2FWOA

Mhc class i h-2kd heavy chain in complex with beta-2microglobulin and peptide derived from influenza nucleoprotein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
275
structure length
275
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
molecule tags Immune system/viral protein
source organism Mus musculus
publication title Structural Definition of the H-2Kd Peptide-binding Motif.
pubmed doi rcsb
total genus 74
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fwoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2fwoA01
3HB3C 1S9WA 5I1GH 3QIUA 5CHNB 5TE4L 2J6EL 4RQQB 3VXNB 5B39B 5J9PB 4X8XA 2HT4D 3O11A 4XNUL 4M6OH 4O2FA 2D0FA 4JO1H 5I17B 1PAMA 3ALPA 5JQHC 4PRIB 3V4PH 4YDVB 4S0UC 5MI0B 5C08E 2HTLD 3FFCA 5ILTH 5D6DA 4KVCL 5F89A 4F7TB 5FYJE 5FYKH 3MRRB 2FL5B 1RUPH 3HS0A 1FIGL 5IBTH 3S98A 5DTFA 1NGXA 3W9EB 3DVGB 3GSRA 4JHAH 4LLDA 4P46D 5D7IE 2YPVH 5E2TH 5F3HB 2X70A 2YK1H 5EIIB 2XFXB 2NCMA 2PW1B 2R2BB 1IKFH 3S36L 4N0CC 4ZTOH 3DX9A 1OM3L 3RWDB 5SWSA 4JFQB 3BGMA 5F6IC 2J8UB 4M5ZH 3AB0B 1EEUA 3O3EA 4XT1C 1FGNL 3FCTA 3W39B 2CD0A 1AI1H 5C0BA 3S5LA 1C5CH 5LGJA 1J88A 3LHPL 3O9WC 4LQFL 2IBBA 2XY2A 4K3JL 4D3CH 4PJ8D 3S3SA 3HE7B 4R96B 4UQ2A 2FGZA 1G6RL 5ENWB 4UOW1 5IFHH 1G9ML 3KPLB 4P57A 5DUBA 1RZ8A 3STBA 3CFJB 3WD5L 2XKUA 4OGYL 3ZYJA 1MCNA 3PXJA 5F9DC 4BZ1L 5I8CA 2FO1A 3RDTD 1MCEA 3MLVH 2E8ZA 4L4JA 5GS1B 1HEZB 2B4CC 4Z7VE 5JDSA 1N59A 2B4CL 4JHWL 3VFPB 4AH2A 5F7KC 4WWKA 3TIEB 4Z95H 1UH4A 3HR5B 5E8NA 1A5FH 2R2EB 4L3EB 2OK0H 3U0WL 1CG9A 5AWNL 4QT5A 2EYSB 1IM9D 5IB4B 4NO2A 3IJSB 1N8ZA 3H0TA 1IC5L 3WJLC 2YD8A 1DANU 4QXTA 4D0DA 1QBLH 1FAKT 3L3HA 4LF3B 1EO8H 4QHMA 3PF2A 1X4XA 4F37K 3QPXL 1R5VB 1S7XA 4LDOB 4F7MB 1W0VA 1JN6A 1JYXA 1K4CB 3IF1A 3KXFE 4RMTA 3BZFB 3CXHJ 3FB6A 3VG9C 1U93B 1BQHA 2HVKB 3I6LD 5CILH 3OB0K 5GS0L 2ICWI 1W8NA 4X7TB 3QEHB 2UYLA 3MROA 2R4RL 1P69B 1F8TL 2YN3A 3S3JA 3VWKB 1G84A 1MVFA 3E3QA 1HHGA 5CJQL 3TNMA 4IHOA 3HNSH 5HYSA 4GH7B 4QGTA 3LIZH 4R4BB 3TH2T 3SGDH 4L3CB 3MLSH 5KJRL 1IL1B 3MRLA 5DGRA 3SDDD 5KJRH 1WV7T 3EO0B 2DOCA 4KI5C 2QQLL 5L2KD 2PXYB 3LN5A 4KKAC 5E00B 5K59E 1U8KB 1E6OL 5EOCJ 1NC4A 1GGCL 5SWSE 1BD2E 1KYOJ 1X44A 3NIDE 1V3LA 4M03A 5IVZB 1DBJH 4MJ5A 2D0HA 5TDNA 2OI9A 1JTOA 3QIBC 2XICA 4ODSL 5GS0H 2HG5A 4NQED 3QT2A 4LQ1A 2QSTA 5H37G 4OZGF 3KHQA 2F54B 1K4DB 2VZUA 2NY2D 3IJHB 1WEJH 3RL2B 2J6EA 3FO2A 4D9LH 4OKVB 1NCWH 1GXEA 1MHHB 2ICES 4U6VH 5HDBE 4Y0GA 3KPNB 1JK8B 2W65A 1Q9OB 4BFIB 3TLRA 1RJYA 2GITB 2FEDC 3HRPA 1CICB 3MRCA 3RHWF 3RJQB 3QPXH 3TCLB 2DWEB 3EGSB 4GG8B 5C08B 5DEFB 4HX1B 1GGBH 3TPUE 3ECBA 5MHSD 1FC1A 2WV3A 3MLYH 2VUYA 5KG9B 2WUBH 1T4KB 4H0HB 5L9DL 3HI1B 1Z6JT 4GAGL 1PX3A 4CL7A 2YA0A 3JVGA 1NGWB 4OLXH 3CH1B 3PGDB 4KK6C 1DBKH 2K9UA 5JW5A 4Z7WB 1IGMH 4YHPA 4Y19E 5D7IB 2VXTH 1CLZL 3KLHD 1T04A 4FFVC 3QUMH 1X5XA 4XVJH 4B7LA 1FNGB 3ZKMC 1DLHB 4FQQA 5DD5H 4OZHB 3CFEB 4U3CA 4RZCA 2V5MA 5D4QA 4TQEH 3M17A 3GMQB 1WZKA 1XZ0B 1LO4L 2G5RA 1DUZB 3V0WH 3I84A 1XIWB 3U1SH 2NXZB 3BFOA 1ZLWH 1VHPA 4P2RB 5DLMH 2XZQH 3NABH 2IPKB 3QEQA 2XYCA 4DVBA 5M7QA 1UCBH 2YOCA 3UJJL 4OI8A 3MRKA 4QRTA 2OJZL 3LD8C 3MRFA 1KGCD 2Y5TA 3QG6B 3KLAA 1JPGB 5ADPH 4R2GC 1BZQK 1HSAA 3SQBA 1J0KA 5I1AB 4HWEL 3FB7A 5EIVA 4LPVA 5EO0A 3SDCA 3D69B 2EIZA 1P1ZA 5KAQF 3NMEA 3FT2A 1NMCB 3QXAA 3B2UC 4X99A 3IU3B 2OTPA 3QO1B 4Y2DC 4J4PA 3WNOA 1FIGH 4LRIA 5IBTL 4N68A 4PYGA 4N8VB 4TRPH 4K9EH 5FYKL 4S1QH 3GHBH 1VCAA 4C54A 5SX5K 2W38A 1KG0A 4FXKB 1TETH 1AGEA 2Z93B 2HJKA 1F6FB 1BLNB 4L8SA 1LO3L 3VFWA 6FABL 3C8HA 4GKZA 2EDHA 1AGCA 4OD2A 5IB1B 1A6UL 5D5MA 5IVXA 1T03L 3QQ3A 4KROD 1ZT4A 2WQRA 2AQ3A 3RGHA 4J3WA 4PJBB 3OBAA 5DSCB 4GKSB 2EXWC 4X98B 5F1NB 4JAMA 5BOPA 3TH4T 3R1GH 4PV8B 4KJWC 3RGVC 4JFFE 1WFOA 1PG7H 4P3WA 5GISL 3NCYS 1YEFL 5DRXA 4CVXB 4I5BA 5SWQB 1UVQA 4PRID 5HDBF 4FG6D 3ZHLA 1I75A 4DKFL 1AC0A 4LSDA 3IFPB 1ND0B 1NAKH 5BRZB 3KR3H 4LGRB 2OXGA 3AMLA 2APTA 1ZVSA 5IQ7L 1YMMB 4IDJH 1ZGLA 5D7SL 5GGVY 3BPNB 3FQXB 4V2BA 5IG7A 1HHHB 1N26A 2MSPA 5AYUL 5J56B 3VGHA 1UKSA 4XB8A 2AQ2A 5INCA 1IT9H 4I3RL 4AL8H 1BX2A 3S36X 1Y6NR 4M7LH 5K59F 1YQ2A 3HMWL 2JELH 3LDBC 4HFWA 4OZ4B 2R2HA 2XWTA 3LS4L 4R7NB 3V5HA 4J12A 1EA9C 1C08B 2HMIC 1JI2A 5BJTA 3BZEB 2DQIL 4MB4A 3KYOA 1I4FB 3ZHDA 5EIQA 4PJ9D 4JFED 5GPRA 1G7JB 2DLGA 1BVKA 1IAIL 4KMLB 3F8UB 2EDEA 3V0VA 4MJID 2R23A 4PREB 4J4PD 3IETB 2V9QA 4YUEH 4N90D 4F33B 1FLTX 3QDJE 1NCDL 1B0GB 3PG2A 4FXGB 4ZYKB 5I15L 2P5WD 3G04B 2C5DC 4WEBL 1KJ2B 1QQDB 3EYFB 2B8OT 2DWDB 3Q3GB 2H3NB 1H3PL 3VXPB 1A7OH 2ZUWA 3OXRB 3GSNA 4LEOA 3FTGA 3P9MB 1K2DB 2IBZY 2JJWA 3TPUA 3V7MA 4WHYG 4Y16C 5HYJA 2MTPA 5GHWL 1J1OL 5DVLA 2P45B 3PUCA 5T3XD 3FN0H 1NGYA 1EPFA 1LP9B 1VSCA 4I13B 3ARYA 5I6XB 3L7FA 4Z5RB 3UTOA 3DGGB 4Z78A 1ZLUH 3ZLQC 3U30B 3O9WB 5CD5C 4HH8A 4G6ML 1UZ6E 3D18B 4IIQC 1U6AH 2A6JA 5C0AE 3QIUD 3ARGA 2CO6B 2ADIB 5B8CB 2I26N 1R3JA 3RY4A 3BJ91 4XPFH 3C8DA 3TBSA 3U30C 5EUOA 2NXYB 4IOSD 4X4XB 3QUZB 3FO0H 4H8WH 3P9LA 2JK5A 4OZHF 3UDWC 1SHMA 1RZFL 4P5KB 3GIZL 5I1LA 1A3LH 3RHWK 1LP9A 5K93A 2P24B 3PL6C 3B8SA 1EX0A 3WJJC 3O3DA 2NY7H 3LQAL 4QRRB 5GIRB 