4GXVH 4HKJB 1BD2D 4QTIH 1KJ3H 2P7TB 1J1OL 5I1EH 4HUVB 5DWUH 4JO3H 1FFOA 2DKMA 3LD8B 2R1WB 1OSZA 4S10A 5CJOH 1JNHB 2YA0A 2YS4A 4P5MA 1MHHA 2DQIL 4LHUG 2GITB 4PRHE 1IMHC 2XFXA 5IQ9A 5DC0A 4JKWA 3TESA 1OARL 2C26A 1JK8A 4FQCH 4EI6B 1CL7L 3R1GH 1J8KA 2R0KL 4KRMB 4R26H 2NY0C 3LRSB 1CLOH 1TCMA 1YEDA 4M1CC 3OBAA 3QWRD 3EYQC 3HE7D 1GHFH 3VE0B 4HJGA 4LFHD 4IRSA 1PZUB 1KNOB 3R0NA 1AXIB 3BXNB 1QVOB 4FFWC 3O6FA 4HPYL 3RUGE 1RZGB 4JFZH 3KJ6L 2LTQB 2VQTA 3DX7B 4ORGB 3TJHC 1XGQB 3GHEH 4DN4H 1CDUA 4MS8C 3MV8D 1SBBA 2EIZA 4U6VH 2DLFH 1A3RH 3SE8H 3BMWA 3QXTA 5C08D 1ACZA 3VG9B 1B0RA 5B3NA 2RB8A 4H0IA 2HFEA 2J5LC 1FYTA 5DJDB 3C6SA 2FR4B 3RWIA 2AXFA 4O2FB 5D9SB 4LLYB 2VDML 3V4UH 4IRJA 3ZO0A 4QNPF 3L5WB 4I77L 1K3ZA 1YUHA 3DETC 5HI5D 2IQAA 3QUKA 5GJSH 2FH8A 1OAUH 3QXUA 4PJAE 3TV3H 5BQ7A 1MRDL 5DJXB 4ZXBD 5L8LB 4K7PX 1T4KB 2VR4A 3EZJB 1HHIA 5IHZA 1PZ5B 2FECI 3ZTJG 3MJ8A 2J12B 4XNQB 2EEDA 2C4XA 2NW2B 2AJYH 5CMAA 3QUYA 4EUPA 3VRIA 2BVEA 4PBVC 3VXOB 2GW5A 3C8DA 2IQ9H 5ACZB 4NOBA 4Y4FC 1FNGA 4M1DH 4NPYA 3WNLA 3B9AA 1LK2A 4WHDA 4NJAL 5CBEA 3VH8A 3O11A 4UU9A 3LKOA 3F6IA 1H9VA 1JPFA 5B4MD 5F8RC 4N0UB 1KB5L 2QQLL 1FVEA 4RX4D 4R96B 1CU4L 1G9NL 5F93C 3I9GH 5LQBL 1NGQL 4NCC1 3A67H 5ICXA 4ELMA 3V5HB 3T8XB 1OOAA 2PN5A 4O00A 1E0OB 4WWKC 4HHAB 5SV4A 4ISVB 4XXDA 4OLWL 2EDYA 5AAWA 1K5NB 5GSVA 4NWTL 1I1FB 3KLHC 1MFBH 1F6AA 1IGML 2DQUL 4LLWB 4NC0B 1AI1L 4RDQG 4R90H 4LSPH 1GIGL 1O7SA 3PV6B 4KQ4H 3Q6GL 1MHCA 5DYOA 5EOQH 4JDVA 3DUUB 5ADOL 3O6FD 1ZE3C 2Y5TB 1VGKB 5DR5L 2X4UB 2I5YL 3R8BB 3PP4H 5CEYB 4NBZB 1D5ZA 4WUKL 5I16B 1TTUA 1IAMA 1BOGB 2YXFA 3GRWH 5KN5B 4XPHL 1YMHA 5CSZB 5ILTL 1A7PL 1D5MA 4NT6B 4OCRL 3E3QA 3TBVA 3H0TB 3MLVL 3QHTC 4ZO9A 2CD0A 1BFVH 1ES0B 1WZLA 1FYTD 2W65A 2HVKB 2PO6D 1F11A 1Q9OB 2HT3C 2YPLA 3RA7L 1F00I 5TDPA 2VLJE 3VFWB 3QDGE 1JBJA 1PFCA 4KHXL 4IRJD 2FD6H 3QQ3B 4Q9RL 1JZ4A 5CJQL 5L6YH 3I3BA 3ULVD 1EAJA 4ZOEA 4BQ6A 2BCKA 3IKKA 4GSDL 2YN3A 1U8PA 4L29A 2OSLA 3MRPB 3D85A 2AI0L 4BSVA 3QEQD 1KIQB 1P4LA 4XBPA 2Q76A 3G04B 3KS0J 3QUYD 1G7IA 2W9LA 3HC3L 3V6BR 2DM3A 2GUOB 1T6WA 4MDJB 4MHHI 4OFYA 4OM1H 3S35L 3VRJA 5EDXA 1BAFH 4NQXA 4OGXH 3Q6FA 3EYVA 4KXZH 5KSAA 1OAQL 4Q6IC 2PYEE 1N6QL 4NZTH 2OQJA 1UA6L 3EJYD 2NZIA 1IEBA 2D03H 5FUCE 1LO5B 1UM4H 3GSWB 2KBGA 5BS0E 3N1FC 5KS9B 1NMCB 3PWUB 3U4EA 3VXQB 4M8QB 1FVCA 3IDGA 3DYMA 3ZDZE 2VIRA 5FOBA 2XXMB 1YA5A 4HWBL 3VXSB 1XGYH 5E8OA 2DLHA 4BH8B 5KVEH 2VDLH 3WS3A 1U93A 1FE8L 4Z7WE 5D5MB 5EOCH 5I2IB 1CF8H 1MI5B 1X5YA 2OP4H 5AWNH 2OI9A 2V9RA 2WANA 4PJ7B 4P9HH 1B3JA 3DWTA 3P0VH 4GXVL 1KJ3L 2YK1L 3ILQD 3T2NL 2VXTL 2H26B 4JO3L 1EFXA 4WO4C 4L8SA 5JDSA 3HPLB 3X14A 4Z8FH 5CJOL 3TFKA 1PLGH 1OW0C 4M4PA 1EUUA 4MJ5B 1RFDH 3M1BA 4I0PB 5HVGB 1RJYA 2WP3O 2YPLD 2VDQH 4LIQH 4FQCL 3R1GL 5D7KE 1WBZB 3HLAB 3D2UB 3QWOA 5ENWB 4Z76B 2NY3B 5FO8B 4HPOH 3O3DA 1AO7B 2G75B 1JV5B 2A6KA 1Q0XL 3L1OL 5DJ2A 3RDTA 4YHIB 4MWFB 3UTTB 4XAKE 3GSXA 4MD5A 1A6VL 3D85D 2I9LA 4JFYA 2AJ3A 5DD5H 3RVXD 5I1AB 3QI9C 5E4EB 3MRDA 4GAYA 3BD4A 4PBWD 1A3RL 3B2VL 4QRTA 4NN6C 4LSUH 3VFGL 3VFOA 4OFYD 2ZKHL 3QJHB 4TSCH 3OGCA 3BH9A 4TUOA 2F54B 3S37L 1XR8B 1KTLB 3SKMA 2VSDA 4HGMA 4LSRL 5KSAD 3V4UL 2G9HB 3DBXA 3WKML 2FIKB 3TA3C 2BVTA 3RWDB 4DQOL 2OJZH 5K33A 5L0QB 3FB7A 3QXAB 4I18B 5GJSL 1DDHA 4JM2B 3W39A 5EZIL 5MEPA 5C8JB 1LMKA 1XT5A 3BESR 4X6CF 3JVGA 5DRXB 4XAWL 3UP1A 3FQUB 1MVUA 1EHLH 5ECJE 3RJQB 4WW2A 2WINA 3RI5F 4XBEH 2AJYL 3KPSB 1CYGA 4PLNC 4RRPA 5JHDE 2IGFH 4PRIB 4HJ0D 3T09A 1R5VA 4ELKB 3HAEH 5T1DH 3CFBB 4M6OH 3DVIA 4OCLC 4WY7H 3IDXH 3GJFK 4Q58C 3A6BL 1ED3A 2ZSWA 4JVUA 3BWAA 4JDZA 4K3JH 1EEYA 1DANT 3B2UD 1BBJA 3AB0B 3FT3B 5KSBF 5D8JH 3I9GL 2VL5A 5AD0A 5CZXD 4NKMA 3A67L 2NW3A 4AEHL 3QIBB 1EFXD 4MSWB 5T1LB 4C58B 3LKPA 3ARBB 3TFKD 3BQUC 1T66C 1DBBL 5T3XL 3KG5A 5HGBB 4PJDF 1F6FB 4M61B 1KT2B 1VFBA 4AEIH 1UJ3A 3OPZL 3BH8B 3G5VA 4GKOA 4A6YB 3JWOL 5D93C 3DSNA 4NRXB 1TVHA 2H45A 2OTPA 1P6FA 1R3HA 3MRKB 5IF0A 1T2XA 5F1OB 3RDTD 2KQMA 4FQXC 1Q9LA 5FDWA 4GRLC 2DWEB 2GJ6E 4CVXA 3TBWA 3PP4L 1G9MH 5HGAA 1KLUA 5SWQB 4HUXA 4C83A 5K9OA 2KH2B 1ZHNB 1AP2A 4G6AD 3ULUH 2YD6A 5C07A 1M6OA 3LKRA 2MCG1 5B3JF 1BFVL 2RAMA 4XP5L 1SQ2N 3C5JA 4KKNA 1CDGA 1FSKB 3EIFA 1S9KC 3S3SA 1LP9E 3HC4H 1OD7A 3LQZA 3O2WH 3ARDC 1XF2B 2HVJB 6CGTA 2YRPA 1ZHLA 3D9AH 4Y5XB 2APTA 1INDL 3GSOA 4ZDHB 4O02H 4CVUA 2CPCA 5AUMA 4N8CL 3QAZB 3IJHB 1C5BL 1R0AH 5HYSB 1H3WM 2DICA 2J8HA 1OAXH 1FFQA 5DHYB 4Q2ZB 1PKQA 4OD2B 5BOPA 3CNKA 2YN5A 1VFMA 5CWSA 5D7IA 1W0WA 3B9KA 4ZFOB 1HHHB 1DBJH 1NBYB 4KI5D 1AKJA 3SOBH 1KJ2B 3TPUB 1IM3A 1EXUA 4OM1L 3W9DA 4G9FB 5IVXF 1I7ZA 3WO4B 4JY5L 4NDMB 5FK9A 4R8WH 1BREA 5GIRB 3G5YB 3WCYA 3HTLX 1ZEAH 1JTTA 4X5WA 5TDNB 1QLFA 1JI1A 1DVFA 3S5LB 2YEZB 4XWOC 1ZANL 2VLRA 2ESVA 2D03L 2HT2D 3CVHA 2C9AA 3HCVA 4JFEB 4K8RC 4G80B 3V6ZB 5F70A 5D1XB 3MRHA 3VD5A 3VMOA 8FABB 5IBTH 4YDKL 3GMMB 5JPMB 1IM9A 3O3BA 3DURB 3Q5TA 1V3JA 1B2WH 5KVEL 2VDLL 5FUZL 1JMZA 1CF8L 5JORA 3HAEA 2IAMB 2XNAA 2UWEA 