4JGMA 1X5HA 1ES0B 1R3IL 3INUL 1X3DA 4TOYL 4KK5C 4GAJH 3CIQA 2WBJB 2E27L 5ALBH 3BPLB 4G42B 4F8TA 4QY8B 1AFVH 1JGDA 4XP1H 1GGUA 1CICC 2OMNA 4K3EH 3GSNH 1FGVL 4HXBH 3FQUB 3ZDYE 3PWVB 4YH6A 5C92A 4CN1A 1WC7B 2UZXB 5D2LB 2CKBB 2DI8A 4X5XA 2BMKB 3PHOA 3GBNH 2ZUTA 3SO3B 3KYMB 3D87B 4XC3H 2B20A 5JXEC 5DHXB 4GG6E 3UPAA 5FYJL 5SWZD 4BELD 4W81A 4K7PY 4TVPH 1G1YA 3IGAA 4UNTA 5E5MB 4CUCA 4GBXA 3DUSB 5JO5B 5L8KB 1CN4A 3H42L 1Q9LB 3PHSA 4KJPC 2JCCF 3QEUB 3WFBH 2I24N 2E7MA 1CXEA 1JYVA 4PJAE 5CJ8A 5DEGA 3EDFA 3IXTB 5I30L 2I9TB 3LRSA 5GGSB 4YDIL 1UKQA 3H9SB 2AP2A 1JGLH 3BKJH 4Z9KB 3KYKH 4LPTA 4YFLF 1FVEA 4QRRD 4KAQH 1QPXA 4XVUC 3O45B 3C87A 3QUYB 4R90H 1MCDA 5FGCE 3AU1A 4G9FE 1G7QB 3J7HA 4NN7C 4EN3C 2GFBB 4N0YL 4WI4A 4NCC1 5F7DB 1HQRB 1FO0L 2ITCB 5IMOA 3HZVA 1LEIB 3ESVF 3QEQD 2Y06H 2R0LH 1HHKA 1RZGA 1KENH 1S78D 3JWOH 3GUTA 1P5VA 2CLRA 2OBGA 1LDSA 4XC1L 4LEXL 4I3GA 3GIVA 1QFWI 2Z8WC 3S37H 2VDQL 4EDXB 2D31B 4P2QB 1HQ4A 4JEGB 4N0CD 5KSBE 2I9TA 2FNBA 1IM9B 1WBYA 4PG2A 4DN3L 4EN3A 4LAQH 3PV7A 1UM4H 1S7SB 3BKML 4S11A 1EAPB 2Q86A 5KN5B 2R4SL 4TSBL 4KKLC 2CDGA 4XX1E 2AK4B 2DQJL 2I25N 5DQDH 3UPCA 1MFEL 3BPCB 3AXLB 1MJ8L 2Q8BL 1Z9LA 4NYLA 4XNXH 1T6VN 4Z7NE 8CGTA 4U33A 5DK2B 3VDAA 2IH1A 2X4SA 2VLJE 5HBBA 2OS7A 2HTLC 3UZQA 4NZTH 2BMKA 3PHOB 4XP9L 1XF2B 1SJEB 5HTSA 2NYYD 5GS0C 1WC7A 4MD0B 4JVWA 3H3PL 1YYMH 1NAMH 4HSQA 2YWZA 5EDXA 3TV3L 5C0BE 2OYPA 4F15C 3CPLA 4XPTL 5BVPL 3IDMA 3CU1A 5CJBA 4DAGH 5C0AB 2CK0L 2P5EB 3GMQA 3I9GH 3M17B 4PJ5B 1A3RL 1OCWL 1LE5A 3KNBB 4O9HL 4WI2A 3SE4A 1NCCH 5I75C 1FNSL 4NUGL 4M7JL 3LKOB 3RY6C 4N0FB 5DD3H 5TF1L 4WIQA 4CVUA 2A73A 2FLRT 1WBXB 3LSOB 4G7VH 3LRHA 4LCWA 1F90H 4JFOB 4PJDF 3DRQB 3WLBB 4Z7WA 4RMQA 3OJDB 3CH1A 1BECA 2DQFB 4PJIB 4M9PA 1I9RH 3BW9B 1GOHA 2EKSB 4LCIL 4OF8A 5F7EL 3HCVA 4CN6A 5D2NE 1R3JB 1W0YT 4A6YA 1MOEA 1K3IA 1TZHA 4M5YH 3SDCC 1L7TH 2GITA 3SN6N 5CKAA 2BDNL 4Z77A 1RV6X 2N7BA 2HJFB 3CFDA 3G9AB 5CZXC 3RBSA 4YHOH 4V1DE 1QSFD 4PRNB 5D2LE 4LLQB 3QIWC 2XZAH 4GFTB 4KRLB 4HULB 3CFDB 5T3XL 3ISWA 4AIZB 1OAKL 3HUJF 4NO3A 4K7FA 1LQSR 3RWHB 1ZK9A 5HJ3A 1T3FA 3MOAL 3L3KB 1N4XH 5DMIL 5T1DL 2VDMH 3JTCA 3HUJE 4ESKA 3STZA 3JV0A 1A9BB 5BW7C 4XP4L 5IBUB 4QXGH 5FDYA 3EO0A 3D85D 5C0NC 3IYLW 1QFWM 2V6HA 4R8WL 5IJKC 4LCCB 3ZHKA 4PREA 1I9JL 3EOYG 2VYRE 4O4YH 4R9HA 5ITBH 1NDMA 2RBLA 4FQ1L 4Z7VF 4P2OC 4UOJA 5IKCB 4BQCA 1FYTA 1MQKH 4LLYA 2VH5H 3F7QA 4G9FB 3QWRA 2L0DA 4MDJA 5IUSA 5H35A 3RTQB 2P8MA 4OTXH 1SM3H 5E2VL 5HHVH 1K4CA 3LPGA 2Q7YB 4NGHL 2OSLA 2R56L 2ZUQC 2VC2L 4JLRA 4JKLA 1YA5A 4ZPVB 1CE1L 4ZS7H 1RPQA 4HLZG 1GGTA 3GSVB 5JA9A 4QHMB 3TA3B 2WM0A 4W68A 2ICWJ 4FQIL 1CLOH 1G7PA 1A22B 3BIAX 5E2WH 5HHME 2F53B 1N8ZB 3H0TB 5C6PB 4ODVH 4QT5B 2HKHL 4LSQL 2IGFH 3HZKB 2V9TA 1MJJA 5GJTL 3TIEA 2HKHH 1FZKA 1I3GL 4LPUA 4F7EB 5IB5B 3V6ZB 4PJGA 5JIPA 5FKPA 4EN3D 4GKOA 4GXVH 5D96B 2EDDA 3MC0A 1LEGA 4EDWL 2D31A 1VEMA 2VNCA 4S1SH 1BLNA 3FAWA 4S2SB 2Z93A 1Q0XH 3LEYL 1KCUH 4HUWA 4I18C 3WO4B 4Y2OA 3FQRA 4YK4B 2DYPA 2IALB 3T4YA 3O6FD 4OCRL 2VR5A 2AEPL 4O51A 4D9RE 3KJ6H 5LGJB 1RZGB 1YEGH 2JB5L 5DRNA 5HYIA 1QR1B 5BZWA 2VAAB 1NEZG 3RVUD 1RZ7H 2UZIL 4QRPD 1DVFB 3D9AL 3T0XA 1WWCA 1YEHL 3IU3A 4OCXL 4P9ML 5E2UL 4EQ3A 4YFEA 4RGNE 4HS6A 3HI5L 4CRPA 2XN9E 3OJ2C 3TC9A 1BQSA 4BQ9A 1UH3A 5DS8A 1ZGLM 5F3HA 1FFQA 1OARH 2V5RA 3U79A 2Y07H 4LCWE 3MUGA 1EHLH 2ADGB 3MXWL 5DEGB 3WIFA 5FFLA 4WVRA 4GSDL 5B3JE 3A6CL 4K3HA 4OFPA 1Q38A 4PJEF 2VSDA 1FL6A 5C7XH 5D2NB 4WW1A 3IGAB 1DSFL 5E5MA 1X5JA 5D7LE 1T7WA 5EU5B 2VDML 2VISB 3QUXD 4PJEE 4F3FB 2HT4C 1Q94A 3KYMA 4RMVA 2AABH 3MO1A 2W9EL 4O2FB 2HFFB 4F57H 3JXAA 1X6NA 4OZIE 2IEPA 3OKNA 4EVNA 4LP4A 2HLFC 3U0PB 4YHYB 3LN4B 3WN5B 2ILLA 5JW5B 4X83A 2X40A 3UYPA 4XCCH 2VDNL 4P5TC 2YUWA 4WO4D 3HI1A 1DDHB 3QRFM 3WS3B 3CVIH 2YRLA 4NWTL 1HWGB 2D9QB 1EMTL 3FT4A 3SKOA 4PJHA 1WFTA 1QLFA 5DR5L 5C08A 3HPLB 2PR4L 3RWEB 3FOLB 5C9KA 3DX6B 5DJCA 3QIUC 2O5XL 1CICA 2XQYK 3BKYL 1TVBA 1YN7B 1E4KA 1OAZL 1Q9OA 2X4OA 3NCJH 1FBIL 3TWCL 1ZT1A 5F71A 1K9TA 3EOTH 3IKCA 3REWB 1XCQB 4MJ6B 2CKNA 3B9DA 1V7NL 2YD4A 2BFVH 3OJVC 2M2DA 12E8L 3FJTA 2EH7L 5CP3A 4JM2F 1HOCB 5I8KH 1CL7H 4EI5B 5B8CA 2UUDK 3HFMH 2XQYG 1IAOB 3FKUS 3KPTA 4FQCH 4D0BB 5IEKA 1VACA 1U36A 1GC1H 3SDYL 3WL9A 3HG1D 4G9DB 1BHGA 1ZSDB 2GTZB 2IFFL 5I18L 1HNGA 2VDLH 5MP6H 5EULV 5FYLD 4YHKL 1RK1A 4L8BA 4L3CA 2Z8SA 4KUZH 2AJVH 2E7BA 3T0WA 4G6KH 1SEBA 5JOPD 4QTIH 5FEBA 1XR9A 1IKNA 4KTYA 3I3EA 4POZC 2F54E 4WRLA 2FJFA 3CX5J 3RWJA 1AO7A 1LDPL 1MNUL 4D9RD 4X6DF 3DVNB 2P48B 5BVJA 2DWDA 3Q3GA 5J89A 4QCIA 4UT9L 4XNXL 3ZL4L 4M3KB 2FBOJ 4U0RC 1MJ8H 4D0BA 5DXWA 3T3MF 5FOBA 1M7IA 2EDTA 1W0VB 4ALAH 2AJZB 3B9KC 4FQPA 5GGTL 2V7HA 1F97A 2KZWA 2MCG1 3PIQA 1T6WA 1BVZA 1M6OA 4ZFZB 3KYOB 2XKSA 3L3DB 1I7RB 3L1OL 4F37F 1DVFC 1B3JA 3NFPA 5DRWB 3KPPA 2KDGA 3TBYB 4OLEA 5LBSH 2P8PA 4D9QD 2X4OB 4UT7L 5JORA 4HGKC 1U3HB 3ZT7A 2XOTA 4JVPA 2ZUYA 3HZYA 3VGEA 3QH3A 4AEIL 2WIIB 2COQA 4APQA 1G9EA 4XI5D 1U8HB 2B5IB 1RFDH 2DBLL 3TO4A 3ULVC 3J8F7 5E8NB 1SVZA 2FD6L 5DC0A 3NZHH 4H1LG 1ORQA 4RGNB 2IAMC 2RGSA 32C2B 4YXKL 1MPAH 5C0CD 2XN9B 3SKNB 1DCLA 3VXRA 1KTKE 3NIGF 4MJIE 2B2XH 5JPMA 4TNVK 5FA4A 3Q5OA 5EU7E 1QLRB 3ELAT 5B3JF 1JGLL 2YD6A 4H25B 3LKPA 4JGUA 2CIKA 3ORJA 3V6OE 1MCQA 2VISA 5DHVB 1PY4A 1YEJL 3SKJH 5DSCA 5I74B 3VE0A 4MA7L 4OF6A 3UROR 4P2QD 4WEMB 2DQHL 1FL6B 1HHIB 2GJZA 3P4LA 2VWEC 2XA8L 1YNLH 5T5FH 5IB1A 2ED7A 2W60B 2R2BA 2IANB 4DFHA 3BKCH 3QXDB 4OLUH 2F74A 3GNMH 1RIVL 1OAUL 3B9AA 2X70B 4HUUA 1BWMA 3CFIC 1ZEAH 4MCYB 2I5YL 3HAEA 1P4BH 3BMVA 1FH5L 5JW3L 1S9VA 4TNWK 3H6JA 3VW3L 3QUMB 2ITDA 1HH9B 4M7KH 3BYTA 3BX7C 3T65B 3IDYC 3GSNL 1CXIA 4KMTL 1GC1C 1DVFA 1TJIL 4YHLH 5FK9B 5BZWB 4RFEB 1BZ9B 3RU8H 5LKNA 2Q76A 1CZ8H 4PY7B 1QNZL 1N2RB 4UTAL 1TTFA 4Z6AT 3KLAB 4UIKH 1I7UA 4NN6C 2AEQL 4YXLH 4XBEL 4WHDA 4H25A 4TUOA 2ZOLB 1YPZA 1RURL 3O2DL 3EIFA 4K7PH 3PABB 4NM8H 1F3DH 3VRJB 4LCWD 2EKJA 3V6FA 5JQ6H 1AGFA 3MFFB 1B9ZA 4UT6L 1A1OA 1DBBH 2XN9A 3SKNA 3VXRB 4BK5A 2G60L 5EUOF 4OFVA 5IB5A 2AXFB 2FH6A 5K9KB 3ARFD 3MBEB 4KKBC 1KYOK 3HMXH 1QSFA 4JO2L 4ZUWB 3I02A 1H15B 2F53A 3BEVB 1WITA 3C5SA 1G7IA 1CR9L 2P8LB 1GZPB 1OAUH 5CFHA 1XH3B 5KSBA 1NANI 1CFSA 1KJ3H 3KPPB 3CZJA 1XEDA 3HZMA 4B7IA 5BS0A 3IS0X 2XNAA 5FA3A 3PIQB 5ALCH 3CXDH 5DFVC 3F6LA 5EZIL 1P4LB 3OR6B 4M6NL 3DV6B 3S35H 5DUPL 4C57C 5BV7H 4XNQA 2OSLB 4HWZB 5FOBB 4WFFD 1JNJA 4IRZH 4U1GC 4QHUB 4I48A 2IPUG 2V2WB 1SJVA 2ORBL 2DM3A 2VRAA 4RDQG 3OKOA 3P4MB 4X6DB 3VXMD 3HLAB 4LK4A 2FJFB 1RD6A 4IRJC 5CGMA 1MHHA 4XP6H 3S37X 4HBQA 4N0CA 3S34L 1IGFH 5DMKA 4HWBL 3NZHL 4NQDD 1K4DA 3WMSA 2A6DB 4OB5H 1A1MB 3OZ9H 3WKMH 3RVVD 5L7XL 1KOAA 4NCDA 3ZDXF 1NANH 2EDWA 1OGAE 1IFHL 2OI9B 5TDNB 1BM3H 1DBMH 1C16B 3UTTA 5C09E 3VG9B 2NY3D 3QCVH 1TMCB 4WW2C 4WI5A 5E7FA 3WL9B 2C4XA 3I6KA 1JV5B 3KG5A 1VADB 4WY7L 1S5IL 1C16A 3C2AH 3HC0A 2HFEA 1CLYL 5HJ3B 1AP2B 1E4XL 3UJIL 3VXTB 3SKUD 4NO3B 2MWCA 4FP8H 4AJ0A 5ACLA 5HYSB 1FORH 2IAMB 4IDJL 1I1FA 4HW6A 1HXMB 4U31A 3QEHA 4NQCB 5KBNC 4YO0A 3P4MA 2HJFA 1JUFA 1MCBA 1PSKH 4C4KT 5E08H 5GGRY 1AXIB 4DZBA 3EHBD 1TVBB 1EBAA 3CLFH 1FQ9C 2YR3A 3ZKSD 4P59H 2APBA 1MCFA 1UZ8B 5IBUG 2F8VA 3TNNB 2J3SA 1YECH 2XXCB 4KJQC 1V05A 4QRRE 4YPJA 3L3OA 3RWEA 4J1UA 3MRPA 3NFNA 5I1KH 3RJDA 4P3CL 1WBZA 1XF5A 4RAVB 1OD9A 3H9HB 1A1NA 2HH0H 4TSCL 4E0RA 5C6WH 5FYLH 1GSMA 2IANE 3BEWA 2YC1A 1V8HA 3Q1SH 3TN0A 3QEGL 3HZMB 5LWYH 2VLME 3WN5A 4KJQD 2XWJB 5L2KA 1A6WH 1GCFA 4PGJA 3MLPA 5EOTA 4RGND 4TSAL 4E5XB 4YGVA 1JNLH 2NZ9D 2VZTA 3K8KA 3DI2B 3D0VA 4JO2H 3UO1L 4L3EA 1LE5B 2R2EA 4KKCD 4GLRI 2P5EA 1YDPB 1A14L 1A2YA 4RGNC 3O4LB 1NJ9B 2BY3A 4URTB 5JXED 3EW3B 2HH0L 1RZJC 1F4WH 3WDIA 1FBIH 1U8LB 4MD0A 2JJUA 1ITCA 1IARB 2HWZL 5CCKH 1AXTL 1RURH 4TUOB 2C3VA 4NQCD 3MUJA 4UIKL 4ONFH 25C8H 4WHYH 4Q97A 2NY5L 3UJJH 1ETZA 1CZ8L 4JZJA 2CKBH 3WNPA 5IROA 4CW1A 1BZ9A 4RFEA 4HC1A 2P42B 1LK2A 4KMTH 2BNQE 1V5JA 1TZIA 2XA3A 5CJ5A 3V0WL 3T65A 1C1EH 5TE7L 4WHTA 1F6AB 3JV6A 4I3SL 4JR9L 4IRSC 3WE6B 4XH2A 2WP3T 5F3BA 2QSQA 2ADJB 1IM9A 3C2AL 1ZEAL 3RZCA 2P43B 1UWEH 2FO4B 4OV5A 3REVA 1S3KL 3GNML 3ZE0E 4AEFA 3F7VA 4EDXA 1KEGL 1ZS8B 5F89B 1BM3L 1DE4B 1HZHH 4LP5A 2NTFA 1OLLA 5B4MD 5JXAL 3HZKA 3RIAK 2F54D 5HI3C 5CEXB 4GRWH 1MWAL 3S34H 1H0DB 1NBYA 4AEEA 4XP6L 5DMJB 1G7PB 3E6FB 2EO1A 5BOZG 3FT3B 2AK4E 3RPIA 4MNHA 2OMBA 5FA4B 4Q2ZB 5DJ2B 2NW3B 3TN0B 3SCMB 4X7SH 1UFUA 1TDQA 1HE7A 3LRSB 5FUZH 5B8CC 5C70A 2NY0B 32C2A 4O58H 4GG6A 4CU8A 2JB5H 4NSKB 2Z8RA 3WUWG 4M6NH 3VXOA 1IMHC 3SBWC 4NKQB 1GOFA 1I1AA 1Z9OA 3UC0L 4GUPA 4Q7DA 2WIIA 1J10A 2FIKA 5ESAA 1PG7W 1I8MA 3QXUA 2B1HL 2P8MB 3UMTA 4X7CC 4OSUH 3EYVB 1S7QA 3S7GA 4NC0B 2X4RB 4FOMA 4B5EA 2P8PB 1CBVH 1U58A 4APQC 4UUJA 1M7DA 4OAWA 3PNWB 5DHYB 1FLRH 1DUYB 2AJYH 2YD5A 3ZO0A 3ULUD 3GI8L 1FG9C 4OLVL 4ZFZA 1I3GH 2J2ZA 1CE6A 4JO3H 5KANG 5JW4Q 2IAMA 1D5ZB 3HRZB 2AJZA 1M7IB 4U0QB 2YSSA 4XRCA 2CPCA 5JQ6L 2EDFA 5CLTA 3RTQD 1S7VA 4K71B 3VCLA 3X3FH 1ZLSL 4BQ6A 1J05A 2PNDA 4K7PL 3QFJE 4JANB 1B4JL 3MRIB 1G7HA 4ETYA 4R7DB 1IILE 3FQWA 1KSRA 2E7LE 4MA1C 3RWHA 2E7LA 1OT1A 5I74C 2RB8A 1N5YH 2A6DA 3LD8B 1TCMA 4JFFD 2KH2B 3QI9C 2X4UB 5D1ZD 1CFNA 3QNXA 3ROLA 4OF7A 3W0WB 5F7HA 3D2UD 2X41A 3VXME 4U49A 2QKIB 3SGDI 4PB0H 4AENB 5TDPB 4LGPB 5E9DA 1P4BL 3WEXA 1Z9MA 3HFML 5EZOH 2YS4A 4UU9A 3U4BH 3U7AA 1HOCA 3S96A 1HYSD 2ARWA 3O4LE 3N85L 4EI6B 1I9JH 1FO0A 5FA3B 3QZWA 3VH8A 4WWKC 1LD9A 4GQ9L 1ZA3B 2Z0BA 3DARA 4P23C 5C6TL 1A02N 1T2JA 3V0AC 2J88H 4PJIF 5HHNB 2OJEA 4H88H 2CMRL 4S0SD 1YEJH 3LEXB 5FO9B 2Q20A 3OKKA 1GZPA 3FMGH 3LKOA 5IFHL 3QWRD 5T1DH 1G7IB 3P9MA 5CZKA 3OMZA 5DJCB 4YHZL 5ISZD 1KIRA 2OTUA 4Y2DD 5FHAH 2R8SH 3TFKC 1RJZB 5DI8B 3SJVA 1R5WB 4X6EA 1WT5C 3QNYB 3CVIL 5GRJH 5CSBA 4BA8A 1ZT7A 4X9IA 1GJIA 1OM3H 2QLVB 4YDJB 3HI6L 4XCCL 2VAJA 1U91B 1UC6A 1S7RA 3LN4A 1VPOH 2BOCA 4MLIA 2NY4D 3BH8B 3IRZA 1RULH 2WBJC 1U58B 2VWEE 5F7EH 2IJ0C 5DD0L 4NYLB 1HYSC 4EUPA 1OAYH 5D2NA 4HV8B 2KQMA 4LLUA 3BHBB 4XXCC 1XGPA 3DSFH 4OGXH 4P3DA 2A9NH 1EK3A 3PL6B 2PXYC 1G1CA 3AC0A 3G6AA 5INCB 1E4KC 5SV4A 5F88B 1IE5A 5DQJA 5HHMB 5E1AB 1KFAH 1S9VB 1WUNT 2E5EA 4HUMB 3WDJA 1KB5B 3ILQD 4MWFB 3U4BL 2LAGB 1WBYB 4LLAA 5SX4I 2CUMA 1JZ2A 4XHJC 4JO1L 5KW9L 1ZGLP 3SE4C 3VWKC 5DJ2A 3JV4B 4EIZC 4JFEE 1MCJA 2IANA 2AV1B 