4MJ4A 1C7SA 5AWNL 4AL8H 5EU5B 4WI3A 4P9HL 3MXWH 3N06B 4PJBB 4MYWB 5MHSD 5E2JA 4Z0BH 4X6DF 3TZVA 2Y7QB 4J3OC 2W9DL 2AKRA 4OKVB 5C07D 4G6KL 1FP5A 3AS0A 1FL3B 2NZ9D 4F8QA 3WE6B 1S7QA 3KWWB 3B9VA 4PV8B 1CGSH 4X9IA 4ZTOH 3HPJA 2X7LB 4U1SA 4MXQA 5SWSB 4Q0XL 1RFDL 4XVSH 1DLHA 3VMNA 4U1LB 3BFOA 2EICA 4WW1B 3V5DA 3OXRA 2E6QA 1MQ8A 4LVOC 5GRZA 4OZ4B 1MJ7H 4L9LC 4JY4B 5F7WC 2UUDK 1NCNA 1Z9MA 5CIPB 3CSYA 2DAVA 1DBMH 5ADPH 3SJVB 3MR9B 3B9KD 4Y88A 4OV6F 1M4KA 1AKJD 3OL2A 1UXSB 4CMMB 4TVPD 2HTKC 4RGOL 2MTPA 4EN3A 4TSCL 1PYWB 3NAAH 1HSAA 1AJ7L 1TFHA 2Z8WC 1K4CA 3LPGA 4JG1H 4TOYL 3ZE1E 3ULUF 2QKIA 4QYOA 4D8PA 1UH3A 5JOFA 1NCTA 4LCWA 4MAUH 1JYXA 2LFGA 3MNWB 1DVFD 3IU3A 3QHFL 3UJJL 3RWCA 5EFIA 1I8MA 1U8NA 3QIUB 3ROLA 2ESVD 5JZ7C 1D5IH 4RA3A 4JPIB 4OZIB 2N56A 2BSSA 5FFLA 4QOKB 1IL1B 4WTZG 2NX5B 4NC1C 5GISH 5J8OA 4ZMAT 1C5CL 4EOWL 4HKZA 1BQSA 5M7QA 3IB4A 1IM9D 3OB0K 5KJRH 4ZPTA 1MCOL 3CXDH 3BPLB 2IGFL 5H2BB 4CJ0A 5IK3B 4LPTA 2FWOB 5T1DL 4M6OL 1QFUH 5HDLA 1V7NL 2XPGA 4KJWD 1FJ1A 4JFFA 5C0AA 3ARGA 3PWPE 3D5OF 2PTTB 3UPAA 4EDXA 3K74B 1S5IH 1KTDB 2LU3A 2LE9A 3IETA 4NNPH 3TZVD 3K0WA 3IDIA 2R2HA 1AGFB 1VESA 1FVDA 2GK0B 3A6CH 3PWNB 4LPUA 4UDUA 2W0FA 1HYRC 3CC5A 4O9HH 4RFOL 4X7SH 5EU6A 5C08E 4F7CB 3PGCB 4MXQD 4NZUH 1T1XB 2H3NB 3REWB 4CBPA 1NAMH 4GAGH 1GGIL 4AEIL 5DI8B 5T5NF 5HD8D 4OFPA 5D7SL 4QTHA 2QJDA 2WSKA 4MQXD 4ONFH 4BK4A 5E03A 2IPUG 4IHOA 4JN2A 4OTXH 5AYUH 5HPMA 2FGZA 4HIXL 1NFDA 4M48H 2BRRL 3SBWC 2NYYD 1R6VA 1QFWH 1G9ML 4BQCA 4PJFB 5JQ6L 1NFDF 2DIJA 2X1PA 3A6OA 2V17L 2PCPB 1CE6A 1QP1A 4I2XB 4FXKB 3ULUD 3ZE0F 1FDLL 4EN3D 3G5ZB 1B0GB 5EU3A 3SCMC 1LE5B 3DIFB 4XBGA 3HC4L 4XP9L 4LP4A 4MX7A 5FB8B 4LCWD 1C12B 4PJEE 1RUAH 3D9AL 4HKBA 4X7TA 4O02L 1PEWA 1MCQA 1DL7L 2OX5A 3WJJC 4MNGE 3OKYA 2UVEA 5CINH 1EMTH 2XTJC 3DRQA 4Y19B 5C7XL 2NXZC 4NN7B 4WV1B 2CKBL 1OAXL 2P46B 4MD4B 1GGTA 3E2HB 3NGBC 1N26A 5C0BA 3RVVC 4L4TB 3PQYA 2VZVA 3CXHJ 4OLXL 4FXLA 4OLUL 4G43A 1RZ8A 4I48A 1KV3A 1I1AB 3CFKA 3NPSB 4HBQA 3RX5A 3WXWL 2XQYG 2Y07H 1JZ5A 1KIPA 6FABH 4V2BA 4N0FB 4YNYB 5F1IB 3KPNA 4R8WL 4TTDC 2F53B 1MUJB 4GBXC 4KJPD 2IALA 4JFFD 5C0AD 2B2XL 1ZEAL 4HLZH 3ARGD 2EIDA 2R56H 3TVMC 3ZL4H 2NY2B 4YK4B 1YEKH 1OAKL 2NY6B 3WLWC 1FPTL 1KGCE 1X9QA 3DGCR 3MNZA 3RWJA 4PGDA 4NWUH 5HGHB 2H32B 2ZJSL 5JXAH 3S5LG 3HMWL 4FTVB 5EU6D 5DD6A 1JYVA 1NCCL 3RWFB 2GTZB 1KELL 3FO9A 1U3HC 3PWVB 2IPTH 4FXGA 4L1DA 3KPQA 3IXTA 1KENL 3LEXB 3FFCE 4QNPE 3QJFA 1BJ1J 1IGYA 4PRHB 2EH8H 3EDFA 5KSVA 4TNWK 4YJZL 4O2CA 3WMSA 1F58H 4H25A 4OGYH 5BV7H 2YKLL 1I7RA 5F44A 4OKDA 1ONQA 4YDIL 1GH7A 4HWNA 2ADGA 5C09E 2X42A 2EDDA 1YJDC 5FYLL 3LQMA 4WHTB 2HLAA 3UJTH 1KFAL 1YMME 1KYOK 4HH9A 4DKAA 5IB5A 5FGCB 4U1HA 3RUGB 3VU2A 1CFVL 2NY1C 4YDLB 1J8HD 2F74A 4O5LH 5C3TA 3MRRB 5FGRA 4NO3A 1J0IA 5H94B 1CGSL 3X12A 4ZFZA 4WFFD 5IW3A 4K23H 2ADJB 4PRAA 4XVSL 4GW1B 5IFJA 5J89A 2JIXA 4XNUH 3GNMH 4KKBD 4KKAD 3V4PH 4JHAL 3DUSB 5JHLH 4QRSA 2CSPA 3MV9B 5GGTH 3ALXA 3WDIA 2YPKA 1GC1H 3JV0A 2JJTA 2ICCA 1QR4A 4AIXA 3PQYD 3O45B 4F15B 5ERWB 4XVJH 2KKQA 5ADPL 3IXAB 3OAUH 4RWYH 4PJAB 3SDDC 1T2JA 4D0BB 1KXVC 2X4TB 5DLML 5DJCB 1U6AH 3CMOL 4J1UB 2DQCH 4IRZL 4R7NB 3D48R 2EEAA 4HT1L 4WUUA 2DMCA 3MUGA 5I1GH 3MUZ1 4K07A 4U1GB 3NAAL 2E27H 4JG1L 1HH6B 3ZDXF 1HHGA 3FT4B 2MJWA 3IJSB 4XI5D 2Q87A 4MAUL 5DSCB 1U8MB 4HULB 1A6UH 3QDMB 4XCYA 3EO0B 2D7TL 4HAGA 1UM6L 2Q6WB 4YXHH 2RHEA 3E6FB 3U82B 1DUZA 1NDGA 4Z0XA 1X5KA 4ZAKC 3IS1X 1JHTA 3E3QE 1BM3L 5GISL 1CLYL 4K94H 1ORQB 1FNEA 5SWZA 3OKNB 4YC2B 2YPLE 3T0EC 2QR0B 3CXDL 1YN6B 1K4DB 4OAWA 1EFQA 3BYTA 1NGPL 1RZ7H 2PXYC 3TT3H 3SPVA 4DUVA 1QFUL 3T65B 3WIFB 2A6DB 3PL6C 4TNVK 3VDAA 4PFEA 4WHYG 1RURL 4YHKH 1BVZA 4P5TC 3OKKB 4UAOB 4U6XA 4W4NA 2FSEA 1G7JB 5ALBL 5B38G 4NNYB 1MF2H 1MJUL 1F45A 5TDOB 1MIEH 3UPRA 3FQWA 3QEUB 4XP6L 3AREA 3GIZL 2IH3A 2BNRB 4KVCH 3UEZA 1NAML 5HGDB 4S1QH 4GAGL 4LSVH 4P3CH 5IB3B 2JIXD 3QFDA 3JUZA 1QZ1A 1U8KB 5KVMC 3MFFA 1NFIA 4GS7B 3V0VA 2VLJB 4OTXL 3QDGB 4JFHE 5AEAA 1L7IL 3TO2B 5JPNA 3UTQB 2HG5B 4X7DC 4HC1H 2VITB 5ITFA 5DURD 1G7LB 1OT1A 3GEWB 1Q0YL 1HZHL 1N2RA 1RK0B 3HI1A 4CMHB 4U31A 1FG2A 3KPPA 4N8PA 5I30H 5DUML 4NUJA 1UWEH 1E4KC 3ZKXC 4WUUD 1L6XA 1VEOA 1BEYL 3B8SA 1INQA 4J4PC 4LRNH 3L9RA 5GS0C 1JUFA 5D2LA 3UTPD 1CG9A 1S78C 4YFEA 1RUAL 5I71B 4ZTPL 2F8VA 3IVKB 1RUPL 3W11D 2L7UA 2WBJC 4NQEA 3QCTL 3N0PB 2AJVL 1MNUH 3P4OA 4MLIA 2RR3A 4XC3L 5DRNA 3AU1A 1CDJA 3GBLA 3OR6B 1GYAA 4YO0B 3LN5A 3STBA 2J8UF 4MAYB 5ABDE 5C92A 1KPRA 5SWZD 2IPUK 5BS0B 2IJ0C 5IBLD 5DEGB 2ED8A 5J1SC 4LAJH 4NP4L 1CGYA 3BT2H 5MEQA 4MQ7B 5HHQA 4Y8AA 3KLAA 3QCVH 3F62A 4KRPC 3OF6A 3NOIA 1UEMA 4J7RA 5GGVL 4ZOCA 2B8OT 2AXGB 3CSGA 1D6EB 3MLSL 2JK5A 3MV7E 3PWLB 4Y4KA 4DKFL 4EDWH 3FCTA 2R56L 3JV6A 1G7QA 1VENA 4Z7WB 3G5XA 3ZL4L 3VXUA 5E5UB 3BEWB 4G42B 2BDNH 1ZGLA 1AGCA 1IC4H 4GLRH 3VG9C 2X4NB 3SE4A 4MD0B 1DE4A 1NMAH 5JXAL 1P1ZB 4A2MA 2CDEA 5C0IB 2CGRH 1BLNA 3B3IB 4U1IB 32C2A 5FHAL 4DZBB 3ARED 3P11L 4RAUB 4NBXB 2FRGP 4M1GH 2FEDD 1EPFA 2IPTL 2ITCA 3ERYA 1A7BA 1IAKA 2BNQE 1OTTD 4PB0H 4RNRB 2EH8L 5T1MB 4V1DA 1UCTA 4D3CL 4ZS7L 1LD9A 1KB5A 1N7MH 4P9MH 5BV7L 5HVWA 5FECB 3SDCB 1RZFL 4KK8D 4LU5L 1Q9KB 3S4SA 1MRFH 4PRDB 1JWSB 3RTQA 4X6CE 2V2TB 5DTFA 2FX7H 4JZJA 4WWID 2E7BA 5F71A 1E4WH 3UJTL 1RVFL 4ODHH 2XQYK 1CDYA 3V5KA 5D72H 2V6HA 4HCRH 2P8LB 3RGVA 1W72B 4KMLB 2IFFH 5B39A 1RD6A 3MLXH 4WI6A 5K9KA 1LGVA 1BX2A 5BXFA 3C60A 5E8EA 4TQEH 4QXTA 4WEMB 4DGVL 3PWJA 4XXCC 4PGBB 4K23L 1HQRB 1EVTC 1UVQA 3FQTA 3CVIL 5J9PA 2O61B 5J12B 3G9VA 5KSBE 4G7VH 4XNUL 1ND0A 1KLFA 4NQED 3V4PL 4LK4A 3TWCH 5CJ8A 3UBXB 5JHLL 4Y4HB 1NDMB 5GGTL 1MLBB 4DUWA 3RIFK 4WRLA 4PJDE 1GC1L 4PJ9A 2ZSVA 3SGJC 3HE6A 2VYRE 2BERA 5IG7B 1AHWA 1FNSL 4RWYL 4XTRD 4R97C 1Y0LA 3EZ8A 5GZNC 5EU7E 1U6AL 3CUPA 1XIWB 4HZLA 1P9MC 3FN3A 4KY1H 5FYJD 4H88H 1II4E 1CICC 3OF6D 2E27L 2OZ4L 4YFDB 1IGFH 4QRRB 5JHDB 3P9LA 4Y4KD 4NQVA 1R3KB 2Z91B 3MSPA 4RGNC 2Y6SD 3VXUD 5DO2D 3D18A 3K4ZA 5F3BA 5B3JE 2RFXB 3PF2A 1MCDA 4BZ1H 1TQCC 4YXHL 4OI8A 1T20A 3E6HB 1NJ9B 1MREH 2EKJA 5IB4B 5F7MC 5FM5M 1B4JH 4JVWA 4BFIB 4MHHG 3QA3B 1E4XL 4L1HA 3H3PL 3EYUL 1R3JA 5LBSL 4IS6B 4KUZH 1KCLA 4LIQE 4LAQH 4YAQA 5D7LE 3IGAA 2VLLB 3NCMA 3BP7B 3KPOB 3ULSB 3R4DA 4FZ8H 3STLA 3RTQD 1CXFA 2X4PB 3WJLC 2Y36H 1ZT1A 1VPOH 2HN7A 2IMMA 5DD3L 4L3CA 1F4WL 5JNYB 1QA9A 2FJGA 1MF2L 4FQPA 2GJ6B 1KCRH 4JM4L 1FNLA 3SO3B 1ZT7B 3RGVD 1YEGH 3ZT7A 3JV4B 5I1CL 1JL8A 5GRWA 5IVXE 4KXZI 4LDLB 2H9GA 3OR7A 4D0DA 3C60D 3O6MH 2J88H 4I9WD 4YHOL 4HDIA 4PJXF 3BRDA 4KVCL 4P3CL 4GKNB 3VGHA 3THMH 3I75B 1U58A 3GB7A 1LP9B 3PDDA 4G6FB 3QPQD 1WC7A 2BMKA 5D1QA 25C8L 1KEMH 2AV1B 4YZFF 5EOTA 5E08L 5DJAB 1YQVL 1J86A 5DZLA 2VLRE 4HC1L 2EYTB 1N5AA 4PJ9D 2VSCA 3HE6D 4POYA 3QFJA 3V8CA 1NBVH 5I66B 1F2XK 3UYRL 1KLGB 1GJIA 1PKOA 1L9NA 4HCRA 4KKLD 4X4MA 5TE7L 4OF0A 5I30L 1UWEL 1IBGH 4EI5A 3O8XC 5HJ3A 3U0PA 1T5WB 3WFEH 3HKFA 5D1ZC 4U2YA 3IF1A 2W9EL 4X80H 4YPGA 1PD6A 4UUJA 4D9LL 2CLZA 2IADB 1M7IA 4RAVA 3QDHA 4NYLA 4X6DE 3MLTB 4R2GD 2BVPB 1MNUL 1NL0L 1XF1A 5IIEB 4G7YH 4HX1B 1BF2A 5IW1B 1ZWIB 2GT9A 1RPQA 4BA8A 4RIRA 5GSRA 2XV6B 3TN0A 4P23A 4LMQE 3FZUD 1MWAA 4XPAH 3BT2L 4MCZB 1RK1A 1J1PH 2VLKE 3EGSA 3QCVL 3Q3GA 4HUUA 2CO7B 3BRFA 3VWJA 2DI9A 5IJKA 3C5ZC 2COQA 2NY4D 5H37G 3GGWA 1HHJA 4EDWL 4GW4A 4KTYA 3V6FA 3DO7A 2DL9A 2Z31A 2D7PA 3J8F7 3MRIB 4UQ2A 3H42L 4FQLH 5I15H 1G6RA 3EOBA 3RRQA 2I07B 1NMAL 5TQ0H 5CD3A 5IGXL 1DQMH 1CLCA 2EO9A 3GMPA 2CMRH 2KL6A 2O5YH 3ULUE 5IM7A 5C0RL 3DX8B 5FF6A 3MNVA 1W0YT 4M1GL 3ZT6A 2EKSA 2OYPA 3WFHB 5CUSH 2VC2H 3SY0B 1Z9LA 4P2RB 3NFSH 3U46B 4OQTL 4LCWE 1OWWA 4P4KA 5J6HA 3AY4C 1GXEA 4P9ML 5D1QD 3I6LD 3SDXA 2LVEA 4S0UC 3O4OB 2VWEE 3MJ7A 3OXSB 3LKNB 5IT2H 3I02B 3V0WH 1WZMA 1TZIB 3SDXF 4PY7A 3HE7C 2X2YA 3SKUD 3U4BH 3QFJD 1IFHH 2K3TA 5D72L 4P3DB 3ZMRA 3A0OA 1H3TA 1NCDL 4PGCB 2R2EB 3MLXL 4EI5D 3DMMA 1CD1B 3GJEB 4QO1A 2B4CL 4AIZA 4TQEL 4JFDE 2D0FA 4F9LA 1FC1A 4OF8A 5CHNA 3VXTB 4EKXA 4Y4FA 1ZV5A 4UDTB 4OLZH 1MQKH 3QXVA 1FO0H 3IDJB 3I3EA 2WW8A 3BAEL 4LMQI 4BKLB 1P2CA 3QIBC 3HZYB 5FA4A 1FZJA 4LCYB 5C2BH 4IEFB 1OB1A 1WICA 4TPRL 3W9EB 1ZSDA 1MVFA 4YLQT 5C71A 1MFNA 5KBNC 3TN0D 4P23D 5BRZA 3WFCH 1QFOA 3L3DA 2FEEI 4ZXBC 1H3GA 1KC5H 1DQQA 4RGMB 2JJSA 2G2RA 3N1QC 2PW2B 4H88L 3NCBB 3VWJD 3VXRE 3WLBA 4RMRA 4LLUA 4JY6A 3WDJA 3L3HB 1NFDE 4OCWL 4YHPB 1ZVSB 2Z31D 2Z35B 4QF1A 4X98A 2FATH 4NM8L 3X3GH 3PWPB 4Q7DA 3FHQA 3ZE0E 5B4MC 4BZ1L 3W5NA 3KYOA 4IOIB 4M8VA 1A6AB 4WFHD 2QQKH 4RISH 3O6KL 1GZQA 1X5HA 2QHRL 2V7HA 5EOCJ 4HH8A 2FX8H 2XZCL 5F3HB 4ODXA 2YWZA 4ZSOE 1B6DA 1JZ8A 3WIHH 4P4KD 5F89A 3O3AA 4Y2DA 1KCSL 3H7BA 1I4FB 5EN2B 3FO2A 1WWAX 3GDBA 4O51B 4XVUD 1KB9K 4F7TA 4LPVA 4LLMA 3QEHA 3ZTNL 4QHMA 3ALWA 5ESAB 5C0BE 3L3IB 4ZUVA 4UTAH 1ZLWH 3O6FC 1J1XH 2R23A 3TYFB 1RMFH 1DCLA 4NQCE 3K8LA 3DMMD 4PRPA 2ILLA 3R8QA 2J88L 4F7PB 3U2SB 5JW5A 2UZIH 4OBRA 3SEPA 5IKCB 5BVJB 3MGOA 1T04B 5EIQA 1HXYA 2P5EE 1Q72H 1F3JB 1EGJH 2YBRA 3GMRA 5IQ7H 2PO6C 3IRPX 1CWVA 4OM0L 2BFVL 3STZB 3WYRA 5E7BA 1KEML 4PJEB 1D6VH 5I73C 4GG8A 4MCYA 3M07A 4IRJC 3F65A 4WDIA 1DR9A 4R7DB 1AGEB 4MNGB 2A6JB 3ULVC 3MA9H 3U0TA 3KPRA 4BK5A 1A9BA 4CU6A 1PG7W 5BRZD 1A4KB 3TYGH 1QRKA 5J1AB 3LH2H 1JGVL 3RFZC 1QSEA 1A1NB 3NCYS 2YD1A 4LVNB 3VFNB 5IW6A 2FYYA 4WTWA 1AD0B 2BP3A 4OI7A 1F3DH 2YD2A 3QUYC 3HNSH 4X80L 2X9WA 2E7LE 3C6LA 1YEDB 4Y5YC 1BGXL 3EYSL 4RQQB 1HINL 3BSZL 1A5FH 1L7TL 1DN0A 1HQ4A 2C3XA 2QADD 5E8PA 4NKIH 4CAGA 1FO0A 1S7UA 3GKZA 3FRPG 2GYSA 4F3FB 2WUCH 4PDCE 3MJ6A 5F9OL 3SKJH 3EJYC 4JGJA 3O2DA 2EIZB 4OQ1A 1WEJL 4EJ1C 4LCUA 1T7VA 2A9NL 1W0VB 3MROB 4TUJA 5EIVA 3SGDH 4Z5RA 1G84A 1Q8MA 1U8IA 4UB0H 4Y2DD 5I76A 2BK8A 3FFCB 4R0LB 3ZDYF 3SGEH 4M7JL 4M93C 2WIIB 4PP1D 1XR9B 2NXYB 1NSNH 1QLEH 4ZOAA 3RL2B 2OM5A 3BGFB 4ZFGH 5GS1A 5GRVK 4JFXA 5GS3A 1K2DA 1BZ9B 2HJFB 2R29H 5H8DA 4JN1L 1CD0A 2AAVA 2EC9U 2OL3H 4G8EA 1AIFB 3T0VA 3WHE0 5C09B 4FQLL 5I15L 1EO8L 2NQCA 3BZEA 5GS2H 5CCKL 3DXAE 1YMMB 5TQ0L 1DQML 4PRPD 4WU5B 4XT1C 