3DYOA 1GHFL 5T1KD 3C5JB 2E6PA 3TV3H 3RUGA 1NAML 2QBWA 2VO5A 3VFTB 2XN9D 1HHKB 3QJFA 4ENEC 4C56E 4NBXB 1A7NL 3TJHC 1OSPH 2Y7QA 3OL2A 2NY1D 3WXWL 2AJUH 1SEQL 5GGVL 4Y16B 3AU1B 5K9JL 1KCRH 1AO7E 4S2SA 3BT2H 3W0WD 2XRAH 4WU5B 1WZMA 2EDJA 2HJKB 1XIWD 5D6CB 5KW9H 3RZCB 5FKPB 4IRJB 3KPRE 4Q9QL 5KTEL 4K3GA 1N6UA 2VQTA 1JTPA 1MF2L 1TZGH 4WV1C 3TO4B 3O2WH 1W2KT 4U0RB 4JG0L 5KVGL 3BVNB 4D9QE 4N5UA 2Y72A 1TZIB 5D1ZA 1CT8B 1KTLB 2R15A 5DYOA 2QTEA 4AIXA 5EU6A 1RAMA 1QP1A 1RUKH 1LK2B 5IOPA 1OAYL 4L4VD 1UWGL 3TWCH 4JFPB 4UQ3B 3C6LC 3FRPA 2Z31A 3TYGL 5E2JA 4P99A 4POYA 4MSWB 3OR7B 4NO0D 2FJGA 4MAUL 1CE1H 4MJ4A 1BFVH 4LBEA 2MMXA 1VPOL 1B90A 3Q0HA 3SE8H 1INEL 4HKBA 1X5ZA 2VC2H 1EMTH 2IPKA 2R0LL 4M48L 4NWTH 4P2RA 2HTKC 4N0UE 2BERA 3VXMB 3FFCD 4PFEA 4K2UH 4LVHB 3D25A 3A6OA 3K4ZA 4R90L 4W4OC 1XZ0A 5EBLA 3RNKA 1IGYA 4QY8A 4MXVF 2DLEA 4CAGA 4YHZH 3BSZL 2NW2A 3U83A 1DP0A 3GK8L 4NWUL 3AREC 4OZGA 1MWAH 2BSTA 4FQ1H 3FMGL 5EBWA 5GIRA 4QRRA 3MX0A 5IESH 4R4ND 2YD2A 1IAII 2P24A 4OF3A 3MR9A 1YEIL 5TPWL 3SDAA 5FV2A 1Y18B 4YIQB 3TEUA 4Y16D 1R3LB 4FNLH 3QUZA 4G6FB 1A9BA 3O6FC 1S7TB 4G9DA 2D7PA 2JIXB 5DVMA 4DFIA 3ZYOA 2LTQC 4GRLA 4HIEA 5GGUB 5C0BD 4LNRA 3O6LH 4HX1A 4L8SC 2DL2A 3TNNA 1EO5A 2H2PC 4MQXD 3EFFA 4JN2B 1QFPA 3MCLH 4BFIA 4AIZA 4TUKH 2VN4A 3ARDA 2K3TA 3QCUH 3WFCL 4QF1B 2EDKA 3RL2A 4QOKA 4QF1A 1NGYB 1IGCL 3ZE2E 5C0CB 3IJYA 1YEGL 2BNUB 2CRIA 2NY5H 5FF6B 4K3DH 1G7MB 3I3DA 1CGWA 5I75B 1QSFE 5E99L 3FQWB 2DYPD 3INUH 5KAQG 4KDTA 3T2PA 5E0QA 3VI4F 4GRLB 2YXFA 3HPJB 5HYSG 5BS0E 2ZKHL 4GXVL 2B0SH 1R3KB 3HE6A 3CFCL 5ITFB 4MHHG 4UINH 2HFFA 2BSTB 1NBQA 5IBLD 5KTEH 1DUYA 2A6IB 4TSAH 1Q94B 1GIGH 1T83C 4NZJA 2PYEE 1CLOL 3IDGB 1GZQB 5DJZA 4QNPE 4FQIH 1A6WL 3VI3F 3I9GL 3RY6A 5DF0A 2OR7A 4QHUA 2X1QA 5F7UA 3SQOH 2R29H 2B1HH 3ARTA 3QDGE 3VXMA 1FDLL 1PZ5B 4QNPF 5SWSD 1OSPL 5D8JL 1NCNA 3A0OA 3KXFA 4LRNH 4UDUB 3VXOB 4HKBB 5DQ9B 3L5WB 1S7XB 1UA6L 1R6VA 4KKCC 1C7SA 2N4IA 5BRZA 4X7SL 2MPAL 2V17H 4YHIB 3MYJB 3DVIA 3U46A 3O6ML 4DWHA 3KPRB 1MRCH 4AMKH 2K7PA 3AXLA 4LMQI 2UWEB 1AGBA 5IP4A 1NBYB 2CR3A 4R97C 3BVNA 4PV8A 5DRNB 4X98A 5F1NA 5JXAH 4PB9L 5KN5A 1EAPA 4ZUUA 2Q86B 3A6BH 3C60D 3ZKQD 2ATKB 1O7SA 1N7MH 1T5XA 4QXGL 5INDB 5D6CA 4XP4H 1KEGH 2OCFD 2VR9A 4Z7VB 3SDAD 3REVB 4JQXA 1J8HE 1LO2L 4HKZA 4GW4A 2AK1H 5CWSB 1N4XL 4OIAA 1NSNL 3QAZB 1KB5L 1ZHBB 4L3EE 1IGTA 2J8OA 4F7EA 5IHBA 2BNQD 3JWOL 4IBLT 3MXVL 4N0UB 3EJJX 1MCLA 1KN4H 4JR9H 4RGMC 4X8JA 5EUKA 1VFBB 2DI9A 3T1WA 4PJCA 1RU9H 1T66D 1FO0H 1GPOL 4I2XB 4JFEA 5JDJA 2GFBA 3V4UL 2BSSA 2VABB 1FNFA 4JZJB 3O45A 4OCYH 4FFVD 3MGOB 4PJXE 1MFAL 4XPBH 4LHQB 4R4FL 5EIIA 4HUXB 4RSVA 2C3VB 4HUUB 4Z7OE 4ZAKC 3IAGC 2XTJE 4ZFOA 3KXFB 3EO1A 3VGAC 4LCYB 5J11B 4LCIH 4U1NA 5IV2B 4F7TA 1I85A 2FCBA 2Q7YA 1OTSC 2D7MA 1X6LA 2XACC 2VLRD 3ARPA 4OZFG 4OCMC 4ZQKA 3TT1L 3DUSA 2GY5A 5JO5A 4GBXB 1T0PB 2ZWLT 4LSVH 2DQCL 1QHOA 3BMWA 1KBGH 2YN5A 3L5JA 4LLYB 5DHVA 5DD3L 5LGKA 1ZHKA 4E5XA 5IKCA 3OAZH 4M7JH 2B1AL 5I17A 3EFDL 1YEDA 3LKPB 4QO1A 5FECB 3D48R 2BOCB 2XWJA 5L2KB 4LIQE 3T2QA 4YR6A 5LWYL 5A40E 5CHNA 4Y19A 1DBBL 5C0CE 3T2NH 3T0EC 4J3OC 5I76B 4TTGA 3G9VA 5SWZB 4RAVA 3WLWD 1KPRB 4N8CL 4G42A 1A8JH 1RHHB 2JIXD 5ADPL 1YECL 3AAZA 5I1DA 4KK8C 3MRCB 3HZYB 2VXSL 1ES0A 5GS0D 5F9AC 4PTTB 5KZCD 5JHDA 4HGMA 5DJYB 2XZQL 4IJ3B 3U82B 5SX5H 2F53D 4P5KA 4X6DE 3QZWB 3VH8B 5AZ2H 3H7LA 1BEYL 5MENA 5EUOB 1MUJB 4HIJB 1G6RA 3VD3A 3CMOL 4X4MA 4TUJA 1E4XH 2PYEB 2XV6B 2ADIA 4JY6B 3O8XC 2BHYA 4NM4H 1T22A 1D5XA 3U9PL 4CVZA 3HR6A 1J0YA 3K7UA 2PXYA 3LN5B 5E00A 5C09B 3PHQB 4ZPTB 3DGGA 1NCAH 3S37L 5I16A 4EUPG 1IL1A 4L4TE 5HHOD 1Y18A 4YIQA 3QAZC 4C56D 5L9DH 2F8OA 3PGCA 4X9HA 2PW2A 1A1MA 5EORH 1MRFL 4PJEA 4JFOA 1J1OH 2HLAB 4X4ME 1G6VK 4LPYA 4P23D 2Y06L 4OZHE 2FBJH 1JHKL 4PG9B 1CTOA 1NKRA 3MROB 4G8GA 4MZ2A 3PP4L 4N0YH 1AD9A 4HMEA 3ZKND 3HG1E 2ORBH 4PRBB 1E6JH 2UWEE 1U93A 4OLWL 1ZSDA 5EBLB 3RNKB 1G0DA 4HFUL 4NQCE 3EYFA 4ZXBB 3DUUB 3IDMB 1WZ1L 1EGJH 4ZXBD 4KRPC 1MRDL 2YSSB 3TJHA 4YXKH 4XNQB 4JCLA 5BV7L 2Q7NA 2FLBT 2WLZA 3MCKB 3BPLC 2WWMC 2X44D 4XBGB 2VZ3A 4MDIB 4S1DC 2DQIH 2E7LC 2WNGA 3HAEG 2ZUSA 3WNMA 5BJTB 1HZHL 3T0AA 3U6RA 5I71B 3IKCB 5FV1L 4MSWA 4G80B 1J8HB 4PD4J 1JGUL 4R2GB 3L3HB 4H0IA 3ZT5A 4XTRC 4J8RB 5EC1B 2JB6B 1XH3A 1S3KH 3ROOA 4HFWB 5CS7A 1QOKA 5FYJH 5IOPB 3BPCA 4RCAA 4AYFA 3L1OH 5I1EH 1U42A 1YZZA 1CT8A 1KTLA 3DX6A 5IB4A 2ZUUA 3EDJA 1A7QL 3HMXL 4OFYD 3RWGA 5CJQH 4Y7MA 3QYCA 4NN7B 4EN3B 3GRWH 3QUYC 4ALAL 4HD9A 5DVNA 4MS8C 3QFDB 3VFRB 3MFFA 4POZD 3NOIA 1HQ4B 2BVYA 2XPGA 3PXHA 1KPVA 4P46C 4R0LC 4X4YB 4NKMB 4LDLB 5DJXB 4FQLH 5ENWA 1WFUA 4NFBA 4LCCC 4TULL 2AS5M 4MB5A 5C3LD 1KF9B 1ZXQA 4KTDL 3SGJC 3FN9A 2EYRB 3W11D 3P77B 5BCAA 3N0PB 4JDVA 3W39A 1T0NB 1J1XH 3C08H 5HGDA 5F7DA 1SY6L 1L0YA 3RWDA 4PRAA 1WT5A 5D5MB 5IVXB 1DANT 4IRJD 3QUYA 3W82A 4WFED 3W2DH 4EKXA 1UB5B 2NLJA 1TIUA 2WY3A 2BNQB 4OGAC 1T1YA 4PBVC 1YMME 3DYPA 1TETL 3H9SA 5KVDH 1KG0B 4LPCA 3W9EA 2KBGA 1KCKA 3ESUF 3WNNA 3RAJL 3HS0B 2W07A 1T1YB 5E1AA 1RIVH 4G5ZH 5DK0A 1V7NH 4HS6B 1NPUA 4KXZH 4PJXA 1P7HL 5SWZE 5E56A 4OCLC 3NVQA 3FT2B 3QXAB 4UV4H 