4LARH 5ANMA 2CMRL 5LJYH 3QQ4A 4JFOB 1TXKA 3LB6D 5LAXA 1RZJL 3BW9B 4OV5B 3VG0L 4FFYH 5H35B 3PDOA 1WWCA 1T5XB 3KHQA 4HAFA 3VRIB 4QGTA 4J2XA 5F72S 3UTPE 3G08A 3QIUC 5IV2B 3ARFB 4I5BA 1OQOA 3WIHA 3UTZB 2R8SH 1Z2KA 3MREB 2R0ZL 3TA3A 1BQHB 3H3KA 5BVPL 2AQ3A 5I1DB 4QRQA 3KPRD 1UENA 4U6YB 3U4BL 1FV1A 1IFHL 1UXWB 1V3MA 4QKXB 5I1HL 3BPCA 1MCPH 2AK4A 5DEFA 1QQDA 4L4VA 4OZFB 2QQNH 1H8SA 1QSED 4LRIC 1S7SA 4PJIA 1IEAB 1KCVH 3VXNA 2FGWL 5GSVB 5DHVA 4F37K 5JW4R 3C6LD 4PJIF 4S1RH 1WTLA 5DGRA 3WXVH 3QULA 1F6AB 4CL7A 3RNKA 1MQKL 3UC0L 4X8JA 1HN1A 2VTFA 5AG9A 1S7WA 5DYOB 3MLYH 3VXME 5C2BL 1WFOA 3FOMB 4MNHA 2VN7A 4NGHH 5T1KA 2R0LL 2CQVA 4DVRH 4HXAH 3QXDB 3BQUA 1T1WB 3OKDA 3WFCL 3WL9B 5D96B 1AXSB 2IANA 4XZUB 1MEXH 1KC5L 5LWYH 1WBYA 2BSRB 4J12A 1S7TA 3QG6A 3TO4B 5KW9L 4Y5VA 3LAFA 1QFWI 5BOZG 1KTKE 2C7UB 5TDPB 4KC3B 4YX2H 1SVZA 1QSFA 4JPWH 2CKBA 4HJ0C 3BD5A 2CIKB 4HIEA 1S9WB 1A8JH 4KZEH 4K3EL 2ID5A 3X13B 1AY1H 3IU4H 2OI9C 2FATL 5L8JB 2R2BA 3CFEB 3X3GL 3WD5H 3UMTA 4DK6A 3GUTA 1S9XB 4JO2H 4DEPB 4JKKA 4DK3A 12E8L 4OLEA 3B2UC 1MY5A 2CJUH 4RISL 5CILH 1S3KL 3G9AB 3GHBH 2CRMA 2F5BL 4K3GA 3IFLL 5DUBA 5ESVB 3TFKC 2FX8L 1YYLL 4A6YL 1VKXB 5DMIH 4NKQB 3QCUH 2HFGH 4HS6B 5HHMA 1ZHKB 3OWEA 4FQJH 1SEBA 1DQJB 1RZKC 1FAIH 2ICES 4JR9L 1I7UA 1KXTB 4YR6A 4MJ2A 3MJ9A 3TA3D 4CW1A 1NQBA 2J8UE 4HJJL 1OGAE 4HS8H 3EOAB 5A16A 5J57B 3PNWA 1EZVX 2CLRB 1TJIH 3RDTC 3BGMB 4M7KH 2BOCA 5FKPA 4FHBD 1U8JB 2OL3A 5FYJU 1I1AC 2VZSA 3LKSB 5TGBA 1M7XA 4MA3A 1RMFL 5E6ZA 4GJTB 2AK4D 2GHWB 5TFSH 4L4VD 2GTWB 2JELL 1GOGA 3QO0B 3L7EA 4G6AC 5D2NE 1MH5B 3WBDA 2MPAH 1IRAY 1LE9A 3BUYB 2NY2C 1DJSA 3JTCA 4QHNA 2UYLB 1Q72L 4OZHB 1LQSR 3DX9B 1OAZH 3CPLA 1SBSL 1QYGH 4K7PH 4Z7UB 5T3ZH 1A6PA 3T77A 4JHWL 1AR2A 5EORL 5T1KD 4XCFH 2BNUB 3GSRA 3QWQB 3F5WB 5DD0H 4Z7VA 3BQUD 4LBEB 1F13A 3KNBA 3CDYA 4R3SA 3TYGL 2IAND 1IC5H 1IQDA 1RJZB 1SYVA 5E95B 4ODTH 1SM3L 4L8SB 4R4ND 2B39A 4PRNB 1MIMH 3JVGC 1KJ2L 3MBXH 3P9MB 3FOLA 3D39A 3LQAC 4WW2C 4V1DE 5DJYA 3QEGH 4O2EA 4KI5C 4U2ZA 3BEVA 2MNUA 1QSFD 5GHWH 3I6KA 4RBPH 3QXWA 3AXLA 1V05A 3WEXB 2C4FU 3MV7B 1LO3H 1MFDH 3NIDF 2CUHA 2AV7B 2XN9A 3MRQA 1H5BB 3OX8A 2Y1VA 5CGTA 5CJ5A 1DEEA 4UQ3B 4C4KT 4TSAL 2HT2C 1Q94B 2VABA 4HGWA 3SDAB 3T0WA 1OTUD 4FG6D 1D5XB 4M02A 3PJSA 5EB9A 3LN9A 1PJ9A 2HJLB 5I8EA 5HHMD 1X4ZA 3KDMB 1TCRA 4FQQA 1T22A 1NGWB 1PDKA 2BNQB 1UJ3C 3CXHK 5IB2A 2I25N 3L5HA 1QLEL 5CD5D 2DQEH 4MDIA 3WNMA 1XH3A 5LGJA 4M6AA 3T04D 3S88H 2AJUL 2ARWA 5A2JH 4APQB 3B5GA 4X6CB 4Q9QH 2J2ZA 5MEPB 3MRNA 4BH7B 3HMXH 5GS2D 3WN5A 4XWGL 4OJFL 4OSUH 4U1JB 3ZE2F 4KMTL 3CDCA 3EOTH 3GJFH 4FFYL 5IVZB 2K7PA 2NZ9C 1N8ZA 1ZLSH 1ZK9A 5FYLD 4P2OB 5J11B 2ADFH 4BSWB 1G7MB 1JGUL 4FABL 3G6JE 5KSBB 1MLCB 5HHPB 1X5IA 2YMXL 4HKXA 3HR5A 3RNQB 4G5ZH 4JRXD 4Y1AE 4K8RL 5ID0A 1XF4B 4G9DA 4OCSH 4DKEL 1HHKB 2BC4B 1RUQL 4PJDB 5EBLA 3GMOB 4U1MB 1MCPL 3VFPB 3D39D 1JPST 3B9KC 1A6TB 2OTUB 4IMKA 2ICEA 5C0CA 4OZFG 3PGDB 4HIHA 4PJ8B 4KK6D 5I75B 1YJDH 1IAOA 1P4IH 1BFOA 1Z3GL 3IDMB 4QWWD 5EIIA 3FTGB 1SEQH 2XN9D 4LEXL 1DVFC 3KJ4C 3U9PH 4PJXE 1AXTL 1KLUB 3CDFA 4EIZC 3FN0H 2W92A 1RIVL 1AP2B 3U6RA 3EOYG 4ONHB 1OGTB 1ZHBB 5DK0B 1YPZA 1T1YA 1MEXL 4AZ8A 4KROD 4YZFE 3RY6A 4N9OB 4S11A 1UADC 3OJDB 1AGBB 4YGAB 2X4OA 5C2UB 3TIEB 1YPZF 1R24A 1V7ML 1FFPB 2VZUA 5I1IH 2O5ZH 1FN4A 1WITA 4OF5A 4JPWL 5I74B 2WWMD 5D7LB 5AUMB 5HYJA 5IOPA 1YN7B 1ACYH 2GY7B 4KJWC 3DLQR 3DRTB 1FLRL 5AG8A 3QB7C 4PTUB 4JAMB 3VFSA 3WD5L 3RIAK 1GGBL 4UT9L 2IPKA 4M7LH 4X7EC 2CJUL 3GMNB 3TZVC 5CILL 5E56A 2KUTA 2XKNA 3GHBL 2QTEA 5IVXB 1W8NA 5JO5A 1N6VA 1P7QA 5DMIL 4ZO7A 4X7FC 4IMLB 4MXQC 2O5XL 5HHVH 3LRHA 2FO1A 1DUYB 3HG1A 4ENED 5D7JA 3QIWB 4FQJL 4W6XB 4HZAA 5HD8C 1D9KA 2E9IA 4LHUA 1C16A 4MQXC 3BO8A 1OQXA 5KANI 4P5KA 4HS8L 4MAYC 4QCIA 1H8NA 3B6SB 5KOMC 2FNBA 1QEWA 1ZKAA 4AG4L 2X1XR 4M7KL 5DRZB 4F7EA 4G6MH 2BJMH 2VLRB 5FKAB 2VH5H 3KR3H 5TFSL 5F7KC 2NYYC 2EYRA 2VAAB 1MCLA 2ITDB 2V7NA 4K7FB 3MRHB 4UNTA 3KYAA 4DCQB 4LSTL 5C0CD 1HXMA 5EZJB 2MPAL 3S35X 4G59A 4G8GA 3O3BB 3GJFA 4GLRI 4EN3C 5DRWA 4LVHC 4FQ2H 1UCBH 1NBZB 3FO0H 2X1QA 3CX2A 4UV7H 5CEZH 2VDRH 4NQTA 2HAZA 2ATPA 3GI9H 3W0WA 4XHJD 2AK1L 1QR1B 1O5DT 4X6DB 4YDJB 2DWDB 5ID1A 3MBEB 3ECBB 2WY3A 3U30B 4PLJC 5T3ZD 5KZCB 4WFHE 2CUMA 3UAJD 4JFPB 1FGNH 5DD0L 5KAQF 2OK0L 1PEZA 4Y16B 5J7CC 2AKRB 3TIDA 4DW2H 1V3LA 3M17B 1IC5L 3MPCA 4N0RA 3KPLB 4C57C 5I0DA 5IFHH 5IJVA 2B5IC 1IKFH 2EH7H 4U0RC 1JPTL 3QEGL 2MKWA 4Q97A 2FX9L 5ITBL 2VDKH 2VLKB 4OD1H 4L3EA 1U92A 5GHWL 3QUXA 1I9IH 4CNIB 2UUDH 2Z93B 5C9KA 1TMCA 3KPMA 3LDBB 4KJPC 2DN7A 5HTSA 3REVA 2C3WA 2FECL 4P46B 1LO3L 3C2SA 4D2NA 3DX6A 4K9EL 4ZO8A 1F4XH 1P7KB 4YQXL 4NQSA 2XZZA 4EBQH 1ZA3A 5FUOL 5GGRY 4PLKD 4P4RA 1TZGH 4IOFD 5F9AC 4WEBL 4UT6H 4ODBD 4DGYH 5GS0H 3DVNA 3PABB 1C1EL 3HG1D 3VJ6B 5D7JD 1JPGB 3PHQB 5CEXA 5F1NA 3VI3F 1EO5A 1D9KD 4MJIB 3QH3A 3ZKMD 4QYOB 5DMGD 4LHUD 4AH2A 4ZYKB 1S7RA 1U8HB 4QRUA 5I8OH 3LVEA 5I1KH 4X9GA 2NXZD 3GMLA 2C3HA 5DJ8A 2CLVB 3PHSA 2H6PA 1AD9B 3O9WB 4Q9QL 2BY2A 3OB0H 4K2UH 1MHEA 2BSSB 3HMXL 4PIRF 3C8KB 3MLZH 5F6IC 2QQQA 4FMKA 5MERA 4PTTA 1FAKT 2NNAA 4L8DB 1QUNA 2EZ0D 4ZQKA 3EOTL 4PJGF 1XGRB 3ARRA 4YEFA 4JFDB 4TTDD 4H0HB 2X70A 3RZCB 2EYSB 2ADFL 1RU9H 2HLFC 1UQSB 3MGAA 3W0WD 5DJ0B 4HK3N 43CAA 2GCYB 3CH1A 4KKBC 5DA0B 2W1NA 4XPBL 5ETUB 3MRMB 4NKDB 3F8UB 1U91B 5ICYB 2J3SA 3BPNC 2A74A 3O2VH 1IAIM 2ZCLH 4ZAKA 3D0VA 3OHXB 4J6RH 5EZLB 1AQKL 4LHJB 5J4MA 4P2YA 1J5OH 4MB3A 4NFBA 5J13C 1DQLH 1XCQB 4OCYL 1OCWL 4ZNEE 2VLMD 4JANB 1ZGLM 2F5AL 1WJ3A 2A6IB 3IAGC 5EC2A 4PG9A 4L3ED 4X6FA 3QUXD 5EUOB 1YJDL 1P4IL 3VXRB 2ICWA 1M7DB 1NFKA 5C0DA 3VWKB 4XI5C 1NFDB 1E28B 3R0MA 2XZQL 1S9VA 2GAZA 4Z77A 4NCDA 4TUKL 4M4RA 3MLPA 4HIJA 1WBXB 4AQOA 1QBLL 3H9SA 3BDXA 3VGFA 3OKLB 1RIUH 3WSQL 3D0LA 2YD8A 3HUJF 3PDGA 4TYUA 3O0RH 1HH9B 3UDWA 4C56E 2EDRA 4ZFFA 3LMJH 5DS8B 1CT8B 3L3JB 3GSQB 3QSKB 4Y0GA 1JGLH 5CSGA 1R3LB 4ZSOB 3OJ2C 5B8CA 4U6HA 2O5ZL 1QRNA 1J0JA 1S7VA 3KXFB 5DMJB 5DUPH 2VDNH 5J06A 3I50H 4XCEA 1KEGL 3BZDA 3L6FB 5I18H 1A2YB 2D4FA 1IARB 3LOWA 5EA0H 3QUZA 3VGGA 5IMLB 1D5BB 1KN4L 5C0BB 1UM5L 4M7LL 4AQ1B 1JGEB 5FEBA 3TJEL 2ZP0T 3LV3B 5B22A 3O4LB 5HI3D 4NQCB 1WIOA 2FZ3A 1S9YB 3VCLB 4E41E 4X99B 4YHNB 5C0JA 4P59L 1KIPB 5HHVL 4GRMB 3DVGB 3F12A 3GSNA 4MA1C 2X4QA 3QG7H 2X05A 1DLFL 4ZD3H 5E5MA 1NLBH 4HKJA 1UB5A 2W07A 2P5EB 3EJJX 4HUVA 5C1MB 5IWLA 3JBG7 1CD8A 2HWZH 2R1WA 2ZCHL 4XH2B 1JNHA 2ADIB 3QP3A 4JQIL 2EDBA 2GITA 4G6ML 4N1EA 4ZAKD 1I75A 4YE4H 5HDQH 4OF7A 3BUTA 2JJTC 1X5GA 4HSQA 1REIA 4YHZH 2F58H 4EI6A 3LRSA 4PGZA 3I6GB 3JTSB 1RUML 1I1YB 1R5WB 5FXCH 3ZSTA 2CXGA 3VE0A 3IXTB 1KNOA 4MMXC 2BSTA 3BXNA 1QVOA 4N5EA 1HKLH 3U48A 4JJHA 2K1MA 4FQ2L 4M43L 4Z9KB 1RZGA 3FO0L 4JQVC 4M7ZB 5EC1A 3PP3H 3OAYH 3DX7A 5CEZD 4ORGA 1XGQA 3GI9L 1CXLA 2QV2A 1HCVA 3P4MB 4HV8B 3W11C 5HHNB 1PX4A 3H9SD 3O3UN 4DZ8B 1IC1A 5DJDA 5I17B 1FYHB 3ES6B 1TQBB 4DW2L 3O3EB 1N3NB 2FR4A 2FBJL 1MAMH 3SQOH 1WIUA 4O2FA 3X17A 4HW6A 5IFHL 5IHUH 1AE6L 1E27B 2ORBL 5D9SA 4LLYA 4LNRB 1RHHA 3L5WA 5IBLC 4RFEB 1NAMB 1HNFA 4DFIA 2VDKL 4IDLA 2BRQA 1QRND 5E2TH 1F4YL 2Y5EA 1LEIB 4PJCF 4C4KO 2JB5H 3BIKB 3V4VH 5DJXA 1T4KA 2VISB 4KPHH 3W82A 5JIIA 3QUZD 1PZ5A 1JN6B 1F4XL 3K2MC 1U3YA 2NW2A 3U7YL 1NUDA 4L4VE 4IIQB 3VXOA 4BZYA 1A1MB 3DXAB 4PR5B 4PJIE 1TZGL 1T7ZA 5ACZA 1LO0H 3ABZA 4UT6L 4V3DB 3AREC 4DGYL 5E4IA 3QZWA 2FEDC 4N0UA 1CD9B 1OTTC 2VQ1A 3FQRB 4JO1H 5I1KL 1XGTB 3V5HA 3T8XA 3CSBA 4KK8C 3LHPL 4HHAA 4ISVA 3V6OC 5E8DH 3VI4F 2DMKA 1W72L 1K5NA 1LNUB 4L5FH 1I1FA 2KQNA 4NHCL 4XP4H 5EZOL 3NABH 3QHZH 3T3PF 4LLWA 1L4IA 1CTNA 2HRLA 3GI8H 4MNQE 3B43A 3VGDA 3DUUA 4N5ED 4JPKL 3LKQB 3NTCH 1N5YL 2ZOLB 2Y5TA 1VGKA 4FQ1H 1RU9L 2X4UA 5CEYA 1EBAA 5LCVL 3SPVB 5I16A 1MCCA 1QHPA 1BOGA 1T1ZB 3FAXA 2Z8VC 3NN8B 4H20H 5KN5A 2NTFB 1JCKA 4GRWE 5CSZA 5FYKD 4WU7B 5DK2B 4NT6A 3H0TA 5K59F 2DJUA 3C2AH 4TTGA 1ES0A 4NN5C 2C1PB 3VXMB 3QUML 4LKXB 2HVKA 1LO4L 1Q9OA 1I85A 1EEZB 3VFWA 5F7DB 1J5OL 4XTRC 2ZZUT 1NGYA 3QQ3A 4AT6B 2DDQH 1OSPH 5T5NG 4TNWF 3ETBF 3LS5L 3DV4B 4I13B 1TPXC 1FNHA 2JLLA 3MRPA 2QSVA 4QGYA 4XMLH 4S1SH 5JPNB 5BV7B 2A0LD 2P5WE 2Q8BH 2FIRT 1KIQA 1QKZL 2LAAA 1HILB 2Y6SC 2BX5A 2ED7A 2ZUVA 3G04A 4WFGE 5DO2C 5TE6H 3RPKA 2GUOA 4MDJA 1RIUL 3SE4C 1KBGH 4ZUWB 3VGAB 2XWBA 5TQ2L 5FAAA 4LSSL 3O0RL 3CMGA 1FG2B 4GMTL 1VACB 1DQDH 3L95B 3B9DA 5EBMB 1A64A 1F4HA 4X0KB 1UJTA 2EDTA 5AZEL 1A6ZB 4U3HA 1UZ6F 1LO5A 4I8DA 1TJGL 3EDDA 3GSWA 1G7PB 2VDNL 3PWUA 2G5BB 3I50L 3VXQA 1KPVB 5KS9A 2GSIB 4BQ9A 4M8QA 2J8UB 4OCNC 1OGAB 3DHJA 3RTQC 1IGJB 5EA0L 4JZJC 3CFCH 4B5EA 4S0TD 5KS9F 3VXSA 2AGJL 3EW3B 1I9RH 2R69L 4M6MH 3OMZA 4BH8A 5ESQB 4PJHF 3RGVC 3RKPA 1Q9WA 1RSFA 4PD4J 5GZOD 5F7EL 5D5MA 5I2IA 1MI5A 3PXJA 4I0KA 2P24B 3C60C 2ZUYA 2JCCB 5D2NB 5HHQB 4PJ7A 3KLAB 4JFQB 3NIDE 5BO1L 3TM6A 5FO9B 4Z7NF 3QG7L 2GEEA 4ZD3L 2XA8L 3DGGB 4LOUD 1HEZB 2Z4QB 2JB6B 5A2FA 1LHZA 3PGFH 15C8H 3ISWA 2H26A 2XN9E 3QPQC 1WZ1L 2G5RA 5C0GB 3HPLA 2OMBA 4I3SL 3SGDI 1LDPL 4MJ5A 1YEFL 4I0PA 4PJ9C 4LQFH 1XCTB 3SGEI 2CDEB 3HE6C 2H1PH 4P49A 1WBZA 3HLAA 3D2UA 5ENWA 4Z76A 3DNKA 1TZHB 5FO8A 1NCBH 5CLWA 1KIRB 4ALAH 1A7RH 3BKJH 3L7FB 2X4RA 1T21A 3KYNB 1AO7A 2G75A 4KKLC 1JV5A 1WAAA 3CH8A 2PW1B 5IEHA 1UKSA 4YHIA 4MWFA 5JXEA 3UTTA 3LZFH 4V1DB 3C5ZA 1BMGA 3T2QA 1CXIA 3O6LH 4YWGL 1MJ8L 1JPSL 4FNLL 4UINL 3WUZA 5SV3A 4N0CA 4HD9A 4H26B 5I1AA 3FB6B 3BP4B 4RFNB 1KXQE 1JRHH 1CVSC 2VXVL 4TNVF 3ZE2E 2F15A 4R2GC 5EG6C 1OHQA 2LQRA 2VDOL 5E6IB 2VMFA 4E0RB 4PYGA 3QJHA 4UV4H 3DROB 3WFBH 2X4SB 5JR1L 2JJVA 4ODUB 3TCLB 2AJXL 2F54A 3SQOL 1XR8A 1KTLA 3LS4L 5GXBB 1LEGB 3GZKA 5BXFB 2G9HA 4IM8A 4KDVA 2P48B 3FZUC 2ERJB 4JPVL 1YECH 1U8OB 3RWDA 4YHYC 1TETL 5L88H 3AY4A 3QXAA 1BFTA 1I8KB 5E2TL 4I18A 5F96H 2CK0H 4JM2A 1SYSB 2EE9A 5C8JA 1CFQB 1CXHA 2NY4C 4ONGH 3ULVH 1AR1D 3NCJH 2DKSA 5DRXA 3FQUA 1FH5H 4X8XA 2AEWA 5CP7B 3VXSD 4NC1E 2W0PA 3KPSA 2UZXB 1J11A 4PRIA 3F7RA 4ELKA 4OD3H 4ETQB 2EDLA 2DQJH 3CFBA 1MI5D 2Q3ZA 3WFDL 4EUPH 4MB5A 5IESH 