2DQHH 5FAAA 5C2BL 3D69A 5D1QC 1DQQB 1HWHB 1DQDH 1KV3A 4JKMA 3SKJL 4P3CH 2D03H 4BSVA 5EBGA 3RWCA 3BH8A 5HSFA 3O11B 4OJFL 3IRPX 2C26A 3DRTA 4LQFH 4X4YA 3VXNA 1S7RB 4BKLB 3ILPA 3TBWB 5JPMB 3OAZK 4DN4H 1FNEB 5JTWA 4DGYH 2YA1A 3T1FA 4MS8A 3UX9B 3VD4A 4G43B 5DWUH 5DGQA 1AY1H 1JGDB 3MXVH 4NO5B 1T1WA 2X1OA 3D0VB 3T09A 3QDGD 5F7MC 5T1LB 3MV7D 3SGEI 1NDGB 4MXQC 4RISH 3NAAL 4J4PC 1IEBB 1U3HA 1S5IH 1EFXB 5D93B 1LP9E 3NTCL 4LSPH 1DR9A 3LEXA 1SQ2N 2GQHA 3RUGF 5C2UB 3GM8A 3HC3L 4E41E 4I1NB 2EH8H 3UTSD 4IOFC 1CWVA 4HDIA 5D1XC 1XGYH 3GSVA 4FTVE 1I7RA 4KVCH 3LKNB 3VMPA 1JIBA 4MDIA 1M6OB 2R2CA 3ME0A 5L7XH 1A1NB 3H9HA 4AEHL 4JLRB 5EU4A 4OZGE 2V7HB 3RRQA 2A74A 3OG6B 1QTYT 1MEXH 5IQ7H 2VQUA 3DI3B 5KZCB 1R5IB 3RVTD 1II4E 2FHCA 4ELKA 3BPOB 1ZVHA 3TA3D 2WWKO 5ESVB 1CFNB 3QNXB 3RWJB 2EDNA 4IRZL 1PKQA 3L7FB 4G8GB 1OW0A 4Y2DB 1NCWL 1L9NA 2DBJA 3EYSH 1WEJL 1UA6H 4PLNC 3DUHA 4NN5B 5C0EB 2E9JA 4FZ8L 1TQCC 3KGRA 2YBRB 4JZNB 1RZKL 4KUZL 4F15B 2HFEB 3MRIA 1B2WL 4MJ5B 2ARJQ 2EXWD 2I60L 4NUJA 1C8PA 1J05B 1E6OH 1KJ2A 1QQDA 1U8QA 4NUJB 2IPUK 3GMNA 3EHBC 3L3KA 1N64L 5F96H 1T3FB 4LHUD 4JFDA 3QDJD 2MKLC 1EBPA 5J13B 4HCRA 5MEND 2YBRA 1G6RB 4S1QL 1JBJA 5MENB 2HP4A 2X05A 4GJTB 4PP2B 3NIDF 1JJUA 3M45A 4XI5C 1XCQA 5DHYA 2R4RH 2X4TA 4NQDA 3BD4A 3DROA 1IQDB 1M7DB 4OAWB 4OI9A 3LH2L 5BRZD 4CU7A 5JHDB 3NCJL 3HTLX 4NM8L 4KI5E 3VFOB 4XP5L 3MUY1 2O5XH 2DN7A 1I8MB 3AAZB 3T0BA 1TXKA 5DR5H 2BX5A 4P5TA 5E8OB 5I9QC 4DKAA 4NSKA 3QIBA 3F58H 5D5ME 5IVXE 2G9HB 4G8GD 4IMKA 5AG8A 2K1MA 2LE9A 1ND0A 4HWNA 2DQFA 2FDBP 4PJIA 5FGCB 3RDTA 5FCSH 3VGBA 1FZOB 3BRFA 1BJMA 1WAAE 1EH9A 2A9MH 4MNHB 1J5OL 3U0PA 2FH8A 5FECA 2BVTA 4I9WE 1P7QB 4ZAKA 2NY6B 4N0FA 5C86A 3QI9B 3VMOA 1XGUB 2J12B 3BEVA 3C5SB 4DW2H 1NDGA 1H0DA 2BSRB 3X12A 1W0WB 3BH9B 5FUCC 5EU5A 2OK0L 5BQ7A 4GKSA 1MCRA 3E0GA 3O4LD 2AXFA 4ZQKB 5T5FL 3SEPA 4G43A 3N1FC 4X9BA 5GRZA 2HT3D 2V7NB 5E03A 1KEML 3UYOD 2P1YA 5IV2A 2JCCA 3ILPB 3TBWA 3QPQD 3BO8A 2BXYA 4ZFOB 4P57B 4C58B 1G9MH 4FXKA 3JWNC 3QIWD 4UQ2B 4FMFA 8FABB 2Y07L 2NX5D 2BVQA 3ARBC 1AXSB 3VFVA 3FONB 3QDMA 2CK2A 2X09A 3C6SA 1N2RA 3WE6A 1MY5A 4H8WC 3MJ9H 3VRIA 1MCWW 1YN6B 2Q76B 3MACL 1ACYH 1FGNH 1CGSL 1PQZB 4NQEB 4JFEB 3BGMB 4YQXL 5KSAD 2UZIH 1PQZA 3W5NA 1WCBA 5EO0B 1IKFL 4IIQB 2W92A 2VR4A 3HE7D 3T4YB 5FYLE 1M1SA 4M5YL 4ZOAA 2Y5TB 1IGTB 3HAEB 4K8RL 2X1XR 1CQKA 1NGXB 1KGCE 1TLKA 5DTFB 5FYKU 4NOBA 5C07D 4GG6F 3KDMB 1Y0LB 4Z7VA 2HT2D 3QXDA 2W60A 15C8L 4I0PA 1BBDL 1T5XB 4BFEA 1BFTA 1DUZA 3GMOB 4JDVB 1MCOL 4OI7A 2VXVH 3P0GB 1MF2H 4WUUD 4QWWC 3TFKA 2J4WH 3BH9A 3V4PL 2BSRA 1PW3A 2IPTL 4KV5E 4MA8H 1F8TH 1HQRA 1WSST 1LEKA 4FMKA 1DQMH 2MQ3A 1AE6L 4WNQA 4PY8J 4E42A 1NFDF 3LQZB 5F8QC 4NNPH 2XRAL 4LLMA 2EICA 1I3VA 1KPVB 4MXWH 4UILH 3WXWH 2YC1B 5GZND 1V7MH 1H5BC 3H3PH 3QIBB 1P2CA 1EFXD 4U6YA 2Q6WA 3WSQL 3EGSA 1Q9LA 3VFGH 1CGUA 1UGNA 3VFOA 4QRPE 5GGQH 2DTSA 5EOCH 3KPNA 4J8RA 4LPXA 5DJZB 3GMRA 1D9KB 3CX5K 3F6IA 1CL7I 3NGBC 4UNVA 4NQCA 1J8HA 2VDKL 2PXYD 5CSGA 2X4TB 4NQDB 5MENE 5M94B 3EAKA 1EV2E 3U7WL 3UZVB 4Y4FA 4BSJA 5L0QC 4PRDB 5K9QI 3WIHH 3QQ4A 5DRZA 4Z95L 1OPGH 3VXTA 4XBPA 1D9KC 3S97C 2H1PH 3SDXB 3BZ4A 5JHDE 4NC1C 2H2SC 2GTWA 3KS0J 4WUKL 1NC4B 4QCIB 2QHRH 5ETUA 5BV7C 2BC4B 3QUKA 4FQHA 4F7CB 2WBJA 3CX2A 2FB4L 4RRPG 3O4OB 3L6FB 4P4RA 1FNLA 2PR4H 4JZNA 4NKOB 1E4WL 5FGRA 1YNTB 2HLAA 3UTPE 5EG6C 1C5CL 5C0EA 1SEBB 3SO5A 3PGCB 2H2PD 4QOKB 1SYSB 3IFLH 2X7LB 5F1IB 3ULVL 4XPAH 4KAQL 3NA9H 5TE6L 4Z77B 1OB1A 2R8SL 1QBBA 3MMEB 4CVZB 4I48B 4QRUA 3QSKB 5SV3A 1H3UA 1MH5B 1R5IA 5A2FA 1NLDH 4LNVA 2XNAB 5EH1A 3TVMB 1JL8A 5KOVC 4HPYL 1F42A 1RJLB 3DXAB 1I1YA 4JREC 2EC9U 3SDAB 4HDIB 3AS0A 3S88H 3GHEL 1DBAL 5BS0B 4FQ2H 2FJHA 3V4VH 4UV7H 4FABH 3DRQA 4JFFA 2F53E 5F6HI 5EBWB 2P8LA 5TF1H 4XVUD 1Z0MA 2MQ0A 1NCCL 4Y4HD 2EYSA 1NGQH 5GRYA 4KWUA 4JPKH 9CGTA 2L7JA 1DJSA 1J11A 1D5MB 5DJAA 1NFDE 3MBEA 4EJ1C 5KS9E 3GI9L 4NKDB 1H8SA 2IH3B 3IFOB 4XWOD 2YEZA 4P9MH 3P0YH 5E2UH 4M43H 4YDLB 3C6LD 1QKZH 4XP1L 7FABL 2F9BT 3AS2A 3CFJA 1N5YL 5DUBB 3PABA 2OZ4L 4XZUB 4XP9H 4NO0A 1I4FA 1QO3A 4G59A 3M8OL 4JFZH 4O2CA 3GKWH 3PWLB 2NX5B 5C0FA 2LVEA 1HHJA 1KLUB 4YDKH 3VFNB 4Y4FD 3SE3A 3O3EB 5L6YL 2DKSA 5D1ZB 1C5BH 4UB0L 4LCYA 3FQXA 5IG7B 4PGEA 5CJXA 4JO3L 5CD5D 2AJYL 4L8CB 1F13A 4IRJA 4LSSH 5I1IL 3U7YL 3M07A 3UEZA 4Y8AA 4J3XA 1CDIA 2F74B 1MWAA 4YBLB 1BF2A 1BJ1H 5FYJD 3JTTA 4Z0BH 4PRAB 2UZYB 5EZJA 2GJZB 1UT9A 1T0NA 2CLRB 2DMKA 3LDBB 2PUQT 1X5IA 4WI7A 4JAMB 4HT1H 1NFIA 1KJ2L 2CXKA 3HZVB 1LEIA 3K2MC 3TO2B 2BZDA 1EJOH 1LK3L 1Z3GL 3PWPE 5CWSA 2CRMA 5HHXL 5HI3D 1WWBX 3H9YA 3VFWB 2EECA 1WGOA 1VEOA 1ZLVK 1NBZB 5GS1C 4F58H 4QOKD 3NBNA 4KDTC 4NJ9H 2MNUA 2R0KH 4DTGL 5I30H 3GEWB 1FZKB 1XF4A 4DQOH 4J3UA 4PRPE 5I66B 3HNVL 3QEUA 1U8HA 2ADFL 4UAOC 1HXYA 3D39B 4HF5L 3QH3B 2VLKB 3O3UN 4ZD3H 4UMGA 5JZ7D 2MJWA 5L88H 2VLKD 4O2EB 5HYQA 3SDCB 2JB6A 1RSFA 2H6PA 4I0PD 4O5LH 3MYJA 1NGZA 2HYMA 1UWEL 5BMFH 4JG1H 1SY6A 4HWUA 3GJFH 3CMGA 4JVUA 3U6RB 4OT1H 2O5YL 3MNZB 4P4KD 2HFTA 1HKLL 4PP1D 2CKBA 3BXNA 3DETC 1AQKH 3VI3E 4K71C 4GO6B 4FRWA 2JE8A 4Y4HA 3GMPB 3MQIA 1EXUA 4JFZL 4PJ9C 