1Y18B 1OP9A 4U0QB 4GAJH 3NFNB 1M1SA 3LEYH 4G6JH 3D25B 4XNXH 3C08H 4FZEH 2VAJA 4ZODA 3QIBA 4MSWA 2R1XB 4X7CC 2E7HA 4JO1L 5D1QC 5T1LA 5E9DE 3ARBA 2HRPL 4XPFH 3G6JB 5HGBA 7CGTA 4M5ZH 1RJLB 4KQ3H 3IDYC 4I0PD 5E8DL 2QLVB 4M61A 5E0QA 4Y1AB 5SX5K 1KT2A 1TTFA 3TNMB 5IR1B 3BH8A 3C9NB 4L5FL 4A6YA 3D2UD 2R1YB 4C54A 1YPZE 2NY3D 4NRXA 4PJ5E 1A9EB 4LCIH 1AO7D 2AABH 5DVNA 4NO2A 4EI5C 5JXED 3UTTD 2P8MB 2DWEA 4JLRB 2YHGA 4GH7B 3HC0B 4OFIA 5CIPH 3QRGH 3BKML 3T0AA 5HYJE 5E1HB 3CCHB 5SWQA 3UTSE 2XKUA 1DSFL 4H20L 4N0CD 3STLB 5K9QI 1SY6H 4GG6E 1ZHNA 5HHXH 5IUSA 3F6LA 1CDHA 1F6LL 4XB8A 4LDOB 2APVA 3MRGB 1CR9H 1JI2A 3EFFB 1JZ6A 1N6UA 1MJJB 1VADB 1F3DJ 3UTOA 1VGEH 4HLZG 4PJXB 2F54D 2WAHA 1XF2A 2HVJA 2FLBT 3BKYH 1JP5A 2BHYA 1GPOL 1JNLL 1A7NL 4JREC 5GGUB 5KVDL 4OCXL 2CRZA 4Y5XA 3TN0C 4P23C 4ZDHA 5TE4L 4N9GB 3NH7H 1I8LC 3IJHA 5BCAA 5DQ9B 5HYSA 5ICZB 2VXUL 4NQDB 4JM2D 1DANU 3WS6A 5DHYA 4Q2ZA 4HS3B 3MA7B 3VWJC 4OD2A 2XTJE 5IJKC 4MZ2A 1GGUA 4YBLB 4XMLL 3FAWA 3U79A 3BDYL 4F58L 1GGYA 4LDEB 4ZFOA 1LVEA 1HHHA 2Z31C 3B83A 4M9PA 4F2MB 1NBYA 3KPSD 3QISA 4JRYE 1T2QH 4Z78B 1KJ2A 3M8OL 4I4WB 3TPUA 1S8DA 4PRID 4G9FA 2XACC 3TBYB 4LHQB 1KBGL 1A3LL 4GAFB 4NDMA 5GIRA 2NY7H 3G5YA 4IJ3B 1J18A 5GRJH 4G8GE 5A3ID 1DQDL 5TDNA 3S5LA 2YEZA 1BOYA 5HYFA 2PUQT 5FCUH 5I9QC 2LABA 2PO6A 4P4KC 1HI6B 2A1WH 3QIBD 1G7HB 1JFQH 4WGWB 4JFEA 5T1LD 1MHPH 3ARBD 4G80A 1Z5LB 3MGTB 4BUGA 5D1XA 4XVUC 4Y89A 1GL4B 2XWJB 8FABA 3F7VB 1MFEL 4TULH 3RIFF 3P3YA 2F8OA 3T1WA 3GMMA 5JPMA 1I9RL 2CDFB 4LASH 3T08A 3DURA 3QNXB 3OKEA 3ULVF 4UNUA 1VHPA 4KHTH 1QACA 1QTYT 3QEQA 3DMMC 3CFJA 2VLME 5HI4D 2IAMA 2M1KA 1CTOA 4WVRA 5EU5A 4U3XA 5IBUB 5GJTH 4BSJA 4F9LC 1CE1H 2NY5C 2NY0B 3IFPB 2DM2A 1J87A 3AS2A 1WCBA 3BX7C 3HI5H 4Y5YA 4K55A 3BJ91 1MRCH 3MC0A 3JSSA 1ZTXH 3INUH 3GGWB 3EFDH 2Y7QA 1QLRB 3NIFF 2BHUA 4MJ6B 1U95B 3PGFL 2MWCA 4OKVA 1FL3A 1WFUA 4FFVD 3WE6A 1JIBA 3KWWA 4PV8A 3G6DH 1S5HB 2X7LA 5IVOA 1R5IB 3IYLW 5SWSA 3RY5A 5D70H 4OUUB 5IROA 2H1PL 1T3FB 3VI3E 4U1LA 4CN6A 2DQTH 35C8L 4OUOA 4ALAL 4WW1A 3CU7A 4N0YH 1RZKH 2J5LB 4ELMF 4M5YL 2JJSC 4OZ4A 4QRPB 2VDPH 3TBSB 3ME0A 4AEEA 3J7HA 4JY4A 5JQHC 1NCWL 1K8DB 5CIPA 2IG2H 3SJVA 2XKSA 1YDPB 3MR9A 2ZPKH 3EYFB 2QADC 1SY6A 2N7AA 1UXSA 3S4SG 4CMMA 2EDFA 1ROWA 4PJGE 1RQ5A 4G9FD 1I8IB 1TDQA 4NSKB 4UV4L 1PYWA 4WJ5B 5C86A 3WFBL 2D2OA 1NAKH 1BWWA 5EO1B 4CGTA 4QLRA 3MNWA 1G1CA 3DECA 3RL1B 5D6DC 4EXKA 3QIUA 4J3WA 4YXKH 4JFED 4Y2DC 4JPIA 4KTDL 4KJQD 4PP1C 1IL1A 4QOKA 4CKVX 2NX5A 3BE1H 4ONGL 4S0SD 5D1XD 3NCJL 1ORSB 5HDBF 4HXBL 4X4YB 2FB4L 5EO9B 2B0SH 2P44B 3L5JA 3QDJE 3IJYB 1BBDH 3LQAH 3IKCB 1A6WH 5IK3A 4WWKB 4OD3L 3L3DB 2DQJL 1DBKH 2FWOA 4LRIA 3ROOB 3T0EE 4MA8L 1H0DB 1E6JH 2IAMD 4NO0B 5IESL 3S36L 3NFPB 4NHUE 3HS0B 4RWHA 1ERNA 3LB6C 1JVKA 2RIKA 4KGJA 4LLVB 2PTTA 4G6JL 4GQ9H 4JJ5B 1KTDA 2J1KA 3WLBB 3C08L 3IDUA 4FZEL 4Z7QF 5CEZE 1AGFA 3HUJE 4KJYB 4PV9B 5CGYD 2GK0A 1IGCH 3PWNA 4ONOA 4F7CA 3GKWL 4H1LH 3PGCA 1T1XA 2H3NA 5SWSD 1JMXA 3REWA 5JLZB 5C9JB 4OT1L 1U8QB 1FNAA 5DI8A 5F97E 4N90E 5C0FB 4JZOB 2V7HB 3HRZA 3HFMH 3BOVA 1CXEA 1N0LA 1ZVYA 4WI8A 1QRNE 3CGTA 3E1F1 3QRGL 3SE9L 5KANG 4PJFA 3C6LC 4JB9H 3ZT5A 5EUKB 3SJVD 4LPYA 1FRGL 2PCPA 2MHAB 2MQ3A 5DGQA 4I2XA 2R4SL 4FXKA 1HYSD 4PJFF 5E99H 1SJHB 1QD0A 5BZWB 3G5ZA 1B0GA 5MENB 1CR9L 5KG9B 2GJJA 1LE5A 3DIFA 4OZGE 4QTIL 1VGEL 3ZHLA 2O93L 5I1EL 3QO1A 5DWUL 5IEKB 5FB8A 1C12A 3BKYL 2DQHH 3L5IA 3U1SH 2ZNWA 5E6YA 3OAZK 1AC6A 4C56B 2I60H 4L8CB 1I3UA 2EXYC 4Y19A 3D69B 3QIUD 4WV1A 4R26L 4MD4A 1CLOL 3E2HA 4QOKD 5F7HA 5GS1C 2NX5D 3BWUC 3HZKB 4L4TA 2MCPH 2EC9T 5IMKB 2C1OB 1GHFL 4Q6IB 2GSGB 2F19H 5AYQA 4AENB 3IS0X 2P8PB 1CQKA 4FQHB 5GPRA 1EV2E 1I1AA 5FGBA 3D1MC 4JFZL 5F9JB 2FJFA 1P6AB 4YNYA 3GHEL 4DN4L 2D7OA 2F53A 5JIKA 1MUJA 2NY7L 2DLFL 4U6VL 3DARA 3SE8L 1HWHB 4TVPH 2AVGA 4FS0A 5FYKU 1X3DA 2KDGA 3HZVB 1AQDB 4E41B 4LP5A 5IB1A 4QHUB 4HWEH 1MOEA 2OR9H 1TNMA 4AY0A 5JW4M 1W8OA 5HGHA 2H32A 4Z95H 1MHPL 4FTVA 2GTZA 2CH8A 3P77B 1KCUH 1B88A 3PWVA 3CVHH 1U36A 2GI7A 4TULL 3LEXA 2ZG2A 4PRHA 2R4RH 1QSZA 1JYNA 2PTUA 4LASL 1OAUL 4KK9D 3TV3L 4WO4B 2APXA 3QQNA 4KI1A 4HBCH 3EJZD 5D6CB 4KHTL 3HNTH 3VFTA 4PJCE 3LDBC 4N8VB 3DPBA 4WHTA 4R4BB 5GJTL 4UOW0 2PKDA 1U2HA 2VO5A 4JCMA 4WW2F 5I6XC 2IQ9L 4D9RD 4DAGH 1H3PH 4M1DL 4JFXB 4CDGC 4KI5F 2X10A 3FB5B 5IBUG 3EFDL 3RUGA 1T0NB 3WHE1 4P2QB 1BZ7B 1QHOA 2ZUXA 3CU1A 3KAAA 3MRRA 5JDJA 1K8IB 5H94A 2DI8A 2B1AH 2ADJA 3GBMH 3L3GB 3RWGB 4H1LA 4GW1A 1HNGA 3QI9B 4LLDB 4NN6B 2DQTL 1VB9A 2DQFB 4J3VA 4X83A 3HN3A 4R4NC 4Y19D 4D0CB 5E2VH 3MV9A 3U7WH 4Y5VC 5C3LD 4B7LA 1MFBL 3LN4B 4OIIH 3VI4E 5E2UH 4L4TD 2EDNA 3O45A 4LSPL 4R90L 5ERWA 3IXAA 4PJAA 2GY5A 4KQ4L 5EOQL 5L2KE 3T3PE 4D0BA 1I1AD 2X4TA 3ARPA 5DJCA 4J1UA 5F1KC 4JKLA 1CI5A 1EAPB 1T7WA 1J05B 5EO0B 4DGIH 3CX5J 1ZS8B 2F53D 3GRWL 1HH6A 3FT4A 3IJSA 2XZAH 4D9QE 4HG4K 5DSCA 5HPOA 1U8MA 2NY2D 3TPKA 1OTUC 4FG6C 4GW5B 2XWTB 3VXPA 4P57B 3T4AB 5CGMA 2NY6D 3QDMA 1NGZB 5MI0C 2X9XA 5K59E 3EO0A 2Q6WA 4RGNE 3E6FA 3MYJB 4FTVD 1J0KA 5ISZE 2FD6L 5CD5C 2A83B 5L6YL 2WBKA 2B1HH 4J3SA 1ORQA 1F02I 4KTEH 1DBAH 4PRHD 3NVQA 3OKNA 3SKNA 2B0SL 1T03H 2QR0A 1BBDL 1YN6A 1K4DA 4LGSB 1X44A 3MLWH 4M62H 4QXUH 5L2JB 4ZG1A 2WMPA 1E6JL 5E94B 2NR6D 3T65A 3WIFA 2A6DA 2NMSA 4MNQB 3SE3C 3ILPB 1KG0B 4I0CC 3TCXA 3OKKA 5D93B 2X44D 5D7IF 2L7JA 1BAFL 1X7QB 1M71B 2OTWB 1G7JA 2M2DA 4NNYA 4OGXL 5JIHA 5TDOA 3QRFM 1ADQH 5AAMA 4FQXB 4HK0B 4GRLB 3ZYOA 3MRJB 3D3VE 3QEUA 4NNXB 4GRWB 3N1GC 4NZTL 5C0EB 2BNRA 5HGDA 5DVLA 4B0MM 3WKNA 5IB3A 3MRLB 1EJOH 5BZDB 1UM4L 4DTGH 4M03A 4BFGA 3GSUB 1M05B 1U8KA 3FQNB 1UZ6E 5HHOE 4L3AA 2VLJA 2IBZY 3CD4A 3TO2A 2PTVA 3MV9D 3N9GH 1DTUA 3UTQA 3MOQA 3AAZB 2HG5A 1XGYL 3ARDB 3BP5B 1XEDA 2VITA 3UJIH 1CFTB 4DOHE 1G7LA 4JB9L 4KK6C 1PG7H 5EOCL 2C4FT 4CADB 3WIIH 4WFEE 1RK0A 4PJHE 2OP4L 4QWWC 5L9DH 2P5WB 1C08B 2W0KA 4Z18A 3F7PC 1O0VA 2UWEF 3P0VL 3FJTA 2J6EH 1MI5E 4Z7NE 3ZYJA 1C5DB 3U1SL 3OKMA 3IVKA 5FM4A 4Z8FL 2H2PD 1PLGL 3SKOB 2FHCA 2Z0BA 3QDMD 5EBGA 3TGXA 4ORZC 4KROC 2GJZB 2VDQL 4LIQL 9CGTA 3OR6A 5F7NC 5DZOA 4HFWB 4F57H 1UGNA 4XHQA 4HPOL 4MAYA 2MCPL 1YEIH 1MCRA 2WWMC 5BS0A 3T77B 4BZ2H 5DEGA 1PSKH 2EDHA 3VFVB 1A0QH 4PGEB 2HKHH 4MB4A 4MQ7A 2HFFB 4G8IB 43C9B 5DD5L 5T5FH 1BJ8A 3WN5C 3KGRA 3UROR 1JF1B 1F4AA 1I1CA 1AO7E 2AXGA 5E5RB 1GVIA 1D6EA 2X41A 3PWLA 1BVKB 4TVPL 4OGAD 4LSUL 3B5HA 5E2WH 4Z7WA 4B41A 2Z8SA 1UWGH 2ZWLT 5HXMA 2ZOKB 3BEWA 4F37F 4G42A 2G60H 4PREB 2OR9L 3BP6B 2X4NA 4P3WA 3I6KB 3VGBA 4ENEC 2OR8A 4MD0A 1H15B 4ZPVB 1P1ZA 3P73B 5C0IA 1FQ9C 4U1IA 4DZBA 2BOBB 3VD7A 4RAUA 2BNRD 2OJZL 1N64H 2Z92B 3CVHL 4JQXA 4FP8H 1BD2E 4WEUD 4FOMA 4RNRA 5T1MA 4UBDD 4NO5B 4HBCL 2X1OA 2DLIA 4HGWB 2VLJD 3QDGD 5FECA 3SDCA 3HNTL 1IVLA 1EHLL 1Q9KA 2YA1A 3FB8B 2FJHB 2L0DA 4PRDA 2GK2A 1JWSA 4IMKC 1OPGH 4IDJH 4XBEL 1FIEA 5DD1H 2V2TA 1NLDH 5CBAB 4HK3J 2XYCA 4N8VG 3BN9D 2HTLD 2R0WH 4WY7L 1HCFX 3IDXL 2P8LA 5B38B 3PHOB 4LVOB 1W72A 1P53A 3QPXH 1L0XA 1ADQA 3O41B 4XHJC 4L9LB 4K3JL 1FGVH 4DKDC 4PGBA 5D8JL 1HQRA 3L3KB 4FFZH 4HMDA 3P0YH 3UAJC 2O61A 3MV8E 1WVZA 1YNKH 1IKNA 3H9HA 5IMOB 3BYYA 1X5JA 3UBXA 4E42A 1BJ1H 4ACPA 3GM0A 5E2VL 3RY6C 1N0XH 4Y4HA 5JMOC 1NDMA 1MLBA 1FFNB 3S97C 2R2CA 3FT2B 4MAYD 3JWDC 3KHOA 5F8QC 5IG7A 1L0YA 1FIGH 2FEEL 4PRBB 4M3JA 3ARUA 5BS0D 5EU4B 3L5XH 1WLHA 2H8PB 4F33B 1XIWA 4G9DB 1FC2D 2PYFB 3GK8H 4UIMB 4JRWA 2CIIB 3P4NB 4DGIL 4UZGA 3ULUL 4QRRA 1J8HA 5JHDA 2XZAL 1R3KA 2Z91A 4PLKC 1J0ZA 1YNLH 2FLRT 2J6EA 4IOFC 4XRCB 1MCBA 2DD8H 4F7MB 1OM3H 4U33A 5BW7A 3O2WL 2RFXA 3WNNA 5D7JC 3E6HA 1NJ9A 5IB4A 1D9KC 3LIZH 3ZKMC 5DMGC 2H2SD 5HYQB 4BFIA 4PLJD 1R0AL 1OP3K 5E9DB 4J3XA 2IH1B 3QA3A 1T03L 1JGDB 4IS6A 4TRPH 3MLWL 4QXUL 2VLLA 5D7KD 3BP7A 3SDCD 3KPOA 1RAMA 3CFDB 4LF3B 4ODSH 4PJ5B 4XMKH 1NC2B 4JG0H 1DBJL 1GRWA 1DP0A 3LCYA 3SOBL 2EZ0C 4HF5H 1VA9A 3C5SA 2HT4D 1T89C 5JNYA 2AJZB 2CO6B 4XAKD 1FL6B 2ARJQ 2GJ6A 1BHGA 1ZT7A 1BJMA 3JV4A 5HYJB 4LEOB 3UTSB 4GG6B 1IZJA 4QY8B 3TPUE 1ZOXA 3BZFB 4QHLB 2DQDH 4U1NB 4P2CG 4W4OA 2EC8A 5IFAH 4GKNA 3MQIA 4HFUH 3FHAA 3I75A 4DTGL 4NOFA 3C09C 1LP9A 1KYOJ 5INDB 1X5LA 4I3GA 3VA6A 3QT2A 1PAMA 2AV1A 3WUWB 2XICA 5IBTL 3SCMB 1FYTE 1P7QB 5DJAA 3N9GL 4Y4HD 3S96B 5A2KH 2GIYA 4M6NH 1KN2H 2EYTA 3MCKB 3B5TA 1B2WL 5CZKA 4AK1A 5D4QA 1FLTX 1J1OH 2Q20A 1SJEB 3QUXC 1OT2A 3W5MA 3T3MF 3MRCB 5I66A 2XTJB 3WIIL 3ULVE 1KLGA 4YHMH 1EEQA 4AL8L 1XIWD 2DQIH 3V7AE 3NGBB 3MXWL 4WNQB 3TEUA 1T5WA 4Z0BL 1OARH 4JRYB 1CL7H 2R0KH 4QRRD 1ZT4A 3QEQE 5JHDD 1BIIA 1RJCA 2HFTA 1T0MB 2IADA 4Y8DC 3FRPA 1S7XB 5HYEA 3MLTA 4ZTOL 4EVNB 3NIFE 4WI5A 2BVPA 2HLFD 4G8GB 2NLJB 4HPYH 5IIEA 4GBXB 4HX1A 5IW1A 1ZWIA 3KJ6H 4F57L 2GFBB 3BVNB 3TVMB 5JA8B 1WSST 1P84K 1MJ7L 3AC0A 1I1RA 3MUHL 2CDGB 4MCZA 1ZLVK 4ELME 1OWRM 4MA7H 2OJEB 1DBML 2AP2A 1J0HA 5A40E 1U3HB 1UEYA 5FYJH 1JRHI 5HI3C 2XI9A 4EQ2A 4I77H 1IAIH 4F80A 4RFNC 2DIAA 3MRIA 1BVLB 2DYPB 5I1LB 2GJ6D 1HSBB 4JQVA 1T0PB 1U92B 5DQJB 3SJVE 1YY8A 2I07A 1MRDH 3FKUS 2A73B 3DX8A 2E9JA 5IP4A 4UIKH 5INCB 1IJ9A 3WFHA 3SY0A 4P2RA 1D5IL 2NY1B 3U46A 1KPUB 1KJMB 4G6FD 1GAFH 1FFRA 4NJAH 1NMBH 2VKWA 2YA2A 3CZFB 3DVNB 3OXSA 3LKNA 4NRZB 3I02A 5C6TH 2ZUQC 5KJRL 1TZIA 4IDJL 2MOVA 4JZNB 1KB5H 4EZMA 2O26U 3KLSA 1OD9A 2BXYA 5I8CB 1CU4H 1G9NH 5LQBH 1NGQH 2NX5E 4JDTH 4P3DA 1YNTB 4PGCA 2Z8RA 3OKOB 1X5ZA 3RX7A 2R2EA 4NKOB 1XF3B 3QPXL 3MRFB 1CD1A 2QSTA 3GJEA 4HWZB 4YIQB 4OLWH 3S34H 1FGVL 1S5IL 3AS3A 2D9QB 4U3CA 4NNPL 1X5XA 4HEPG 3EYOB 4WHCA 4O58H 3UZQA 3VXTA 4PJGB 5F7UA 3SDDB 2D7QA 4U1KB 1IGMH 2DQUH 1TIUA 1AI1H 3A6CL 5T33H 1KTRL 1XZ0B 1NGXB 1TVBB 3BPOC 4O9HL 4UDTA 4X7SL 4Z7QE 3IDJA 3UDWC 4NZUL 4BKLA 5GQBA 3HZYA 3Q6GH 4A2LA 4XNZC 4LCYA 4PS4H 1XGPB 4YGVB 5DR5H 5K9QG 4ONFL 5B8CC 3W9EA 1QO3B 3BZ4B 1IGTB 2VN4A 5AYUL 5ILTH 1A7PH 4OCRH 5EPMB 1Z9SA 4M48L 3MLVH 3BIAX 3V6OA 1UZ8B 1JWMB 3QUZC 3GK8L 1QFWL 2PW2A 5DJ6B 3QDJB 4S2SB 1NH6A 5HVHC 1QSVA 4KHXH 3L3HA 4Q9RH 4YHPA 3T0EB 4H5SB 5CJQH 2Z35A 3H9YA 5EC2B 1OM3L 4NHUB 2BSED 3VW3H 1AGDB 