5KSVA 5DDHB 3QQNA 3RTQA 1LP9F 4XAWH 3EUUA 4H0GA 3TCXA 4MDJB 3G6JF 3B5GA 5AD0A 3DVNA 3S4SG 1KTDA 2E27H 1A6ZA 4KHTH 1RIHH 5JPNB 2ZCLL 5HPMA 2VLLB 1OGTB 4Z76A 4MNQD 2Q8AL 4NHUA 1NDMB 4FQXA 4X9GA 3UTQB 3JVGC 2OJEB 3LMJL 1NGWA 4L8BB 5JUEL 2ZOKA 1RZFH 4CU6A 4DCQA 4HUNB 1NCTA 3LZFH 2JK5B 1A14H 4ONHA 1FO0B 1OQXA 3FQNA 1H8NA 43C9A 5J7CC 5HDQL 4D2NA 5DEFA 4A2LA 1T22B 2ZG1A 5EUOE 5F6IB 3BQUC 4JKPL 4RWYL 3FRUB 4M1CC 3EJZC 3UYRL 5TDPA 4JPVL 4K7FB 4K9EL 3GBML 4U1HA 1A3RH 1OCWH 4TRPL 4NRZA 4W70A 4DAGL 1CD0A 2DIJA 4P23A 2H8PB 3VFSA 2ZCLH 2I9LA 3BJLA 3PQYB 3DURA 1MREH 4U3HA 3D0LB 4XAKE 3DO3A 1ZT1B 4M7LT 2ERJC 1UZ6F 1YN7A 2ZJSH 5I1KL 3ZKXC 2N7AA 1J12A 1GGYA 4LEOB 3FOLA 2NNAA 5HGHA 4JQXC 3OXRA 2MHAA 4GMSH 4QWWD 5GGUA 3PGFL 1SVCP 4LU5H 3EO9L 1ZVYA 3VCLB 3GSQA 4MJIB 4X7DC 2EKSA 5I76A 4FXLA 3O81A 4LRIC 3HG1B 5ACZA 1B0GA 1A6AA 3K8LA 3MRLB 3DYMA 2ATPA 1MI5D 5TQ0L 3SDXF 4AY0A 3OV6A 1OL0A 2XG5A 5IB2A 4P2RD 4PP1C 4EVNB 4U3XA 1HHGB 3MV01 5FO8B 2ED8A 4GAYB 4ODXA 5CBEB 5D7LA 4MVBC 5CZXD 2A1WL 4ZD3L 1ZHKB 1WTGT 4J6RL 4MA1B 4UUJB 4I0PC 5I2IA 1OPGL 3SDCD 2DLTA 4JKKA 4TNVF 2R69H 1IGYB 4FFZH 4WW1B 4MQTB 2EDLA 1D5BA 4U2YA 1RUMH 3IXAB 2EDOA 4QRSB 2Y1VA 3CJJA 4GAGH 4GUPB 1D6EB 5IW1B 5BW7A 4WTWA 4O00A 2E3VA 4N8VG 2WUBL 4U1NB 5E94B 3VJ6B 3WIFB 4N5ED 3MUGB 5E8PA 1DN0B 5DURD 3MYZA 1R5VA 3ULUC 3WFEL 1NBVH 1TTGA 4Y4KD 3IFPA 3MGOA 1IEAB 4CN4A 4KRMB 1P84K 1KJVB 1QYGH 4I5BB 2VABA 1TITA 3CSYA 1G0YR 3EOAB 1FYTD 4KY1L 4OKDA 5F70A 3ZYZA 2P46B 2CDGB 2VAAA 4NO2B 4IM8A 1QR1A 3S35L 4X8JB 4Y4KC 5EUKB 4Z18A 1LE9B 4N0UA 4PJBA 1NUNB 3WFBL 2X1WL 2B39A 2DYPB 3MV9D 1PLGH 2M8XA 3O2DA 4KPHL 5C0GA 4R26H 5IQ9A 4LMQE 5L8JB 4OD2B 1EUTA 4LPWA 1AKJD 4JPWL 1N6QH 5AZEH 1CTNA 1JRHL 2FEDD 3TIDA 4UB0H 2WZPD 1EZVY 4M8QA 2OP4L 4Y16A 2ADJA 4RBPH 4XC3L 1P6FA 5FDWA 3MLSL 4JJHA 3V6ZA 2C7UB 1BBDH 4S10A 4NRXA 1KELH 4NKIL 3LCYA 1F6AA 1MCIA 4XPHH 3AM8C 1B4RA 1E28A 3GMMA 5HVHC 5EBMB 4U1GB 3BWAB 5SWSB 4LHUG 3DX9B 3C5JA 3EOAA 2HMID 4P2CG 2BXZA 3FB7B 1GVIA 3MJ6A 1UM6L 4G3YL 4HUKB 4NNYB 4XCFH 5CEZE 2D4DA 1XFPA 4Y5YA 3NACL 4TOYH 2AEQH 1CDJA 1XGRB 3SDDC 2AI0L 2NY7L 4DVBB 4CMMB 1B0RA 4IRSD 3MV8D 4CMHC 3WDHA 4KQ4H 4HJGB 3PDOB 4EUPB 1QRNB 4DOHE 1OSZA 3JV5A 2DQTL 1DLHA 3FL7A 3UXFA 3C60C 1QSZA 1IC5H 2VSCA 4MNGE 3E8UL 4XVJL 4HPYH 4UBDD 4D8PB 3LPFA 5B39A 4FTVA 1TJHL 1U3JA 4XVTH 3D85A 1WCQA 3O6KL 4TN9A 3SGKC 4YDJA 3WHE0 3MLVL 3BEWB 2D7OA 4E41B 1A6AB 4BZ1H 5IFJB 1QEWA 3HPJA 4HHAB 5KG9A 2DQTH 2NQCA 5JW4M 2DM4A 3R8BB 3SPVA 1T20B 3ECBB 3ULUL 3TCLA 4I4WB 4ODHL 1UZ8A 1FV1A 1CGTA 4K3JH 5FF6A 4M9OA 3F58L 1H3PH 3O3DB 5CZVH 4BZ2L 1PBYA 3CD4A 3D0LA 5D7JC 5HHNA 3RP1A 1ONQB 2YMXL 4YHNB 1NCBH 2ENSA 4WFGD 1JWUA 3AUVA 3IJHA 2FEEI 3O8XD 1T0MA 3F62A 3JZ7A 4P5MA 4X4XA 3WXVL 2RR3A 4WFHE 2YK1L 3MUZ1 3MRDB 3EFFB 4R0LA 1R24A 1NKOA 3HC0B 3B5TA 4HLZH 4AK1A 4WWID 5KVFL 3L5HA 4KU1A 3D39D 4XPHL 4YBLC 5DMGD 2QKIA 4XMPL 3V95A 3HMWH 4Z78B 4DKEL 3BE1L 4R6UA 1A0QH 1N64H 2ZOKB 3VD9A 1BOGB 3WLBA 1EEYA 2QL1A 4LGSB 3F5WA 5HHOE 3TBTB 4U1MB 2VLLA 4JGJA 4QEGA 5T5NF 1K2DA 1F4XL 2AXJA 4XNUH 5FKAA 3OKOB 3ARED 2HVKA 4GS7B 2YKLH 3FZUD 2VXQH 5EWIH 5K9OA 5C0AA 1BVLB 3BZFA 3U2SB 2AJXL 5DO2D 1A64A 1NLBH 3LQAC 2R23B 4XMKL 2FX7H 3NIFE 2QR0B 3ULUF 1BVKB 1NGPL 1G7JA 1SJEA 3OJMB 2XT1B 1D5ZA 1KB9J 3BISA 1WIOA 1CE6B 2AJVL 1CGYA 1DQML 1WK0A 5GZNC 3IDIA 1Q72H 3IDUA 5DURB 3OR7A 1C08A 5T3XE 5D1QB 1A6PA 3JWDH 4WHCA 1CFSB 1J9CT 2IH1B 2X4SB 4IDLA 3RX8A 1QBLL 1HCFX 4DZ8B 1WAAF 1AGDA 4PYHA 4KZEL 3P3YA 4Y8DC 5C07B 1ZLWK 4CVWA 1CL7L 1H3GA 3U0WH 1K8DA 3W11C 1RZKC 12E8H 1UQSB 4J3SA 4RMUA 1G0XA 4D0CA 4C59B 1S9KC 3NTCH 1N59B 2B4CH 3VFPA 2VZ1A 4N90E 3RI5F 2GW5A 4OUOA 3R0MA 3S3PA 3EOTL 3BDYL 3GSUB 5EA0H 2W0FA 1INQB 1RQ5A 1JMZA 4HGWB 2ZG3A 4WU5A 4OIIL 4NN5C 3KPLA 3HC4L 5DWUL 5GGTA 3DMMC 3GIVB 1OTUC 1JZ6A 1SMAA 2OJZH 3GUTB 5CEXA 2Q3AA 3QJFB 5CZVL 3P9WB 3CVHB 3FAXA 1NEZA 4BM7A 2ITCA 5IMOB 4RNRB 4JFQA 1QRNE 3U1SL 4DOHB 5FOJA 1ZS8A 4P46B 1LO4H 2W9DL 1HH9A 4NQEE 1AGCB 1HN1A 1S7UA 4G8IA 5F9OL 1JFQL 6CGTA 4JPIA 3BDYH 2AABL 2W9EH 1FPTH 5EZLA 5GGSA 5IHLB 2E7CA 2Y6SD 4MCYA 3DTXB 3WUZA 3OB0H 3IXTA 1KB5A 3DO7B 3MRRA 1DSFH 4ZUTA 1XF3A 3IDJA 1NQBA 3V7AG 2NMSA 4EBQL 4W4OA 1RIUL 4KRPD 4RWYH 3HA0A 5I1JL 3QO1A 1NUFA 4LOUC 4HV8A 1O7VA 3FFCB 3SGEH 3L3IA 3IFNH 3UAJD 1CGVA 5L0QB 4Q9RL 4KKNA 5ICYA 2M1KA 1GGIL 3MOQA 2DQEL 2NYYC 4LHJB 4WUUB 3ABZA 4Q6IA 5J9PA 5D2LA 4MNQA 4NQUA 5A2KH 3PWVA 5CIPH 4LL9A 5F6HJ 1LILA 3ZTJH 1AJ7L 1RZJH 1BGXH 2F58L 3FHAA 3BQUA 3QNYA 1YDPA 2BCKB 3X11B 3NZ8A 3LKQB 5IBLC 2YKLL 3CVHH 1IAIM 2ICWB 1DVFD 5KVMC 4APQB 2DB8A 3ILQC 3NA4A 1FNGA 2DM7A 5E6IC 2QADC 1YQVL 2XZZA 2EIEA 5C3TA 4YHPB 1WFNA 4ZO6A 1F2QA 4QRPB 2ARJA 1EHNA 5D72L 2C1OA 4W6XB 4JG1L 5A2IH 1XGQA 3V6BR 3S8WA 5LXGL 2PO6D 1T89A 1XF5B 1LNUB 5HI5D 4LSQH 2I60H 2AGJH 5EFIA 1CFTA 5E2WL 1PYWB 1Q0YL 3ARGB 4WCYH 4PS4L 3KPSD 4IMLB 4CADA 1RZKH 2A6JB 5GS2D 3SDXE 3CVHL 1SMOA 2LU3A 2APWA 3V6OA 1JK8A 2W65B 2QQNL 1IZKA 3ROLB 1M7XA 4Z5RA 4JDTH 4C56A 1CK0H 1JPST 3PDDA 3FO2B 3P30L 1J1PL 1I1FB 2F54A 1QYGL 4Z8FH 2BVEA 5HYJB 1AR1C 4Q9CA 4P4RB 3UZEA 3CFBB 5LCVL 