2D0HA 4X6FB 2PXYB 3PWPA 4GSDH 4IOIA 1A6AA 3BHBB 3ESVF 3MO1A 3PL6B 2AI0H 2SEBB 5D2LF 4P5TB 5CINL 5IWLC 1EMTL 3HUJB 3LD8C 5DZNA 1CN4A 4P2RD 5F3HA 2PYEB 4NZRH 1BECA 4V3EB 2YRZA 4XGZB 1PQZB 3FFDB 2WUBH 1I4FA 5EN2A 5KSUB 4U7MA 4O51A 4XMKL 4JG0L 1OAQH 1P5VA 1CFSB 1N6QH 3GIVB 3ZZ1A 2Y07L 2W60B 2Q7YB 6FABL 5ESAA 2VR9A 3L3IA 4N5EC 3BN3B 1X6LA 5FA3B 3TYFA 3VFMB 1KJVB 4AIOA 3T4YB 1FCCA 2LTQC 1FZOB 2IC2A 1BWMA 2Q3AA 4J8RB 1YEKL 2IMNA 1LO2H 3SGKA 4F7PA 3U2SA 3FQXB 3DTXB 5IKCA 4NWUL 5BVJA 2B4CC 1LEKB 2F53E 3OV6A 4GUPB 1T04A 3KYMB 5F9WB 1NEUA 4ODVH 4OZGB 3GSVB 1F3JA 1FE8H 4XCNB 1BQLH 3ZKXB 1G6VK 1HOCB 3STZA 4OIBA 3WHXB 4PJEA 4ZUTB 4R7DA 1UB6B 1AGEA 3FL7A 4MNGA 2A6JA 3F12B 5LGKA 2X9YA 2I9TB 1F58L 3WUWG 5JTWA 1CXKA 4L4JA 4FTVE 4Q74A 4WI7A 4OGYL 1UB5B 5DHXB 2YK1H 1D7FA 3VFUB 3T2NH 1A4KA 2VXTH 2WBJB 2N4IA 4RZCB 4YHML 5J1AA 1JZ2A 2A0LC 1A1NA 1ZVHA 3VFNA 1AD0A 4KKCD 4O5LL 4RQQA 5A1AA 4KI5E 4AM0B 3IAQA 1Q0XH 3L1OH 3MLUH 2BSTB 4KRPB 2V2WB 2ATKB 3PWPD 1Y6KR 4HUWB 5FGCE 4F3FA 2HP4A 1VEMA 1A6VH 2P45B 5EC1B 3GNML 3NA4A 3B2VH 2FO4B 1W0VA 3MROA 3VFGH 4B50A 2OXGA 1ZA6B 2ZKHH 2KPNA 5MEOB 5KAQG 4MA7L 4KH2A 4YDVB 4MVBA 3FFCA 4R0LA 4XVJL 1MWAH 3CSPA 3OAUL 2V5TA 2WIIA 3QUMB 3S37H 1XR9A 3RL2A 3RHWF 4LSRH 2J7LA 1BZ9A 2HJFA 3MV9E 3T0XA 3S9DB 4BQ8A 3MV11 4X9FA 1RHHB 5FYJL 2DQCL 3WKMH 5GZOC 5BJTB 4YFLI 1IAIL 4DQOH 4NRYB 2BVQB 4OLYH 1AIFA 5KVFH 5C09A 4PJCB 5I1GL 3MZTA 5EZIH 4NZDA 1YMMA 3R06B 4LOUC 4WU5A 1VEPA 1A6UL 4XAWH 4JKPH 4JFOA 1G6RH 3BW9A 4OV5A 4UIKL 5MHSE 2EDOA 5H35A 1T5XA 3ALPA 3CDGB 4KWUA 5LG1A 1K6QH 5C07E 3U83A 1F90H 5IV2A 3ESUF 1GAFL 2P4AB 3ARFA 1I85C 2DJ4A 4PB9H 4K94L 3UTZA 1NMBL 3A6BH 3MREA 3QDME 2DL2A 1BQHA 3QZWB 4J23A 5C6TL 5I1DA 1K85A 2D7MA 3U36B 4U6YA 2VQ1B 1RZ7L 5DMKB 4JDTL 1UXWA 4AEHH 4N1CA 3TT3L 2AEPH 4XPTH 3FMGH 3PG2A 2DRUA 4OZFA 3VRLF 1DBBH 5T3XH 1FL5B 4YHKL 3IAPA 1IEAA 1PKQE 2E9BA 5L2KB 3S34L 1I7TB 2EEBA 3OPZH 4OLVH 3JWOH 4O58L 1MIEL 4R97B 5D7IE 4HWBA 4TVSa 3MMEB 3WNKA 1N4XH 5T33L 1UH4A 2NY5H 2W0LA 4IRSD 5J6GB 4TVPE 1CGVA 1NC4B 1CICB 4S1QL 4LSVL 4PS4L 4FA8A 3KLDA 3FOMA 1KGCD 2V2XA 4RGNB 3QXDA 2ARJA 1KCKA 1T1WA 3WL9A 4MXWH 2BNRE 2BVOB 3QNYB 1AXSA 4GXUM 1I9EA 1NMCC 5ISZB 1HWGB 4XZUA 1AR1C 1TQCB 2ESVE 5HY9B 4XP5H 2BSRA 4MVBD 3GO1H 3FFCD 3TO4A 3OSKA 2C7UA 4QT5B 2NXYD 4X9BA 3FO1B 3P2TA 4DVBB 2VE6B 3TNNB 1INDH 4E5XA 1JWUB 2CIKA 1NGYB 4N8CH 1S9WA 1C5BH 1XGUB 5C09D 3X13A 5LKNA 4LRNL 3VW3L 3CFEA 1BQUA 1YMMD 3G6AB 1S9XA 4OCMC 1XF5B 1V5JA 2UWEE 2XT1B 1H3UA 2LU7A 3K81A 4I3RH 1I3RB 2EDWA 1W2KT 3ARTA 1EA9C 3ZYZA 4KGLA 5ESVA 3D3VB 1N59A 4ZUUB 1A4JB 4PG2A 1VKXA 4NZRL 1A1OB 1YZZA 1RZJC 4HS6A 5E1AB 4I0PC 1ZHKA 4JY5H 2XWBB 3ARFD 1DQJA 2WUBL 3EO1B 3ZKND 2NY3C 3GMQB 1I8LA 3EOAA 4MGXA 3TP4A 5HHOB 4ODWB 2CLRA 3PIQB 3BGMA 5JXEC 1U2CA 1U8JA 1ZANH 3LKSA 1GZPB 3ARYA 4HLJA 2Q86B 4DOHB 2GTWA 5E00B 4MLSA 1URLA 4CU8A 1L8JA 1FCGA 2X09A 1VFAA 4N0CC 3QO0A 1QBMH 5E4EC 1LO2L 4LCCB 4PJHB 1WGOA 2BDNL 4YDKH 1MH5A 4GKZB 1IC4L 3W2DH 3TBTB 3BUYA 4CU7A 3IT8D 2CGRL 4ODVL 2UYLA 1C7TA 5FUZH 1Q9WB 1BQLL 2YC1B 4LPXA 3O8XB 4OZHA 3DX9A 4Y2OA 5D1ZB 3GBNH 1HDMB 4Z7UA 4GOSA 4PB0L 3FRUB 4OZHF 2BNUA 5L0QC 3F5WA 1N7ML 2NCMA 4I18C 3NZ8B 4Z7UF 4JM2C 2W9DH 4LBEA 4G6KH 4RMQA 1MRFL 1RJZA 4X5XB 5DXWA 4PRNA 3P9MA 2FX7L 5FO7B 4LKCB 1E4WL 4ODHL 3TO4D 4Q0XH 1OF2B 4FQIH 4HCRL 2ZCKH 2IFFL 2PNDA 4YBQD 4N68A 2VUOA 3GFUA 2X4RB 4WGVB 3LSOB 2DLEA 1CFNB 1T21B 2FL5B 3WEXA 3NIGF 3MV7A 5IEHB 3MLUL 3AROA 5A3IC 2AV7A 1RZIB 1TITA 3C5ZB 1QBAA 1H5BA 3AB0C 4G7VL 4JFFE 4RBPK 5C0AE 4E9LA 1TNNA 4UQ3A 3NACH 1Q94A 3TWCL 3SDAA 3PE9A 5DJZB 1A7QH 3ARBC 3IFOB 1D5XA 3K8KA 3GRWA 3WNPA 4KZDH 2LV4A 1KACB 4HIIB 4RGOH 2HJLA 4Q9CA 2XG4A 2RBLA 3DV6B 3O2DH 3OG6B 3RWHB 3KDMA 4N1HB 1AJ7H 1NGWA 2BNQA 5EU6E 1BD2B 3EBAA 4TOYH 1MWAL 1RI8A 4KK5D 4CN1A 5IMMB 3QHFH 4JFHD 3UJJH 4K7PY 2E8YA 4JGMA 4KY1L 5HI4C 4OLYL 5KVFL 1ETZB 1PX3A 4G8FB 3IRZA 1OP5K 4APQA 2EDXA 4X6CA 5CLTA 1IGFL 3L3OB 1FZMB 4LSQH 4BH7A 2D31B 3HZMB 1EJ6A 5GGRB 4U1JA 4PP2A 3HE7B 3K46A 4JKPL 1C5CH 1G6RL 4EOWH 2F8XC 4L8BB 3TC9A 5IVZA 1KB9J 4FFVC 1MCOH 3MRBB 4P2OA 3HNVH 4QRRE 1FSKC 1MREL 1J8HE 5JW4Q 4X4XB 1K6QL 3VA2C 4OB5H 1T7XA 1F90L 2HJKB 3CK0H 1B4JL 4BSWA 1G7MA 4PB9L 3MV8B 1V7NH 4CVZB 4WFFE 5JOEA 4Y5XC 5KSBA 1MLCA 5C08B 5HHPA 3NZHH 1ZAGA 3QAZC 3RNQA 5D6DA 3JTTB 4KUZL 1XF4A 4LAQL 5SX5H 3U9UB 3WS6C 1HHKA 2BC4A 3QZWG 4CN4A 3H9ZA 4PJDA 5DDHB 3GMOA 2AEPL 4U1MA 3JWNC 4XPTL 3FMGL 4ZUSB 4FZ8L 5GGVY 3VFPA 4RFOH 2Y36L 1VPOL 2C3VB 5T3XD 5E8NB 1A6TA 2DTMH 2OTUA 1GGIH 3PQYE 3PGDA 1KCRL 4OLVL 5D7SH 1YEGL 4PJ8A 4R9HA 1JHLH 4KUCF 2C3GA 3QNZB 3Q48A 3WO4C 4DWHA 1N4XL 3DI3B 2YSSB 4ZXBB 2NY5L 3O6ML 3IDMA 5DHVH 3MV7D 4NO2B 4HIXH 2YPVH 1WWWX 3FTGA 2BRRH 1UG9A 1J7VR 3THML 5JQ6H 1LQVA 3RPIB 1MCFA 5TH2B 2V17H 3UBXI 3SDAD 4ETYA 4ONHA 1OGTA 4MXWL 1YC7A 1YEEH 1ZHBA 4KJQC 3X11B 5DK0A 5D1XC 5JOPD 5DT1H 1FDLH 3T1FB 4GKSA 2GKIA 1T7YA 5J0BA 3AGVA 3OJDA 1AGBA 1MCSA 2BNQD 3GO1L 4XP9H 3TIEA