1FNAA 3PP4H 1RK1B 3VWJD 2DQEH 1SM3L 5E2VH 5HHVL 3V5DA 4WDIB 3GSNB 4JANA 4X7FC 3PWPA 5JZ7C 4Z7UA 5ETUB 4Q9RH 5C07E 5L2JA 2YRZA 4Y4KA 2WBWB 4FXGA 1MQKL 3UTTB 5B3NA 3P11H 3STLA 5I1JH 3PV6B 3V7AE 1XGYL 3CDFA 3CDCA 4WTXA 1NCAL 5FO7B 4DGIL 1EEQA 1DEEB 4FFZL 3V0VB 1FYHB 3QQ4B 4WFEE 5DRZB 4DGVL 1PZUB 2E9WA 4XNYH 2AV7A 3E8UH 2Z91A 5I71C 4LSSL 3MBXL 2UYLB 2Z8VC 3VXUD 3JUYA 5TGBA 3MA7A 4M4PA 1BEYH 1S7QB 1TVHB 3P4OA 4HUVA 5FO7A 3MOAH 1CIDA 4MMZC 1BX2B 2G2RA 4PRHD 5ERWA 4JM2C 1PEWA 4TYUA 2F19L 1U9KA 3LHPH 4WI9A 3OR6A 3FB5B 3K0WA 4OJFH 4CDGC 3D3VE 5FB8A 5I1CH 1NUDA 3JBG7 3M8OH 1REIA 4M8VA 2BDNH 1J0HA 4JM4H 3LQZA 4D0DB 1CVRA 2ZCHL 4KFZC 4Y4HC 4C56B 2EC8A 2ZUXA 1VFOA 4MAYA 4PR5A 3GI9H 1YEEH 43CAB 3CZFA 3BD3A 3QDGA 1KT2A 4JPVH 4JM2A 5K9KA 3R4DA 5KS9A 1MJ7H 4BQ8A 3MNVA 4PJ5E 5JDSB 2B1AH 2EIDA 5D6DC 1DE4A 3QQ3B 1W72H 4I0PB 4MQ7A 3KPSA 3LVEA 4MD4A 5IHUL 1O5DT 1KB9K 1F90L 4PJGF 3GHEH 4ENED 2AQ1A 4GOSA 2HJLB 4NUGH 1Q72L 3O3BA 1FFNA 1IC1A 4RMSA 4F9LC 2ARJB 3GB7A 2N1KA 4PJIE 4FN0A 4OGAD 4XH2B 1F3DJ 4L4VB 1ZE3C 3JV6B 2Q87A 3OGOE 2J6EH 5ID0A 1XAUA 3HHRB 3IVKB 3QULB 3ET9F 4PJHE 3BGAA 2R0ZL 1IQWH 3CC5B 1JZ4A 3FOMB 1P1ZB 1BAFH 2CDFA 5DEZA 5C0RL 2VXQL 5EWIL 3F65A 4CJ0A 4C83B 2G75B 4LVNC 4O51B 3L3JB 3C6SB 2OLDA 1AXSA 2XFXA 3PWJB 3VFVB 2PTTB 2X9WA 1DEDA 3FQRB 3ARBB 8FABA 1MHPL 1RU9L 5D7JA 2MOVA 2ERJB 3GRWL 5B22A 1A21A 4WTZA 1AQKL 3QEQB 3OB8A 1U2HA 3PWUA 4K94L 4PJGB 3O4LA 3QUYD 1CF8H 5I1EL 1A2YB 1HK6A 5FGSA 3I75A 5HHQB 2P49B 4RZCB 1BQLL 3GZKA 1U92B 3UJTL 2QEJA 5L88L 5HDLA 4YGVB 4RWHA 3DX8A 3FO1A 4OZFB 2BY1A 2CIKB 1MELA 2O61A 5D7IA 2VLKE 4G6FD 5C1MB 3WHXB 5TDOA 1CDUA 1T80A 5A16B 4M62L 4RX4D 1BIHA 1NCBL 3GJEB 3MRQA 5CP7A 1S9WB 3KPQB 4O02L 3SKMA 4ZFGH 4E0RB 4K94H 3G5ZB 5C8JA 2WWMD 2V2TA 3RWIA 5E8OA 5IB3A 4ZUSA 2WMPA 3L3OB 3QDAA 2MCPH 1AIFA 3JWOC 4ODHH 4RNRA 4Y5VC 3ULUH 3ES6A 1H3XA 3NFSH 2BK8A 5IMLB 3CVHA 5T3ZH 4JN1L 2QQQA 1JUFB 1L7IL 2GSIB 1AQDA 4ODWA 5T1KA 4DVRL 3L7EA 3B2VL 1IQDA 4YDIH 4KJPD 5JXEA 3L3DA 2FWOA 1QA9B 2VDPH 4XVTL 2KQNA 4TNWF 2HG5B 1ZTXL 5I19L 5IFAH 1AE6H 4HGWA 1EAJA 1GIGL 1BZ7B 4KVNH 4XNMB 1T5WA 4UOW0 1OF2A 3DOSA 1AD0A 2Y36H 2AXHA 4FHBD 1BFOA 4TVPL 4IOFD 4XVSL 1B6UA 1T7VA 1QRND 4OZIA 2ZKHH 4XCNB 3MREA 4WU7A 3SE3C 3RVWC 1CICD 1BIIA 2GY7B 3QXTA 2QQKH 4GT7A 4A6YL 4ODUA 4JY4B 1FGVH 4ZFOL 1OWWA 3GKWL 4P2OA 4J7RA 3ZE1F 2V2XB 1OTTC 4WJ5B 1OT2A 5E99H 3C5ZB 5E70A 4NNXA 2IAND 2LQRA 5GRUH 3C9NA 4CMHB 5IGXH 5E4EB 1T21B 5LGHH 1IAOA 4JFHD 5IEKB 1F6LL 3P0YL 1OP5H 1CGSH 4F7MA 1VKXA 3K4DA 1LWRA 3BDXA 3VWJA 2VL5B 2WINB 2PO6B 3T0ED 1YC8A 5E5UB 3ZTJG 1ACZA 1A3LL 2GJ6A 1HCVA 5KOMC 1JGEA 1V3JA 1EEZA 3MZGB 4ORGA 4U1MA 3RKPA 4OCNC 1X5AA 1JRHH 3OX8A 5GSRB 2FHBA 2Y36L 2A73B 3LSOA 2NXZD 2NY6C 4LCWB 2NZIA 4LKXA 4PJXF 5HVHB 4FNLL 3TZVA 1AKJB 3MBXH 4QXUL 3I02B 4M7ZB 3TM6A 5IHZA 1U6AL 2EYTB 2YWYA 4U1IA 2Z92A 3HNVH 3AB0C 1Q1JH 3I6GB 5CD3B 4OLZH 4PJHB 1NLDL 5D70H 3EYQC 3QXWA 3WS3A 3QUXB 5C0IB 4ELMB 5GSVA 1LMKA 3P11L 4NHCL 1R24B 5C09D 3RWFA 3BSZH 5I8CB 1JZ3A 1MIEH 3VWJC 3V6FB 4GRMB 3QDME 3VRJA 4OCYL 1FFPA 1JF5A 5T3ZL 5GGRB 3ULVH 4MVBD 1R3HB 3X17A 2XG4A 5F9JB 1FAIL 5IJVA 3MRBA 3T8XA 3DBXA 4PJ9A 3WFEH 1CYGA 3GBLA 3QEQE 3C5ZC 3WV0A 4OF5A 4PGZA 1KN4L 3QIBD 3DV4B 5CGTA 1CU4L 4WEBH 3FCTB 4HKJA 5I15H 4O02H 4AQOA 3QZWG 1FV1B 3VH8G 1I8KB 1FL5A 1HIMH 4YUEL 1WWWX 2AK1L 4PJXB 4C4KO 4N5EC 4WFFE 3TYGH 1T20A 1YY8A 2RCSH 5HY9A 4EQ2A 2ADGA 1T7XA 4YLQT 3QDHA 4JFHE 1W72A 4J6RH 4Q58C 3GSRB 1F58H 3DVGA 3ARSA 4LLDB 1QHPA 2YUXA 1JYWA 2JJTA 4KV5F 5E5RB 1G7LA 3MLTB 4FQXD 4JZOA 4WW2A 4X6CA 3WHE1 2BNQA 4P2QA 2FL5A 1S5HB 2ENYA 3JTSA 2AKRB 3RZWA 3LN9A 4EI5D 4YNYA 2DQUH 1CF8L 5E6YA 3C60B 1C5DB 1HHIA 1LGVA 3QRGL 3VE0B 3ARRA 5DFTA 3EO9H 4FFWC 3MRHA 5DFWH 5GGQL 3PGFH 1QSED 5I73B 5EOQH 1BD2A 3NH7L 4U1LB 2MPAH 4XCYB 2AJUL 2IWGA 1WAAA 3KR3L 4PTUB 4YBQC 1QLRA 1T7YA 4NKMA 5DJXA 1LEGB 5EN2A 1SJHA 1P6AB 4X0KA 5JMRA 1MREL 1KC5H 1HH6A 1RZJL 3MV9E 3VFRA 2ZSWA 1A4JB 1CDHA 4IMKC 3RWGB 2WAHA 5IW6B 3L9RB 1NL0H 1MJJB 5ADOL 5AG9A 3O6FB 5IMMB 2IAMD 1K85A 2XKNB 1D6VL 5HGAA 2FATL 4JKPH 4LLVA 1U8OA 3KS0H 2R9HD 4V3DB 2PF6A 1HI6B 2Z9TA 5I0ZA 3CUPA 4HS8H 3IFNL 1FVDB 3JWDC 5HDOA 3TBYA 3V9FA 2VXVL 3CFCH 4H1LH 1I3RA 1W72L 3TF7A 1VFMA 5F7LB 3ULSB 2EH8L 3LMJH 2LV4A 3QG7L 2ZSVA 5DD0H 1M05B 5EO1B 5MEOB 3I50L 3QNZB 5TFSL 5F7NC 5T1MB 2CGRH 4K3DL 5H35B 3G5YA 5BVJB 5HYFA 3FO9B 2XWBB 3Q6GH 3OSKA 1IGCH 4Y89A 1OAXL 4M6ML 1M4KA 2A6KB 4I77L 3BUTA 3QCUL 3WFCH 1OTUD 2GJ6D 2V9RA 4LSUH 1H5BB 5AYQA 1KJVA 4JZJC 5D1XD 4CNIB 1QSEB 2PW2B 4EOWH 3MCLL 5TF0A 4HIHB 4P4KA 2NR6D 4G8FB 1CDGA 4OT1L 3O0RL 5I16B 2ICCA 3P9LB 4OQTL 3HC4H 4LKCB 5E8PB 3RKDD 2GIYA 2Z35A 4IRSA 5I8OL 4V1DA 5E94A 4WUKH 3OKYA 4KK5D 3O8XB 1IVLA 4ONOA 5H8DA 4EI5A 4HF5H 2PYEA 2H1PL 5EO9A 2H9GA 2AXGB 4XNYL 4ELME 4DGVH 4JY5L 5E8DH 4OCSL 5I2IB 4OLXL 2OTWB 1L0XA 2X89D 3REWA 1MIMH 4FFYL 2M26A 5KVDL 1A6TB 1OTSD 4B41A 4Q0XL 2A9ML 1YJDH 4BH8B 3JWDL 2BY0A 1G9NC 4ZODA 3KHOA 5CIPB 2NXZC 2NY6D 4HWBA 3RKDC 2X5PA 4ZAKD 2HN7A 3HG1A 5HHOB 3LY6A 1QLFB 2H3NA 4BFBD 2C1PA 1KPRA 1XT5A 3HCVB 3M1BA 5A1AA 3RI5K 4JFXA 1P7QD 4JDTL 5JNYA 2IFGA 3RVXC 3I2CL 3SBWA 4NNPL 3OKNB 3BDBA 4PV9B 5D5MF 5IVXF 4PJCF 5I73C 4KI5D 2A83A 4JO4H 1F4XH 2BVPA 2DICA 5E7BA 3GMLA 2OTWA 4R7NA 1NEUA 3V5HB 2OL3B 5DD1H 3O2WL 4JRWA 4U1HB 4PJ5A 4OGZA 1BJ1J 1MCOH 2QQLH 4F2MA 3PJSA 5ESQB 3GSXB 3ULVF 1FLRL 5F96L 4KDVA 4OD1H 2DLFL 5L6YH 5E8EB 5DVKA 1HINH 1HSBA 4JQVA 3LIZL 4GKNB 1J8HD 3BT2L 1YQVH 1XF2A 1FL3A 4GXUN 3UPRB 2XQBL 2D7QA 4OBSA 7CGTA 1XIWC 2AEIT 1XGTB 4WFGE 2JTDA 5D7JD 3UTQA 1UVQB 3BI9X 4KH2A 1W8OA 3BP4B 4UIMA 1BFSA 3VFMA 3VXUE 3E2HC 5CEYA 5I8EA 1BGXL 2VE6B 4YQXH 4ONGH 4GXUM 2Y23A 4PJCB 1OP5K 3WFHB 5F9WB 5HI4C 3T4AB 4Y5XB 4LHUA 1KTDB 1CXHA 4HPOL 4YHMH 1XF1A 2LU4A 1VGEL 1OAQL 5T1MA 3VXQB 2HRPH 4Y4HB 5F44A 2APFA 4G6AC 3VU2A 1F11A 1DLFH 4GKZB 5DHVH 4KJYB 1MRFH 1U8IB 1U8JA 2XI9A 4FFWD 5INDA 3PDGA 1YMMD 4ODBD 5J3HD 3O2VL 4S1RH 3MLZL 1WISA 2AJSH 1OP3H 2ATKA 3L5XL 3KLSA 5AUMB 1TJHH 5J13C 5EU6E 3V79C 4NOFA 5HD8C 2WSKA 4MAYC 5T33L 4OFYA 3DGCR 2E6JA 4HIXL 4I0CC 1KXQE 4PJAA 4V3EB 1RULL 1VFAB 3ZKNC 2VLKA 4X99B 1R0AL 2VB5A 1G7QA 2UUDH 3CMOH 3KPRA 1I7ZB 5F9OH 4OM1L 5D7LD 1YC7A 1EGJA 1JPGA 1DQTA 1IC7H 3IFLL 4D3CL 2NTSP 5LQBL 4ZPVA 4DN4L 3MRKB 1A7RL 4X0KB 4KJYA 4D94A 5ACMA 4C55A 3NPZB 2F8XC 1P9MA 3IAPA 5EC2B 2I07A 1MVUB 4HKXB 4ONFL 4P48A 1L6XA 4H5SB 2N56A 3QO0B 4XP5H 1MCHA 4N8CH 1U8MA 1F4WL 4OZHA 3IDGA 3WFHA 2YPVL 2UV3A 4M4RA 3MGTB 4U05A 1MI5A 1J0JA 4X6BB 4UDTA 4M93B 1T04B 1ORSA 2B7DT 1H3TA 1DQJB 1RUPL 3C6LB 1JWSB 1MWAB 5HVFB 4X6CB 2FSEA 4OLYL 5D1XB 1BBJB 1XGTA 3HMXA 3LKSB 5I1HL 4H20H 3HE6B 3ALXA 4JRYD 3HN3A 2AAVA 1MCSA 4JCMA 1T4KA 2YPLA 4KI1A 1TFHA 5AZEL 5HY9B 3GFUA 4LSVL 5EOCL 4HZLB 4TPRH 1QR4A 2X2YA 3K46A 3TT1H 4R4NC 4GG8A 1B0WA 3E6HB 1PLGL 1J1XL 3WSQH 1A7BA 4HKJB 5JOFA 1BREA 2XXMB 1FHGA 2FX7L 2HFGL 4L4TD 1FN4A 4TULH 2BVPB 3N1PC 5ID1A 5J06A 2DMCA 5IJVB 2BRRL 4MXWL 1HDMB 3CSPA 5E08L 3IU4H 2GYSA 4Y19D 4GW5B 2CXGA 3UBXA 4P2OD 4GRMA 3BRGC 1TZHB 2L7UA 4M6AA 1BJ8A 5HYJE 4H1LB 5IROC 1WWAX 3H7BB 5DZOA 2JIXA 4I8DA 1S7TA 4AG4H 1MY7A 3UJIH 4RAUB 1CLYH 2VKXA 3WJLA 1RUML 1AKJA 5KVEH 4HK0A 3UTTE 2J5LB 4AZ8A 4P2YA 4U6HB 5ISZA 3CGTA 1WBXA 3CDGA 3RQ3A 2GKIA 5KVFH 5GJSL 3BN9C 2WK2A 1I1YB 5H2BB 1RJLA 4HMDA 2NW2B 3SOBH 2Y25A 2G5BB 3BN9D 4PJ7B 4WENB 3TVMA 1ZANL 4X80L 5GRVK 3WXVH 4P5TD 5FCUH 1FVCB 5E9DE 1LO0L 1YEKH 4DEPB 4H1LA 3IF1B 1WZ1H 4YPGA 3IETA 3KPRD 4M1DL 3QCTL 4KUCF 3WUWB 5FYKD 2P5WE 3H8NA 2SEBB 4OD3L 1RHFA 4RBPK 2X7LA 3BZEA 4WJ5A 4FA8A 4HIHA 1SYSA 4P4KB 5M95B 2D03L 4LF3A 1QSEA 5MEQB 4FQJL 1FYTE 2QSVA 2DRUA 4OCWH 1YNTA 4QXTB 5ALCL 2DKUA 4M1CD 1INDL 5EU6B 1ZHLB 4HG4K 3O4OC 5C0DA 3U0TB 3VWKD 4M61A 3X13B 1NFKA 2XZCH 3MRJA 2LABA 4LSRH 5JIIA 4PUBL 1HHHA 2FX9H 1S7SA 2WUCL 3QA3A 1ZGLB 2W0PA 1HEZA 1CR9H 4HIIA 3OKDA 4U6XA 2A2QT 1P4IH 1MHEB 5D71L 5T1LD 3KPOB 1RZ8B 4YFLI 2VITA 4I3SH 3W2DL 5AZ2L 3CCHB 3Q2CA 4ZUVA 3LZFL 4R96A 2G60H 4PJFF 1NCUA 5LAXA 3OKLB 3C08L 1MSPA 1S8DB 3L7EB 2O93L 3TZVC 3BUYA 5KSUB 2CKBL 4NIKB 2GSIA 1I9EA 1Z5LB 5IMLA 3QIWA 5DMGC 2DQGL 3ZDZF 2OM5A 3QUZC 4L4VE 4EXPX 1KCLA 1IGJB 4PJHF 1DL7L 2YZ8A 4KHTL 4K8RC 2HWZH 5LVEA 1N5AA 3G5XB 5EC2A 5D7KD 2WP3O 2PW1A 3JV4A 2IBZX 4L8SB 4KZDL 1MLBA 3T2NL 3GJEA 3QR2A 3T0DA 5CINH 1JWMB 5DQJB 5HHMA 2YPLD 2DKMA 4L4TA 3VW3H 1LQVA 3UO1H 4BSWA 1A7QH 4E42B 5JW3H 1P4IL 3G6AB 1OGAD 3W0WE 2O61B 2FHFA 4L8DB 1AO7D 4IS6A 3RA7H 3U36A 3FO1B 1VFAA 1M71A 1BD2B 35C8L 4Y5XC 2EIZB 3CNKA 4PJGE 4NQDE 4BQBA 2CO7B 5T3ZD 2FX9L 4OLUL 4JPWH 1N6QL 2DIBA 1QFWH 2AW2A 3BN3B 4JB9L 4R26L 4DK3A 5AAMA 4KPHH 3B6SA 2GCYA 1YEIH 3VXRD 4QRTB 1P5UA 2CQVA 4X5XB 1IJ9A 3WN5C 4MAYD 1JNHA 4PLOB 5CJXC 3MV7A 1RUAL 3KDMA 4G7YL 1JF1A 4ACPA 3EYSL 1JPFB 2X4NB 4NJ9L 3EZJB 5ICZB 4KY1H 1RZIA 4HBCH 4X6EB 3QB7C 4HFUH 4FZEH 4C83A 3O41B 4IIQA 1IZJA 4Y5XA 2A38A 3QCTH 2QHLA 1LK3H 1Z3GH 4TVSa 1LO5B 1GPOH 2O5ZH 2R0WH 1Q9KB 1MPAL 3OGCA 3OKKB 2PYED 2DLHA 1KIPB 3SE8L 5JLZB 3MRMB 1A4KB 2NXYD 3P2TA 3RNQB 4N1EA 3CAFA 3C09C 5I1LB 2WW8A 3PL6D 2HVJA 4Z0BL 5GJSH 2D9CA 1LD9B 2X89A 2DTML 5GGRA 2C3WA 4LCUB 5BZDA 4XXDA 5LBSL 5CMAA 1CQYA 2ID5A 2GSGB 1KNOB 2VLJA 3OPZH 5E8EA 3HAEH 4XX1G 1UACL 3V5KB 2JJSC 3GSXA 2OZ4A 4ELMA 5E9DB 3G6DL 2GAZB 5FUOH 4NQSA 3A6BL 1TNNA 1ZA6A 1TZGL 43CAA 2YUZA 2NY3C 2BNRB 3NCYP 4JRYA 1AY1L 2EYTA 4KROB 1C5BL 1U8PA 3HE7C 4Q9QH 2P5WB 1UM5H 1XGUA 2A83B 2NY1C 4L3AA 1L9MA 4GMTL 4LIQL 2YPKB 4YDKL 5JA8B 2VUOA 5CBAA 3NIFF 1GRWA 4U7SA 3V52H 2V17L 1FZOA 1LDPH 1MNUH 2BRRH 3RDTB 1JI1A 3AREB 1NFDB 4GRWB 4RIRA 1CXFA 2YUVA 2ZJSL 5DUPH 5I9QB 3VXPA 3M1BB 5CEZL 4OM0L 4KTEL 4LRNL 1VKXB 1RK0B 3MJ7A 5C2BH 3G04A 4P5TB 1EIBA 2OQJB 3X3GH 4UV4L 5JHLH 1FDLH 2NY2B 4X6CF 1ZWIB 4F33A 2H26B 1T1XA 4XWGL 3KWWA 1OWRM 4N9GA 4JHZA 2ZZUT 5CEZD 3GBMH 4K55A 4IHOB 2GJ6E 4GW1B 1GC1L 2HT3C 3UYRH 5DD6B 2DD8H 2A0LC 4PGBA 4JY4A 4H20L 4GBXC 4MZ3A 4ZSOA 2R2HB 2XWTB 4UINL 2RHEA 3MTRA 4MX7A 4MS8D 4FQ2L 3V4VL 3FB6B 5C9JA 5HXMA 1DEEA 5DK3A 1YY9C 4XCNA 2CIIA 1OP9A 4JFDB 2WBJD 3G08A 4PJBE 3G6JA 3VG0H 2VJXA 4AT6B 1JN6B 1A9EB 1CS6A 4R97B 1U8QB 1NC2A 3F7YB 1CFQA 1OAZH 3EDEA 2Z35B 1YMMA 2EDQA 2CDEA 1T5WB 2R1XA 3MLWH 3N1MC 1KCSL 1WVZA 2QADD 4WTZG 4R4FH